5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
1YFLA 2UYQA 4ER7A 3TMAA 4YMHA 1FBNA 4QEEA 2PV0A 2AOTB 1I9GA 2FYTA 3MERA 4PYJA 5HZMA 1XLGA 2PT9A 5GIOE 4OX9Y 3PFHA 2FPOA 4RSRA 2P41A 4PYMA 3NGFA 3C3YA 1BHJA 3TM4A 4RTMA 1BXCA 2IDJA 2ZVRA 2OB2A 3OCJA 4PYQA 4QDKA 2ZDSA 2GA9A 4HGYA 4F86A 5LQNA 4CKBA 1BKYA 1XIJA 4KRGA 5CIYA 2QULA 3FUXA 4Y30A 3OE4A 10MHA 3EMBA 1NBHA 5HOQA 1RI5A 2HK0A 5CVVA 3RIEA 3THSA 4RTLA 2P1DA 3GGDA 1QAQA 3DUWA 2IH4A 2OO3A 3BWCA 3B3JA 1QT1A 1RI4A 5FWDA 2ZTHA 2I6GA 3AYVA 5EEGA 1ZHFA 3TKAA 3GIWA 3LX6A 5EEHA 5AVHA 3KQWA 4QTTB 5H6HA 3R9XB 2QRVB 2UZ4A 2X7WA 1JTFA 2JH9A 2C7OA 1UWVA 3GNLA 1KYWA 1XLHA 2HV9A 4W4QA 3G88A 5EMJA 1NV9A 3EGVA 3GXOA 2AOTA 3O31A 3CJTA 5T64A 4C4AA 2PX8A 5C9ZA 4YUVA 4Y2HA 5TNVA 2BZGA 2LD4A 2NXNA 3ELWA 2H00A 2OPBA 3G2MA 3HVIA 3FUVA 1X1BA 2ZIGA 4HGZA 2GUBA 2H1RA 3JWIA 2J6VA 5EIWA 5F2KA 2XYQA 3KQSA 4XCXA 2ZIFA 3M0XA 4BLUA 3PFGA 2VS1A 4MTLA 1WY7A 4DQ0A 3I9FA 1XTPA 3PX2A 2JHCA 5EC8A 5K0GA 2O57A 3MAGA 3KQYA 3UJ8A 3ELUA 2ZIEA 3FTEA 4A8RA 1XIBA 4YUYA 3BUSA 1XIMA 3GRZA 3DTNA 2F8LA 3K6RA 4E2ZA 3M6XA 1QANA 1A0EA 2WA1A 2R6ZA 1X19A 2XISA 1EJ6A 2OXTA 1WZNA 1JG3A 4QQNA 2Y1XA 2QY6A 4FGZA 3RODA 1SUSA 5EMLA 2P7IA 3SXJA 1P1CA 3ITYA 3KWSA 3EVFA 2QE6A 3DXXA 4ER3A 3M0YA 3PLAE 5EKXA 1AF7A 3BZJA 2PJDA 2BR4A 3QXBA 3G2PA 4PGGA 2B3TA 1G60A 3OZTA 4DM3A 1XLAA 1FPQA 4O29A 4LG1A 1YX1A 3GRVA 3P9CA 4HTFB 5HILA 1ZGJA 4R8SA 1IY9A 1T43A 3E8SA 5DXJA 2VDUE 3P6LA 1VQ1A 5B1SA 4PYOA 3UJ7A 3XINA 3HVJA 3KR1A 4H0NA 5H02A 5K0NA 2GVEA 2HCVA 3CQHA 3SSMA 3VNLA 3G89A 1SUIA 4HH4A 3FTDA 3GU3A 4DA4A 4LWPA 2ESRA 4GJJA 3G5LA 5GM1A 3KQTA 3F4KA 3WQOA 1R74A 1KPHA 3I5UA 2YXDA 4A6DA 2AOVA 4E33A 2ZZNA 3DX5A 4LNCA 3B5IA 4RTKA 3KBVA 3HCDA 1D2CA 2AZTA 3KBJA 3FZGA 3LL7A 3R0QA 4YTSA 3OU7A 2DPMA 3KCJA 3TPZA 4ER0A 1DE6A 2JH8A 2R3SA 3EGIA 3LDUA 3LGAA 1H1DA 2KW5A 4IV0A 2HR1A 3FPJA 3NVKI 4BLWA 3HA5A 4EKGA 1XLCA 4HTFA 5C1IA 5DTMA 3SM3A 3UJ6A 3UJBA 4C03A 3KR0A 5MHTA 5FUBA 3VSEA 3U3HA 3XISA 1BOOA 1JQDA 3I53A 4GOLD 2C7RA 4BY9E 4XUDA 4R6WA 1RJFA 2OB1A 5J8LA 2YVLA 4QVKA 5E2BA 4QE5A 2AVDA 4MHTA 4U7PB 2ZSUA 1S5NA 2ZBPA 3GJYA 3KHKA 4A6EA 1XLIA 2OY0A 5ICGA 2Z6QA 4KW2A 1DXIA 4PWYA 2NQHA 1OR8A 2QUMA 3M33A 3HEMA 3NJRA 2HWKA 2YR0A 1QUMA 3PT9A 3FUTA 3EVBA 4XSMA 3SMQA 3A27A 3MTIA 3OFKA 1MNZA 3KCLA 2GB4A 1UFKA 5DM0A 4E31A 4YV1A 4XUCA 3PS9A 4FT2A 2Q02A 3KBSA 1P91A 3BDKA 2V74B 3ITXA 4Q7IA 1JQEA 1I60A 2EJTA 3ANXA 4P7KA 4PGHA 5EHGA 1XLLA 3BWBA 5EQJB 3G5TA 4PONA 4RVGA 2PGXA 3MCTA 3KCOA 3VYLA 3R6TA 4RWZA 3GDHA 1SKMA 4QPPA 3IV6A 3P2KA 4WVLA 5FQNA 1KR5A 2IDKA 3SVZA 1XIGA 1BC5A 4L7VA 5CM2Z 3P9KA 1D8WA 1JSZA 2HTEA 2I62A 1INLA 5CCBA 3P71T 1FP1D 2ERCA 3KR9A 3D2LA 3LDGA 5M5BA 1D2GA 4YUWA 2IH2A 4RV9A 4YMGA 3EVGA 3CGGA 3HCFA 4PFHA 1NBIA 3REOA 1JG4A 4PCLA 1BXBA 3KR2A 1TZ9A 2HNKA 1XINA 2IPXA 2P40A 4QTUB 5DLYA 3UFBA 2P7HA 4GOND 1G8AA 4OVXA 2PWPA 5E9JA 3CWHA 5T6BA 1L3IA 3AALA 1ZG3A 2XINA 1XLDA 3FRIA 4FT4A 3FTCA 5FWAA 1XP3A 1IM8A 2AN4A 5E9WA 3T7TA 4AX8A 3UBTA 9MHTA 4XUEA 4K3ZA 2A14A 1RI3A 1NKVA 5K8VA 1AQIA 1P39A 1PJZA 1YZ3A 3P2EA 5LQUA 1AQJA 1XIHA 4YV0A 2PX5A 4M37A 1HNNA 3KPYA 3A4TA 4PIPA 4FSXA 4CKCA 4YTTA 5LQCA 3IUDA 3LDFA 2G70A 2QRVA 1DIDA 5DX8A 3QZAA 5XIAA 3LBYA 2VZ9A 5EG5A 5GP1A 3TVAA 3ORHA 2BM8A 1TW2A 1XYMA 2GYIA 5DTRA 3E05A 5E1DA 4RTRA 5LQKA 2AOUB 2IIPA 3JWGA 4HGXA 3THRA 1DCTA 2P3OA 3ELDA 4FR0A 4GJIA 5GWXA 4QEHA 3KBMA 3KPVA 1Q0SA 2FK8A 3FUWA 3V8VA 3DH0A 1NW5A 2FCAA 1R18A 5CVDA 3Q7EA 3C0KA 3LHDA 1MJFA 3G8AA 3O7WA 4FSDA 3KBNA 4EQZA 1O9GA 2NP6A 1JQ3A 2PXXA 4XISA 3MCZA 3M0VA 4QDWA 2GH1A 2BM9A 5E2AA 4DCMA 2P8JA 4QE4A 2G71A 4FZVA 2CMHA 4E30A 3LCVB 3P14A 1EQAA 1N2XA 1VP3A 2XVMA 3AJDA 3OZRA 3S68A 2I56A 4GOMD 4P58A 5BW4A 4HHLA 3BWYA 4PYNA 3IYLW 3LCCA 5F2OA 3HVKA 2PBFA 2Z6AA 2NYUA 2YX1A 5E1OA 3NMUF 1OADA 1XIFA 2CL5A 4GBED 1DL5A 1VP9A 3VNKA 5B7ZA 9XIAA 5DRYA 2I57A 4PGLA 1XJ5A 2AOUA 2EX4A 3CC8A 1B42A 1XIDA 3KQVA 4ZB5A 4U7TB 5JR3A 1XYBA 3HTXA 4KDCA 4RTNA 4QVGA 1JG1A 3OU2A 5DPMA 4AZWA 1X1AA 5FULA 3KBWA 4X1OA 1Y8CA 3BANA 1Z3CA 3HCCA 3SX0A 3TFWA 4ER5A 4YV2A 1YF3A 3ITVA 4AZTA 5JUWA 1KPIA 5E8JA 3G8BA 4E2XA 3X0DA 5B80A 3EVZA 3MGGA 5ERGB 3CVOA 4FP9A 3U81A 4E70A 3OFJA 1XLFA 1XLEA 5G02A 5EVJA 2PX2A 3VC1A 4CWAA 3CBGA 2V7EA 1PRYA 2O0LA 3KQOA 4RVDA 3HA7A 3EVCA 3SSNA 2NXJA 3PB3A 1R8YA 2ZWVA 2G8NA 3A7EA 4K6MA 4XKMA 4ZB2A 2CMGA 2XVAA 4PNEA 3AWIA 4AUKA 2UYCA 2YXLA 8XIAA 7MHTA 3IUHA 4M38A 1XIEA 3UA3A 2AS0A 4EACA 3KKZA 4PINA 5EHIA 4PYLA 4XSLA 3IEIA 3TQSA 1RJDA 3NTVA 3TRKA 4OA5A 5LQJA 3ITOA 1XXLA 4MQ4A 4DZRA 2JHPA 1VPTA 4KVZA 3LCUA 3E7PA 2IGTA 2PY6A 3B89A 1XYCA 3HVHA 4RVFA 4EVIA 2Z6UA 5EIFA 3FPGA 4ZBCA 1I4WA 4RYLA 3BGDA 3CQKA 1NW7A 1QAMA 1TPYA 3QOXA 4RX1A 4GQBA 5CVEA 5XINA 2GPYA 3UWPA 1G6Q1 2NXCA 2GAFA 3U0HA 4PIMA 5ICFA 9XIMA 4GLEA 3EVEA 3QV2A 1XYAA 5HFJA 1HMYA 2ZFUA 1KIAA 4RTOA 2UYOA 2O07A 1XVAA 4QDJA 3XIMA 4XIMA 2IBTA 5ICEA 3EGEA 3EVAA 3ME5A 3WSTA 3O4FA 2VDVE 4FS8A 5ICCA 3UVAA 2OU4A 3TKYA 4M7RA 3UU0A 1R00A 2NP7A 3EMDA 2WK1A 4RVHA 3TR6A 3M6WA 4EK9A 1SG9A 3LKDA 3ERCA 3GNXA 3SSOA 3HA3A 4BP1A 4HSGA 1Q0TA 3RW9A 2C7PA 3NDJA 2AOWA 1ZGAA 1D2HA 2ZW9A 5DM1A 1SQGA 5B7YA 2NQJA 1S5MA 1L9KA 3BT7A 5LR6A 3EVDA 4XIAA 4A8NA 3GO4A 5DXAA 3VNJA 3KTCA 1N7IA 1QTWA 1YZHA 3UA4A 3CCFA 3HM2A 1X1DA 3M6UA 4YUXA 2UYHA 5K0JA 3DP7A 3DLIA 1IXKA 3C0SA 5K0BA 2XBMA 3I58A 3LBFA 3M70A 4RTSA 2B2CA 1FJXA 5AVNA 2B9EA 5LQAA 3NVMB 2G4JA 3EEYA 4YTUA 5EOVA 2DULA 2GLKA 1NW6A 2FK7A 1EAMA 3QYSA 1QZZA 2ORED 3DULA 2ZVJA 2PT6A 3P8ZA 5FCDA 5HIKA 4RTPA 1A0CA 4GOOD 2PX4A 2I9KA 2IBSA 1F3LA 3BGIA 3DR5A 3LECA 3M6VA 4DMGA 3BZBA 5EMKA 4US6A 1VBFA 2ADMA 3DXZA 1EG2A 1O54A 2OKCA 5DSTA 3LPMA 4GF5A 3VNMA 1U2ZA 2ZLBA 3P9NA 2PLWA 2P3LA 3UJDA 3CJQA 4ZTBA 4CXMA 2G1PA 5DWQA 2BH2A 3MHTA 1DE5A 5U4XA 3CQIA 4GEKA 1G55A 3CJRA 1VIDA 5CD1A 4AZVA 1K77A 2ZBQA 3BKXA 4DUOA 3C0LA 1R6AA 3R3HA 1XIIA 2C7QA 3IHTA 5CUQA 3E23A 1V39A 3NWEA 7XIMA 1MHTA 4DVOA 1A0DA 1YFJA 4A8LA 4EAYA 5KS2A 2ZCJA 3BGVA 5EGSA 3GRYA 3KQMA 3VNIA 3KQPA 4ISCA 3EEOA 2GLUA 4A8IA 1XICA 3IUIA 1KYZA 5EMMA 4QE1A 1M6EX 2QUNA 2PWYA 1EJ0A 4OBWA 4OQEA 1NV8A 4QDPA 1M6YA 3EPPA 1NW3A 3OZSA 1N7JA 1JG2A 3L23A 4EKIA 2ZULA 1O1HA 3M0HA 4RTJA 1XISA 5CVJA 4X41A 3I64A 1GW9A 4K1GA 4KIFA 3MQ2A 2XIMA 2XYRA 4C06A 5K05A 1P1BA 3MB5A 2O06A 5DM2A 5FHRA 2CWWA 5K09A 5XIMA 4OQDA 3C6KA 1XDUA 1G8SA 1RI2A 2PKWA 2H11A 2Q41A 4QPNA 3DMHA 5EZQA 4OBXA 5FHQA 3VC2A 3TOSA 4BP3A 4PYIA 3CNYA 2AOXA 2PXAA 1VLMA 4C07A 3Q87B 5K0CA 3HNRA 3LKZA 4MWZA 2X7VA 3DBNA 4HNOA 2OYRA 1XLJA 3KPWA 1XDSA 1YB2A 1JTEA 3UZUA 2G0WA 1NW8A 2JJQA 4Z2YA 4PCAA 3HCAA 3K0BA 2NXEA 2JHAA 3ITTA 3G2QA 2HK1A 2QYOA 4R6XA 4KIGA 3OBEA 1WG8A 4HG2A 3T7SA 2P35A 3H2BA 1XLBA 3PVCA 3AYTA 1EIZA 2EFJA 1L3CA 3FUUA 3V97A 3VYWA 1CLKA 3C0QA 4HHMA 3UXIA 3BWMA 3CKKA 1SQFA 3B3FA 1RI1A 5LQRA 2EJUA 5KYGA 5T67A 3JWHA 2K4MA 4ZB0A 2HMYB 3JU2A 5DX1A 3BKWA 5CCXA 2YTZA 3BZGA 3BXOA 5FA8A 2IFTA 3AY0A 4DF3A 2IP2A 4IKPA 1QAOA 2OBFA 2PVCA 5CVUA 3OU6A 3KPUA 5P8WA 1SVUA 5BP7A 1NE2A 1L3BA 2B78A 4GC9A 2XYVA 1DIEA 4IWNA 4IV8A 1YUBA 3C6MA 4GC5A 1DUSA 4X61A 4C08A 1I6NA 1XLMA 2AN5A 2WA2A 1I1NA 3DOUA 4V0QA 6XIAA 5EZSA 3NWBA 4CTJA 2ZZMA 4MIKA 5KVAA 4JXJA 3G2OA 1TW3A 3DMGA 4CTKA 5IKMA 3AAMA 4POOA 3FYDA 3FRHA 3FTFA 4HRAA 3UJCA 5IH3A 1WXWA 3TLJA 5GINE 2BR3A 3ER8A 1KXZA 3TM5A 5K0EA 4P7GA 4X60A 5I7GA 3KPJA 3HCEA 2G72A 3LMZA 4BLVA 2B25A 1RJEA 5KQRA 4C04A 5FA5A 1XCLA 4KDRA 3SR4A 4OA8A 4WXHA 2N47A 4C05A 4ATNA 1M0EA 4KWCA 1KP9A 1X1CA 4B17A 1JSXA 5HEKA 4HC4A 2PSSA 3AXTA 5EPEA 5HIMA 3SGLA 4E3VA 5DX0A 5HIJA 5E1BA 3ITLA 5GM2A 3LSTA 4DCGA 6XIMA 3A7DA 5E9QA 5D1NA 5F2NA 3BWWA 5HIIA 3DLCA 1NT2A 3HP7A 3ID6C 3P2IA 4AZSA 3T7RA 2NQ9A 2YUIA 3ELYA 4P7JA 5K0FA 8MHTA 3FYCA 4DKJA 4F84A 4PYKA 3B7PA 1UIRA 1VE3A 4GUAA 3MTEA 2ZBRA 5DT2A 5FADA 3UJ9A 5BW5A 4E2WA 4X63A 5BXYA 3JWJA 1ZKDA 2Y1WA 1MUWA 3NW9A 3QOWA 4KW7A 3T0IA 4E32A 1G38A 3HCBA 1AV6A 4QQKA 2P3QA 3P9IA 5C0OE 4F85A 4CKEA 5GIPE 2AR0A 2ZWAA 2PXCA 2GS9A 1FP2A 1XLKA 8XIMA 5E8RA 5EKUA 4LWOA 1F38A 1R8XA 3AXSA 2AVNA 3DMFA 3FPFA 2VDWA 2AN3A 2YQZA 3M4XA 4RTQA 2I7CA 5K01A 3B3GA 5H1WA 2CKDA 4YTRA 3QC0A 2EG5A 3A25A 2ONZA 3GRRA 4R05A 2FHPA 5DSXA 3CQJA 3C3PA 3KQQA 5FTWA 3M0LA 1QYRA 3GCZA 5DRTA 3UJAA 4ER6A 3A26A 3PTAA 2VP3A 1XDZA 5DTQA 3ER9A 4YTQA 2E5WA 3GWZA 4J4KA 3OPNA 1VL5A 3R24A 5GOZA 1XCJA 1KHHA 1O9HA 3FPEA 3G7UA 4M36A 2O05A 2NNWB 2BR5A 2OZVA 1WXXA 3M0MA 1ZQ9A 3L8DA 2QM3A 2ONYA 3TC3A 2QW5A 1RJGA 3FPHA 4YUZA 5K0LA 1WS6A 3OE5A 1ORHA 1KPGA 5E1MA 1JR4A 1ORIA 3NDIA 4P7FA 4R8RA 3FVMA 2YXEA 3PX3A 4NECA 5D1HA 3P97A 3N4AA 4E2YA 2FRXA 4V0RA 2ZZKA 5DM4A 4LECA 4G56A 3DXYA 1L1EA 3KU1A 4EMSA 4UOEA 5LSAA 5KQSA 2IH5A 1XYLA 5FQOA 3GRUA 5K03A 2JG3A
chains in the Genus database with same CATH superfamily
3ONEA 1R46A 4GI6A 1OZHA 1PAMA 2AZ4A 1MTOA 2MR6A 4O4IF 4CPDA 4H7FA 1JPUA 1XQ6A 4KVAA 4BF7A 1UANA 1X7FA 3HPFA 3NWRA 1ZR4A 3G9QA 4EZIA 2IUUA 4TTAA 3EAFA 3EVNA 3VV2A 1DC8A 2FCRA 1A5UA 2QVGA 3CNEA 1E64A 1PYFA 2ZYDA 4EZEA 4XCXA 3ZBQA 3ND7A 4B5WA 3WCZA 3GDBA 1HLPA 4PCSA 1M2OA 3TSWA 3HJHA 1GAEO 3O2JA 3HQOA 4BS0A 2TMYA 5G2HA 4UPVA 5JO0A 2XVLA 4Q6BA 3R3JA 1Z4LA 3S28A 3TR0A 1DX9A 4DDVA 1N4DA 3P8IA 4MUNA 3AKZA 5H91A 4G1NA 3RARA 4TKUA 4WN9A 4BQ4A 3G1SA 1WTCA 5JH2A 4E33A 1A8UA 3W2NA 4FINA 1UQUA 4FONA 3OU7A 4DN1A 2EO7A 2QLTA 4KQ6A 4FX6M 2VTBA 1OQFA 3PRYA 4DEXA 1L4KA 1QTIA 3VPHA 1NG1A 3B0PA 4QR6A 5H02A 3I3SR 1WV2A 2O9OA 4LYRA 3KBSA 2Q3DA 1F0YA 5I3DA 4MR7A 4OXKA 3DXIA 1F8GA 1OJLA 3T5MA 2IF2A 1O6FA 1NBIA 3KKKA 4JIQA 4FLOA 3AJAA 2VGGA 1P4JA 2WAGA 3DFYA 4WXEA 1H6BA 4PSVA 4GGMX 4HYVA 3FGOA 1G8AA 1YQTA 1S8OA 1B0PA 4ZQHA 1CT5A 3EW7A 5B7PA 2JKAA 4DJFA 5IRPA 3LG2A 4L6CA 3LDFA 3Q5EA 4I14A 1L5HA 3GVPA 3SKYA 1OBCA 4EFDA 5DTRA 2WC3A 2I80A 2HA5A 2J9XB 2C3OA 2P3OA 5GWXA 3DG3A 2NZUG 3ENWA 3ZQ6A 4QE4A 4C65A 2ZRUA 1HDRA 4AUEA 3NDZA 3RILA 1MB9A 3CS2A 4DLYA 1JDPA 5EXSA 1PZFA 1FFXB 4JBGA 1II8A 2H65A 1SO5A 3PNVA 2O8BA 3BICA 5K99A 2VG8A 2B8TA 4XQCA 4YV2A 3EPNA 5HS4A 3GDWA 3VC1A 1RJQA 1QK0A 4BCEA 4R9SA 5F2GA 3TOPA 2J45A 2ZAIA 4P7RA 1CGUA 1JUDA 2ODTX 3RQIA 4OA5A 1G8KA 4A10A 3HC7A 2Q9BA 2Q5JA 2QW1A 3CQKA 3FBTA 1O8CA 3KE0A 3GC5A 2P9EA 5AVOA 4A9AA 3K94A 4CLOA 5ALWA 2J3QA 4HCJA 3U6KA 5D9NA 4MQEA 3KYBA 1IXZA 1Y42X 5TS3A 5JBEA 1EUNA 3C6XA 4V0MA 2IY9A 1PYDA 3KAPA 1G20B 2WJDA 1G9HA 3UR7A 1PIFA 5ICMA 2Z09A 1YVDA 2AWNA 4QDOA 1DJMA 1VLHA 5KTKA 3WQ6A 4UTTA 1I01A 1SQ5A 2J5BA 1T25A 3MINA 4R01A 3FNIA 3CRZA 3ZHSA 3IGHX 2NADA 3GJ6A 2HHLA 3MMWA 2ODOA 3ZZTA 3MB9A 1LZOA 5JYCA 1POXA 4XUYA 4NOLA 4MV0A 4B6QA 1DZIA 1RAGA 2ANBA 4JUBA 3SP1A 2JIPA 1L8NA 3GV0A 5TXGA 3NIGB 3C6KA 4W8BA 1XBYA 2X9NA 3JVIA 2B1JA 1POKA 4MMYB 2NUPB 3SCPA 4HQFA 3S2SA 2R1UA 2QYOA 1VM6A 4RH0A 3L82B 2JA2A 3C0QA 2AIRA 1U7TA 4QFCA 1CGTA 3KL5A 2NU9A 3FHLA 5A6AA 2J7KA 2AJTA 3B0XA 2WVHA 3HCNA 5DGDA 3W5CA 4DPKA 4GRAA 1WXGA 1TOAA 1OZAA 2V6MA 4IV8A 2GVDC 1WA3A 2LTAA 4AU1A 4XZHA 4XGKA 2JLCA 4POOA 2QPLA 3URBA 4RY2A 3CSUA 4MUIA 1BW9A 3AJEA 4YO8A 4D96A 2EJ1A 2B25A 5E4JA 1X0VA 4TKVA 1UBCA 2JARA 3RHZA 1F3XA 4UVEA 4AF7A 4QQUA 4NMHA 1R4NB 3CWNA 2WICA 5FPKA 1W49A 3R7MA 2DZXA 1DIKA 1KEEB 3BWWA 3BFJA 1OFRA 3GFRA 3G24A 3ZHBA 4MZDA 1EESA 1POJA 1IJEA 2BDTA 1WULS 4EKYA 4D99A 1VGRA 2EP8A 3CZLA 1AXEA 2OBBA 1JU4A 5KEIA 3NORA 3VKVA 3QQ1A 3FSUA 3W9UA 4K9SA 3O1HB 1QC5A 4HMQA 4N5DA 4Z5XA 3V4LA 4IJ6A 4RD3A 4W8AA 2BR5A 1RXOB 2IHNA 5THQA 2CXQA 3OE5A 5ESDA 2RGNC 3ZIUA 2FWMX 2F3RA 3LP6A 2YWGA 4Y2GA 1NIPA 5FPTA 2X0YA 4ICMA 3GN2A 5FFNA 2WMIA 2HFJA 4Q66C 5DLCA 1CW2A 3PFHA 1OIFA 1E1LA 5FOWA 3OLVA 4UU7A 1E71M 2IV3A 2F1RA 4RPGA 5JE8A 4AXKA 5BUCA 2ZP1A 2Q5HA 4DHEA 4CCEA 4HX2A 4LHZA 1N2JA 4LYDA 3IESA 3VZSA 1H5QA 2W2OA 3CZEA 1X8KA 1WSDA 3T07A 3QR0A 4RGBA 1MEOA 5KNCA 4H1ZA 5MFPA 1J0EA 1DQYA 2WT8A 1PU2A 1W5NA 2PCLA 1QHFA 2OCXA 4M9XA 2GJ8A 4CM3A 3MJHA 3ISJA 4MVJD 3AEQA 4J27A 4GQ0A 1W5TA 1ZJAA 3BG9A 4WZAE 2ZU6A 4I5RA 4HQLA 5H8MA 13PKA 3CLRD 4O63O 4MROA 2IDMA 4GZLA 4LOCA 4HSNA 4HTFA 1RC1A 1KU6A 3XISA 1SM4A 2GN4A 3D0OA 3VOIA 1QH8B 2A86A 4D6EA 1IT0A 3SJNA 3HGRA 4LYKA 2AFVA 1P61B 4KERA 1I60A 1PL0A 3UZYA 2XQKA 1G7VA 4Y6QA 4L74A 1NJFA 4JT2A 4ZI7B 3SJ7A 2B94A 2AG8A 3LPCA 3JQ7B 2JHGA 1YB4A 1A5NC 3HYTA 4QQRA 3OCCA 5E9WA 5BYKA 2JGKA 1YZNA 2ZTLA 3OFSA 4O5OA 1RY8A 3QPAA 5AP9A 4K9OA 5JVLA 2HPHA 3M4NA 3TH6A 3N8IA 3FMGA 2D8AA 4S3GA 4ALIA 5I24A 1QOZA 2WIDA 3IKMB 5FAGA 3M0VA 1KM2A 3MK31 2ZOSA 3NC1C 1AMKA 2IE8A 4C20A 3QLTA 3AVVA 3T3MB 3TZCA 1RBQA 2GNAA 2PC8A 2J48A 1AG1O 4U7TB 1H51A 1RQHA 1RLUA 1VMEA 3TZFA 1RRCA 4PTDA 1KXTA 1XTIA 4DA8A 1GL9B 4F21A 1XFAA 2YVAA 3IJQA 5BQ3A 6LDHA 4M1OA 3TQSA 2O8CB 3TRKA 3W5IA 1F73A 4WH0A 1VPTA 1T0JB 1CB7A 3WWDA 1M6WA 4OYLA 3NGLA 4GKJB 1X1ZA 4R1LA 4H31A 3B52X 1XL9A 3KD2A 3H2KA 4RKEA 4ALKA 2I3BA 4QXRA 3ZCSA 1NFFA 3TKYA 2W2MA 2VRCA 721PA 3LZCA 2PUTA 3ERCA 3TONA 1B3OA 4CFSA 5EBUA 1LWIA 4P61A 5GVRA 1T5TA 3W04A 4EBFA 1U5HA 3P9XA 4TXHA 2YV1A 1SIUA 1VLJA 2HUPA 2R60A 4HIBA 1A0CA 2IV7A 4L07A 3RTAA 3CLKA 3L0KA 4XSGA 1QRQA 3KKQA 2FHFA 1BHSA 5IF9A 4NIMA 3BGSA 2WG2A 3AVOA 2WP8J 4Z1DA 4FD3A 4FHZA 2VN8A 2VRJA 1YFJA 1W1TA 5F4WA 3EPJA 4D0RA 4WBNF 5F23A 5HQEA 3JS3A 2PWYA 4MUBA 1EJ0A 3BMCA 1Q66A 4D9CA 4LPSA 3K4PA 2BUAA 3TEFA 5C8DA 3EB9A 3IURA 2CWWA 2XMZA 4J8PA 2PKWA 1G8SA 2PU0A 3C6ZA 1HYGA 4YP9A 1FMFA 5FF9A 3ZVKA 1N2HA 3KL2A 3H2ZA 4ZO9A 3DGFC 1E6MA 2BDEA 1HM5A 1S02A 2P9JA 3OKFA 4LQDA 4F1WA 5BMWA 3BULA 3PDCA 5AVKA 1MO3A 4JTCA 4CU8A 3B6MA 2M6KA 4RANA 1I5RA 1QH9A 3HK2A 2D4HA 4LVGA 3WWOA 3SZ8A 1VXRA 4XUGA 1ONBA 3HACA 4M82A 3I8OA 1ZP4A 3EMQA 4G9GA 3IXLA 1J9EA 2E40A 4P5EA 2PWEA 2L19A 3TD6A 4LDZA 2PWHA 1M53A 2WU3A 1EP9A 2P2CA 3L4JA 1PNRA 2VENA 4A6PA 3TXAA 2GVYA 1F06A 4D6HA 1OWNA 3VH2A 5F9HA 3ZTWA 3D6UA 2O7VA 3KRZA 1KYXA 3B3GA 3PGLA 3RS2A 3GCZA 3IAAA 4U00A 5LIXX 1HKKA 1Q7QA 1JZQA 1Q0ZA 3RUCA 1AVTA 4Y6GA 4P0QB 2W93A 3L8DA 3FPHA 1NXWA 1KTBA 1E2LA 4EQ6B 1Q0PA 3IS3A 2PMQA 1CQJB 1Y34E 3TSBA 3KVLA 1HA3A 1DWFM 3KJIA 1FBNA 1OX4B 4QUIA 4ARIA 4PPGA 3FUXA 3VO0A 1TVKB 2VXYA 3SCWA 1YL7A 2I6GA 1BGVA 4MFDA 3VR2A 3ZHXA 4DBSA 1ZUHA 2DIJA 3INPA 1GRVA 4H2HA 5KB3A 3AB7A 2YJGA 1N6OA 1CGYA 3JD1A 4P0TA 5C1BA 2GWNA 4K8OA 4LB4A 1RBLA 3WK3A 1PT8A 4JI8B 4JFWA 1ZBWA 3ZY5A 2E68A 3ZWBA 2PDWA 2V9ZA 3HDHA 2OHHA 5EKXA 4LAZA 4Q3KA 2IF0A 4I90A 4Q4HA 1QVWA 2Q6KA 5JJCA 1QNSA 1USUA 1K02A 2BUCA 1HTBA 3H26A 3HVJA 1ISJA 5JDIC 3GF4A 5BWLA 3ZE0B 1QW9A 4GUGA 1E7SA 3KOFA 2DSNA 1ITCA 5HULA 4YIHA 5DTMA 4AJKA 3TTQA 1P0IA 3OWOA 4N18A 4KIJA 3LEPA 4D8TA 1NC1A 3BTUA 1E3EA 5H59A 1SURA 2GZ1A 3I0MA 3DDMA 4MMWA 4ZPXA 4GXWA 4XUCA 2XOKA 4MWAB 1UWSA 3ZR6A 1TJYA 2SKEA 2BBOA 4JB8A 1C1XB 4II7A 5CEJA 4JQYA 2AMVA 5BMVF 4BEVA 2YLAA 1TB4A 3AL3A 4OUDB 4WXYA 1NJ8A 3CKLA 2GGEA 1VGAA 2VFGA 1UWLA 5AVTA 4P84A 5FWAA 4DJTA 1KK2A 2RDWA 3OT5A 3EH1A 1HN1A 1KI6B 2ZI4A 4WTOA 4AH7A 4M0PA 5LXXA 2J0SA 1NMQA 4R7OA 3NJ4A 4GKLA 4MUFA 4JVSB 3UTCA 2W11A 5AVUA 4EE9A 3MILA 5A94A 3S68A 2FV8A 1GSHA 1YJ5A 3GCGA 1OAAA 2EX4A 4D25A 1AKQA 1G8PA 3A58B 4I9AA 4CU2A 3VUPA 4MWCA 2PDIA 3CZ4A 3L4BC 2FTWA 2SFPA 4CM1A 4NV1A 5M1TA 2EYQA 4JUDX 1PUJA 4EWJA 2ZETA 5H0IA 3DBHB 3ZDXB 5LB2A 2Y0CA 3EXRA 2ZR8A 3RTGA 2QVNA 1ESMA 1M6VA 1JG7A 1F20A 1V0JA 2R65A 2X4DA 1N2CE 4Z1YA 1WMBA 1NU6A 1TZCA 3MI6A 1NQUA 5FBQB 3QR1A 2J6BA 1NDZA 2XIBA 3GHRA 3GXFA 2R1ZA 4HTYA 2YL8A 5I45A 4JICA 5DBTA 3I76A 2X42A 3FJOA 1UP6A 2JGRA 4O2BB 3EVDA 2BDQA 2HEJA 1NR5A 1XSKA 3VH3A 3VIMA 2V58A 2HHJA 1LPMA 4OXRA 2B2CA 3TDFA 3LUJA 3PUZA 1UWTA 1EKXA 5JCPA 1A4MA 1DVRA 1UEJA 1RRKA 4OVKA 2A9OA 1HE1C 4CXMA 3H55A 1CJMA 5CSSA 1YD7A 3F1LA 2H7VA 3WDMA 5ALZA 1IE7C 4WW0A 2WNQA 3LUGA 5CK5A 4EIWA 3KQKA 1Q22A 3NLLA 4MB1A 1Q15A 3EXAA 5K3EA 4ZWNA 3HN2A 4L9RA 3DB2A 1GXSB 4O0KA 1DJOA 4NRRA 5DYYA 1C93A 4O3FA 1NUUA 1P5FA 2AOXA 2PWDA 1D6NA 3L1VA 3HNRA 1C41A 4QXPA 5KDLA 4NJMB 1GG8A 3GG8A 2VWSA 2VP8A 5LWQA 5FEWA 4ODIA 1EO5A 1V0NA 3I2JA 4TS9A 3BXOA 4RE0A 3RSOA 3LHYA 1W47A 1TYGA 3TSCA 1ML1A 3EDYA 1NP3A 3ADBA 2O8EA 4REOA 3QZUA 3WRVA 3NIDB 3AETB 3ZDYB 3DMGA 1J06A 2HMAA 5L53A 1H2RS 4R31A 3OD1A 1WPQA 4A23A 3GEIA 2C88A 4MKIA 4I1PA 4P4NA 1KP9A 4M8UA 2DHQA 1UIOA 3BW4A 2QMYA 2KB0A 4EUHA 2GXUA 3HFRA 5HBGA 2QZ4A 5FADA 5TRTA 5L4SA 3HXQA 2OMKA 2Q21A 1D09A 2V7UA 2NUPA 1AKYA 3WOVA 2YQZA 1FVXA 2A0KA 2XCOA 5FTWA 1C8YA 1TV4A 1RRGA 2QU7A 3Q7SA 1M0WA 4RYDA 1QTNA 4HQOA 4P9NA 3EYWA 2QTFA 3TCKA 1Q14A 4L5IA 1ACMA 2H00A 4C6TA 5JW6A 1YBAA 3BOXA 5JCXA 2GD2A 4FOUA 4HNVA 2IDJA 2X1TA 4JJIA 5FNVB 2H1HA 4LVCA 1PKNA 2RJNA 1E2UA 2J07A 3BWCA 3BG5A 1HZZC 1VSBA 5CEWA 5FBZA 2O6HA 4IM7A 5EZ5A 2J8ZA 2Z6AA 1C0IA 3E3HA 1CCWA 3HU1A 3LV5A 5TNVA 4HUQA 3OLGA 5L3QB 3H24A 1ONRA 2VS1A 4KUEA 4RENA 1TMGE 1FTQA 4RHTA 1H11A 2DWQA 3WWEA 3O26A 3TK7A 4PLPA 5CLIA 2IU0A 4MQ6A 4EFKA 4I08A 4WGHA 1VYUA 3FB4A 3IVSA 2MSNA 1Y9DA 3PBGA 4PUJA 4M7TA 1QKIA 2IZZA 4ZDJA 2RHMA 4YROA 1MEHA 4O11A 4H7KA 4I50A 2BGGA 4UXIA 3SSMA 4OUEA 4WLNA 4X7MA 4DA4A 1NTRA 1QQ7A 5I9MA 2J1LA 2VHEA 4LNCA 1M2NA 3LQKA 4ROSA 3WDLA 2CNKA 2W0UA 5A2GA 4FYKA 1GGEA 4EB6B 4LHXA 2NSXA 2HNHA 1XC7A 3S6OA 4ZVKA 2G1UA 1AW5A 1XEAA 1QIFA 4C0KA 3TFCA 4Z1AA 5ECGC 2ERCA 2VJOA 3ZVMA 1LU9A 3NAMA 3QELB 2AQKA 4ZJZA 2WJZB 3IXMA 5E4TA 1JN0A 2BMEA 2XWEA 3AALA 1FFHA 3GHTA 4J90A 1QV9A 5AWFC 4IT1A 2W6JD 1W8DA 4NJJA 1PK8A 2RFGA 4DNOA 3WQEA 3CISA 2Z1SA 3HPRA 3KJXA 3O2SB 4JTUA 4ENWA 2Z3WA 1XR3A 1FMTA 2P79A 4RZ3A 3QQ0A 3TJIA 4GINA 3GZNA 4JSTA 1ECQA 3DCIA 2NYUA 3ZCRA 3S29A 1DL5A 1VKHA 4S1PA 1LTHR 2W2XA 2NIPA 3DKKA 4F8JA 1KOGA 4A5SA 2VNIA 4B73A 3NTRA 5I9LA 3ITVA 1S3IA 1RDFA 4CJXA 4TXNA 5HNRA 4DTIA 1NJJA 4J3JA 5FI0B 3FFWA 2RONA 4EI8A 2C61A 3UNXA 1DOAA 1P7CA 3N13A 3VR5A 1SU4A 4JDPA 1DINA 3PA8A 4EWLA 2XNSA 1QATA 1HX7A 1YK0A 2NUWA 2G3MA 3DGRA 4LGMA 1KI4A 4U2KA 1TTTA 2I7TA 3R23A 3CH4B 1Z08A 1MPTA 1TR9A 3C7CB 5IHRA 2YL9A 2RK6A 3DL4A 4D45A 1U5CA 3OZDA 4JQ1A 3L5MA 3E1KA 3ESZA 1T5BA 2B7NA 2GFHA 2DOKA 3H2FA 4FI3F 1I45A 2BGRA 4F2DA 1H0GA 2WILA 4JVLA 1XEFA 4MW7A 1W4BA 4KAJA 3KTXA 5DWDA 2O2GA 1WKFA 1GQIA 2I2WA 4LEIA 4UBIA 5EGRA 3KQPA 3NAZA 2FPIB 3TAHA 4R2JA 1CLEA 4NK4A 4QELA 1NBMD 4KIFA 1BGXT 2P50A 3U56A 1OFOA 5DEIA 2CLOA 3DF9A 1F2UA 1S3FA 4DE5A 2H52A 3T0DA 5ITVA 2W0SA 1JH9A 1VKOA 4H41A 1YQWA 1NTOA 2AKAB 3OC0A 3FR7A 1SXQA 1DKRA 2II6A 1QR2A 5DY3A 3IWPA 2PT5A 3KUCA 3VJMA 1QAOA 2VBGA 1VA4A 2VQ6A 1QZ3A 2AL7A 3KS9A 4TVOA 2QP4A 5BVGB 1B6TA 4P08A 1EEHA 2CZQA 2FZEA 3CZ9A 3GG7A 2GBCA 1E70M 4UVHA 3HJCA 2D2GA 3D3EA 3ENNA 1JSXA 1EJBA 4PQEA 5I5EA 2H63A 3A7DA 3Q0TA 2J0UB 2G04A 1Z0AA 1LOLA 5A4IS 1HF6A 1P0MA 1GRCA 3K1DA 4LZLA 4CQMB 3NW9A 3R20A 3WO0A 3T2QA 2PXCA 4XBKA 4BU0A 2I1VB 3FCUB 3GFVA 1SFTA 5CC3A 2WF8A 3LUDA 1ZCJA 1EQPA 3MW7A 2UDPA 1UPTA 1H42A 2OO0A 2EIHA 1H2ZA 4EARA 4ZO6A 3LCWA 4EIVA 1EINA 3H3JA 3O7MA 3SXUA 5AHMA 1WEHA 5KQSA 5FQOA 5KQPA 4CM9D 3MYYA 3OOYA 1LW7A 4BNIA 1YQXA 1CY6A 2FVLA 2X8BA 2OOFA 4A03A 4N54A 4YUVA 3SUSA 2ZIGA 3PBKA 5EIWA 2ZIFA 1GCGA 1LK0A 3V7PA 3I8SA 4A8RA 1L4GA 1P3JA 3L2IA 2FU5C 1W7AA 3KBOA 2OXTA 1YR2A 1LDGA 4G5SA 4DDMA 3H19A 5LA2A 3WVNA 5F9FA 4Q00A 1EHCA 2XH2A 5A4KA 2QTVB 2YXDA 5AYYA 4B5VA 1L7MA 3TTTA 1MJ5A 4ZJYA 5IEJA 4F56A 1ZBCA 1OA1A 4FFMA 5LXTA 4XKYB 3HQPA 1U2DA 3TW8A 5DCEA 1LSSA 5CPOA 4QROA 5BNFA 3RG2A 2WVUA 4Q7IA 4B5LA 1JJKA 5EHGA 5DE3A 3BWBA 4LGCA 1Z48A 4FUTA 3EDQA 2XZ9A 1JQLB 5HJ2A 5CJMA 3B7GA 4MKGA 3AUAA 3LT5A 4RZXA 2HEIA 4UTNA 3WJWA 1PHPA 2GEVA 3NT2A 5D5QA 2HSWA 5F7UA 4PN7A 4JKOA 4S1NA 1ODSA 2H0AA 4LHVA 2QE7A 5AKKA 4V0LA 3D6TB 1EFRA 2H16A 4J4BA 4AICA 3AVWA 3M89A 3JWGA 5GQBA 3F7JA 1ZO8A 2PFHA 2PKEA 4QDWA 4GH3A 1IBKB 1EXBA 4FBGA 4URHA 2I4RA 4M6PA 2WLSA 4H00A 3A6DA 1JLLA 1E51A 4G1BA 5JSQA 5BWNA 1I1OA 3H1PA 3D3WB 1B3XA 2R6AA 1AH4A 2OTCA 4DWWA 2QN1A 3IIJA 4PN2A 1Y1QA 3L0IB 3ZUPA 4EB3A 5LDDC 2QPXA 2D2VA 3E7FA 2XIIA 2Z1MA 4K6MA 3EEZA 2XUPA 3ES9A 3EGOA 3OLZA 4CV3A 4WXYB 3A4IA 1Q7RA 4L0DA 4I6GA 3D3QA 4WCVA 4YHEA 2Q8PA 4D9GA 3MWYW 5JXWA 2OQHA 1XB2A 5LMUB 4YN5A 4TV9A 2DZTA 4Q7QA 2UY5A 1DTNA 3R7SA 4CLRA 4NFSA 4G5DA 3MHPA 5JHHB 1Q0TA 3PG8A 5CAEB 4RPQA 2OQYA 4FCVA 3BSWA 5F1YA 3MGBA 4H0CA 2IXAA 2P9GA 1GKKA 2Y3IA 1NMZA 2NN3C 4XBJA 5CFZA 3BCUA 1SA0A 2ZLBA 4PSAA 3LC7O 1J8DA 2FUG1 4D8WA 1OILA 3BKXA 1E9DA 7ABPA 1MAHA 5KI6A 1E5QA 1P3Y1 3K71B 1UBSB 4EAYA 5KS2A 2PS1A 4HJXA 2C8VA 4RPLA 1WZAA 1KB3A 3BV7A 1FH7A 2JBWA 4FXSA 3L6UA 4L4XA 5F7OA 3QZ6A 5AK4A 4RTJA 2A3RA 2OD2A 4MB2A 1LS1A 3RO8A 3UT0A 2PMCA 3I65A 2ZG6A 5IX8A 5DNAA 5J5DA 2ZCGA 5B55A 4AO6A 2BFNA 2J08A 2NVAA 3W2JA 3NEJA 2Q29A 3W24A 1XEXB 3HKBB 1EIZA 1ZALA 5HKBA 3R2GA 4PGFA 4QQ8A 2OCBA 2GUUA 1USVA 4NL4H 3C3MA 2ODNA 5E09A 2UYGA 1MB3A 4P2BA 1Y82A 4TLDA 3BAJA 1JHZA 1FX1A 4ZZ0A 2ZE3A 4L5JA 4OZOA 2ZJBA 1DEXA 1Q1BA 3TLQA 1S2NA 2QM8A 2GTIA 4H3KB 4QUAA 3IPCA 3EFOA 4F5YA 3F98A 4YCCA 3K9NA 1A47A 5FSEC 1GKLA 3NYZA 3Q6MA 3R44A 1Y6JA 3B1XA 4MCJA 3A36A 5IFLA 2ZRCA 3AIKA 3GEMA 3BZUA 1QCYA 5F64A 4AM8A 2GVNA 2AYXA 2WM9B 5E4FA 3LPAA 5AM0A 1UZHA 3UJEA 4KW7A 3E9MA 4CNSA 1EVJA 2VPTA 2F9LA 5F73A 5GJWC 4HLUC 2ATEA 1OZFA 1SSGA 3EQ2A 1ISMA 4KAAA 1MJNA 1SW7A 3ESRA 1ISSA 2JFEX 2EF1A 5DK4A 1X7GA 2FPYA 2YV2A 1P72A 2O14A 4KLCA 1FFWA 2XA2A 4BFTA 5AM3A 3AWDA 3DXYA 4DJEA 4YDQA 2QQFA 4LRSB 1QCZA 2BASA 1ZK1A 3PHAA 1NF3A 4J0FA 1K0UA 2X9GA 1XRSA 3KAQA 1CVRA 3G2HA 1SFRA 4QTTB 1YI1A 3UXKA 1UBLS 1KZ6A 4MQBA 4TS3A 1XUZA 3N4EA 5EPUA 7ADHA 3JQPA 1LLWA 4HJFA 5GADl 1NP7A 1P9LA 1IPFA 5KCMA 1G42A 1MFZA 3CNBA 2ZM6B 3MHFA 4H1UA 1IFXA 1VCIA 5LJLA 1MTZA 1LA2A 3EDCA 1RBAA 1I0IA 2D1SA 3EGXB 4EX7A 3GA5A 2PANA 4DLPA 1NR7A 3NQ7A 2NZLA 1XQKA 3EKGA 4A6DA 4IJUA 3T5CA 1FU8A 1ECJA 1F9EA 2JIZD 1TWIA 2DPMA 4D56A 4I36A 4FZIA 4GI2A 1EP2A 4LAOA 1Q21A 2A3BA 2MYTA 5A0FA 2Z7GA 4R7GA 4PTWA 2JZCA 4Q37A 1U63A 4XGNA 1NU5A 1R3RA 3MTIA 5J2UB 2EJTA 4XAZA 4WSJA 2XB2A 2AKMA 1OK6A 1TJRA 2QJNA 4DZIA 4NEGA 3UJ2A 2PDCA 1CZOA 2IPOA 3LPLA 1E3XA 4NE2A 3S6TA 4PC3A 1NYLA 4J0DA 4UZSA 3CRRA 2RSLA 2WV8A 4GECA 4LXIA 1CZ1A 2XINA 3EA0A 1J49A 1NYTA 1BYAA 2A14A 1Q50A 3DT8A 2DUJA 4BRZA 4CKCA 1J2TA 4BC0A 4PLWA 4Q18A 3D6FA 3U57A 3KX6A 3TJMA 3P27A 2CXHA 2XLCA 4QS6A 4C29A 1WVMA 1Q4WA 1NVKA 2GQ3A 2NZJA 2VKZG 2GJPA 3H1GA 5FXMA 1C3LA 2QTLA 1YFKA 3C2RA 3JZAA 3WD0A 1UDRA 3VVBA 3LCCA 4QLAA 1UEIA 1U1CA 4Z9AA 3EFHA 3VNKA 3KQNA 4YJFB 3AIVA 7MDHA 3UK7A 2P0YA 1MZPA 2OEPA 1YF3A 3FAXA 3G8BA 2AAMA 3SHVA 1YIOA 1YS1X 3KB2A 3BOLA 2XVAA 2UYCA 5AR1A 1ISXA 1RJ9B 2C1ZA 2RAVA 5EHIA 3OG9A 1JDSA 5ABFB 2BFFA 3DMTA 4AEEA 1XD2B 3B6EA 4FQ7A 3QUQA 3KHJA 2ZX9A 4IBOA 4B44A 3GG1A 3MO7A 2RMKA 2KX7A 1J1IA 1YO6A 2ZE0A 4I1UA 2PH5A 1W9UA 2YBUA 3FHAA 5CQ1A 5LKAA 2WMIB 3M4ZA 3NOOA 1NBMA 4H0FA 5LIKX 2ZQ0A 1BXGB 9ABPA 3OE4A 4KR3A 2ZK7A 3UAOA 1RWQA 2QD5A 1N5KA 2C4VA 3O47A 3EWDA 1ZSVA 4MGYR 1UP3A 2GTHA 2PGAA 1L4NA 5CLQA 1ZITA 3MUZ1 1K6WA 3WD1A 4Z1MD 4S05A 1ZSNA 4IGAA 3W8NA 2PPVA 5EY5A 4EUSA 2C3MA 1NLUA 1UMDB 1IY0A 1GTHA 1W17A 4BNHA 2Z2JA 5A5EA 4L9XA 5FEMA 3C7DB 1FE8A 5KYTA 3WB0A 4BMZA 3NHYA 5F33A 5FKJA 3WQDA 2HMWA 4YYZA 3LHVA 2YFKA 4Q9HA 5ALFA 1J9GA 2FR8A 1Q6QA 3T9EA 3TRIA 3C24A 4IFOA 1OB0A 4OYYA 2YY7A 3FTNA 1GZ5A 2VJPA 3B20A 3TTOA 1B93A 2A9KA 3M8KA 4TOIA 4QE3A 3IRUA 1KI3A 2Y5SA 4RDWA 4G4JA 1GG0A 1G1MA 1T8QA 3MUCA 2CLKA 4DM2A 2GO1A 1TD9A 1K2WA 2QS8A 1IATA 1EJUC 1VE9A 1CUZA 4ICCX 1L0PA 3RR2A 2QLBA 3OX1A 3EXFA 3W2TA 5KMGA 3OZVA 4K1XA 4GI9A 2WJHA 3Q9NA 1RWNA 3EXEA 3AF3A 4BQFA 4YCNA 1HTIA 2EHJA 3UMYA 1D1TA 4KQGA 1Q65A 1ME7A 1N1GA 1L5MA 4Y6OA 2C4UA 1E7QA 1KQ3A 4P7JA 4DUGA 3BLIA 1UR5A 1SM9A 1U9JA 1MUWA 1G7CA 1W1YA 2Z0IA 5IG2A 1SPXA 4XR9A 3IV9A 5C3UA 2UBPC 1QGAA 2GJXB 4IWYA 2NVBA 3JD2A 1WU7A 4MUEA 3H4GA 3IGFA 2Z6IA 3VAVA 5J4LA 4EGAA 2A2ZA 4EVQA 2O7QA 2BGQA 1L4MA 3JR7A 5F12A 5JVDF 3D8HA 3AUFA 4OG2A 2E85A 5KTPA 5EJGA 5J2TB 2XI4A 5D00A 1O0BA 3R8CA 1U7HA 3QFEA 3TM4A 5JECA 5JY1A 2A5GA 4KETA 1DRKA 4RDVA 4L65A 5KITA 1NPDA 3K70C 1E77A 1Y8QA 2X4LA 1UWVA 2Q4EA 4HXFB 2XCRB 1O4UA 1IQ8A 4WDRA 1USIA 3ELWA 2H7YA 4S3EA 4RDYA 3FUVA 4NMWA 3O3NB 4IMGA 4Y9MA 5EWMA 4CMBA 1MP0A 4CQDA 1OFTA 2Z7KA 2XVNA 4FBLA 2XSXA 2FQ1A 4J35A 1GKQA 3BHNA 1P1CA 3KKPA 3ITYA 3T5BA 3G6LA 4L64A 1EX7A 2BPOA 3QJGA 3IPXA 3NVAA 5DN1A 2Z2IA 2FN4A 1L1QA 4HVLA 2Q07A 3L4KA 4OBTA 1M2VA 3IVMA 4E2BA 2JH8A 2H06A 3LDUA 2BI8A 4AY5A 3CT2A 1PJTA 2WM0A 2DLNA 1W88A 4QE5A 2NU6A 3AB3A 2ZBPA 2VF5X 2IRWA 3LO5A 5AJHA 2X5KO 1Z7BA 3N11A 3VM5A 4MLCA 4UAVA 3G5TA 2ZI9A 4D72A 2P2DA 4G1MB 1XIGA 1H6CA 1L5WA 1RAHA 5IVHA 1WO8A 1C8XA 3EVGA 3HCFA 2E6DA 3FDFA 3JCZA 3CMCO 4W5WA 4EVRA 1P6WA 1NYRA 1PR4A 4U2FA 1EK0A 4K9KA 3FTCA 4LJYA 4YPFA 1G4AE 2WWRA 2PV7A 3BE8A 1XRJA 2HA2A 3AV0B 3NUGA 3PF3A 2KPOA 5DHAA 2AWOA 2QVHA 4B3GA 1SZNA 4HK7A 5JBFA 3NS7A 1CZKA 1P60A 1ZW6A 5E5CA 4B8ZA 1FDZA 3O8QB 1NZDA 3O9MA 3UJ3X 1JHOA 4QX4A 4JHXA 2P8JA 2Q5FA 4MH0R 1AU9A 4E08A 3WQ8A 4HNAA 4XKYA 3QBEA 3RF9A 1BU8A 2F3TA 4J2PA 5HZHA 2HMVA 4FX2A 1C4XA 4PPFA 2FETA 4US1R 4UU1A 1YS6A 4ZKDA 1J8YF 2QJGA 5FL3A 1VIMA 4MRMB 1B57A 4JTHA 3RU7A 2IYSA 4ZJPA 2F1HA 1VCVA 4D6DA 4CEHA 3SHTA 1JR1A 3SCSA 5F4XA 5CJNA 4F0SA 4MVJE 4FE7A 3ASYA 1T1JA 1JYNA 3WK6A 2FH8A 3A6PC 3S5NA 5HK8A 1BYUA 4IZIA 4CDNA 4FX5A 3Q4GA 1MX3A 4I8DA 4FZRA 4H6WA 1FIUA 2WKQA 1M7BA 1RYHA 3AXKA 1JZSA 1GR1A 3LLVA 3KP0A 2PD6A 2YOGA 1PKXA 2ZIVB 4OHUA 3NVMB 2XV1A 3ZGOA 3PDIB 1YRHA 4PBFA 2P27A 3UAYA 3AF0A 3GLGE 3GC2A 4XIFA 5AIAA 4ERIA 1SO8A 2REOA 2D2FA 3GBEA 5KYWB 2PL3A 1MIHA 8RUCA 3PE4A 2V5VA 1NJ5A 3HCWA 4U7FA 3OOJA 2CLFA 4OQEA 2W70A 1GPFA 2GUYA 1ICSA 1RTKA 4EEKA 2UUPA 5ALNA 3NTQA 1YRQA 4PNHA 5LQSA 3G23A 2ZE5A 2P2SA 5FHQA 2HWYA 3TRHA 4JUFA 3J7TA 4EW1A 2O0MA 5B2FA 1QVZA 1GORA 5ALRA 3FDZB 5ENDA 1BFNA 2VPXA 3GVWA 5TLSA 5I4IA 2WHLA 1DQUA 1JW9B 3H5LA 3R6IA 3DZDA 1OFQA 1XMIA 2L17A 2VRBA 1PSZA 1E9BA 3Q3IA 1JL3A 5ITZB 4C08A 4UBJA 4CN8A 4M89A 2J4GA 1KWKA 2H6RA 1XVUA 2FP4A 5AI0A 4HQ6A 3BAWA 3NEHA 2BR3A 2C31A 4OUDA 5IABA 1Y3AA 1OIMA 2D54A 4NJOA 3PEWA 3MW8A 4M0DA 2CWNA 4WXHA 4CL2A 1EVEA 3ECQA 2R8WA 3NI2A 2PCJA 1N78A 4I9NA 3DLHA 7REQB 4X9SA 5KU7A 3G5UA 2GESA 2YQ4A 4KXLA 3ZPXA 2P2ZA 3V1MA 3B6IA 1XA0A 5B6JA 4XPIB 3ZDEA 2CIPA 1IWOA 2UUOA 1K8YA 4X9XA 4ZSTA 1RQRA 1UPUA 3WNDA 2KS6A 4HLCA 4D9HA 4KBFA 2LDXA 3K1AB 3EX7C 4QITA 3TLEA 3B8UA 1V3JA 3HG4A 3C3PA 1QYRA 2NX2A 2JHFA 4MKRA 2W22A 2GAAA 3GEBA 3LOTA 1DPMA 4LFAB 1QBAA 1KEZA 3PFBA 2ET6A 3B1WA 1WWKA 2QW5A 4IXMA 3WIUA 1KEWA 1GTG1 2Y1CA 3BD7A 3KVVA 5BXSA 1EP3B 2YWEA 1VCGA 1ORVA 4A2CA 1U0JA 3GJ8A 4DNFA 3E5HA 4AG3A 4FNSA 3NT5A 1BHJA 4ZGBA 4UTUA 1DI0A 3OZAA 2QULA 3GUZA 3M3DA 2ZJ2A 3RMEA 3OT1A 5FTMA 5DJ5A 4L8FA 4XVEA 2WM3A 4DRXA 4B7XA 3KQSA 2OYMA 1JVSA 3W7VA 3ITEA 4RJEA 3W3AH 4YCLA 3UZWA 3AP2A 2R6ZA 2FFCA 4QASA 4FGZA 2WUEA 3VNBA 1MABA 2VSNA 4G5RA 4JQAA 4BGVA 1G5IA 1TUBB 1DWQA 3GIDA 3AJ8A 1KFCB 4O18A 1L6WA 3KOZA 5GM1A 3WA6A 1MT3A 4EG4A 3HJFA 2YDAA 4MDYA 3LL7A 4RESA 4MCIA 4DMKA 2ZRDA 1G5TA 3OHMB 4US0R 1BOOA 1XYZA 3FMVA 2YVLA 1HL2A 2VCBA 2AVDA 3KOWA 1RD6A 1YB6A 4A6EA 3D4BA 1ZPDA 4BX8A 2XCTB 2VF7A 5CFQA 4TT8A 3NPAA 3VINA 5HDQA 3OX2A 2W2LD 4C7GA 5LU8A 5ILGA 1GEEA 4YJ3A 4ZSUA 1IXPA 4B90A 4NQZA 4B6RA 1FUYB 1P8AA 4DXKA 2GYWA 3WQSB 1V11B 3L01A 2F6XA 2E9LA 3PC2A 3H0KA 2XEDA 4E0BA 2IJGX 2VX4A 2OV6A 5HGXA 4BIMA 2H2FA 1TTJA 3F4VA 4CQBA 1LNZA 3ET4A 4HPXB 3E2SA 5LQCA 2VZ9A 3W6ZA 4W5TA 1MH1A 4F5DA 2EXXA 4YAGA 5A5DA 3IMEA 2DZVA 5LQKA 2RDMA 4IDOA 4TTIA 1MJFA 4FW8A 3FA4A 5I3KA 3L4WA 4K9PA 2ZM5A 1LI4A 3NYRA 4Q1EA 2P62A 2HVOA 4FIDA 5FLYA 2QN3A 5C7OO 2BI4A 4GWGA 1XJ5A 2Z9DA 2QVLA 1XIDA 1DBQA 4PGAA 4U2ZA 1WR8A 2IZ1A 4S2BA 1T3LA 3FW1A 3MGGA 2HWXA 4E70A 1L2TA 3D7NA 1PDWA 1WQ5A 2YL2A 2BEVB 2Z04A 8XIAA 4B7UA 1M8JA 1KMCA 3R8GA 3SDSA 4GIEA 4PMYA 2IU4A 2CGEA 5AVXA 4PINA 4BO4A 5CLLA 1W6UA 4IIXA 3SOPA 4MVYA 4DA9A 5U4NA 4KJZA 3R2JA 4C43A 1OX6A 4RVSA 5EIFA 2GN2A 2WG0A 4TU1A 5G1PA 4FOOA 1E2EA 3OTHA 2VFDA 3POCA 2PZ0A 5CX1A 2A3EA 4CIDA 2RGRA 4G4SO 4KWTA 4JEUA 5CPQA 3ZWDA 1C1YA 4TXEA 4JJ4A 3GL9A 1TREA 3QNWA 5KTNA 3D46A 2FEAA 3O0TA 1US0A 1N3YA 4M1KA 4M3PA 3C7KA 1JDAA 3OBAA 3F46A 4DUGD 3SIRA 2J9RA 3K8LA 5AHIA 1T1GA 3GVCA 5KKAA 2BGSA 3T52A 3HP1A 3AIMA 1AA9A 5EMYA 3LNTA 3EA4A 3VX4A 1MEJA 4CEUC 2MINB 3OP4A 2Q3CA 1QO9A 5SV2A 1TC1A 1V6SA 2WJIA 2PDNA 3BDAA 1E1QA 5CCZA 1LLQA 5XIMA 4OFWA 1SZDA 2Q41A 1RI2A 2JBHA 2ZJ1A 1ZB5A 3BGAA 1W1A1 4EGCB 3QHPA 1RP1A 2O5CA 3TROA 3BWDD 1F7VA 1MKYA 3B38A 3L1UA 3FA5A 3TLGA 4R9OA 3S2GA 1VJ1A 1U2GC 3OZUA 1Z75A 3MDUA 1Y5LA 2VUNA 3DG6A 1GP2A 4L61A 3LYAA 3ILXA 4M3NA 4YJ2A 3QEMB 3BILA 1DUSA 1XK7A 1RM0A 5LP6C 2PAFA 3I83A 2SBTA 3RRFA 2FW7A 5BPFA 2JFWA 4HYYA 5AW4A 2POQX 1QJWA 3SY5A 2EFEB 4P86A 2GXQA 2XA9A 1FOBA 1M0EA 3CF6R 5H9VA 1U0RA 1UBGA 5E3JA 1I2DA 2FMUA 4UMDA 1G7RA 4TV5A 1XXHE 3BFVA 4G84A 2DJXA 4O8AA 3HRHA 1ITXA 2INGX 3LY5A 1F7BA 1XDDA 4OP3A 1OIXA 2ZBRA 2V0NA 1ZLPA 4K36A 4NCNA 2H1FA 4LFBB 4RJJA 5LKRA 4FK8A 3PUHA 1C30B 3A26A 4GFDA 1C81A 3AH8A 1EB8A 2BM1A 4IFIA 3W4IA 4LYQA 1SUAA 4AF6A 3S1VA 1EJ7L 3ZWWA 1M01A 3V5FA 2AEMA 4GRDA 5E1MA 4MUPA 1PR3A 5ELMA 5CLGA 3NTOA 5DM4A 1R9ZA 1I4EB 3WRXA 3WNKA 2UYQA 3I2HA 1A8IA 4R3UA 3N6HA 3LF1A 4F38A 1ZWKA 2IYNA 3NM5A 4RK4A 2ZRYA 1GNVA 2WV9A 3AT1A 3TSOA 1SUBA 3MCNA 1HV8A 1XLHA 3HGTA 2PGFA 1KDZA 2ZAOA 1AUOA 3B9OA 4AIBA 2I3GA 2RGYA 4KMRA 4HGZA 2JCVA 2G9UA 2NSLA 2P9FA 4YLGA 3IAHA 3UHJA 5K6RA 3C61A 3PWAA 4NATA 3ZG6A 3B2EA 3L0OA 3KLMX 3DL2A 5CLWA 4AYXA 4ZICA 1S01A 1B8UA 2OO7A 5EQTA 4GYYA 1BQEA 1PWLA 5HILA 1CUWA 4CLDA 3JARB 4M0UA 1ZRNA 2OR3A 5K0NA 2NO7A 3IUBA 3H97A 2J79A 5CPTA 1GNSA 3ICWA 5D8DA 5EHQA 2LE0A 2IS1A 2QTTA 5EE3A 2H5JA 5EPOA 3PZUA 1H1DA 3OSUA 4AC9A 2VVSA 1K9TA 2F8QA 6AT1A 2QL6A 3JRWA 1AKRA 1XLIA 4WN9B 3I09A 1Z4PX 2FDCA 4TWIA 4HB7A 5K51A 5AUOB 4MAFA 5SZKB 3ZU2A 1EM6A 1OT2A 5K1ZA 2I2XB 5T4EA 3CLTC 1J23A 1P1MA 2YXXA 2YDXA 1DCFA 3C3KA 4HFMA 4IIFA 4AIIA 1NPYA 3T7TA 1P39A 2Q3HA 2QWXA 4M4SA 5MKGA 1YBVA 4HWOA 1E2KA 2R4QA 4EX6A 4I4CA 2IDZA 1XD0A 1D2MA 3VDXA 4L5CA 4JLVA 5B1IA 1DRVA 4MW2A 1ARZA 1C3FA 5E2AA 3DC2A 4Y1EA 1Y0BA 2IOHA 1W44A 1SG6A 5BQXA 2WZCA 4MB3A 3EW9A 4GIYA 2E6KA 1NT4A 5FULA 2WFAA 1DEOA 1YH3A 3A6JA 1H93A 3OBKA 3MT1A 5M3BA 5I9TA 4DLNA 2PX2A 3BSGA 4O54A 2BHRA 5I9BA 2RDUA 1Z5GA 4FZJA 4J1QA 1EEXA 3AESB 4KX3A 2QGNA 2WHPB 4E09A 5KVCA 2PMBA 3IEIA 1DIOB 2A0UA 3T1VA 3N2EA 4C6RA 1NRXA 2A7NA 4HA1A 4L76A 2DSZA 2G17A 3I68A 1WCIA 3PQ4A 4JA0A 1WP6A 5LIUX 3GMIA 3G5EA 2YWRA 4H6VA 1EGMA 1IHIA 2ZQ5A 1QPBA 5EGNA 2JH3A 1CI1A 1KBLA 3EMDA 3G0GA 3NDRA 2RBGA 1R2TA 1ADDA 4G6CA 2X1IA 4LAFA 4HNNA 3T81A 4JOMA 1UC9A 4C6SA 2VP5A 1Q6ZA 4EYOA 2D2JA 2CDAA 1EFKA 1ZUAX 3JSAA 1BF2A 3G0UA 1VJDA 4KSCA 3OPVA 4D42A 1LP6A 2CL6X 3OCZA 1OF6A 5IM4A 1SSDA 2E0IA 7XIMA 1BFDA 3V5CA 3R6LA 4WX2B 3O93A 1V3LA 1CUCA 3CRNA 3LLUA 1JT2A 4CMKA 2NVUB 4YUAA 4LJ3A 2NSDA 3F8TA 3MQ2A 1QH8A 5FHRA 4ANFA 3LIPA 2ACKA 2GM9A 4LE1A 1STOA 2P68A 4MYSA 2FXVA 5TJ9A 4ZU6X 4KEZA 3DBNA 4GMKA 3UYKA 2JATA 1IEVA 1SVDA 2BC9A 1CJTC 2AN9A 4UQPA 5LXTB 3JPYA 1PYMA 4IPNB 3GE7A 4UFHA 5T26A 3B3FA 5F35A 4NXSA 5FA8A 2OBFA 1NQKA 1YZYA 2JLAA 4ROTA 4GO1A 4N5IX 1YUBA 1XTZA 4BQRA 1KAEA 1XCPA 1PTJA 3FRHA 1GHTA 1DKPA 2VF8A 2F62A 4GXRA 4JNMA 3RRJA 1XCLA 4UARA 1YXMA 1QPRA 2QE7D 2CLFB 3B40A 2G76A 4NJIA 3FRJA 1D1SA 1PWZA 1X7DA 1KP2A 3FYTA 2MYPA 5B6IA 1XF9A 3Q6IA 3W7JA 1PZXA 2IBMA 5AOAA 1M6NA 3PQFA 4ARUA 4KMQA 2OVLA 3QSRA 4JXCA 3QVTA 1NU8A 1DO8A 1NN1A 3FAWA 1IIRA 3TOXA 3G7UA 3SKVA 3CZKA 1XKXA 3EMZA 3PFIA 4XYLA 1E6KA 5AESA 5AW5A 3L6DA 5IJ0B 1NM5C 1QVAA 1VHDA 4PUEA 3VFLA 2OZLA 4IQJA 3GSMA 1A9QA 3TMAA 3TAOA 5FO0A 1W91A 1Q1QA 1B3ZA 4ZCSA 1P2DA 4PS1A 1VBMA 5BWCA 2ZDSA 4W87A 4MARA 1FF9A 1OU4A 2YYAA 2H0RA 2ZZ6A 3P61A 3MWEA 4FO4A 4HRVA 1CUUA 2ZZNA 4HU0A 1CW2B 1RPZA 2GF9A 1FWTA 3EUAA 3L4TA 3UOGA 4QARA 3EXG1 4C0JA 2HWWA 1IRXA 4L8WB 5K4GA 3V2HA 4LOIA 3C3DA 2CDBA 4I9FA 1DFGA 4MAAA 2PS3A 4M9CA 5H2ZA 2IE0A 3SYLA 2IXDA 4OBRA 4RAQA 2DKNA 2GCNA 5KSPA 1Z4KA 4QICA 4DIDA 2VJBA 1EIWA 1GVRA 3CEUA 2I17A 1PZHA 3S99A 1ZBKA 3ANUA 4J6FA 5TC4A 1LPPA 3IACA 5I7RA 3RO6A 3LA6A 1CKEA 1V7CA 1GM5A 3E0IA 1UEXC 4EG0A 3HA5A 1HYHA 5BWMA 4UPDA 2AQ8A 4TGLA 3E9RA 4AY7A 1M2FA 1EKOA 2J09A 2YR0A 3AHYA 3V3KA 5GONB 3OESA 4Z42C 3E7PA 4PSRA 1U1HA 4LNUB 1UZDA 3LQ2A 4QG8A 3O95A 3ZE6A 1PQ4A 1FRZA 4G5GA 2WWYA 4NCJA 4P4TA 1PWXA 2O0HA 1KL7A 3GDFA 5IAGA 4DF0A 4ZGWA 4XUGB 5JMTA 1XDWA 3EXIB 5IZ4A 5EQDA 1DG9A 5AI5A 3ATYA 4M1WA 3CB8A 3AX6A 3DQZA 2PAAA 2CF6A 1GCAA 1EZ4A 1P2BA 3UWZA 1QMGA 4XIGS 4K2SA 3M4JA 2BFWA 2Z2YA 1UWQA 4I5UA 1XU4A 3ITKA 4DZAA 4BO2A 2WOOA 3QW3A 4LF4B 1KVSA 1E7WA 5IT0A 4LE0A 1TEHA 3GJXC 1P6UA 4B4KA 5FJIA 2Q1YA 1FWIC 4NI5A 4W6QA 4BEBA 2ZRLA 1WBBA 1XVVA 3PFWO 1NP0A 1VP3A 3MPGA 3D8BA 3F3KA 3DI0A 4URFA 3IVAA 4BYMA 1E92A 4QLBA 5AW1A 3TOVA 3ESBA 4IQ0A 4RD4A 1A3CA 2VT2A 3O4GA 4QS5A 3SR7A 1Z83A 3LZ3A 1J33A 2C4HA 1EPVA 2VUHB 2OUIA 3S5UA 1EI9A 3DCJA 2O9JA 4MIEA 5CLFA 3EGDB 1E6ZA 1RP8A 4PYLA 4XSLA 1RKBA 5TV2A 2CETA 1ZN7A 3G6KA 1YHNA 1YNSA 7YASA 3QOXA 4I46A 1RQGA 2C99A 3PQ2A 3B9BA 4PIMA 4BRUA 2R84A 1V02E 3T3IA 3RVBA 1YA4A 2Y5JA 1KJ8A 2WK1A 1JQ5A 4KE7A 3D7KA 3WK0A 2JVIA 1A9PA 1BAPA 3V8PA 5FEZA 3VDQA 4CIBA 1NAIA 1FSSA 2BVTA 3PXEA 3ENLA 2GLXA 4GD3Q 3A6LA 4ZHQB 1JVNA 1Q0UA 1JEQA 3GU1A 4R9UC 2LBPA 2BGWA 5FPSA 1Z8FA 3G8RA 4CU6A 1Q7EA 1BGGA 3W9ZA 3N59A 4S2CA 2O1EA 1VLWA 5AZ0A 3CQIA 2ZREA 4XTRA 3CL6A 4DDWA 3L8EA 1JFRA 2XUZA 4PTLA 5AC7A 2ZEJA 2CCGA 3LCJA 2QGZA 3ED5A 2H1WA 1WZCA 2VHWA 3R7FA 3L23A 2XD9A 3UC9A 1P81A 1REQB 1J96A 2ID9A 2H6EA 4Q12A 1P1BA 3HO6A 4BCBA 3Q2KA 2GWRA 3FWNA 4OQDA 4CCCA 1W46A 3SSZA 1I51A 1I33A 4XWOA 4PRWA 4LISA 4Q7BA 1YSCA 3EPOA 1VLMA 1J07A 3PC8A 1EBHA 3KJEA 3LHTA 4DNQA 1TK9A 4GPAA 3WDHA 4L56A 3RUHA 3MUIA 1QHXA 1T1IA 2L0XA 2PS9A 3AFGA 3ICCA 2CLLA 3VYWA 5JS2A 5DTIA 2NQTA 2JEOA 1H4PA 3K70B 2CVZA 3UYIA 4JB3A 3TLLA 2FZ8A 1UUFA 2P91A 3NWBA 3ZT5A 3SLRA 3C8MA 3UO8B 3WXMA 3ER8A 1GV1A 3TO5A 4KRUA 4ACZA 1HPLA 5JG7A 1R0MA 4R1SA 4LXXA 4F2GA 2CXTA 5HEKA 1MQ9A 2IOFK 4E3VA 2O3UA 3N2TA 5LFAA 3DZ8A 5JAHA 5CXUA 3ID6C 3I12A 2XDQA 2NQ9A 3U9SA 2VDWB 4B6FA 3RUBL 2OL4A 3S47A 1IIBA 5CBIA 5FX2A 4ENUA 1ISHA 2H1SA 1SN7A 3ZIDA 4HKPA 5HPCA 1R9GA 1W0JA 2CCKA 1V6WA 3DBIA 4OX9B 1N6HA 4AXNA 2RGLA 2XMDA 2WWTA 2OGWA 3B8TA 1QV7A 1O9HA 2OOSA 2G9NA 4BNUA 1Y9EA 3U60B 1Y3DE 1U11A 1O6CA 4UOEA 5B1YA 1T4DA 5J4VA 2SHKA 3P1JA 1FDYA 4IOJA 4PQYA 4V2XA 2JLZA 4I1VA 5A2BA 1VGVA 1SBQA 3CS3A 1DAGA 2OAQ1 1Y9ZA 2O4CA 1KEVA 1S1CA 1TB3A 4D4GA 3BB3A 3VR4D 4JTEA 4UXDA 2Q5QA 3NCTA 1YE6A 1WOAA 5FO1A 1CXFA 3OPXA 5KOJB 3UMSA 3QKSA 4FFSA 4M1ZA 4DABA 2PQ0A 1TO6A 4AT1A 2PBOA 3HJZA 5LNRA 3L92A 5FIPA 3OLDA 3A6KA 5I3JA 4RIGA 3GR4A 4B34A 1JR2A 1AZTA 4QVIA 3G9XA 3TXZA 2ROQA 4OY3A 2WRZA 3W1TA 4HOYA 3KOYA 2VD8A 2ESRA 5ALDA 1E5LA 1GZ7A 5A69A 4J3FA 1X94A 3UJ6A 1Z26A 2PDHA 1TF2A 5AXBA 2GHRA 1RJFA 2OB1A 3ZWYA 4ZVUA 4YEDA 3OX3A 4K39A 4DM1A 1GGKA 4UUQA 3FB1A 5ULLA 1V37A 3PT5A 4DLUA 5FUYA 3MUEA 4FT2A 3JZIA 1RWWA 1RZMA 2QOEA 5GZ6A 4BRWA 1YBFA 5A6KA 2LR0A 2IDKA 2HD4A 3U7VA 1CNMA 1FQOA 3DV2A 1YZFA 4LDPA 4M76B 1EVKA 2PRSA 1O96B 4KUGA 1UC8A 3TZEA 5GJNA 1GPWB 4BFXA 1XHLA 4QC2A 2R62A 2Z2BA 3V9AA 4PMNA 2E4UA 1VHQA 1KBZA 5KEZA 1J8VA 2W4MA 1RFLA 3RWOA 3QKTA 4JZKA 5ERXA 2J66A 1E5NA 1D1QA 2C1IA 3KKMA 4DIUA 2VOTA 4R68A 2BP7B 1K2VN 4WXPA 3U7RA 4BO9A 2R6OA 4PGLA 2GHIA 1AKEA 4X6LA 1R50A 3FNDA 2NLOA 4GUHA 4B9YA 3I30X 2Y7EA 5CSUA 3HV8A 4L75A 4QXIA 5T91A 1G1AA 2FWJA 5TVKA 3HIJA 2VVTA 1TCMA 3C45A 2VRNA 3QTTA 4D9IA 5L51A 1O5XA 4M8KA 4D9MA 3M5PA 5CD9A 3MS4A 3NHWA 1EVZA 5L9AA 1JKXA 4WPGA 2IPFA 4M0CA 1JDNA 3ROKA 4LBRA 4TYQA 1T2DA 1ZXBA 2ZFUA 5BMOA 5C2XA 1AKMA 1W1WA 4BGIA 3G1HA 2E4AA 1WB0A 3KTDA 2AQHA 1HGYA 4Q7NA 4C3UA 3NQ8A 4LXTA 3WHIA 2AUMA 3ZGLA 3SQLA 2WMFA 3EPKA 1W2WB 4EYSA 5CT9A 2JJYA 4MI9A 1KQYA 2Z83A 1NKSA 3AERB 4UQ9A 4P5UA 4JP8A 1UR2A 1TWSA 4ZT7A 4GGPA 1J97A 1HDIA 5J5RA 1ONNA 3KZMA 1Z2PX 2ALJA 1BJTA 3SI9A 5DGCA 2WD9A 4R1TA 1NW3A 5JHGB 5FF4A 1NQWA 4TTGA 2AG6A 1RC8A 3OUUA 5DCLA 1U7DA 3GLHA 3WYEA 3VU2A 4GVHA 1QWSA 2HJVA 3GEHA 2EV9A 3EOSA 3KPWA 3EDRA 1QOXA 4N3AA 1RBZA 1MO4A 4FDUA 4CW7A 1I24A 1L3CA 1UD6A 4HSOA 4JP5A 2RHWA 3T06B 3A0UA 2JANA 4M54A 1VL2A 2YZKA 3VIHA 4WKHA 3WKZA 5EWMB 3A21A 1EGVB 4BECA 5DO8A 4V24A 2QAIA 1T2NA 2G5GX 1LXCA 1Z5PA 2OGUA 2WNNA 2VNJA 3W7GA 1ENYA 1A9RA 3COVA 1NDUA 4OH7A 1Z69A 4KCTA 1XYGA 1FFDA 4Q4SA 4BLVA 4CCZA 1KZGB 4KDRA 1Y7VA 2J3EA 4R2HA 2PSSA 1QVVA 3ZNPA 4H1HA 1BD4A 1CX9B 2P65A 5C3MA 4NE7A 1QO5A 8MHTA 3T0TA 1YC5A 1SHLA 1L5NA 5IU6A 3UW6A 5CT6A 1FWEC 3VGPA 4Y9OA 3RG6A 4QUJA 2QTRA 5AFDA 2J0UA 1SXHA 3JSXA 4PTNA 2CKDA 2CBUA 2OFWA 3UNDA 2HIMA 3W2UA 4LBZA 2C2WA 3QOYA 1P1IA 4EO4A 4Y6RA 4NNAA 2W27A 4EI7A 5LLTA 2DFVA 4UAUA 3WL3A 3PEYA 1YTKA 2ISCA 5BNTA 5EP4A 4R8VA 3MERA 3F6PA 4QYIB 1BQ3A 5AJTA 3WWCA 1Y8RB 4NNCA 2W48A 4IS2A 3TIFA 4DBVO 2WSYB 4OAOA 3LQ4A 1JYWA 2OHVA 4WXZA 3NZQA 3CLSC 2C13A 1H22A 3EBVA 4P2VA 3Q7TA 4R9NA 5D9OA 2VEFA 2C2MA 2ORIA 3HWWA 3TMKA 3E3LA 4Z2JA 1G4TA 1X6LA 2WUWE 4O13A 1W581 2QQ0A 3QOFA 4IIDA 2Z5GA 5HX7A 2R8RA 3RT7A 4HQRA 1XVIA 2CEKA 2FEKA 3REGA 5M2QA 4RULA 2BR4A 1XDJA 3OTIA 1ZBDA 3OJCA 1RALA 2NO1A 5HCNA 4DMFA 4GL4A 4G37A 4HBGA 1G98A 1WDKA 2D5CA 3LKVA 3U4QB 2PTXA 3VSBA 3WJZA 4A3SA 4R81A 3DEYX 1BD3A 4EUEA 4WLVA 4XW2A 3R12A 3ARXA 3FXAA 4P1ZA 4YJ5A 1QUMA 4WA8A 2NVOA 2HS8A 3WQGA 1EHYA 1F8XA 1YOVB 1EDDA 3LCLA 1T5DX 1OFAA 2PHZA 4KFRA 4RF5A 1ONWA 3NASA 3R3WA 3E0LA 1UZLA 5BVGA 4IG2A 1U4SA 4KGDA 3MA0A 4DXVA 2W2VA 4QBGB 3I6TA 4CNBA 3FGPA 3JQ9C 4D3YA 3WR5A 1O9BA 2HWUA 1YS4A 3CWHA 4TYMA 3AJXA 3ND8A 3EIWA 1I4TD 2VHVA 4MPPA 4GXMA 1CJCA 3LMKA 5TIIA 1CUDA 4V3BA 4BMSA 2OK7A 1WXDA 2A4MA 4IWWA 5FUQA 4BN5A 4JJ6A 4WVXA 4KWOA 1XYMA 3S2FA 1YTUA 2O2ZA 1E32A 1E9FA 3V55A 2Y8KA 3TQ0A 3QH2A 2C18A 2BV3A 3O1NA 2QUBA 1MG5A 2W90A 3K09A 1SY7A 2X7XA 2P53A 1WO2A 3MLAA 5J5AA 3AZOA 3QWFA 3S70A 1FTYA 1F8IA 3R0KA 3H3XA 1TPZA 3RANA 2BJWA 1YZKA 3CT7A 5BN3A 2XBLA 3CEAA 2ZA2A 3WDJA 4K0KB 3D3WA 2B7CA 2G6TA 2FEOA 3Q85A 1MF7A 4MNKA 4JIGA 4ZK2A 1OINA 2BVDA 4LZWA 1OLXA 1RCQA 2D5AA 3NANA 2OGZA 3BMCB 1Y3CE 4XVHA 3QZEA 1N8SA 1RYYA 3W2LA 1NF9A 3ZK8A 3IEVA 1PJQA 3OJFA 1QAMA 3ESDA 7PTDA 1W0CA 3FPLA 1ZM9A 4LV6A 1QE5A 4DAIA 1Z0IA 2XUFA 2CUKA 1XZHA 2I4NA 2Z2XA 4FDMA 7REQA 3L40A 2AYYA 1EWTA 3KK0A 2OG1A 5BV8A 4E4RA 3HJUA 4IGMA 1EAMA 1N8NA 3CLHA 2G6BA 4HP8A 3LHWA 2PX6A 3WUEA 5TE9A 2AJBA 2WVVA 3GOQA 5JSZA 1XJBA 3ZLUA 5FRDA 1QJ4A 5CUQA 1RYEA 1FWDC 1Q0QA 2W2QA 3GRYA 2GR9A 1EIXA 2X8LA 3TDKA 3EPPA 4M46A 3RK1A 1JG2A 3ET5A 1DXQA 4X41A 4AJNA 1UBSA 2XYRA 1DHKA 1EB9A 3WAKA 2PQ2A 1KXVA 2Y0BA 4DLAA 2QQGA 3N73A 3NJ3A 1TIWA 4M1RA 3OHMA 1JLSA 1PFUA 4F8YA 5MN6A 3M9XA 1F6WA 1ORDA 3ZO9A 3BKWA 5E9AA 5G0VA 1SCBA 5K4HA 1C3XA 2V2DA 1L3BA 3MIZA 1ECGA 1FDJA 3BJFA 3OYZA 5TGZA 3DL7A 1T13A 2A6LA 3G8EA 1C50A 1MV8A 4C6CA 1P1JA 1BE0A 2VP4A 4LC9A 4MJ4A 2W7TA 1QI2A 2L18A 2Q6ZA 3R89A 3M6FA 1DJLA 4D4IA 1WDDA 5F1UA 5KX5F 3WLMA 1RXSA 4I4NA 1RWKA 1U02A 2AFHE 3RVNA 4Q15A 4ASUD 2J3DA 1ZU5A 3ELYA 1NY5A 4EW3A 1VPLA 2HXGA 4XA8A 4DYEA 3FVQA 1GZ6A 4E2WA 3EZ9A 3CTLA 5E6UB 3T0BA 3LC1O 4GZ6A 1R6TA 5I3HA 3FF4A 3TSMA 4HCDA 1R3WA 1V4NA 1R6BX 2GMWA 4KPFC 1E3IA 1NNI1 4RFSB 4LOLA 3QFHA 3V6MA 1PVDA 5HKKD 4KODA 2VATA 5IHSA 1DBRA 4OPMA 1YBMA 2R48A 4LWWA 2ILVA 3CM0A 4RJLA 3WF2A 1V11A 2YXEA 1WDQA 1DCKA 5DF0A 4C7MA 2OTDA 4IMCA 3O3MB 1C8VB 1VC2A 2ZXUA 1EP1B 4NYIR 3WB9A 5LA6F 4KN6A 3UJSA 3RV3A 2WOQA 5JQ9A 1ZKMA 2JH9A 3O5AA 1T6ZA 3WJ2A 5BQPA 4LI3X 3R40A 5CJ5A 2FVKA 3PX2A 1L4EA 2LIPA 3FR8A 5BUZA 4YUYA 3ZXUB 1KMHA 3CHCA 2QAFA 1GZSA 1SVKA 4MCHA 1O89A 4KQMA 3G2PA 1GQKA 5ALXA 2FUNB 3NAVA 4KFSA 1O97D 2IKJA 4XQ0A 1N2SA 3NHZA 4C7BA 4Z3KA 3BAFA 1Y48E 3FPJA 2HQBA 3PJDA 3KXIA 1A80A 4LZAA 8OHMA 4I8XA 4N9EA 5IM5A 3LWZA 1GU7A 2HZBA 4KXWA 3O7UA 4CN4A 1T15A 4OEHA 1MW2A 3GQBA 3OMXA 3GP3A 4ZEVA 5DIFA 5HJLA 3WQHA 5CCBA 2XGBA 3OC6A 4NMLA 5D3QA 2GN1A 5KO2A 4L78A 2PX0A 2FY8A 3GBVA 1XCWA 3DBHA 2PRJA 3ZD8A 4GYFA 5LIWX 4I6VA 1M6VB 4ZRDA 2VEOA 1OK4A 2AN4A 3TDNA 3PUVA 2IV2X 2A67A 3LW8A 3CNHA 1GZHB 3DWIA 2ZJYA 4L85A 2E6UX 2AFHA 1G0OA 2R1VB 4DGQA 2C77A 3UKDA 3EODA 2NT4A 3GXNA 1NRIA 3KBMA 3B70A 4L1XA 2EBUA 4A8PA 4EQZA 3NATA 2Q0QA 3GCDA 3FX4A 2XCSB 2JZNA 1N2XA 2YZGA 2EKPA 4LSGA 3CHDA 2Z5FA 4CD8A 3G0HA 3HG5A 5JCOA 4U2YA 1NI5A 4OM7A 3NXLA 1CUYA 4DJEC 4W89A 1Y8CA 5B80A 3DFZA 1ENUA 4BDTA 1OLOA 1BTOA 4CVUA 3OKAA 5AK0A 1UAAA 1X7WA 1UBHS 4FGSA 3D6VA 1ZONA 2VPWA 1EK6A 1YS9A 4C3VA 2ZX5A 1J0HA 2O4MA 1ND5A 9GPBA 3UB4A 3DA8A 2CLHA 2TRSB 4GP9A 4ACBA 2K2QB 1TDJA 4X1IB 2OCYC 4TWBA 2AGTA 4DLXA 2IGBA 4MQLA 1PK7A 2WJ6A 4Q03A 3SEFA 2NP7A 1JVBA 4BX9A 5BQFA 3O8RA 3ZWQA 1JBQA 1TFUA 4Q9JA 1D7FA 3PQ3A 2F9MA 3WRYA 3F5KA 1CD5A 4BJ6A 4WERA 1GV0A 2ZITA 1E1KA 2ADMA 3AFNA 4IJWA 4LTDA 2DUWA 3L43A 1S5PA 4DUOA 1Q0HA 1R6AA 1A49A 1QKJA 4DM7A 3WFLA 4MB4A 2PQMA 4A8LA 1MG0A 4MO2A 3OIVA 3VYRB 4EJ2A 1QHEA 4Q1CA 1TV7A 4H4EA 4K8HA 5E6ZA