5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
b'RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
2ZFUA 3HA7A 3I5UA 5AVHA 3OE4A 1O9GA 2C7PA 4E2WA 3NW9A 4YMGA 3LKZA 3M0XA 3L23A 3CC8A 1XYMA 1L9KA 4YTTA 3G2MA 2OPBA 5DLYA 3M6UA 2C7QA 1BC5A 3BWYA 1XLGA 2ZTHA 1VPTA 3NGFA 4X63A 4OBXA 3R6TA 1EIZA 4GUAA 4K3ZA 7XIMA 4HSGA 4ER5A 2NP7A 8XIMA 5FCDA 2XISA 3FPGA 2O0LA 3DR5A 3ID6C 1VQ1A 1NW5A 5J8LA 1OADA 1ZKDA 3PX3A 3DLIA 10MHA 3LECA 5EMJA 3TRKA 4RV9A 4RTSA 3I58A 2ZZKA 4IKPA 5DM1A 3DX5A 5E9JA 3DUWA 3KWSA 4HNOA 4PGLA 3CQJA 2O57A 2NQ9A 1YFLA 5F2NA 4R8SA 1K77A 5EC8A 5EIFA 3R24A 3KQSA 4AZVA 1YUBA 3HA5A 1N7IA 1VL5A 5KS2A 1SQFA 2FK8A 4PYKA 1B42A 1MHTA 1T43A 4BLWA 5B80A 3M0HA 2JHAA 3KKZA 3FUWA 3QV2A 4P7FA 3C0SA 4XIAA 3LPMA 4DCMA 3QZAA 3G7UA 2JH8A 4PGHA 3MTEA 4Q7IA 3A7EA 3P8ZA 1YB2A 3REOA 4US6A 1Q0TA 2CKDA 5F2KA 5E8RA 4YTQA 5BXYA 4KW7A 1S5NA 3OU7A 3ER8A 4HRAA 1G8SA 3MCZA 4M38A 2NNWB 3VYLA 3S68A 1FP1D 1NBHA 2G72A 3HVKA 5DX8A 4HHMA 4QVGA 5DSTA 2AVNA 3VNIA 4YUZA 2XYVA 5DXAA 4CKBA 3UJCA 3UJ9A 5FA8A 4X41A 5T64A 3TKAA 3UVAA 2FCAA 3PFGA 1QAMA 3LX6A 3DLCA 2VDVE 1KPGA 2O06A 2PXCA 3SGLA 1WZNA 3EVFA 3KBNA 3OU2A 4E32A 1XLBA 2QW5A 3ITLA 3G2OA 1SG9A 5K0FA 4R05A 1EAMA 3VSEA 4A8NA 2JH9A 4R8RA 1R8XA 5B1SA 2PSSA 5K01A 4E3VA 2WK1A 3K6RA 2ZBPA 5EMKA 3M0MA 4P58A 3AWIA 3HA3A 3GNLA 2PXXA 2QULA 5EMMA 5E9QA 2DPMA 3DULA 5XIAA 2QUMA 3BWWA 1XIBA 2VDWA 1P91A 5DT2A 2I7CA 3FTFA 2GAFA 1DL5A 3KR1A 4XCXA 5FWDA 2P35A 3RODA 4GLEA 1L3BA 1D2HA 4ER7A 3NVKI 1XLKA 1R8YA 3MCTA 3XISA 4RVGA 5DM0A 2AN4A 2XINA 4DF3A 3T7SA 2WA1A 8MHTA 1XLMA 3ITYA 3EVAA 4FGZA 1RI4A 2CWWA 5LR6A 4F86A 5FTWA 2YR0A 3THRA 3MB5A 4KIFA 5EIWA 4YMHA 4PGGA 3ERCA 2NP6A 2DULA 2FPOA 5GM1A 3VC1A 3KCLA 4RYLA 5LSAA 3QOWA 2ZIEA 5EPEA 4ZB5A 3VNKA 3SMQA 4RTQA 4KIGA 1CLKA 1DE5A 2ZIGA 3I9FA 2AZTA 2B2CA 4K6MA 4IV8A 5EVJA 3DH0A 2R6ZA 1JSXA 2PY6A 4M7RA 1SKMA 2YTZA 3EMBA 1L3CA 1QAOA 7MHTA 3KQOA 3M6XA 3M0VA 2HCVA 2C7OA 1XJ5A 3DMGA 5B7YA 5JUWA 1UFKA 4C07A 4HH4A 1NW3A 3EEYA 2GLKA 1IY9A 2P7HA 3GU3A 4YUYA 3IV6A 4GJIA 3GO4A 2VP3A 2YQZA 3B89A 4KDCA 2GS9A 4QQKA 2BM9A 3HM2A 1X1BA 3P9KA 1JG2A 3M6VA 5LQNA 3PVCA 4XUEA 2PJDA 5LQRA 3HCBA 4EKIA 3CVOA 3KQMA 3QYSA 3GCZA 5IKMA 3KR2A 5HIKA 2AOUB 4QDPA 1RJFA 2YXEA 4HGZA 1L3IA 3NDIA 3JWIA 2QM3A 3L8DA 4GEKA 2YVLA 2VS1A 3KBJA 3VNJA 4EVIA 1R00A 5FWAA 3H2BA 5CCXA 2JHPA 4QE1A 3ELUA 3A25A 3MERA 2PVCA 2G70A 3KU1A 3LCUA 3I53A 1XVAA 4U7TB 4FR0A 2J6VA 1X1AA 3LHDA 2IDKA 2XYRA 5M5BA 3UJAA 1D2CA 2HMYB 4LECA 4QVKA 3EVCA 2NXCA 3P2EA 5EZSA 5XIMA 2EJTA 1BOOA 1JG3A 3CQKA 3LBFA 5GWXA 4KRGA 4R6WA 4HGYA 3O4FA 1YZ3A 4DCGA 3FPFA 3JWJA 2Y1XA 3F4KA 4F85A 1EG2A 3IUDA 3A26A 5DRTA 2G71A 3SSOA 2I62A 2UYOA 5DWQA 2OZVA 4FSDA 1FPQA 1QANA 4HG2A 3P6LA 2BZGA 2PX2A 2Z6UA 3B5IA 4OA5A 4ISCA 4PYLA 3BGIA 2F8LA 1EJ6A 4GJJA 3V8VA 3VNLA 5HIJA 1V39A 2BR3A 4OQDA 4M37A 4RTKA 3I64A 3WSTA 5EKUA 3BDKA 3OPNA 5C9ZA 3R9XB 2JG3A 3GRZA 1AQIA 1RI1A 3O7WA 3FRHA 3LDGA 4E2YA 4A8RA 5GINE 2NYUA 3IUHA 1G8AA 1RJGA 5GP1A 5HEKA 4EQZA 3LBYA 4GC5A 1F3LA 2EG5A 4OBWA 3OZTA 5KQSA 4MTLA 3HCFA 4POOA 4GOMD 4OX9Y 1I1NA 2BR4A 3KQYA 4Y30A 3GDHA 2AN3A 3JWGA 1XP3A 3CQHA 1XIMA 2IH5A 1NW8A 3TM5A 1XLEA 4PNEA 4C04A 5KVAA 1XIGA 1XCJA 3LL7A 2BM8A 3NTVA 4A6EA 4X1OA 3UJ7A 5FUBA 3BWMA 3WQOA 4K1GA 4E31A 3ITXA 4E2ZA 3KCOA 4YUXA 4G56A 1XLJA 2P3LA 3C0QA 3RIEA 1XIIA 3LDFA 2OB2A 3P71T 5AVNA 2ZBQA 5LQAA 4UOEA 4PIMA 3FUTA 4C08A 5FHRA 1H1DA 4XUCA 3AY0A 5LQCA 4FT2A 3DXYA 4RTLA 1KPIA 3R0QA 4PINA 3KR0A 3MHTA 1KHHA 3B3FA 3AYTA 5CVJA 3A4TA 2VDUE 2QE6A 3M0LA 4HTFA 1FJXA 4P7GA 2P7IA 1ZGJA 5T67A 1G6Q1 4RTMA 5E2AA 5K0GA 5D1NA 4DKJA 4QEHA 3GGDA 4YUWA 3KTCA 3HCAA 3EGEA 4PYIA 1QZZA 2GVEA 3AYVA 5H02A 3FUXA 2JHCA 3G8BA 2Q02A 5T6BA 4PYOA 5H1WA 1M0EA 3KPYA 1VP3A 3GXOA 4U7PB 3KCJA 5DSXA 2XVMA 3UZUA 2G1PA 4CKEA 3BUSA 5K09A 3TC3A 3HCEA 4FSXA 2I9KA 3HEMA 3OFJA 2EJUA 3M0YA 2OU4A 4R6XA 3C3YA 3HVIA 4LWPA 1SUIA 3QOXA 2H11A 3ITVA 3UXIA 3NWEA 3OFKA 3FYCA 2IBSA 1NBIA 2IH2A 1R18A 5CUQA 2OY0A 4H0NA 4E33A 1P1BA 5LQUA 3G8AA 2AOTA 1WXXA 1RI5A 2GPYA 2P3OA 2ZLBA 4HTFB 5U4XA 3EGIA 5DX0A 3T7TA 5FQOA 1NV8A 3T0IA 2IFTA 2OYRA 1PJZA 5EZQA 2YUIA 3DBNA 4RTOA 1XLLA 3SSMA 4HGXA 3TQSA 1D2GA 1XYLA 3HCCA 3G89A 1DE6A 3B7PA 1I4WA 3AJDA 1WXWA 3P2KA 4DMGA 3GRYA 1DIDA 2B3TA 4MHTA 4YV2A 2QY6A 2GH1A 5KQRA 2PX8A 3HCDA 4OVXA 3OBEA 5H6HA 1JG4A 1HNNA 1AV6A 4MWZA 3R3HA 5HILA 1UIRA 5ICCA 1I60A 1DXIA 3CNYA 4FS8A 3BXOA 1G38A 2QRVA 4V0RA 5FA5A 2ONYA 3CWHA 3CJRA 4C4AA 5CVEA 3GRRA 3UJBA 1TW2A 4CTKA 1ORIA 4XISA 2NXJA 1DUSA 5DRYA 2XBMA 4ER3A 1M6YA 2AOWA 2ORED 4ZB2A 5TNVA 2V74B 2JJQA 1XCLA 3NMUF 3FVMA 3UBTA 4B17A 4FT4A 1DCTA 4WXHA 4BP3A 5GIPE 4XSMA 4IV0A 1SQGA 1HMYA 3G2PA 4DM3A 3BGDA 4DQ0A 4QPNA 4A8IA 5LQKA 3MGGA 2IP2A 1O1HA 2Z6QA 4XIMA 2OBFA 3TR6A 4BLUA 1KPHA 3MQ2A 2P1DA 4BP1A 2B25A 1XICA 4DZRA 3TMAA 3BT7A 1DIEA 4BLVA 1BHJA 2IGTA 1XYCA 2IH4A 9XIAA 4DUOA 3KPVA 2BR5A 1WS6A 3FRIA 3CKKA 1XDSA 1XIDA 5HIMA 4RX1A 2PLWA 2LD4A 3FTEA 3KPJA 1KP9A 1QT1A 3CBGA 4L7VA 5FULA 3HVHA 4Y2HA 5GM2A 5DM4A 3K0BA 4NECA 3SVZA 3OCJA 3EVZA 2NQJA 4GQBA 5GIOE 3JWHA 3RW9A 2GUBA 3AAMA 3LCCA 2A14A 1N7JA 1XINA 1XLCA 3DMHA 2PWPA 1PRYA 4AZSA 2XVAA 1QAQA 2UYCA 3KQTA 3CCFA 4YTUA 1MNZA 8XIAA 2ONZA 1QUMA 4RVHA 5EEHA 1OR8A 3BZJA 2FHPA 2WA2A 2X7WA 2IBTA 1KIAA 2PT9A 4HC4A 4M36A 4KW2A 4RSRA 1XLAA 2P3QA 1NW7A 5EMLA 3P2IA 3EMDA 4MQ4A 1JTFA 2B9EA 1KYZA 4X61A 3X0DA 4PFHA 3OZSA 4ATNA 2IDJA 3ELWA 3P97A 3BZGA 3EVBA 4LWOA 4GC9A 5K0EA 2ZW9A 1F38A 2AN5A 3UJ6A 2PWYA 4ER6A 2ZULA 1SUSA 3C3PA 2YX1A 3CJQA 5EOVA 3U0HA 1INLA 3PLAE 3LCVB 1FBNA 4OA8A 5K0NA 4MIKA 3DXXA 3E8SA 1RI2A 3C0LA 1NKVA 4V0QA 3T7RA 3HNRA 4CTJA 1R74A 5CVVA 5EHIA 2ZBRA 4P7JA 4DA4A 4YV0A 2ZWAA 4CXMA 4EAYA 3MTIA 3E05A 4PWYA 4ER0A 4RVDA 1IM8A 3LMZA 3FUUA 1P1CA 2FK7A 3TVAA 4FZVA 2B78A 4O29A 5MHTA 4ZBCA 1ZHFA 1NT2A 2GLUA 5E8JA 5E9WA 5IH3A 4KVZA 2ZZNA 3BGVA 1Q0SA 1EQAA 4AX8A 3NDJA 2FYTA 3GNXA 3HTXA 3GIWA 2PX4A 3BZBA 4QDKA 3OZRA 3MAGA 2ZSUA 1I6NA 4QE4A 3PX2A 3M4XA 2HK1A 2N47A 1VIDA 3GRUA 1JR4A 1SVUA 5BW5A 2XYQA 2ZIFA 3SR4A 3UFBA 3KQVA 3FPHA 1XISA 4YTSA 1VBFA 5K03A 3UWPA 4CWAA 2AOXA 5DTMA 2V7EA 3BKXA 1L1EA 5CCBA 6XIMA 4X60A 2H1RA 3EGVA 5P8WA 4KWCA 1VLMA 3G88A 2OXTA 4JXJA 4EMSA 1ZGAA 1O54A 2HR1A 5C1IA 1XIEA 1YZHA 1JQDA 4QEEA 1XLIA 3C6KA 4J4KA 3TLJA 4EK9A 2ZDSA 1G55A 5EHGA 1TZ9A 5HIIA 2G8NA 5K0CA 1YFJA 3N4AA 2Y1WA 2G0WA 2AS0A 1XYAA 1D8WA 3UA3A 2Q41A 3CQIA 3KQPA 2I56A 4EKGA 5K05A 3AALA 4YV1A 2KW5A 2R3SA 1YF3A 4Z2YA 4E30A 4QTUB 1ORHA 1P39A 4GF5A 2CL5A 4XKMA 3FYDA 1UWVA 3V97A 5LQJA 1XLFA 3KBWA 1X1CA 1AQJA 1QTWA 2HNKA 1BXBA 5CVUA 3FTDA 4EACA 3BWCA 5DTQA 3IHTA 3LGAA 3G5TA 3UU0A 3E23A 5C0OE 3THSA 3ELDA 1Z3CA 3BKWA 5D1HA 1YX1A 3OE5A 2I6GA 3AXTA 1O9HA 2UYQA 1IXKA 3TFWA 3NWBA 2ZCJA 2XIMA 2PBFA 4QE5A 5E1OA 2UZ4A 4RVFA 5ERGB 3IUIA 3UA4A 2O07A 5XINA 3DMFA 1RJEA 1FP2A 3DTNA 1BXCA 3PT9A 4PONA 4C06A 2AR0A 3KQQA 2QYOA 5ICGA 1JG1A 4LG1A 1VE3A 5E2BA 3KPUA 3ME5A 4XSLA 2G4JA 3P9CA 3TM4A 5F2OA 3U81A 5HOQA 3PTAA 2ZVRA 1XTPA 3FPJA 3CJTA 2PKWA 2O05A 3DXZA 1A0EA 1M6EX 1TPYA 1MUWA 3SXJA 2HV9A 1NE2A 3SM3A 1XDZA 5EEGA 3VC2A 4ZTBA 4PYJA 2P8JA 3LDUA 5DM2A 4ZB0A 5E1MA 3KBSA 4FP9A 4QDWA 2AOVA 2HTEA 1XIJA 1MJFA 2FRXA 3GRVA 3TPZA 2CMGA 2PV0A 4A8LA 3BANA 3ITOA 1XIFA 3VNMA 5FHQA 1BKYA 3U3HA 3QC0A 4PCLA 1VP9A 1G60A 2AVDA 5EGSA 3FUVA 2YXLA 3EEOA 3DOUA 3ORHA 1WG8A 2VZ9A 4GOOD 4QPPA 2I57A 5DTRA 3B3GA 4DVOA 1XLHA 4RTJA 2OB1A 2ZWVA 1JTEA 4XUDA 3G5LA 3VYWA 4C03A 4F84A 4AZTA 4PYNA 2ESRA 4LNCA 3SX0A 2EX4A 3Q7EA 5ICFA 5K0JA 3PS9A 2AOTB 2GYIA 1XIHA 2AOUA 3P9IA 3UJDA 5HFJA 2BH2A 4E2XA 1RJDA 4A6DA 1ZG3A 5B7ZA 3IEIA 1S5MA 4RWZA 3EPPA 5GOZA 2P41A 2NQHA 1X1DA 3UJ8A 3HVJA 3SSNA 2CMHA 4RTRA 5E1DA 1A0CA 1X19A 5DPMA 5I7GA 3A27A 1AF7A 1KR5A 2ERCA 2OO3A 3LSTA 6XIAA 3HP7A 1NV9A 2X7VA 2GA9A 5CVDA 5E1BA 3ER9A 3ANXA 3EVGA 2QUNA 2H00A 2NXNA 4GBED 1KXZA 2HK0A 3KR9A 1A0DA 4W4QA 3CGGA 5G02A 2QRVB 2PGXA 3TKYA 1R6AA 1XXLA 1JQEA 4PYQA 3G2QA 3OU6A 1XLDA 3P9NA 4E70A 2E5WA 2K4MA 5K0LA 3KPWA 3FZGA 1N2XA 4QQNA 2IPXA 5EKXA 2OKCA 2PT6A 3C0KA 4OQEA 3KBVA 2PX5A 2ADMA 4AZWA 3QXBA 3E7PA 3BWBA 3LKDA 5ICEA 4QDJA 3XINA 2C7RA 3NJRA 2UYHA 5HZMA 1Y8CA 3GJYA 3C6MA 4KDRA 4PCAA 9MHTA 3IYLW 3KQWA 4WVLA 5K8VA 3GWZA 1XDUA 3FTCA 5DX1A 5CD1A 3A7DA 2IIPA 3ELYA 1QYRA 5FQNA 1WY7A 1TW3A 1RI3A 3NVMB 5JR3A 5K0BA 5CIYA 2P40A 4RTPA 3KBMA 4GOND 3EVEA 5EQJB 2ZZMA 4PIPA 3O31A 9XIMA 2Z6AA 3AXSA 3M6WA 1XYBA 3M33A 4P7KA 4RTNA 4HHLA 4C05A 3PFHA 4AUKA 2NXEA 2EFJA 3JU2A 3FPEA 5BP7A 5CM2Z 3ITTA 5EG5A 2GB4A 3D2LA 1ZQ9A 3KHKA 4IWNA 3DP7A 2ZVJA 4BY9E 1JSZA 4YUVA 3PB3A 1NW6A 4CKCA 1I9GA 4GOLD 1U2ZA 5FADA 3P14A 1EJ0A 5BW4A 5KYGA 3TOSA 2YXDA 3EVDA 5DXJA 1GW9A 4QTTB 2PXAA 4YTRA 2HWKA 3B3JA 1JQ3A 1KYWA 3XIMA 4PYMA 3Q87B 3M70A
chains in the Genus database with same CATH superfamily
2D1ZA 1NBEA 1WBJA 2ABBA 2ATXA 2JAOA 1I5RA 1WQ4A 4NG4A 4LJKA 5FF3A 2GM4A 3I05A 3NO3A 4B3ZA 3RQIA 3TW9A 1Y98A 2GPBA 2OX1A 3NWJA 4YTTA 1GWJA 3G2MA 4D9KA 3EY4A 5HE8A 2GZ3A 1MQ9A 4FLOA 2A5LA 2ZTHA 3EARA 2F84A 3TLCA 1Q57A 2JFPA 4FHAA 4GIRA 4NASA 1V1JA 4L65A 1QHIA 4NHEA 3W2IA 5ALUA 2ID4A 1PEYA 1WCIB 3OQPA 4RJ2A 1BCSA 4FP1A 1GA4A 2UUAB 1EF3A 3I4LA 4PV7A 3CAVA 2FPKA 1ZLYA 1SZFA 2EGZA 3PKIA 4V1CA 4HA1A 2XIQA 4W8BA 2XMSA 1T7LA 1N2VA 3TEMA 4IKPA 2OZLB 4GCXA 2ZYAA 5COBA 2FEMA 3U57A 3WQBA 4BF5A 1SOUA 5IUKC 3KOWA 1XU7A 2HNBA 1Q1GA 5EIFA 3S1GA 4RHCA 4NILA 3MUZ1 4A0SA 4BNGA 2O9TA 3MP4A 5I9TA 1M7PA 5EWLB 1M01A 5KWSA 1DJGA 2XSBA 5AW3A 3SGZA 4HYRA 1WUYA 2V69A 1KQGA 2ORVA 4M6UA 5DCEA 1J79A 5K4XA 1A5MC 4MQEB 4RQBA 4ICCX 4JI3B 1NNI1 3BQ9A 3LTEA 2PG3A 1CJCA 1YCHA 3P8ZA 1YB2A 1MD9A 2PGDA 1I6MA 1YR2A 2WG1A 3T78A 3O4RA 4FXRA 3W72A 4ZL1A 1CUBA 3R5XA 3G23A 4NNAA 4RFSB 5I5RA 1AU9A 2O3RA 1XO1A 3HU1A 3THYB 1XFDA 3CV3A 2P9QA 3L6CA 1YZNA 5LB2A 5HQ3A 4X71A 2W67A 3LP6A 3ZOAA 2WYSA 1R2TA 3DL0A 3CMCO 3OD5A 1N2CE 5IHXA 3NCOA 1YVDA 3PIDA 1FS4A 3TXXA 2D5LA 5U1PA 3RYSA 4QBIA 1T1EA 3LPOA 2NNLD 2ZRQA 2JLUA 3PXCX 3GEDA 4DO4A 1AMKA 1YTEA 1UPTA 1M1YA 2Q29A 1UCWA 3DEJA 3T0AA 3B9DA 3RFAA 2YA2A 4TTAA 1VSQA 3YASA 3PNBA 2W8BA 4DR1B 5ESDA 3I1IA 5A5EA 3LC7O 1VL6A 1ISFA 2D2GA 3QKEA 1P0NA 1N75A 2PXXA 4JFRA 3CCCA 1RQNA 2Z08A 3ZBQA 4C6BA 2P91A 1RC8A 2B6NA 1DAPA 3H18A 1KMCA 2VQUA 1J56A 3VGFA 4N40A 1C2YA 1I2NA 3OTIA 4EG3A 3EEBA 3ROTA 1N2CA 2A59A 1X9HA 2F3SA 4KPEC 5K0SA 1Y3BE 5DULA 4IIBA 2PC8A 4EJFA 3I8OA 2XN1A 5GJMA 1HUQA 3PE3A 1JDCA 1G4HA 1RMTA 4EPKA 3FSTA 4UMFA 1EWDA 3C2VA 2H2HA 3DZBA 1H2YA 1JA9A 2A3HA 2QCGA 3TTOA 1N57A 3EVAA 5IANA 2H0RA 4ICIA 4BNYA 5T5QA 4DLVA 5DWVA 1V5IA 1F05A 2NIPA 4UTTC 1ULHA 3ET4A 1LRTA 4JZYA 3BDVA 3ZJ8A 1CRZA 2VAVA 1FQ0A 4AWAA 4UAVA 3R0UA 1M34E 4JTFA 4C14A 1JU4A 4CTMA 4IQLA 5ALTA 3S4TA 5K8CA 3NC0C 4RW3A 1TAHA 1UR9A 5RUBA 2QGYA 5C8YA 2QTAA 4ND1A 1J21A 2PY6A 4U7GA 1UP2A 5LIUX 4GMDA 3SEZA 1FDJA 1P7TB 4C60A 4BEVA 3DFHA 3MCNA 1L8AA 3DDWA 3FPKA 2NADA 2DQ4A 1UD6A 5A9TA 5JUWA 2ETVA 3ENVA 2NZYA 4MJMA 1U3TA 2DPXA 1NW3A 3S1SA 4IOJA 3UG3A 3H16A 3IV6A 2CXPA 3IAQA 2AQ8A 3RLVA 3PIRA 3HBJA 3T1HB 4D9BA 4KQMA 3BICA 4DQUA 2YQZA 1RTKA 4EANA 3VDMA 1JG2A 4Z0PA 2PJDA 5GJNA 3TDFA 3HCBA 1UG6A 4WGHA 2PM8A 1PX4A 2H3EA 5TGZA 1VPWA 3TQTA 4BLQA 2B1JA 5FJRA 3U17A 3CVOA 1ADFA 4RVSA 3THQA 3NRBA 2RDUA 3KK0A 3EGXA 4Y9RA 4KXMA 2JI7A 3ECAA 5LOVA 4LRUA 4AS1A 3OA3A 3F4LA 4F40A 2W5FA 1RCFA 1UKQA 2O56A 4JN6A 1TTPB 4XWTA 2INFA 4X44A 3AYZB 3UEOA 1AXEA 3HDHA 1THZA 3QMWA 1B43A 3K15A 3C5VA 1G20A 3TWBA 4RPCA 1R00A 1Q3NA 4N03A 1IOZA 4I6JA 3L1KA 3EC2A 3OEXA 4NFSA 1UWUA 1E6XM 1H66A 1YIAA 3AF2A 5FKYA 3R4VA 3IFSA 3F5DA 1NBMA 3WF2A 2OHGA 1YL5A 3PHIA 1M1XB 3BBPA 4QVKA 3VHXB 5JC8A 2C07A 1W5NA 5AT1A 1WBBA 1I2CA 2WSYA 2OQVA 2YFOA 2FFQA 1GNVA 2O2ZA 5CP8A 4F3CA 1I30A 5KYUB 1NX9A 1JG3A 1GVOA 4YHHB 4TUYA 4RXUA 4KQJA 1E62A 1ZCOA 1SZCA 4WA7A 2XB4A 3MWYW 5TMDA 1XZCA 2HRZA 3FPFA 3FB1A 2Y1XA 4MV4A 1NVUQ 5D00A 1SUAA 1BD3A 2DFDA 3L4YA 1GQSA 4PG8A 1AV7A 3LUJA 4POCA 3FOAA 4XZMX 3P8IA 3P6LA 4LBYA 4D9JA 4D6JA 5ALWA 3A2LA 3OSZA 4QFMA 2DIKA 5MN6A 3IBSA 4G4SP 5HJ2A 3CWOX 1NMQA 4LZPA 4Y2PA 3K8OE 1FFGA 3E12A 2FEPA 3BGIA 2PKRA 4IJ5A 1YA6A 4NRSA 1Y48E 2RSLA 3P0FA 2AFHB 3RFFA 5JSKA 1CNFA 1NSJA 3QEOA 5D85A 1H42A 4EIWA 1NG1A 5JD5A 4CPDA 1ONWA 2ASEA 1E9DA 2G82A 4LXGA 2BRUA 3IAXA 4BC0A 4JBXA 5E6SB 1J0DA 2XVGA 2EFHB 3K4QA 1ZMBA 1F3LA 1YQUA 2VC9A 1N0HA 4WXYB 4JKOA 1WP4A 4JEMA 1IQ8A 3C7DB 3ILVA 4MTLA 4C6EA 3K4PA 2EV9A 3KCQA 4IPTA 4LRQA 3M5XA 2JCSA 2F38A 1C3FA 3I5YA 2YL6A 4F6RB 2CJWB 2R4QA 1P29A 5E5CA 2GWNA 2CXOA 2I6QA 1L5QA 3OH8A 4KQGA 4Z9AA 4D6XA 3H2JA 2A79A 2N1BA 2ZC1A 4N8EA 2REOA 4KAAA 4BO8A 5KYYB 3NCTA 5ALJA 1XIIA 8ATCA 5AB3A 2RBKA 4E2FA 4RSMA 2XPCA 1OGSA 4RLHA 4C08A 5I6DA 1PZ2A 3ZT7A 4CRWB 8TIMA 4R7WA 2HLPA 3WAGA 4RTLA 3O7MA 4ECLA 2QPXA 3UJSA 4WZ6A 5FXMA 3TMYA 4AI6A 3IVCA 3AYTA 4IHAA 5BR1A 3DFTA 5EJ8A 2P7IA 3OZFA 1WQ5A 1X87A 2H16A 4Z2JA 1FDWA 2OBBA 1XMVA 5H80A 3EGEA 1V3VA 1I7LA 1SFLA 1KS2A 3TG8A 1B0UA 2Y7FA 3B2EA 2ZRJA 1MPTA 5KJ6A 5KJCA 3P9ZA 2J45A 5IABA 3NWPA 1UPMB 1ZC3A 5M3BA 3KPYA 3H86A 4GT1A 1W4AA 1DFGA 3PUKA 2I5QA 4BKRA 2HSEA 2OQRA 2HYDA 3CASA 5KINA 1EJBA 2BW0A 3F74A 1QLJA 4D42A 5JJKA 3NO1A 3TN6A 4CIVA 1USUA 3O74A 1Z6QA 1AW1A 4MJ4A 3TD6A 2PWBA 2IPJA 1CUSA 4AD1A 4FNGA 2BOFX 2NO7A 4JSYA 4BVLA 4GQ0A 2ZOXA 3T0DA 1AZLA 4MUMA 3URNA 4KWOA 3DV2A 3V1PA 1R85A 3MP3A 1MAUA 2IH2A 2JIZA 5J2TA 3AEKB 3QMTA 2F4NA 1TCBA 2JGNA 2FEOA 1KDTA 3NO4A 1GOIA 3EB3A 1IOWA 3IGUA 5BWAA 3VKFA 4V38A 1EX5A 3IQXA 2C9YA 2J5KA 3MJSA 1R7RA 3SSMA 3QITA 4B5SA 4ZE5A 4LVDA 1XAGA 4HX9A 2D0HA 1C3OA 4O17A 2PBRA 2GQAA 3QJYA 3KB6A 4KYTA 1TG7A 1E8NA 4JBGA 2B3TA 4MV7A 3JALB 4PXSA 1XCGB 5J5CA 1DVRA 4XQ6A 5H6HA 2E48A 1HI9A 3S8EA 3R12A 2PEZA 5ICCA 4LUTA 4MH0R 5EYWA 4UFPA 4K3VA 2P1RA 4FR2A 3C39A 3Q15C 4WASA 4RE4A 2AAMA 4S3BA 3AESA 5J47A 1NNUA 2YDRA 1H4VB 3E8XA 3HNPA 4KRUA 2BXZA 2YZKA 3ZVHA 4PX9A 2E4WA 3SIXA 1HVQA 5LSMA 2PUJA 2X0EA 3ALGA 3EK2A 3OVMA 5BSUA 6PTDA 3LI2A 4RDCA 4KREA 3ICOA 1CB2A 3B9OA 4DC0A 4LNHA 3BGDA 3T9DA 3ZCPA 4YLYA 3F2IA 2NUTB 3G0IA 4EB8A 3NTRA 1U8TA 4Q1EA 1ULBA 1GG9A 1A72A 1GGVA 4MYSA 3E0XA 2IP2A 3D5HA 1NUTA 1RFLA 3GDOA 2H1VA 3T44A 1DWJM 4F91B 3TR6A 3EXHA 5H70A 3BCFA 4W1SA 2WNZA 1BWLA 3DZKA 1IUKA 5CG0A 2MU1A 2Z7KA 2OZ3A 5F4SA 3FH0A 1WAWA 2ZI7A 2Y88A 5IJWA 5J23A 3IH5A 4WW0A 4AG3A 4MYHA 3TYBA 3PF8A 3TWAA 4P4NA 1GPFA 5KSWB 3L7MA 9XIAA 3KPVA 2UZ3A 3WGNA 3SEFA 4Q4AA 4UU7A 4HZ8A 4DE5A 3AIIA 4GLJA 1GZ3A 2W2XA 2RHGB 4LXHA 1TO6A 4L7VA 1B0IA 7CGTA 2X22A 3CV6A 1V25A 3E5HA 3W7AA 2B9VA 3PDIB 1H8EA 1B31A 1RM0A 1GPKA 3BTUA 1YDYA 3S6JA 2NQJA 4GQBA 2C7GA 1GUDA 2YFQA 3RW9A 1KOLA 1TLLA 1GCOA 3LCCA 3T5BA 1W2VA 1XLCA 1L6YA 2VHWA 3LY9A 4LDNA 4Q6XA 2GL5A 4FHEA 3B0YA 2C2GA 1ZOSA 4ZFNA 2XVLA 4RORA 5HJ5A 4YGXB 1STOA 2R1LA 5E0FA 4DLNA 3KXPA 5JSZA 2X7WA 4ATDA 1U0LA 1JZSA 1T8WA 4C22A 4REQA 3KLNA 4BWLA 5KSOA 2V7UA 4BR1A 4DUZB 1ECFA 1JKJB 1RCXB 5L3SA 3KJQA 3OIWA 3BURA 3DHYA 1YPXA 1IDN1 5ALZA 2WJYA 4TMWA 1E9CA 1GEEA 3NUQA 3AEQA 3OZSA 1ZAJA 3CV7A 1UL1X 1OF6A 4MRNA 4C91A 3DF7A 5CR9A 3GAFA 3ZV4A 4NZYA 5JLAA 1UUQA 1RBAA 1IEXA 1D4FA 3VR2A 2X1SA 1JVSA 5D3MB 3T7CA 2NO0A 5EY5A 3CR8A 4G5SA 1R47A 4CLDA 3UWZA 3E49A 4FBGA 4J3XA 1UH5A 1XJBA 1MXFA 1QG6A 5IDXA 4F3KA 3KQUA 1ME7A 1SNYA 2WU0A 5EFZA 2HQRA 4PULA 3WXBA 5C2CA 1OT1A 1VBJA 4BJ1A 1FWAC 4BQNA 2FW9A 3VJRA 1H22A 3LO5A 2Y68A 2DG2A 4JJEA 1DRVA 3W6ZA 2M6SA 5AKLA 1XMOB 4CN8A 1NJ1A 4TOIA 3LRKA 1IE3A 4QBTA 4CXMA 4HU4A 4K9NA 4B5XA 1R4NB 2VC2B 2BYTA 2GFQA 3PHJA 1GPLA 3Q3VA 2E3JA 5JBNA 3MS2A 3M07A 5C7HA 1KYXA 1TU3A 1EHNA 5C70A 3UWWA 1Z63A 2AR7A 3EX3A 4TX9A 1CBUA 3CVVA 2BUCA 3KRBA 4LCRA 3N2LA 3G2KA 3G2JA 1MEHA 2PX4A 3NYIA 3RQSA 4ECAA 3F5MA 2J7CA 4WXMA 3N13A 1I6NA 4CE6A 3TVDA 3OOYA 1P9WA 3VIPA 3BH7A 1IAQA 3NWOA 2NSJA 3GTHA 4G67A 3LZ6A 3VK5A 4LKOA 4MVJG 4OBRA 3VDQA 2Z2JA 5BNIA 1VBFA 2QKYA 4MYAA 5I03A 3AH8A 1UC9A 1NJFA 3DMPA 4PM4A 5ETJA 4W8GA 4H1ZA 2ZBTA 2XITA 4DBWA 2OO6A 4QLLA 4UWMA 5MN5A 3NBKA 3MJTA 4OGZA 4BP8A 1GPYA 3FPCA 4O5OA 2R7MA 1YKGA 4NZJA 2QLLA 4HBGA 4QISA 1JQDA 1X14A 5KNBA 2C1EA 4ALIA 5CFPA 4L73A 1AOXA 2YDSA 3F4WA 3U16A 3FCOA 2C5AA 1NBMD 1QHPA 1VL8A 3CNLA 1ISGA 1EMDA 2GLTA 1I2ZA 3IODA 4TQUS 4W9MC 2F17A 1PJ3A 1PL0A 4LBWA 4AF7A 2F4VB 2XCSB 4A8PA 3AQUA 2VEPA 5FDFA 5DMYA 4KKVA 2QYGA 5EINA 4HA4A 4JLBA 3V00A 2VHTA 5JMWA 4NENB 4QOJA 3UAZA 2TECE 3IEBA 2PMQA 1PBNA 3I9NA 1IWPA 3H42B 4G9EA 4Y6RA 1XXXA 4N7QA 5HSGA 3TGLA 4HMNA 1U4SA 4ZHQB 1ARZA 3STUA 2HPHA 3MI3A 1JKFA 1UDBA 2CDBA 3KV3O 3E4DA 3U44A 3C43A 3EOUA 2W2KB 2BP1A 4C1LA 4H2DA 2OGZA 1CQIB 3OFSA 4JLUA 4HQ6A 5ULLA 3IMGA 2AUMA 2YJTD 3IUJA 3ESQA 2ZVIA 1A8UA 2XBUA 2VR5A 3AI7A 2EPOA 4AULA 4G0QA 1IIGA 2BTOA 5GPRA 2PBFA 2SKCA 5F1OA 2Z2XA 3WKEA 2QG4A 1OG0A 2E6FA 4S1TA 5SYMA 1OJXA 4H7CA 5KWEA 5GVRA 1KBQA 4EY3A 4UUOA 3PT9A 1HLDA 2QYOA 3G7SA 4TLDA 4DLWA 4RJJA 1JEAA 2EQAA 4UVDA 4GQRA 2H63A 2VAPA 1T9GS 3QFSA 3UW6A 1LI7A 1ODUA 2A0XA 2X6QA 2VF5X 3W7DA 1D9XA 3O3CA 1WU7A 5D04C 2ZVRA 3SIMA 1UJ6A 2ICAA 2FN8A 4EA6A 2OM6A 4Q93A 3GZAA 3HZZA 3ICQB 4XPIB 3EOAI 1KO8A 1XDZA 3A3XA 3MS7A 2PWEA 8LDHA 3MJHA 2W63A 4S39A 4CLRB 4IRUB 3OT1A 4EG8A 1H9AA 3FPAA 2P8JA 3V2IA 5JRJA 3BHNA 3FKSD 3O8OA 5TQ2B 2XUHA 2GGIA 2DFKB 3V75A 1XWYA 3HGSA 1YS1X 1NVKA 4ZANA 4ORMA 3LYUA 4GVIA 4KPGA 1PKLA 1F2UB 2HBQA 1NM5C 4QATA 1KF0A 3GRVA 3GR4A 3TLMA 4R51A 1TREA 4NAUA 4PSCA 2GX6A 5JO0A 1XLVA 5D4YA 1GTL1 4OBTA 1TMOA 1K5PA 3KELA 4BWFB 4B92A 4FDLA 1MOQA 4YCMA 1G2QA 4GMFA 2O8BA 4FFPA 5D3ZA 2REQB 3M9XA 4QPPA 3A1SA 4CTOA 1DARA 4YIHA 2PX0A 3F4VA 5DCBA 4HDRA 3GLFE 4CMBA 4YPJA 1T8TA 3KUUA 4UHEA 2PPGA 1I0DA 4XUDA 3VYWA 4MOWA 4LEFA 1WMEA 1ZSXA 4ILEA 3OQEA 4F45A 1W6RA 3ZJKA 1MX5A 3ZO9A 1YHZA 4Y90A 3UJDA 3P1JA 1UC5B 4E1BA 1QX4A 4UTWC 1Z0KA 2P69A 2ZX6A 3SIWA 1GXSA 3EIHA 4MWSA 2OBYA 1C4WA 1HH4A 4CU2A 3S5OA 1YDWA 2YL9A 1RCTE 3QU7A 1N9GA 1PR2A 1P9OA 4O3FA 1MXHA 1VA5A 1RYFA 4ZYVA 4XUYA 4L08A 1IN4A 3WN6A 3AI3A 5AHRA 3RRAA 3K2BA 3E4CA 2IU0A 1HZYA 2XT6A 4J5NA 3GFYA 4WQMA 1ISSA 1V3QE 1KXZA 4RZXA 3CLVA 2HNHA 3FF1A 1VXRA 2C18A 3TKYA 4M29A 1BDBA 4TL9A 4AS3A 2FPYA 1FDYA 2OVLA 3H9EO 2Q46A 2X0HA 1NZJA 1D7FA 4RPQA 4JS3A 4WOQA 4YRNA 1JPKA 5KZEA 2A92A 1A7KA 1K9VF 3MWKA 1N2XA 3WH9A 3RYIB 3BFPA 2PT6A 3PFFA 3FXGA 1HNYA 4NNCA 5HRUA 3OMLA 2WTEA 5SY6A 4PTLA 1AH3A 3AHZA 2BDUA 3XINA 4F71A 1VB3A 4YCJA 4JJFA 1KI1A 5L4NA 1OH8A 2DWPA 4QXOA 4LS2A 3UOGA 1G0CA 4E5NA 4O02B 5K3OA 4KRZA 5HDRA 2IP4A 2X2FA 2V58A 2BWJA 2ID9A 4XUGA 3WZMA 2AEMA 3RTDA 2GTHA 2F3PA 1UXJA 4MLJA 1YJAA 4O25A 2J79A 4PCPA 2XQIA 3EFEA 1TYAE 1NUPA 2P27A 3HG4A 4BCEA 2G88A 2FZGA 4LDJA 4RTNA 3WX0A 3HDGA 3PFHA 3O4VA 1UOZA 1KXVA 1G9XA 5B1DA 4AUKA 1FNSA 2X2EA 3FCEA 3NHUA 2N3ZA 4BFLA 1E2FA 3WGJA 2PA3A 3DP7A 4CQBA 3WWPA 1PP4A 5LXXA 1M2OA 1P8JA 1DAMA 4FJ1A 3CPHA 2QZ9A 3CTPA 3HWRA 4J3WA 3ER6A 2RUSA 2VKQA 3S2EA 5DI3B 3RK4A 4OXYA 4GOLD 2ZJYA 4CFSA 4PUUA 4PNPA 3ROXA 1J11A 3OZPA 4P0PB 1QHXA 5KYWA 3MYYA 4BO2A 3W6LA 3A6HA 4LF8B 3FJ6A 1R2RA 2VX7A 3QEMB 1QQ6A 3U13A 2BF7A 2Y89A 2HREA 3N11A 4DMKA 3PBVA 3HN7A 4W89A 1FFBA 3AWOA 4GY1A 3I5UA 2C31A 3PR2A 4MDFA 2GJKA 3LYAA 3RLUA 3AFGA 3QKRB 2BNJA 3QLUC 1OXKB 5IAJA 3RLIA 3THXA 1NMEA 4IXHA 4ID3A 3A05A 3A4LA 4BKOA 2DZAA 1WXZA 4XZBA 1VKHA 4DOMA 3IAAA 5EA9A 2PWFA 3UR8A 1PJCA 2MANA 3KFXA 3HDVA 2PDKA 2ZCVA 2ZUNA 3RYFB 4U1RA 1X6LA 1Z4MA 4D6GA 3I6QA 3MAAC 3N2OA 1PBTA 4Q4SA 4NMXB 1F6KA 3APYA 1KKLA 2G36A 4P4SB 4RDVA 4QEZA 2O5VA 4DSTA 4ER5A 3ZZNA 2OZPA 3TQQA 2BGNE 3WNVA 1QWGA 4BO9A 2ZXQA 5BOVA 3LHFA 5CGTA 3ID6C 3NZEA 1CJTC 3IUPA 1NW5A 1Z8FA 3TPFA 4QIHA 1H3GA 3KE9A 2BGWA 2I2AA 3BF7A 4TRRA 4CBVA 1F8UA 4G09A 4N5HX 2IUZA 4BFAA 4RV9A 2YWFA 3QTPA 1K2WA 4RK6A 2DWQA 4Y2UA 4JNZA 4PMJA 2FGZA 1FNCA 1JJIA 5DM1A 2F6RA 1L8LA 1S2UA 1TA3A 4EF4A 4AEEA 2QCFA 3FDFA 4JY8A 2XUQA 1O57A 3MRVA 3THWB 2EWMA 5F2NA 3OESA 1L8NA 3BOSA 1J93A 1K77A 4FOJA 1TYGA 1SVIA 2K7ZA 2C9ZA 4LZLA 3N3BC 1RPZA 1BEEA 5KS2A 5I3ZA 4NQZA 1TVKB 3S29A 2WINI 1PSDA 5I8ZA 3DT6A 4BJHB 2XSAA 2F6XA 3DAQA 2CXTA 2JGDA 1ST2A 3LHUA 5AK6A 1AUPA 3QZAA 3LXAA 2XD9A 1E3WB 1QE5A 1QZUA 1Z73A 4WKPA 3DAHA 4QZVA 4MIMA 2ZR0A 1FUKA 2QV7A 1N5OX 2ZRCA 4G89A 3BAYA 2OCLA 4GMGA 5DF1A 1I1WA 4KF1A 3GSMA 5LP6B 1K8XB 3SF8B 4YUZA 4Z53A 2X2OA 3PC8C 3QSYA 3UJ2A 3F6RA 1W31A 1C8XA 1W25A 1AB6A 1RSCA 4UOJA 3ZR6A 3LX6A 4RDYA 4BTLA 3FKJA 1J8QA 2IIVA 2YCLA 3KBNA 1EIBA 2W6ZA 2OHVA 2CLFB 3V8MA 5D6NA 1BSIA 5KSPA 2Z28A 4XX0A 3THCA 1A4MA 3TVTA 3ZBPA 3BL8A 3WR5A 4KBFA 1ZJJA 3OLXA 3G3MA 2H1IA 4KRYA 1GNSA 4Q34A 1E3ZA 1E5QA 4UM8B 2XXBA 3MRSA 4BMCA 5B1SA 3AF3A 3GGSA 2PJUA 5BRPA 1S2TA 2AEJA 1L4MA 4U4MA 1GNQA 1ZJWA 3BMVA 1P1JA 4HYWA 3RVJA 4JNCA 3ZZ0A 3PFIA 3QVJA 4TLBA 3SQLA 4M86A 3D5TA 3WO8A 3HKEB 1J2BA 1LQ2A 1C9NA 3X2FA 3OJEA 1W59A 1XQ1A 4WA8A 3A6FA 2J77A 4M8SA 2FE4A 4N5MA 3KDSE 3E3HA 3URAA 1DL5A 3RD5A 4FQ5A 2XNCA 4ENVA 4AZCA 4GLEA 5IT9A 2YNMC 4G5YA 4EFMA 1D2HA 3ZHCA 3LX5A 2J13A 3CQ9A 3Q2IA 2IXTA 4FYMA 1XSKA 2WA1A 2R5FA 5BXQC 5ADVA 5HF5A 3GBDA 3ZJ5A 2DHDA 2EWVA 3BIOA 2V96A 4OZOA 1X1QA 2V4UA 3G0DA 5BN5B 3VOCA 1UEIA 1RCUA 1TSIA 2J6XA 4TQAA 3THRA 3D4NA 3WL7A 3ERCA 5FTMA 4RU1A 3UZ5A 3Q9NA 3PA8A 1W8IA 5GM1A 4FU0A 3MP5A 4XTDA 4LNUB 3WQRA 4GCAA 1GTMA 4IDHA 2WBKA 2VD8A 2ECOA 2V68A 5TIMA 2NU8A 1GNXA 4NXNB 3VAAA 1NXXA 1UEJA 1S2LA 3P5SA 1ZHAA 5JI3E 1QAOA 3C3KA 2VOTA 2QTMA 2OEJA 4S3MA 2P2GA 2V5BA 3O05A 2VELA 4LZZA 5BOSA 1WP9A 4EG5A 2GLKA 2IEZA 2AYYA 1XFAA 1L4EA 1H6CA 4FX8A 2JKVA 1QGOA 4G4GA 2QR5A 1UBFA 3NM5A 1Q5MA 5L3QA 1UWAA 3EB4A 3R7WB 1B0ZA 1DP0A 1XG3A 1JJAA 1KM1A 3IEXA 1W1YA 2G5GX 3A4WA 2DFVA 1FFYA 1FNMA 3EIXA 1J1IA 1FRBA 4KG7A 1MC4A 3TECE 5HFNA 3F78A 4IFOA 3H9BA 4UBNA 1W8DA 2GZHA 4B79A 4ZV4A 4ACZA 1Z4KA 1RM3A 1G63A 1S2AA 4DIDA 4I1IA 4R1LA 1QCYA 4EB6B 2XB2A 1LL6A 4HRYA 4OHYA 4PSUA 2XTKA 2A0FA 2LKDA 5AHNA 3ARYA 1M72A 4BQEA 4FX7A 4JUAA 4Z7QB 3DBHA 4KQEA 1V9SA 3CS2A 4ME6A 4AG6A 1M6VB 8GPBA 2QXYA 1MDLA 621PA 4GC4A 4QYIA 4HXYA 2RKWA 3NQGA 2YA0A 1KZGB 3JQ9C 4PRZA 4LGXA 2G04A 3PJDA 4C2AA 1YJQA 3OO2A 5BWMA 3LHDA 1OSEA 2XGBA 2Z83A 1JMKC 1H2RS 1UZ1A 3CGTA 4GI8A 5EXEA 5JFOA 4Y0AA 1L7VC 4HZ7A 3K96A 1PZ3A 1QRTA 3LDAA 1QFSA 1TUBA 3AO0A 4UZSA 2C15A 4HQRA 4CF7A 1OYBA 2BZNA 4LB4A 4HYYA 1GTVA 4YQZA 5ALDA 1U65A 2W22A 4XW2A 1X8JA 2X3UA 3UH0A 4N6NA 4HFJA 4KVGA 1F06A 3GR7A 2C4HA 5BN3A 4M1EA 3T52A 1QF7A 3NAMA 2V7WA 4QR6A 4DV5B 3ZT5A 3TNJA 4HYQA 2H31A 2IU4A 2O4UX 1VRXA 3R2JA 5JDCA 2QN8A 2X2GA 3FNQA 5GZ6A 4XO6A 2FX5A 1XBZA 1Z2PX 3O8QB 5HIJA 4OGGA 2W2NA 4UFJA 5KU7A 3HPSA 3WSTA 4H7IA 2HISA 4YHBA 3S2LA 4LOCA 2W4IA 1QR6A 3ANNA 4TV6A 1CS0A 2DY0A 1TWWA 4PTYA 1LFAA 4MEJA 2GVZC 1NH6A 3CLKA 1TZJA 1U8UA 3E2IA 3CVUA 2XAAA 1EP3B 2EBNA 3EMKA 1URPA 1JNYA 3T3HA 4LNAA 4OBWA 5EKYA 3FBGA 2XWQA 4P5PA 2ATIA 3KETA 3HCFA 2OLSA 1LTQA 5A3VA 1ZALA 3V8NA 3JQ7B 5JXHA 1VG9B 2Z7GA 1OOEA 4CCYA 2IH5A 2PDQA 2PCEA 1ZGGA 1IL0A 1XXHB 1B76A 1U5BA 3H5AA 3SNKA 3K0KA 1N3YA 3RR2A 4FGJA 4XAPA 3BJMA 5L6LB 5LZ2A 1DV1A 1M67A 3MS8A 3UJ7A 1KQYA 1F3OA 1V8PA 8ABPA 3V5NA 2VZ8A 5SZKB 1JDZA 1LWNA 2XZLA 3VKKA 1W1A1 1D03A 4KXXA 5F3DA 3PCTA 2BGSA 5E4JA 2IE0A 1ABEA 1GKIA 4UOEA 4HOYA 4GBUA 1D0IA 1RYEA 4HAVA 5GNXA 1ZD8A 3U26A 5EWJB 1RK5A 2NX1A 4Q9AA 3C6XA 4TMYA 4MY1A 1OLXA 1DPMA 3EA5A 1QZ3A 3M0LA 3KVRA 1VYUA 3ANMA 2FF5A 1Q2SA 1U2YA 2FVMA 2Y9PB 3B8DA 4PAMA 3FKQA 3GGDA 3FYUC 4YUWA 3BG3A 4P22A 3RRJA 1EFLA 4PPNA 4GL4A 2WVTA 2NVCA 4NJJA 1QGED 1KMIY 5EB8A 3PQ4A 3OZCA 1F8FA 2WAMA 2HMSA 1JLHA 3WEMA 1RVGA 3KJIA 4ZO8A 1ZXBA 1LWHA 3E7WA 4LQLA 4NU8X 2WAAA 5C7VA 5TC4A 3EIQA 1W3NA 5ABGA 1DIGA 5F1PA 2FP4A 5DCYA 3ITCA 5JJLA 4MJZA 4DJFA 1WJGA 2FEWB 2ZZ7A 3QX3A 4OXRA 4XGKA 2OU4A 2I7TA 4DCPA 3LHYA 2GJPA 2WHXA 1KZ7B 3UICA 4RMNA 5I24A 1EE9A 2ZX9A 3B0UX 4AG5A 3WBBA 3UZWA 3GLQA 1UZNA 2I3DA 1YU6A 1Z15A 1VS1A 1EO7A 5A2GA 3H5VA 3D8BA 4WBNF 4KK3A 2XMGA 1NVBA 2FU5C 2G4LA 1YQEA 1ZUIA 1JFFB 2WWVD 4FWBA 1E2EA 4BNTA 2NGRA 3II1A 3ITKA 3NM6B 3W87A 2OYRA 3UCCA 1IY8A 2FMFA 4ZVTA 2C79A 4N41A 2CJPA 3CG0A 3HCCA 2CVZA 3B7PA 5A3QA 1MABB 2Q3CA 1GKPA 5LNUA 3GEBA 4KLRA 3T0FA 2FPTA 5JSHA 1J4EA 1NQTA 1QAPA 3UG5A 1AV6A 3BCRA 2DV0A 1VJCA 3P2YA 5B37A 3GXIA 4HYEA 3VOGA 3OU8A 2FDCA 1I60A 1R9ZA 4FS8A 5IM51 1J0KA 2OR3A 2TS1A 2AMFA 3CMMA 2OAEA 1KFKB 1NI5A 4GXNA 5CFQA 3AUXA 5CNIA 4OFWA 5A5VA 1GCGA 3QY0A 4YAFA 4HJRA 5DRYA 3GUHA 3HLYA 3L5KA 3I2IA 1XELA 5T3UA 2AR9A 2J32A 3DI0A 4C89A 3Q4GA 3WL8A 1XCLA 4WFJA 2OSYA 4ZQOA 2XCUA 1OH5A 4HKPA 5T41A 2RK4A 1W17A 2CFCA 1UR1A 5CA0A 1QO7A 1IU9A 3H8AA 4WNCA 4WESB 2D06A 5K20A 3QG5A 5A5WA 5LQKA 4E22A 3VI2A 2QTVA 2QI9F 2B8EA 1W4BA 1G1AA 2Z6QA 3R8RA 4U3AA 4XIMA 3KXKA 3CHVA 3BFVA 3VZCA 5FJOA 3QJ5A 3G18A 3HKDB 5A6VA 1S9DA 3ZK9A 3AU9A 4KVAA 5FNVF 2VK8A 3PZNA 3M6AA 2FGLA 3P27A 4X7PA 1APBA 1ZRMA 5CLTA 3LUDA 4KO3S 3TW8A 3MJRA 1VDMA 2JLAA 3EDKA 3G1HA 4EHDA 1E7SA 1ZQ1A 2GDZA 1O97C 4OF4A 1DKQA 2JGIA 1E3TA 1EM8A 3OJXA 4AYXA 1E2KA 1PUXA 5LZ9A 4L6IA 3UV6A 2R1KA 1OPXA 5BY2A 5B2EA 3SFWA 4KHPB 3I30X 3DO8A 4J3VA 2NXIA 3HRIA 2PV7A 4M0EA 1FTYA 3GRCA 4ZGYA 5FULA 5C5EA 4ZZ2A 3IBFA 5D38A 5AYYA 1FVHA 3HUDA 4AEOA 3SVZA 4GWLA 4IPPA 3ZGXA 4AXBA 3C2FA 4OB6A 1KBOA 4Z1CA 3GA7A 4Z51A 2PNJA 3C0JA 4B3IA 4HDNB 5K2ZA 2PWPA 4TV9F 3EGDB 4B3KA 1XAJA 5AI8A 1C4KA 4MR8A 1Y5XA 1Z26A 3G85A 3KZOA 4YTUA 3G1TA 1MNZA 3UHJA 1PS9A 3G8RA 2QM0A 1L1RA 3H65A 3MWEA 4LOAA 3KLPX 4PB3A 3KZXA 3G13A 4DHWA 5BVGB 1RWMA 3KXQA 2ZX5A 2ZX8A 4YQFA 3NEVA 5AMXA 3VU9A 3RK1A 1FJGB 3I72A 1GQLA 4KR9A 1HL7A 4D8YA 1OY1A 1WB9A 2C96A 2D59A 3ETGA 2N42A 2QROA 5AKHA 2QVXX 5K0EA 2UKDA 1NULA 5CKSA 1ZN7A 1SCUA 1AXRA 2H57A 3K2IA 3SHWA 5HRCA 4O1AA 1SFTA 1X8CA 1QHSA 4GRAA 5JVDB 3TZHA 5FT9A 3K8ZA 3FF4A 3F2CA 4YRGA 2AG5A 3VKWA 3MPUA 1JYXA 1H2EA 4R0VA 3UAGA 2VA9A 5GTDA 1YDGA 3HDTA 1KLYA 3JS3A 3IP6A 2DX7A 2V5CA 1L7DA 3PC0A 3PK0A 3C0LA 3ZIAD 4GFDA 5D7BA 1OG6A 4R0MA 2RG1A 1E51A 2MYUA 4TTTS 4X8MA 5DBIA 1JHVA 1J96A 1SXHA 3H5NA 4H83A 1HXJA 2HWYA 1QHZA 1UROA 3D6HA 4L6HA 4LJ9A 4UTJA 3F5KA 3FWNA 1ZN9A 5BN1A 1F60A 2OXEA 3ZW8A 1CFJA 5E8JA 4CM1A 3U6WA 4FCWA 3M1LA 3IL2A 4AX8A 1JWLA 4J1NA 4PLZA 3HTXA 4TV9B 4DLLA 4OFBA 1FLAA 4HYTA 3CYVA 3UJRA 1VIAA 2ZSUA 1K8RA 1QK4A 4M1QA 3I7SA 4MP6A 4EYKA 3FNBA 3LW7A 1N8FA 1QBAA 1QWSA 4QXAA 1GOOA 4WCJA 3W83A 1FMTA 3WB1A 4JWKA 1ZP4A 4EHIA 5TGTA 2X13A 3F5QA 1C4XA 1E9ZB 3UWPA 1B6SA 1NBOA 2EKZA 2V7EA 4BYGA 2P2ZA 5CA1F 1XZEA 2VF2A 2YYAA 2HZBA 1Q6QA 6XIMA 1R38A 3HXKA 2JFQA 3MVTA 4UFIA 5CPQA 1M3UA 3K4WA 4KB5A 1RW4A 3W1EA 4BP9A 4H9TA 3ZYCA 1YIXA 4BVKA 1AQLA 4ZQCB 2Z3WA 2GO1A 3H8SA 1FX0B 5KVSA 3LZDA 2AUNA 3P60A 1SC1A 2R1VA 4AJNA 5K0CA 1SUEA 3QHNA 1B1CA 5HX7A 2J9YA 1BVZA 3CEPA 4C3OB 3LDVA 4Z4IA 1JFXA 1S02A 3GLRA 2R1TA 2JRCA 4MI6A 4F9EA 1VPVA 3OICA 3PITA 2HVNA 4Z6KA 3N2IA 5J5RA 2P68A 5AI5A 2C3YA 3GIYA 3WWCA 1ZI6A 3NQMA 1TV4A 2V9PA 3FTDA 2A2ZA 4CUKA 5MKGB 3VM6A 5AXAA 5BT9A 3UU0A 1W37A 2IZOA 5D9OA 1H5NA 1M1YE 5DNWA 2VCCA 4X97A 3DKJA 1P2TA 2C7FA 4GZJA 1I01A 1FH7A 3ASYA 1CNVA 3H9UA 3U60B 1P2GA 5D37A 2PO5A 2RHJA 1UXGA 3OJ0A 2CCRA 5EJIA 4PBGA 1YXMA 5EE9A 4OBEA 1DQSA 4FFBB 4RA6B 3DKPA 3ZWYA 3HCWA 3V6LA 2ZWPA 2O07A 4LU0A 1B2YA 3VR5H 4AUMA 3TLGB 5IK2D 4MKVA 2QCNA 1LC3A 5CA1B 2ALJA 4F9TA 2AR0A 1ZD1A 2XHYA 1IZJA 4Q3NA 5FWYB 5ENLA 3WYEA 5I3FA 5A6TC 1Z07A 4GFIA 5E7IA 5JDIA 3PNKA 5KX5A 4XGRA 2C84A 5LBIA 1K4GA 4P54A 5BXRA 2JEOA 5AQEA 2V1XA 2C2HA 4L28A 2HO5A 4OQQA 6REQB 4AK9A 4C29A 3AVUA 1QVBA 3E7FA 4Q16A 2EPKX 1L4GA 2HSWA 1RJPA 3AIOA 4J0HA 3IK2A 2PS9A 1E3MA 3LCXA 3VUSA 3D5QA 3DDMA 3HXQA 4A8JC 4BV2A 4RM2A 4UNNA 2X86A 3HVRA 4FP9A 3BLEA 1V7AA 3OTGA 3OMWA 1MA3A 1V2HE 4GABA 3LQ4A 2AMYA 1JRBA 1XCBA 2RB5A 1II8A 4ZK2A 2Z2ZA 4TXJA 4XQCA 3NPWA 4GHRA 2GQ0A 3OM8A 4H9XA 2GUGA 4U2YA 4BFWA 5FOTA 2PI6A 2GI4A 1WDQA 3S1XA 4R88A 2OD7A 3HCOA 1VMKA 4KRXA 1AGYA 1ONOA 2DTDA 5G0VA 1B23P 2MSLA 5DTRA 2VYND 3ZK7A 2PKYX 1XGEA 3MWFA 1I4TD 3WQSB 2HMVA 2D3NA 3H4VA 4HI0E 1E9IA 3JW7A 3APTA 1Z47A 3K9LA 3E6AA 3C2RA 4I8DA 1JTEA 2YHUA 3G5LA 4F84A 2PRZA 4Z3OA 4DWSB 3WBFA 3ADKA 5KDOA 4GP9A 4JB8A 4DJFD 3NNSA 3NQ41 1YR9A 5BMXA 4IIDA 1I4NA 2VCBA 4YU1A 4L8GA 5EIBD 2ZE8A 4AP9A 1PZMA 2J3MA 4HVAA 2J8TA 2VHYA 3A24A 4RWZA 2WABA 3EPPA 2EG9A 2DPGA 1ODJA 4LHWA 3VKDA 5CD9A 3COWA 2NSDA 2JEZA 1U1IA 1O66A 3LUKA 1OXMA 1U98A 5AHMA 1O4WA 1BTOA 5IBRA 1XV5A 4HZIA 4EDHA 2WQ7A 2NXWA 4JFAA 3SN4A 3A1EA 3KJEA 4NEQA 2QQFA 2OKGA 4EA7A 4N4QA 4GEGA 3ON5A 5CYGA 1N5JA 3R8CA 2C95A 2R8XA 4HN8A 3SEPA 4FMVA 2ZBGA 4F46A 1G20E 5M5DA 2R7NA 3I6IA 1R6AA 1LTKA 3FHOA 4PYQA 2OQ2A 3G2QA 4CCAA 1S4MA 3O3OB 5F9HA 3VSDA 2C9BA 2HWWA 3WP0A 1NBME 3E70C 1RLJA 1DX4A 1CQWA 4Q4DA 3FVVA 3FZGA 3SXUA 2ZRFA 4XZNX 3KE8A 3QXBA 1UZLA 2VTBB 1JPUA 1NC1A 2QVLA 3WNQA 3NJRA 5IKOA 2XE6A 3UANA 3DFNA 2LV8A 3DG9A 4I66A 1JXAA 1E4LA 3OZIA 1XDUA 3FSUA 3CRQA 4HX2A 4MYXA 4ZICA 2Z9DA 4ARSA 3LCLA 4LYRA 4U5IA 2QZ4A 1DX9A 1ADCA 2Z2KA 1RI3A 2XMQA 5K0BA 3L1UA 5C52B 1MR3F 4XWWA 4GNKA 3JV7A 4LZNA 4YIKA 3VO2A 4P7KA 5DNYB 3U49A 2OLEA 4EPYA 3IMCA 4C05A 2IW1A 3RYCB 2ET6A 1CUZA 3TYZA 1RK6A 2QZPA 5IVKA 4IJWA 3RARA 4ZIRB 3F1LA 4XBSA 1XHGA 4ZMSA 3KVJA 1KORA 1NQ5A 2PUVA 2ZC8A 5AKIA 3FGCB 3DHNA 3C41J 4L0QA 1JJ7A 2B20A 5KYXA 5K3EA 4LHSA 3WLTA 3ZE6A 1LNQA 2C9OA 5KAPA 1PJ2A 1Y3FE 4EPTA 1IMJA 4TVUA 1ATZA 1Z17A 2PMEA 4B3SB 2BFAA 2ZPAA 2H54A 2R8BA 3Q9LA 4DJ5X 1VBHA 2YLAA 3VR1A 3B3JA 1A5BB 1QKJA 5C46F 1ISWA 1RP8A 3N39C 3CT7A 4Q4JA 2X09A 1EEHA 3HA7A 3AHCA 3EDYA 2FVLA 2Z5LA 2HH9A 2IF2A 5AVHA 3GDFA 3EISA 4IMEA 3PUDA 2O7QA 1SCNE 3LX4A 4HADA 3KKPA 2JI4A 4OGLA 5E7JA 1HKIA 3UOWA 3JUGA 4MW5A 4BEBA 2DZTA 3CC8A 4PUMA 3TO5A 1JFRA 5ITZB 2VCYA 4O11A 2IYYA 1OBFO 4RNJA 2GXQA 1GV1A 2N46A 2AF4C 4MNLA 5I9SA 1ZAYA 3MPGA 4N0PA 1HM5A 4PF1A 3RUBL 3KTAA 2M1ZA 2K5UA 4NATA 5FLEX 3E58A 4DQKA 3PRHA 2WJZB 3UKOA 1Q6EA 1R9XA 3PR3A 4HZUA 1NUSA 1W3IA 2RHBA 4KLAA 2NQ8A 1W54A 4WKAA 2WMOB 2XISA 2VX4A 2C2BA 2BSAA 1Y0BA 2X8AA 5AVWA 1U31A 2DECA 3NVTA 3SQSA 1K3UA 4KXYA 3PX3A 1E55A 5HF6A 3LLCA 3DLIA 5FEWA 3LECA 1D2RA 1BIFA 5HBFA 3PAOA 3W26A 4CEJB 4OJYA 1NMSA 4UM9B 2Q4DA 3WMLA 2X1HA 2VEGA 3H9JA 4NOLA 4AJKA 3ZDFA 1ZOIA 5A04A 1GAEO 4QHSA 5DI9A 1K7XA 2NQ9A 1MW0A 3W7VA 1NQUA 3FKSA 4JXKA 2FZ9A 3ZN2A 5C8XA 4PAGA 4IIVA 1QPQA 4JI6B 5E70A 4MK4A 1P1KA 3BMCA 1VL5A 4WDUA 4X6XA 1RCQA 4FYPA 2V5VA 2GDJA 1L7BA 4J27A 3EZ7A 3ONBA 4NONA 3KKZA 2JQXA 3G2NA 2Z04A 4M8NE 1EHAA 1N9ZA 1R8QA 1ZP3A 2OD9A 3NKVA 5DQPA 4KWHA 3B9RA 4FC7A 2P3SA 1KFJA 1K1DA 2EXXA 2CKDA 1EXDA 1AQNA 3WADA 1Z5WA 1W19A 2PIAA 2A6PA 5MHBA 1H2WA 5IAKA 2H6RA 2XVPA 2Q4BA 3O4HA 5DX8A 3LGDA 1KOFA 1XAIA 1ATIA 3W8NA 3ZR4B 2XB9A 1KNQA 3GROA 3HMKA 4QAJA 1EEXA 3UQZA 1J12A 1V7ZA 3E0WA 1SOMA 3ABQA 1PJ4A 3UJ9A 4HNLA 1H7NA 3KSRA 1JLLA 5THXA 1A9YA 1M73E 3QX7A 2FTYA 1KH1A 2CNKA 2GXSA 3DLCA 2G9VA 3QLTA 2WIJA 3WLJA 2Z26A 2P2SA 2CZFA 3NSMA 3HMJG 2WM1A 2HLNA 1KAOA 3PWIA 4M8KA 3S5UA 2XF8A 2PMDA 2PDPA 1P6QA 4AD2A 2OBXA 3RXZA 3UVIA 1WBDA 5F4XA 3S42A 4ZYZA 1IEQA 1JI0A 4NZ3A 1E7WA 4CEHA 3GDBA 3PKJA 1IEVA 2X77A 2VFGA 2AKYA 5JEEA 3ALFA 3DULA 5M03A 2B92A 1JR6A 3TCNA 5KITA 4Z99A 3JAMA 1NIUA 3C5WP 2YFHA 1XCPA 1GZ4A 3OJWA 2VDWA 1OFOA 3PJFA 3QNWA 1FCQA 4HNHA 2ZRNA 5IVHA 1X7WB 1VB9A 3EX4A 3W86A 1F6DA 4ERGA 3BCJA 1VLZA 1EOMA 5G1NA 5I9MA 1XPUA 2FVKA 3VOIA 4YJHB 4BMYA 2BTQA 4RNCA 3QTBA 1HE3A 1MOSA 4XIJA 4KV7A 2QTTA 3WMCA 3TX9A 2Q3EA 4M83A 3V1NA 1G4UR 4OOFA 3QW2A 4XD7D 2AL2B 4EF5A 3VR5D 4CM3A 3LXUX 5LQDA 3DEFA 2OORA 1J6OA 1QOXA 1Z88A 2XUOA 4U2GA 3ZEAA 1C8LA 5BNWA 4ZGWA 2EU8A 2IVZA 3LX8A 3L7RA 1QB7A 4J9VA 1VP5A 4S0ZA 4XA8A 3MUAA 2ZR7A 3KRTA 2NP6A 1GZ5A 1AW5A 3E2QA 1XVIA 1KDRA 3PGXA 3EXIA 3U3DA 2FZKA 4I1UA 5FOOA 4ZYWA 2ABAA 1MZRA 3QVLA 4N49A 3RS3A 2RH9A 1M54A 2WOOA 5E6RB 1XPRA 1QK2A 4IV8A 3UKDA 2YWJA 1C91A 4QQFA 1RRVA 3P0RA 4OLAA 4JT8A 3UY8A 3A4YA 3TIVA 1M8GA 1SCDA 3BE4A 7MHTA 4MB5A 4HDMA 3OKPA 2MIIA 4FQ8A 1JMYA 1XJ5A 4PR0A 4WZAB 5SZHB 1HGXA 5JAOA 3NQBA 1XMJA 1TXGA 5LYJF 3F5SA 4PSKA 3KW3A 3PWGA 1SUDA 3R6LA 2PZKA 3W6UA 2Y0DA 2QCDB 3IPRA 4GXTA 4BRSA 1SO8A 1GW1A 1H69A 3CUVA 3HM2A 3AVVA 3M6VA 1WDSA 3WJ7A 3FYYA 4LGVA 1JAYA 1C1DA 3ZDEA 4ETNA 3CUKA 4ASTA 1GUVA 5C37A 4NYMQ 3Q7SA 4JR5A 2XWDA 2VQEB 2WW5A 2YZNA 1EPXA 2VENA 1ZESA 4B1FA 1W91A 2EL9A 1KMHA 1NOWA 2E0IA 2RAPA 3OJLA 5CDSA 1V77A 3TFCA 3DBRA 1MJNA 3V5CA 3MVEA 4FQ7A 4CDNA 3EXFB 3V7FA 1IN7A 2FG7C 1QMPA 1YRWA 3JWIA 1ZNWA 3KSUA 3Q41A 2P5UA 3WD4A 2ZI6A 4Z9YA 4GDMA 2OYMA 3KBJA 4JEQA 3T9PA 3PDHA 4LUIA 5DNCA 3S5JA 3SC2B 2NZLA 3RMEA 3UWSA 3CXOA 4G37A 1I1XA 2G70A 2BCEA 3AETA 1QK0A 3CB8A 2C8JA 3OTWA 4CQCA 4IM4A 4ESVA 5M5BA 2EL7A 5LNSA 1T41A 2IKJA 3ME3A 1XGZA 2NXCA 1PZ0A 5CG2A 1HDOA 4AJ1A 5EIHA 3DNPA 3KOYA 3DMTC 3KL2A 1XOIA 3H2EA 5GWXA 3DJYA 1X15A 2I3ZA 2RIRA 2VNIA 3VMFA 4DCGA 5LYJB 5B30A 3NGLA 1CUFA 1T5DX 3QPAA 1JGMA 1XRMA 4RD0A 3SHTA 5H68A 4AX7A 1BFUA 4C6FA 4D8LA 2JCXA 3AS3A 2OV3A 3SY8A 4UARA 4K6AA 1ZUNA 2Y92A 4JT9A 2FMXA 5DU2A 4BO6A 4ISCA 4Y6GB 1YH3A 4BQ5A 4RL4A 2ZQYA 2GZRA 1F3EA 3V34A 1E1NA 4AIOA 3GRZA 1TPWA 3MSRA 4KN5A 1G7CA 2XYHA 2Q8PA 1C41A 4BCBA 4EATA 3CNHA 3MK31 5E3JA 3BDAA 2NYUA 1AQUA 4XH9B 4A10A 3PSVA 4UVEA 3JQEA 1FTGA 3CRRA 1XSEA 5JWHA 1H7RA 3AM3A 4D9EA 4PHGA 1A71A 2DR3A 3WS7A 1Y6QA 3PPWA 1KCZA 4C4XA 1WSBA 2GHRA 4YXWD 2WHJA 4IUGA 2FW6A 5BUQA 1NW8A 3HB7A 3G1RA 2FZ5A 4IIGA 2J9FA 3PBKA 3L5MA 5BSTA 4R2JA 2BMJA 3K8MA 1TTQB 1WSDA 4EARA 3R44A 4CGTA 3OBAA 3AIBA 4DLBA 2J30A 3DL2A 4GKKB 3HP4A 3NQAA 4G3XA 1RLOA 3TIGA 4A3UA 1P60A 4MO9A 3AJ9A 2OB2A 3P71T 1TO1E 3DOHA 1L5NA 2PURA 5LQAA 1KRWA 1CUJA 4QASA 1BEUB 2VTFA 3AY0A 2QN1A 4FT2A 3I6RA 5LDDC 3FSJX 2C13A 1U3DA 2PZBA 3I28A 2FE1A 1XK6A 2D0PB 1OTYA 1M66A 2WJ6A 4C6NA 1FVOA 1TAGA 5BYJA 2ZK7A 1AM4D 1X70A 5LBTA 2OSWA 1NY5A 4QEHA 4GSKA 3SIPA 4B9YA 5L51A 5DMMA 1UIOA 3AMLA 3H3JA 3ROMA 1PKXA 2IQIA 4GZ7A 1NOUA 2ZJ8A 3QZUA 1V3HA 4JGIA 4NE2A 4L1GA 5IAOA 1UYQA 5AM5A 2PMKA 5J4HA 5IJZA 4XI9A 5A8MA 4KX5A 4EKYA 2HN9A 3QPEA 4IQDA 5EWMB 3C5QA 1EOKA 2DM6A 4I7EA 1NM9A 1A9XB 2RGWA 4FGWA 4KIEA 1KDYA 3TC3A 4MKZA 5IHSA 1JAEA 1BAGA 1FTQA 4XFKA 2IVFA 3RSFA 4LWPA 1P74A 4PODA 1E6QM 3WNMA 4OYRA 2YCEA 2V30A 2IYRA 4Y96A 1E0KA 1L5ZA 3AWNA 3F3SA 3WF3A 3N14A 1TM4E 1JG9A 1SCKA 2OV2A 5DY3A 1K7FB 2ZB7A 1D2MA 3M4ZA 1H23A 1NM5A 2WMIB 1NYQA 2VDGA 2VHEA 2GPYA 1RXVA 4ZT3A 1UJNA 4PFSA 5IJXA 1SD5A 3T7TA 3QWFA 5B58T 2IXDA 2PUDA 1T1RA 2QDDA 2H8GA 4Y7EA 1RVV1 2NZ8A 3GNSA 4LVCA 2XLBA 1ODTC 2EZTA 4V0OA 4YO7A 5CDYA 3MMUA 3PENA 1UADA 2OSXA 1EUAA 5BROA 1SOWA 1V6YA 4KFOA 4MGGA 2CLSA 2I71A 3TXAA 1NF0A 2OCZA 1V48A 2IDMA 4YAOA 1JEYB 3OBEA 2CEQA 4PTDA 4NJMB 3BH6A 5DT9A 3SIRA 2EQBA 3V4VB 2Z30A 1FH9A 2YBVA 1UIRA 3EPMA 1FFEA 2E68A 3PUHA 1G38A 2QRVA 1OZ0A 3SZ3A 1G59A 2BEVB 4ON9A 3BXEA 1NU5A 1VEMA 4RDWA 4ER3A 4YLGA 2GCOA 4L4XA 3E1F1 3JQFC 1QNOA 4IIJA 2WSKA 1I6LA 3H7IA 1M10A 3FCYA 3BORA 1E9YB 1YHTA 2HT1A 5HF9A 3W53A 2GRJA 2VH2A 3UKJA 4HMDA 4P8WA 1MH1A 2MSNA 3ZJTA 4HNAB 3FE2A 4H7VA 2GR9A 5JYCA 1GZDA 4Q12A 4Q8MA 3MT7A 3KWLA 1L0PA 4PS0A 1EVIA 2ZVDA 4II3A 1LRJA 4KFUA 4F3NA 2GWGA 2HY7A 1W7AA 1XICA 1EP2A 4OCZA 2Q07A 2RGNC 2FLWA 3FVWA 2C8VA 3ABSA 3ONFA 4URUR 3IHWA 5A5DA 3JRXA 2VURA 4WSKA 5CDUA 2O8NA 4W5QA 1C93A 4B35A 3ZJ4A 3CKKA 4NT0A 2ODPA 3W28A 1XIDA 3H3XA 4O16A 4GGHA 3M82A 2F3RA 2PH7A 3W1MA 3WNLA 3FTEA 2VPIA 4BFSA 3AHIA 3C3AA 2CBGA 1YWGO 2R6JA 4NMLA 3STGA 1Q74A 4KPUA 4DMMA 1D7AA 2CXGA 2OCBA 2GM3A 3JQ8B 3HPQA 1W30A 2VPWA 1XA0A 1CUCA 3HR7A 5FI1B 3O3RA 2GEKA 5CZ0A 1S2VA 3ZSSA 4E2OA 2OCKA 3VX1A 2P9YA 1DWGM 3U5ZB 1PVOA 2PGEA 4QCEA 3CHDA 3EYPA 4HHHA 2E87A 2X7HA 1FP6A 1LYXA 4KQ9A 2A5YB 1KAMA 1N8WA 4QPCA 2XUGA 3R4IA 3EOBI 2WA2A 5LXTA 1NC3A 1WOMA 5DNEA 2QJGA 1CR6A 4N3NA 5LNK1 2PT9A 3PWAA 1BX3A 4CV1A 3JQGB 2QD4A 4YYFA 1NUUA 4AZ0A 2INZA 1SD2A 3QJAA 2YVUA 4IYRA 3O06A 5KTSA 1T8QA 1TFUA 5AZ0A 4Q1DA 4HAXA 1U3GA 2JANA 2FB9A 4ZTUB 1HGYA 1TRIA 4K6OA 4Z2LA 3D3WB 3L0KA 1S0UA 4JZKA 5L45A 3EULA 1GLGA 2IUUA 2W8ZA 4M1OA 1V08A 2ZW9A 3QVQA 3STHA 5BSKA 3JYOA 4EI7A 4MRPA 2O59A 3TRDA 1H7OA 4B3GA 3CB3A 1ZSYA 3C56A 1Z06A 4A23A 1IZYA 2DLDA 4LSWA 4MTCA 3E8SA 1QGZA 4Q8WA 3CZCA 3QPUA 1AMNA 3BIWA 1PW7A 3VMOA 4CTJA 1GYLA 4GRDA 3SFTA 3GQBB 4OKSA 4NAVA 2P9TA 1Y63A 4PWYA 3T4PA 2QGHA 2OELA 3UV3A 3RO8A 1C30A 1P1CA 5KTRA 4G0OA 4V0NA 4LRTA 4MLZA 5C1PA 1JIJA 1KRAC 1Q13A 1Q15A 1Z0ZA 4ZI7A 3AHVA 3ZDRA 4B6FA 4YRJA 1TEXA 1ZHFA 3BRSA 4MWDA 3U3RA 1AE1A 1E63A 2QM7A 1XCWA 2O52A 4QO7A 4TKVA 2G07A 1OC7A 4JLDA 2XQFA 4G1EB 2DVUA 4C1NB 5L40A 2WFMA 5AC8A 1R86A 5C5DA 1GP2A 4GWGA 4R98A 3GLUA 2Z1NA 5LLTA 3R4CA 1CFZA 4RZ5A 3CF4G 2J3DA 4WKCA 4WPGA 3DMRA 3QKZA 3NURA 4TVOA 1VI6A 4YY3B 4Q3MA 1UHVA 2QUJA 3NV9A 3AFOA 4NCKA 3Q6MA 4IVNA 2PUWA 3G24A 1PQWA 4X60A 1VFTA 4FNMA 2CLPA 3Q94A 1A8SA 4RV4A 5K7JA 1F3WA 1P7WA 3UR7A 5BWCA 3ODPA 5CBPB 4ID9A 2XUFA 4FGLA 1PAUA 3NJ8A 1MVYA 4KUEA 1K8ZA 4A35A 2OCPA 3N3AC 3C6KA 3HLKA 1OC5A 1NRJB 3KAKA 3LCFA 1LT8A 2IUEA 3KL5A 5ALNA 4S1NA 2QMZA 2CDAA 4WACA 3CUYA 3A2NA 5E7MA 1O6FA 3A1WA 1UOPA 1IN6A 3KQPA 1JDDA 2WU3A 1XPJA 4EKGA 1UM9A 1ECQA 1L1FA 2QYTA 3QG1A 3AZSA 1ZZMA 2CUKA 5I00A 4TXHA 4JC4A 3K2QA 4GMKA 2EOAA 3NBAA 1SZJG 2AD1A 4BNDA 3RTCA 2XKAA 4HPXB 3JZAA 1R5OA 2QRQA 5J2UA 5JH2A 3SZMA 3R5SA 3RS7A 3PUIA 1XX1A 4YJGA 5AK4A 4N3GA 1M2KA 5HTOA 1AFSA 2OTCA 3TTYA 2FXIA 2I6GA 4GOXA 1NVDA 1OFQA 3GELA 4US5A 3W74A 4G0YA 1MUUA 4MW7A 1O60A 5EL1A 2Y8KA 3KDNA 3CE9A 3BE5A 5K3DA 5KU1A 3KYIB 3T0TA 3B8IA 1KFWA 5JG7A 4QE5A 1R3DA 4R2HA 3CQ0A 5EBUA 1QB8A 4NMHA 2IYOA 1VLJA 3ANVA 2ZZ1A 4UFKA 3HS3A 3HJHA 3KSAC 2KZHA 1C7EA 3WOHA 3D7LA 1J49A 2ZJ4A 3W1LA 4JKLA 1KSHA 2X5OA 4YVXA 2CT8A 4J0GA 3IVAA 4FXSA 4HEJA 1FP8A 5GQBA 3RITA 2PWGA 2PDBA 2G4JA 2E4AA 3P9CA 1UP6A 3WIBA 2VJMB 1V6UA 1D3GA 2RFGA 1GQIA 1P0FA 1ZMOA 1Z22A 2NW0A 4JLMA 2WD7A 2ZSFA 1NXTA 3BMXA 4NYIQ 3SGGA 2BEUB 1IQPA 1VJGA 4D1JA 4NBWA 1ZONA 3LKBA 5EJGA 2YNMA 3AL0C 2BGTA 3F90A 4GUIA 4KE9A 1C1YA 2CLOB 1PL6A 3TGWA 1LI4A 1Q6LA 2GM9A 4M6VA 3VNVA 3LS9A 1YADA 2ZKLA 3WH5A 3E7XA 1PQPA 2EGHA 3E9CA 4EY5A 4PC1A 4IP7A 1F3TA 3DFFA 3NVAA 3TLEA 4ALNA 3VGBA 3I09A 3N25A 4UBLA 1E71M 4OGKA 1GPAA 2F59A 4BLRA 1P9RA 4MY8A 5DBHX 1PS0A 4FNRA 3BAIA 4A8LA 4L72A 1F0KA 3QF0A 1XIFA 3DE6X 1XRRA 3R7FA 2ZBVA 4PN7A 2FJUB 3NM4A 4TX6A 2V8OA 3NDPA 3W9SA 3EEOA 3URKA 4XBKA 1OABA 3FX4A 2BY0A 4L02A 3VDGA 5BXSA 2QT0A 3DMNA 4RZUA 3OPYA 4RIEA 1CCWB 5FEMA 3OM9A 2GYWA 4F4RA 4Y0NA 1YB7A 5I3CA 2Z2YA 1UD2A 1GVNB 1WNFA 2OB1A 4B4UA 5LNVA 4R3UC 4AUBA 5ICFA 4DMLA 1MQ8B 4ND8A 2PP0A 2AMVA 4QARA 1UOOA 4JJ7A 3DTVB 4N7MA 3H84A 4P86A 1TO3A 4MS1A 2AOUA 4D6YA 1UMDB 3ECSA 4GH5A 2OBNA 3J7HA 4FNQA 4JYAB 4ZCTA 1G7RA 1JEDA 1RRKA 3INNA 2P41A 3WQ4A 1THFD 2XH8A 1EYZA 4FGSA 5TPWB 3GZ4A 1ZNQO 2R14A 1DAEA 4D3SA 5IUNC 5HKKD 3BK0A 1LH0A 3ZIAA 5HFAA 3OPMA 4S1OA 3A27A 3S2ZA 3T81A 2ZZ6A 2VLIA 4E3TA 3IQWA 1QFJA 1II9A 3EVGA 4GVLA 3CTMA 1YZLA 2VFIA 1CUVA 2LKCA 2C20A 1EGAA 4C0HA 4PBFA 1YI0A 1ZFNA 2XGIA 4M1SA 1BSLA 1ONEA 4C7MA 3AHGA 5HK8A 1JFHA 4QUGA 4WVXA 2FZDA 4UBPC 1FWNA 4YDQA 1U5JA 3CBQA 2E5WA 4KSCA 4KNWA 1Z0AA 2YPIA 2FJPA 3BXXA 3E0QA 3VZRA 3CONA 1M5TA 1IG0A 3FMVA 2HNAA 2ACSA 5KOHA 2TYSA 2GGGA 3DM5A 1A3XA 1O5IA 2CWNA 2I6UA 2Y99A 3OIXA 3O2JA 1CT5A 4QQUA 3GVCA 1RJ9A 1EBFA 4HLDA 3NYZA 3KQWA 2Y3IA 4O4HA 1W0KA 5K4AA 1T99A 4LSMA 4BQQA 3ELYA 1REQB 4E13A 5J4VA 5L6MB 4KH1A 5M7EA 5I7OA 1WY7A 2BF4A 1PTKA 2OLKA 3LVQE 2V1UA 3NL3A 3DTTA 3EVEA 5LU9A 3KVOA 1G01A 3AC0A 1YC5A 1UD3A 1GU0A 1K06A 1JUDA 3L4KA 3L0BA 2PTHA 4WFKA 2GEVA 3R6DA 3TNBA 2AE2A 1E2GA 1SK9A 5LIKX 3RG6A 4TROA 1V45E 2VBIA 2HM7A 2EFJA 3FPEA 3VMNA 4DV2B 4H6PA 1CG6A 1XEFA 3KHKA 2IEYA 2PS2A 4BY9E 3S2YA 4MAFA 2VDLB 1J23A 3VH2A 1M0WA 3NDOA 4TTIA 4DBEA 2JVKA 3E1GA 5AWFC 4CKCA 1K7EA 1NWTA 2EZUA 1N92A 1EJ0A 2Z9CA 5DNAA 1CHNA 4YRCA 2OZ8A 1N0VC 2YY6A 3TEFA 2NUPB 3RVOA 4DUYB 4LJRA 4OMCA 4U2DA 3C3CA 2R91A 3NBZC 4UTZA 1MZVA 3M70A 2CHEA 2R00C 1DJHA 5IXEA 1JI2A 5KREA 4XLZA 1KEEA 3R0JA 3UC5A 3NW9A 4QOFA 4N6FA 5K8UA 2GUUA 3M0XA 2Q7DA 4QDMA 1H6BA 3VCNA 5LYRA 3UJNA 1V4VA 3AOFA 1JF6A 1Z08A 5AHKA 2J9GA 4Y7CA 1QP7A 1G8FA 4PMXA 5T91A 3WGYA 3PHLA 4PH6A 1N1GA 1IXPA 1WIWA 1A1VA 3EWZA 4NZZA 4GC3A 4IWXA 2DB3A 3M6DA 5GPBA 1KH3A 4ZAGA 5D51S 5DBUA 3M64A 1HETA 4H60A 5IK2A 5F3RA 4OBXA 3R6TA 4B9AA 3O1LA 3U4MA 4GYJA 1XK7A 5BV1A 2NP7A 2PKEA 4LH8A 3TSAA 3RCYA 1Y8AA 1G5FA 4W7VA 3QY6A 1QPNA 4DADA 4BRWA 4D9FA 5J8LA 1M7XA 10MHA 4HHEA 1EUZA 1KNXA 3UCXA 3STXA 1NN1A 1G21A 4NNPA 4LDPA 3LW8A 3DG3A 4F1KA 2FW7A 3T5AA 3B1FA 3T12A 3UYIA 3FYUA 3DX5A 4AISA 5D05A 2WZDA 3CVWA 1J7JA 3EQZA 5FUYA 3EEIA 3Q37A 3GZNA 3FMIA 2GJXB 3TTQA 3RPMA 2ZIDA 5LWHA 1AA9A 4TS3A 5EC8A 4U2CA 4WN9B 3C8ZA 5E7QA 2M98A 1J2JA 4K2HA 4AWBA 4BLTA 4BE9A 4NUWA 1GKRA 3FCUB 4QTGA 3CZRA 5LA1A 1G2IA 2H4WA 1DJPA 4C2UA 2LLEA 1QI4A 1NDHA 4GI9A 4EAQA 4O1EA 1AHNA 1QNRA 2D5IA 2GZXA 4DZZA 4XIAA 2AKMA 7REQB 3BCSA 3OO0A 4MSSA 1EP1B 4URZR 2IXUA 2YMLA 4WRHA 1X98A 1NWCA