5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
4RTNA 1XLDA 3LMZA 3UXIA 4AX8A 4QEHA 4CKCA 5CUQA 4YV0A 3O4FA 5K0JA 3VYWA 4DM3A 3OE5A 3LDFA 5CVDA 2FHPA 2QULA 2CL5A 1G38A 1QYRA 1ZHFA 3DLCA 3F4KA 2ZZMA 1HNNA 5CVEA 3FTFA 1RI2A 2PX2A 1L3IA 5EOVA 4EMSA 3JWGA 3M0VA 2NYUA 3G7UA 4HH4A 5E2AA 3KQVA 1ZGAA 1TZ9A 2FPOA 3GJYA 2C7OA 4FSDA 3SXJA 2I6GA 4RVHA 1XDZA 3EVGA 3BWWA 1P91A 3BDKA 1KXZA 3SGLA 5ICGA 3EMDA 2GYIA 5E1MA 2GLUA 2WA1A 4C4AA 2ZBPA 3CCFA 3HA3A 3HEMA 4GOOD 3KU1A 4O29A 1YZHA 2PXAA 3IUIA 3HCCA 3DMHA 3TM4A 3EEOA 3MB5A 2YUIA 1OADA 2G72A 4DQ0A 5DSXA 1Q0TA 4LWPA 3TOSA 2BH2A 1ORIA 4PYQA 5ICFA 1ZQ9A 4BLUA 3BUSA 5DRYA 4E2ZA 4YUXA 5HIKA 4CKEA 2IH4A 2IGTA 1XIJA 5LQKA 1L3CA 3KPYA 3CJRA 4U7PB 3LKZA 2UZ4A 2I57A 1RJGA 4BP3A 2AVNA 3HVKA 3BZGA 1R8XA 2AZTA 2DULA 3FZGA 3HCEA 3P8ZA 5C1IA 4EK9A 3KBWA 9XIMA 3GRVA 2X7VA 5HILA 3EGVA 4CKBA 1X1AA 4E70A 1YX1A 1XYAA 5E8JA 1U2ZA 5DX1A 2O07A 3KBMA 2PX8A 4PYKA 4Z2YA 3CQKA 2YXEA 3MTIA 1SQGA 1VPTA 4PCAA 2EJTA 1BXCA 3SSMA 2Z6UA 3M6UA 4LG1A 4RTQA 2JH9A 4QPPA 9MHTA 4IKPA 3NW9A 2HK0A 1B42A 1XLBA 3GNLA 3HVHA 1XIHA 4ZTBA 3M33A 1INLA 4XSLA 2G70A 3M4XA 3CQJA 3PX2A 1BOOA 4X60A 3R9XB 3UVAA 4IV0A 1EJ0A 2DPMA 2IBTA 4ER6A 1YF3A 2YX1A 4ISCA 4E2WA 1TPYA 5LQJA 3PFHA 2ORED 3BWCA 5CCXA 3AAMA 3L8DA 2PSSA 1FBNA 2PJDA 4P7KA 3QXBA 5HOQA 2N47A 4L7VA 4KW7A 4M37A 1XLLA 1WZNA 3UFBA 2JG3A 5XINA 4GJJA 5GM2A 1TW3A 3I9FA 3ELWA 2Z6AA 2GS9A 4PYNA 4PFHA 5JUWA 2AOXA 3C3YA 5J8LA 1ZG3A 3PVCA 4OQEA 5H02A 3FTEA 2FYTA 1X1DA 3G89A 2HK1A 4WVLA 4HGXA 1KPHA 2AN5A 1P1BA 1XYBA 2P7HA 5FQNA 5DLYA 5F2KA 4RTSA 3XIMA 1EAMA 1QZZA 2J6VA 1YZ3A 2ZFUA 3B7PA 3SSNA 3THRA 3LSTA 3ER9A 1NW3A 3CKKA 5DRTA 1X19A 2Z6QA 3G8BA 3ITOA 2CKDA 4XIAA 3FUTA 3G5TA 4YTTA 3GRYA 1XIDA 3FVMA 1RJDA 4BLVA 2PBFA 3FTCA 3KQTA 3L23A 4RWZA 3TKAA 1EG2A 2HNKA 1SUIA 3Q87B 1NV9A 3LKDA 2PX4A 2HCVA 2B9EA 2YQZA 4MTLA 3G2PA 4RSRA 3B3FA 3NMUF 3IYLW 3KBVA 7MHTA 3KQMA 3V8VA 2YXLA 4FZVA 3IHTA 4K6MA 5CIYA 2LD4A 5FA8A 5GWXA 1V39A 2GH1A 2AOWA 5XIAA 2K4MA 3DR5A 3FPEA 2HV9A 1EJ6A 2YTZA 2O06A 1JR4A 3LBYA 1DIDA 4A8LA 3EGEA 1DCTA 3M0LA 1QAQA 1MJFA 1UWVA 3VNKA 2I7CA 2NXCA 3NWBA 1NW6A 5EZQA 4GF5A 2BM8A 3HA5A 4YTQA 4R8RA 5FWAA 5LQRA 3VNMA 5EC8A 5I7GA 5IH3A 1A0DA 1XIGA 2QUNA 4Q7IA 2CWWA 3FPFA 4QDPA 1K77A 4F84A 4MIKA 3DX5A 1EQAA 4DUOA 4HC4A 5DXAA 2PT9A 4WXHA 10MHA 2P1DA 2EFJA 4XUDA 5K0GA 4C03A 1UIRA 5LQUA 2WA2A 2QM3A 3UJ8A 3HVIA 4OBWA 4C04A 3FPHA 3ELDA 4BLWA 5M5BA 3C0QA 2C7QA 2ZBRA 3FRHA 5H1WA 1I6NA 2P35A 3MERA 2P40A 1R00A 2IBSA 5HIMA 2QY6A 4P58A 2I9KA 4YTUA 1RJFA 5K01A 3JWIA 3VYLA 3OU6A 4J4KA 4P7JA 3GXOA 2AR0A 1RI5A 3KCLA 3NDIA 1O9GA 1QT1A 1DL5A 1I1NA 1JQ3A 3HCBA 3OCJA 1G60A 4PIPA 5DTRA 3PFGA 3P6LA 4ER0A 4RTMA 4AZWA 1PJZA 3EVCA 3P9KA 5K09A 4A6DA 5E8RA 3TQSA 3VC1A 5EMLA 1G8AA 2BR5A 5B80A 2PWYA 2Q41A 2VS1A 3CC8A 2NP7A 1NKVA 5DM4A 2BR3A 3AWIA 5LQNA 4HSGA 1XYCA 5C9ZA 3KBSA 4ZB2A 2PT6A 3CJQA 3OU7A 3P9NA 4V0RA 2P8JA 3HCAA 3M6VA 4F85A 3XISA 2AS0A 4V0QA 5KVAA 5MHTA 1XINA 1XLJA 2ONZA 3FUWA 4KW2A 3OE4A 2FRXA 2ZVJA 1VL5A 2IPXA 4POOA 3U3HA 2JJQA 3DXXA 5EKUA 2ZTHA 5C0OE 3EVDA 3NVKI 3C0LA 1A0EA 3AJDA 3AXTA 3DUWA 3EGIA 3LL7A 1DE6A 3SM3A 1YFLA 4DVOA 4OQDA 3EVFA 2P41A 3DH0A 2QRVB 2ESRA 3VNJA 2GB4A 5HFJA 3M70A 3NVMB 1NV8A 4AZVA 5DSTA 2G4JA 2C7PA 2XBMA 4X41A 1FP2A 1XICA 1R74A 2I62A 4KWCA 3UA3A 1O1HA 2YR0A 4QEEA 5FULA 3B89A 4F86A 4GQBA 2PKWA 3MCTA 5F2NA 4KIGA 3BGVA 4PGLA 4FR0A 4RTJA 1FJXA 1XIIA 4OVXA 3EPPA 1QUMA 5ICEA 4RYLA 3FPJA 3OPNA 2BM9A 3OZSA 1NBHA 5CVJA 6XIAA 3UZUA 4LECA 4PYMA 4PNEA 4YUYA 2FK8A 2G71A 3G2OA 3RIEA 1H1DA 1PRYA 3B5IA 2AOTA 3A7DA 4YTRA 1JQEA 2AOUB 1D8WA 3R24A 4YV2A 4EAYA 3BWYA 5FUBA 3E05A 3TVAA 1ORHA 5EMMA 3LGAA 3UBTA 3BWBA 3C6MA 4ZB0A 1JTEA 2VDUE 3EVEA 2O0LA 5E1OA 5FTWA 5K0NA 3TLJA 4X63A 3AYVA 1X1BA 2ZZNA 2UYHA 2ERCA 1AQIA 1R8YA 3BGDA 3DTNA 5DTQA 3NDJA 4XUEA 3IV6A 5CCBA 2F8LA 2PVCA 1KPIA 2EJUA 1Z3CA 3A25A 1DE5A 5HEKA 3KCJA 4M38A 4OX9Y 1S5NA 5K05A 4E2XA 8XIMA 2NP6A 5CVVA 4E32A 1AQJA 2GA9A 3I64A 3S68A 2G0WA 1KYWA 3CVOA 3ME5A 3CQHA 1VLMA 4ATNA 4RTPA 1XP3A 5ICCA 2Y1XA 1NBIA 3R6TA 1I60A 1BKYA 1XTPA 1I9GA 1KIAA 3M6WA 1VP3A 5E2BA 5EHIA 1XLIA 4E31A 4PGHA 3QC0A 4QE5A 1NW8A 2VP3A 3HVJA 4PCLA 7XIMA 1R6AA 3KPWA 4GOMD 3SVZA 2WK1A 3U0HA 1TW2A 1WY7A 1NW5A 2P3LA 2PV0A 2UYOA 3G2QA 3LDGA 3V97A 5FA5A 2XVMA 1AV6A 2NQJA 4FGZA 5FADA 1MHTA 4BY9E 3IUDA 5U4XA 1RI4A 2UYCA 1SKMA 2PXXA 4DCMA 4EKGA 4QVGA 2PY6A 3GWZA 3UWPA 4P7FA 3C3PA 1DXIA 5FHRA 1G6Q1 4H0NA 4B17A 2JHPA 3CWHA 5BXYA 5T67A 4OA5A 2P7IA 1SQFA 3ELYA 3G88A 4CXMA 3ITVA 2FCAA 3KR0A 3MCZA 5D1HA 5DT2A 3PLAE 3MQ2A 1XLAA 3IUHA 1IXKA 1N7JA 2FK7A 4C08A 3D2LA 3ORHA 2NQHA 5E9WA 1DIEA 2PX5A 3BXOA 4QDWA 1L1EA 8XIAA 4PONA 3OFKA 3LCUA 4EACA 1JTFA 9XIAA 4GLEA 2AOTB 2CMHA 4LNCA 2OKCA 2PLWA 3BKWA 3TRKA 5CD1A 4G56A 2ZWAA 5T6BA 4DZRA 4YUZA 4MQ4A 4DA4A 5HIJA 5EHGA 3UJ7A 1JSZA 1CLKA 2ZLBA 3GRRA 2BZGA 3ID6C 3SSOA 2AOUA 1M6EX 5D1NA 3UJCA 3PTAA 3GU3A 2A14A 5FQOA 3WSTA 4C05A 1NW7A 3DMGA 1NE2A 3KR1A 3BKXA 3KQPA 1QANA 4KDCA 4A8NA 5E1BA 5BP7A 5LR6A 1M6YA 3P9CA 3UJAA 3LCCA 2Q02A 3THSA 4FSXA 3HA7A 1XIFA 5EG5A 2H1RA 3G2MA 1XDSA 4RTKA 5JR3A 2OB2A 2R3SA 1RJEA 3CGGA 4E2YA 3TKYA 4PYIA 2UYQA 4GOND 3P2IA 3A7EA 3IEIA 3QV2A 1QTWA 2IP2A 2ZBQA 4QQNA 1Y8CA 3EVBA 4YMGA 1XISA 2B25A 2ADMA 2ZSUA 3NWEA 4R05A 4RVDA 3REOA 3SR4A 2OU4A 5B1SA 5GM1A 5DTMA 3AYTA 2PGXA 5K8VA 3EEYA 5HIIA 4E3VA 2ZDSA 3ANXA 3K0BA 3QZAA 4CTJA 2OZVA 1IM8A 1D2HA 1VE3A 3QYSA 1P39A 2P3OA 2VDVE 3G8AA 3DXZA 2OBFA 3A4TA 2NXNA 3MTEA 2PXCA 1SG9A 2QE6A 3PT9A 3QOWA 3KBNA 4C07A 4OBXA 2I56A 5DM2A 4YUWA 3JWHA 3NJRA 2ZCJA 5DX0A 5EPEA 3KQYA 4QTTB 3T7SA 1XLKA 4DF3A 1KR5A 1WXWA 2ZULA 2ZZKA 3P97A 3R0QA 2HMYB 4FT4A 4NECA 4QVKA 2AVDA 5K0BA 3FUUA 1MUWA 3DULA 3FYCA 3BGIA 3KKZA 5K03A 1AF7A 3E7PA 3MHTA 2JHCA 8MHTA 3UA4A 2V74B 4K3ZA 1NT2A 1GW9A 4M36A 3DP7A 3GRUA 3LECA 4YV1A 4YTSA 3KHKA 5K0LA 3XINA 1FPQA 3O31A 5TNVA 2IDKA 3RODA 3A26A 4PYOA 1VBFA 1KHHA 1I4WA 4DCGA 3X0DA 4QE4A 5XIMA 4GOLD 3JU2A 4LWOA 4FT2A 5E1DA 5E9QA 1XVAA 5CM2Z 3AY0A 4YUVA 3HM2A 4FS8A 3SMQA 2ZIEA 1SUSA 1JG1A 1Q0SA 2ZWVA 3NTVA 3OZRA 5CVUA 3SX0A 4AUKA 4HTFB 5EQJB 5FCDA 5DX8A 2OB1A 4U7TB 3UJBA 3VC2A 4C06A 1DUSA 6XIMA 3Q7EA 1RI1A 1SVUA 1X1CA 3OFJA 3PB3A 3QOXA 3E8SA 4R8SA 2NQ9A 3GRZA 3DMFA 4ZB5A 2AOVA 2OPBA 3KTCA 4HTFA 3TFWA 3P9IA 1WG8A 4RX1A 2BR4A 3BWMA 1YB2A 2XINA 3KR9A 1JG3A 3M0XA 3PX3A 3HCFA 4P7GA 2ONYA 5EZSA 2HR1A 2GLKA 4Y2HA 5E9JA 4PYJA 3GNXA 3TC3A 2AN4A 2QYOA 2XVAA 2NXJA 4KVZA 4XIMA 1VQ1A 4IV8A 5BW4A 1M0EA 3LX6A 3KQOA 1XIEA 4HHLA 4GUAA 1XLEA 3U81A 4ER7A 1BC5A 1YUBA 1D2GA 4QQKA 2G8NA 3C6KA 3I58A 1VP9A 4OA8A 1BXBA 3ITXA 1JG2A 4AZTA 2ZIGA 3DXYA 4CTKA 2YVLA 5G02A 3KR2A 2Y1WA 3I53A 4X61A 3ITYA 3P71T 5EEGA 3ITTA 2O05A 1XYMA 3ERCA 1OR8A 5GOZA 4PINA 3DOUA 3GIWA 4US6A 2XIMA 3AALA 1XXLA 1BHJA 4YMHA 3VNIA 1HMYA 2IIPA 3EMBA 4FP9A 4RVFA 4RTOA 1A0CA 4QDJA 3M6XA 4E30A 4QTUB 5KQSA 2H00A 3T7TA 4RTLA 5GINE 1N2XA 5EGSA 1IY9A 2GPYA 2O57A 3MAGA 4ER5A 3JWJA 1KPGA 4AZSA 3LCVB 3UU0A 4A8IA 4HGZA 5H6HA 3O7WA 4RTRA 2HTEA 4JXJA 1KP9A 3LBFA 4GC5A 4R6WA 3M0MA 5K0FA 2NNWB 2EX4A 1XLHA 4PGGA 1EIZA 3TPZA 3BZJA 2ZVRA 3C0KA 4PIMA 5DPMA 3B3GA 4UOEA 3P2KA 1XJ5A 3GCZA 1XCLA 4QE1A 4M7RA 5EIFA 2QRVA 4HG2A 5GP1A 4GC9A 5FHQA 2IH2A 3KQWA 4KRGA 5P8WA 4R6XA 4HHMA 1WXXA 1ZGJA 1O54A 4HRAA 1XCJA 4X1OA 4A8RA 3K6RA 2OXTA 2G1PA 4EKIA 2HWKA 2R6ZA 3GDHA 5B7YA 5ERGB 4DKJA 4E33A 2PWPA 3NGFA 3HNRA 4RV9A 5KS2A 3FPGA 4XSMA 1UFKA 1N7IA 3TM5A 3T0IA 4KIFA 3UJ6A 2XISA 2P3QA 3M0YA 1ZKDA 3CJTA 3B3JA 2IFTA 4MWZA 5F2OA 3TR6A 5KYGA 3AXSA 1F3LA 1XYLA 1O9HA 2JHAA 3GO4A 2QW5A 3DBNA 4XKMA 5AVNA 3EVZA 2B2CA 3H2BA 3KQSA 3OBEA 3DLIA 2VDWA 4XUCA 3UJDA 5GIPE 4BP1A 5DXJA 1G55A 2ZW9A 4XISA 1T43A 2CMGA 4GBED 2V7EA 3WQOA 4HGYA 2GVEA 4EVIA 2IH5A 1D2CA 3BT7A 3M0HA 5EMJA 1VIDA 2ZIFA 1XLGA 4IWNA 3LPMA 5T64A 4PYLA 5K0EA 2GUBA 3CQIA 3HCDA 5DM0A 1S5MA 2B3TA 4A6EA 5KQRA 3T7RA 2VZ9A 3OZTA 4GJIA 5EIWA 2QUMA 4MHTA 1FP1D 2B78A 2OYRA 3KCOA 3KPJA 2IDJA 3MGGA 3LHDA 4GEKA 4CWAA 3N4AA 3KWSA 2XYQA 3KPUA 1L3BA 3FRIA 4QDKA 4ZBCA 5LQAA 3ELUA 5LQCA 5AVHA 4QPNA 3PS9A 3VSEA 5BW5A 1R18A 3CBGA 5EMKA 5DM1A 1QAMA 2XYRA 3RW9A 4DMGA 3VNLA 3FTDA 3TMAA 1QAOA 1XDUA 1P1CA 3P14A 1L9KA 1F38A 2C7RA 2OY0A 1JQDA 1RI3A 3A27A 3BZBA 4ER3A 1YFJA 3KQQA 1MNZA 3ER8A 1JSXA 4HNOA 1WS6A 4RVGA 3KBJA 5EVJA 3C0SA 5B7ZA 5EKXA 1XIMA 3CNYA 3BANA 3EVAA 2H11A 3HP7A 5IKMA 5K0CA 3FUVA 2EG5A 1XIBA 3E23A 4W4QA 4XCXA 5LSAA 4EQZA 5EEHA 3FUXA 4Y30A 2JH8A 3KPVA 4PWYA 1XLFA 4K1GA 1G8SA 3OU2A 5HZMA 1XLCA 5DWQA 2KW5A 2NXEA 3FYDA 3GGDA 2E5WA 3ITLA 5FWDA 2OO3A 3G5LA 2YXDA 3LDUA 1JG4A 3HTXA 2XYVA 3P2EA 2GAFA 2AN3A 1KYZA 4KDRA 2X7WA 3R3HA 3I5UA 1XLMA 5GIOE 3UJ9A
chains in the Genus database with same CATH superfamily
3FV9A 4G4IA 1F07A 1W48A 1GHSA 1WEHA 2ZZMA 3F71A 1KAEA 3HM9A 1ZUHA 2QUZA 1SZDA 1D4FA 1SO8A 4DMRA 1N7GA 3ZWCA 4QISA 4TT8A 2BTMA 1GYLA 4R27A 2V97A 4PV7A 4WQMA 3QY6A 4UC5A 1QQBA 3L0KA 1OF6A 4U7PB 4NATA 3WDPP 3QXHA 3KDNA 4MV9A 1A50B 2NSXA 2HV5A 3NFRA 4DV2B 4N0RA 1FF9A 4ECLA 5AM4A 3A9TA 3FM9A 2DJIA 3GL9A 4NF7A 1FFHA 3HJBA 3WOVA 3W0KA 1UBHS 4QBGB 2G70A 3F47A 4TT3D 2O8FB 4FXPA 1I24A 3PFWO 4C4PA 1GVOA 3E7WA 4E2WA 3WKDA 1RLIA 5TGDA 5AKJA 4G1MB 2IY8A 3K4HA 2IV3A 4RACA 4RM2A 4EYSA 1X9GA 5SY6A 4BZQA 1M2KA 3LTSA 5M34A 5TPWB 2WVJA 4E1BA 3C3UA 3OP1A 1I3CA 4UQAA 3I4LA 1HK7A 2ATXA 5IBPA 3S2JA 3T0FA 1LOLA 3PBGA 4B6PA 4B92A 3GY1A 4MPJA 1QNRA 1V48A 1A1VA 3HJAA 5DNWA 4JN6A 3EULA 2BDQA 2QD3A 2ANCA 3EYPA 2YCKX 4D3XA 2NQLA 5AVJA 4BP8A 1YZVA 3GMDA 3S1XA 4MPQA 1NONA 3W6PA 4KGLA 1ZW6A 3KAPA 4ZQMA 1XMOB 3FJYA 2OP1A 4S0ZA 5EMLA 1YDEA 1FP6A 1G2OA 4O2BF 1VC4A 3HY6A 3CUYA 4PNPA 1Z56C 1DARA 1RA5A 3QTTA 4AD0A 2CDBA 1E2PA 4FOLA 5C4IA 4C14A 3I2HA 1ZQ5A 3B12A 3WJAA 1XRPA 1PF7E 2XOXA 4PRLA 5JOQA 3UW6A 2XH7A 1NBHA 4KEMA 1JQLB 3AZQA 3C14C 3IOCA 1LRKA 1Z38A 1ZPTA 1P4CA 2CXOA 4B3IA 1YOBA 3NSXA 5I7FA 4RIEA 5H80A 2KPOA 2W5UA 4OL9A 4Y6RA 1VOTA 4MVXA 3CEHA 4KVAA 4WY0F 3OYXA 2A59A 1Y5RA 2WR8A 3PQ8A 3IP8A 3I9NA 3W38A 4XVCA 1CX9B 5HANA 2QUIA 5BUSA 1TMHA 2DSUA 1G7RA 2Y8UA 1DX4A 1E6PA 3DWEX 4FXSA 4QKQA 4G56A 2YCJA 1NI5A 3EZ7A 2VJDA 2ISSA 4K40A 4JC0A 5AHXA 1KH3A 5JRZA 4MB1A 1BXKA 4BO9A 5TS2A 1TRHA 1NJ6A 2GYYA 2QM8A 3MF4A 2F1RA 2BRUA 1DMSA 4JS3A 1F8YA 4GNKA 2O6LA 3UCQA 2C13A 5EBAA 4E3TA 1RUSA 2QTBA 1M34E 4YCAA 2XA1A 3A4VA 4MYAA 1Z69A 2OD9A 3HU7A 1IK4A 3V1TC 4UBLA 4KF1A 5JCOC 2R4QA 3PNVA 4P5UA 3ITCA 2XEDA 3KQNA 1VDZA 1RXIA 1ZUD1 4NJMB 4JC4A 2BR4A 2QJOA 1ZFNA 1JAKA 3BLKA 1JU3A 4Q39A 3VC5A 1U8EA 1NXPA 1RVKA 5BSUA 2BXYA 3EDDA 3H5IA 4D96A 1G3UA 3K9HA 1OFPA 4I8DA 1T6YA 1BQ4A 2GK7A 3LZDA 3LA4A 1K6MA 4NNBA 4KAFA 4U2EA 4I9JA 4CLRA 1LA2A 4M87A 1PD1A 5BYAA 2ZRIA 1I51A 3P4UA 2LTAA 3E58A 4RHUA 3H8SA 4Z4CA 2ZIZA 4IGIA 3OURA 3ZIAD 3PM6A 1PR4A 3DC2A 5SYMA 4GC9A 3MWYW 4Z7OB 3AYXB 1TPWA 4Q4AB 4WGXA 3VFDA 1NDHA 1SELA 2I2FA 3EEGA 5TPZD 4ZYYA 2BI8A 4OIFA 1GDTA 5AVRA 3PUEA 4BKNA 1KAOA 1DG3A 2TS1A 1HZYA 1WMSA 3BD6A 3CF4A 3MVTA 2PH3A 5G0SA 3UXDA 2XUQA 4O10A 4R8MA 3SCOA 1OW3B 1JJAA 2IEDA 3UR5A 2XYRA 3GYCA 5U4QA 3DBIA 4BGVA 4NDNE 3VD3A 4B43A 3ER8A 1JSXA 3K92A 2G3NA 3H5WA 3VM6A 3OVPA 1NE7A 3KSMA 3TK7A 4WN9A 4C1LA 4G0WA 2VJAA 4DIBA 1J8VA 4WCFC 2WKWA 1T24A 5J2UA 3TXXA 3VISA 2RKXA 1MDBA 3I7SA 1V7YA 4MV5A 1HDXA 3PK7A 3FWZA 1G38A 5DO9A 3PWSA 1REQA 3CRVA 2YASA 3KQVA 4N3CA 5TMEA 1PZ0A 3GYGA 5F64A 1G19A 2XIOA 3SIPA 2GFHA 2CWNA 4V0LA 3HY4A 3L2IA 1U2EA 4A2PA 1AKYA 1UW9A 1X98A 4W9RA 2HJSA 1UDXA 1ZAIA 4PLZA 4CMEA 4UM7A 4O3MA 2E0PA 1SD1A 4JLOA 4GNKB 2Y7DA 1QQ6A 2G4FA 3CNQS 2GK3A 3G0XA 2ZJOA 2NVAA 3PNPA 4U2BA 3WG6A 5I7OA 2PWDA 1WNOA 1H8HA 4BQNA 1EO7A 2FJUB 3UP8A 2DIJA 4KUHA 2I2BA 3FHQA 1DX9A 1PJ8A 1R3SA 2BKAA 4DYKA 4D6DA 1ATZA 3E2SA 3EX3A 4X3PA 3OFVA 1DSSG 2D2FA 3GR8A 3ZJVA 5E9AA 3D3WB 3Q87B 4NZ3A 2PS9A 1A2KC 5FL0A 1L5GB 4F9GA 5EJGA 1TJYA 4U10A 4KYVA 2LD4A 3EQ2A 3A1CA 5ESDA 3U7EB 3CB2A 2SCUB 2GO1A 2GZMA 4CDMA 1LK5A 5IJWA 1QO2A 3K2GA 2CWWA 4ZAVA 2Z26A 5AKIA 3KS6A 2PBLA 4YXFA 5IYZA 4GI5A 4II2A 3MZ0A 1Q2SA 1FX0A 3TZNA 2NV2A 1GWNA 1IRXA 5FR1A 2XHZA 4KR0A 1TJ5A 3UT0A 3QMPA 1D9EA 1XJCA 3TLCA 5IRPA 2LP4Y 4LF1A 1BYCA 1VLLA 3K09C 2CUKA 3NTLA 2FEOA 1K7SN 5CTJA 4CJXA 5JMUA 1WB4A 5AUOB 1NW4A 2WTNA 4WV3A 5TBOA 1SUEA 4IFBA 3QKSB 1Q1AA 4XQ6A 1FUYA 1YA4A 4BF9A 2G4JA 2XBMA 1VMEA 2YR0A 3WTBA 4C3OB 1ZGCA 3ZE2B 3I83A 1YWGO 4JT2A 2QSUA 4J1SA 2DB3A 3WDSA 3MXOA 2YW4A 3ZWSA 1PDVA 5L51A 5K0NA 5G4HC 1P6UA 2BTQA 1G16A 3BLIA 1XVLA 3CZQA 2WPNA 2PUBA 2P3EA 2ZBDA 3ZK8A 4E2XA 4JZ5A 2AD5A 4IYRA 3RSSA 1GKIA 1P7PA 3CUFA 3HYNA 3R6TA 4KOEC 3HPFA 1XQLA 3A3WA 7XIMA 3SVZA 1WDMA 3F4DA 4OXKA 1O6ZA 2FYMA 3GLHA 3QV9A 3I1JA 1JFHA 4PGFA 2DHQA 2QS8A 1YVEI 3AUOA 1ZCCA 3CYVA 3E5BA 4CM4B 1K6EA 1M03A 2CITA 1UMCA 4EMUA 4EYQA 3BG9A 3QPUA 2AL2A 4LYRA 4F60A 1JDEA 1EA0A 1SUCA 2K7FA 4EAQA 4A15A 1JFSA 4A8NA 5K3BA 5LR6A 5DOZA 4MYTA 5EJAA 4GNJA 5ALNA 3D8NA 5BZAA 3WSUA 4UQPA 1PQWA 2EAWA 1W1ZA 1MX9A 3VNSA 3G8AA 1EHAA 3HGJA 4NCKA 2P50A 3MELA 4B5XA 5IFLA 3BTUA 2DLCX 5K9XA 1CJKC 5A2CA 4GY7A 4MDPA 4CW7A 1UIOA 1RWBA 3TNOA 5XIMA 4YJDA 4OLFA 1WV2A 2IVFA 3SS9X 1TQXA 2C4HA 2XCRB 1A95A 2Y77A 4DWSC 4RX1A 1EHCA 4EHFA 3STEA 1Z07A 1US0A 4LV6A 2G0NA 3JQCA 5JYDA 4C22A 5I0DA 3DKKA 1NQ6A 4MIMA 2YJZA 4RK0A 1XIEA 2R7NA 2QCNA 4TTJA 1C80A 1PX0A 4QO7A 1B1CA 2RG7A 1DEXA 1W4AA 1EDTA 1X7WA 3S2CA 2VWGA 4UM5A 1NDZA 2Q99A 3KQUA 3PHHA 2RH8A 4ONEA 1L6GA 3ZLFA 4KRYA 3NM4A 4CG1A 1W73A 3GCZA 1ZOIA 2BUAA 2Y1LA 4L9WA 1CQJB 3CV7A 3HXPA 5HJ2A 2L2QA 4KR2A 5AJYA 4MUJA 4D9HA 3TOVA 2RJ3A 3W3AD 5JD4A 3ZN2A 4W85A 5IZ4A 3OHIA 2GILA 4EVIA 4L0CA 1Q3TA 1T15A 1HR0B 1KRMA 2ZIFA 3M1AA 3NOOA 2GRAA 1U28A 1YQWA 4G5QA 2JFHA 4OFZA 5KAPA 1QI2A 1XTJA 4TX8A 4ICCX 1PV1A 4YPFA 1QAMA 4DMGA 1U1HA 3LLFA 1KCZA 1ZVQA 2O6HA 1U3DA 1E77A 4N0EA 16PKA 4U63A 2QAFA 2ZB8A 1OWQA 3QX7A 2QR3A 3L43A 1QHHB 5JQGA 3L01A 2PDIA 4MO9A 3N19B 2QT3A 3M7SA 1D2NA 1O95A 3JYPA 2QE7A 4QFBA 4MB4A 5J2TF 1IWPB 4LXYA 1NR7A 2IKJA 3ZZUA 4YCCA 2CHEA 4TV5A 4KQ9A 1IWPA 4RHCA 5T4BA 2C16A 1IWAA 3HUFA 1SXJC 4FUTA 5AMXA 3NGMA 2E6AA 3P0FA 4PR0A 1RJGA 2HQOA 1Z18A 3EX4A 2D1FA 2OG2A 3HI6A 1H6BA 4CU5A 2WMJA 4M3NA 1XR2A 1G20A 1EA7A 5DMYA 2MYTA 1A9QA 5DTJA 4MLDA 2YYTA 2E6FA 5T57A 2OYKA 2YN4A 2HDNB 3IDOA 3UKOA 4BKRA 3BRSA 1OWLA 1DV1A 2I6FA 4QJ4B 1OXSC 5CNJA 5FJTA 4GZLA 1YNYA 1DHRA 4LZWA 2ALRA 5JEEA 3SY8A 1L7AA 1H4QA 1QZZA 1VIAA 1RHKA 3KDOA 1K7YA 1J1UA 1AXEA 3RM3A 3K31A 1WCGA 2VPQA 1TJRA 1PZHA 4BFVA 4G1VA 5C32A 5BRQA 4Q37A 1QIIA 2HWGA 4I4TA 4WZBA 4GVIA 2PRMA 1GARA 5JS2A 1W7AA 4HCJA 1Q5PA 2UVPA 1F0KA 3IK4A 1ZUIA 3UJHA 4PVCA 5HQTA 3V8RA 1WXEA 2WVGA 1IUNA 2IP4A 2NSDA 1FYEA 3ID7A 3H22A 1ZMOA 4KRTA 2AHOA 3V4ZA 2DPHA 3FRHA 4AURA 4LBZA 2CESA 3JWIA 4MLPA 5IC5A 1D0SA 5LIXX 1V9SA 1XMIA 4FBGA 1UM9B 3CO4A 2ZXDA 1LRLA 3H5AA 2JJ2D 4NE7A 2NP7A 1FTWA 2FOXA 3H2NA 2QJRA 3UUWA 2RDWA 3JAMA 2JASA 2C04A 1QU3A 1ESWA 4MR8A 1D1QA 4L4UA 1W75A 1ME8A 4YRNA 3W2KA 1CIVA 2ZX7A 2WSYB 1FH8A 1P1RA 3WGUA 3RX4A 5BV1A 4JSYA 2WHQA 3EYWA 5K8UA 5K8IA 4LJ5A 5A3JA 1OZ0A 2BOVA 4RKWA 5ERXA 1XV8A 5HS4A 1VR6A 1RWMA 4DMMA 1VLVA 3P0WA 4LF2A 1CUDA 1E4NA 1I2QA 1ZINA 3R7DA 5CCBA 3T06B 1G9XA 1TQ4A 4CF3A 3ROPA 5HW0A 5MFZA 1TX0A 4DIDA 3T34A 4WK4B 1XP3A 5CT8A 1A3CA 2CZEA 4L51A 5CH8A 3M5VA 3B6MA 2C2MA 3NHWA 1RRMA 3WO8A 5CEWA 5BU9A 1C1XA 3B1ZA 1J6UA 4CXMA 3D2LA 2YY7A 3LBMA 4JXCA 3EWYA 1NVTA 3FGPA 1WB9A 5HZGA 4MUZA 1JNXX 4PX2A 1ZAKA 1FYFA 1W93A 3MCNA 5F7OA 3W1MA 2I54A 3SCZA 4C01A 1K9SA 5A02A 1PHQA 3RUIA 1Q4NX 5JFGA 5ESRA 1DTUA 1G4PA 5BOSA 2IPAB 3VKVA 2X23A 4J1NA 4CNNA 4QHRA 5I5GA 2OORA 3H18A 5ALMA 1WQ3A 3OTOB 3P97A 1GQQA 1ZONA 4BI6A 2EGZA 3KTAB 1UWAA 2CXQA 3A26A 5L4NA 1UKYA 5DULA 3QKSA 1K9EA 4XKJA 4FX6M 1EUDA 3D8RA 3PPVA 2YZMA 4ZSUA 5AHWA 3LLXA 3DKLA 4K9SA 1P19A 3BDVA 1Y5NA 1S2NA 3EPOA 4BVLA 1QQ7A 1HDGO 3TDFA 1UP4A 1ICSA 5E9JA 4I3FA 2QGYA 4GUAA 2F43B 2ZRGA 3IL2A 1JPVA 1E9LA 4RPCA 4WAUA 3FI9A 5I9MA 2AGVA 4NBLA 1KC3A 1FXQA 4JJFA 2ZAMA 3WF2A 3TLGA 4UXHA 1FMJA 1HDRA 4X64B 4L4OA 3C86A 4R1NA 1CJBA 4S1NA 4Y3UA 2LIPA 1MZPA 4KBFA 2CVZA 2R48A 4RXUA 1P29A 2DZAA 3H9UA 2X1LA 4PG6A 1FFEA 1A8HA 1RPKA 1VL6A 3UCFA 2BY4A 3NQ6A 3GDHA 2PLNA 3CPEA 5IDYA 2CV2A 4W8LA 1AODA 5ICCA 2YHAA 3CLMA 3QOKA 2VUTA 3DOJA 3UJSA 4MVCA 2VJLA 2AKMA 1SCUA 2O2JA 2WQ6A 1RLMA 1OPRA 2DH2A 3C24A 4QPNA 1R66A 2BJWA 2QZJA 5IM51 4FNQA 2QIPA 5HE9A 5I7UA 3VAAA 2ZBVA 1QR7A 5T6MA 3PNUA 4I55B 1DJYA 2EG5A 1NJ2A 1KAQA 3EPMA 2ZZ2A 2VZLA 2BF7A 5I3KA 3Q98A 4ZCSA 4B8YA 1S2TA 5AVXA 1L8OA 1PL0A 5TY0A 3QEOA 2QJTA 5EKSA 3VO2A 4KESA 2FXVA 2KSQA 5HKAA 3GRIA 4I66A 3PNMA 4J76A 2JAUA 4NG4A 3FTFA 3GH5A 3BILA 1YYAA 2A85A 2FPOA 3KFLA 1RRPA 4E11A 2V7QD 2OMEA 1UYQA 1O2DA 3TXYA 3THCA 1FQWA 2K87A 1O96B 5FPQA 5B4UA 4MI9A 3L4SO 2Q4EA 5HILA 1FDJA 1VFPA 2WQZA 3K73O 2WMGA 3O8DA 2IEYA 3TE6A 4PMYA 4NSNA 2C4VA 2X5JO 2O5VA 1OGJA 5F1UA 3WHLA 1JP7A 3U44B 3BW4A 1I5OA 3NAVA 3O83A 1ZD5A 1WUJS 3IGFA 1TJ0A 4DYDA 4D6HA 3ZXXA 4ENSA 4M54A 1H9BA 2YV5A 4L7VA 3OMWA 2JG3A 4O18A 1KMNA 3KYDB 1B23P 1I2DA 1DOAA 1DU4A 3VKKA 1P0IA 1KJZA 4IMRA 4HEQA 4LJYA 3RABA 4JLSA 1XIDA 4TWAA 3RK0A 4ALDA 3IJ8A 1ZD1A 3TVDA 1TX4B 3WUBA 3QVGA 1OBOA 1IZ7A 3SZGA 2ZZ6A 5XIAA 1L9WA 1E0AA 3KVJA 4IEFB 3RVQA 4UUIA 4D4GA 1RXOB 1HFKA 1QAQA 3W7HA 2DCUA 5K20A 3HGTA 3CF2A 2HRBA 4UHEA 1XLVA 4XUDA 4DPPA 2P68A 4FNAA 1AQLA 1IN8A 3SI9A 4B4UA 3ARVA 4PFMA 3VIGA 5FTLA 4ZIRA 4FZJA 1K66A 2CLLB 5ILOA 3E1SA 1O1YA 3S9ZA 3ES8A 2W7TA 1UZ4A 1QHYA 4GE3A 3SIWA 3HIJA 4RK1A 4N12A 2Y1HA 4G97A 3AR3A 4IHQA 1FWIC 3M47A 2V58A 1OROA 3P9NA 3SS8A 4IBOA 1WMAA 2BZ0A 2ZUCA 1B6RA 1UWUA 2OBYA 4FN5A 2GZSA 3ZNOA 4TWBA 4M3PA 2P2ZA 2I1WA 4EEXA 1LDMA 3U7HB 3DAOA 2JLVA 1OXTA 4HXGA 4EO9A 1F61A 1G3IA 3FSJX 3WF3A 3K70B 5LQJA 5K3DA 3T4XA 3ZY3A 3G2OA 3O47A 3TTEA 3SN4A 3ZDZB 4ATWA 4DXDA 2BBTA 2C1EA 2EKQA 2O0LA 4Z0HO 2Y6UA 1KORA 4U3JA 1R8YA 4W1RA 4EJSA 3R0KA 4EGAA 1IIRA 3GY0A 4IXHA 3ZXYA 3RH0A 2HRWA 3L9XA 3W28A 4MTCA 4R1SA 4DI8A 1I9GA 3QFWA 1U1JA 3H4GA 1E8MA 2E8ZA 4HGNA 4MI6A 3DBLB 4K8OA 5SWUA 2V5DA 1CNFA 3FD8A 3WWZA 3GXTA 1T2AA 3C3PA 3V35A 4UDXX 4JGGA 1LORA 1XSIA 4L3OA 3I7RA 2YPIA 5FJJA 2BBWA 2GUWA 1T1IA 5AT1A 3IP5A 2HL6A 1GPJA 5FFFA 4XQEA 2GZAA 1XIFA 3K70C 4GOND 3A7EA 3QV2A 2IP2A 1Q0HA 2IHBA 3V8NA 2FN4A 2HW8A 3EQ7A 1TPZA 3ORWA 3S7TA 3TLGB 2FZEA 2FMUA 4DDVA 2JI6A 4RFSB 3ZOAA 4HNAB 1QE5A 2VP2A 2G9ZA 4YRMA 4OMCA 4FHGA 1MUWA 3AU6A 2AL1A 4EVZA 1ABFA 4I9UA 1W52X 2EYUA 1QCYA 3A6OA 1JZSA 5LLTA 4YP7A 3NCHA 1XFDA 2C14A 3VBCA 3SMQA 1AFSA 1M54A 1OFBA 1H6CA 3HFSA 2IXEA 3VDAA 2NUBA 4EHKA 4JDUA 4HJFA 3WKAA 2DBZA 5DNCA 1UH5A 4EA8A 2VC5A 1EC7A 2QU7A 1OG0A 3GXNA 3QMVA 1UH3A 4MNMA 3GIWA 4QYWA 3WAKA 1H1YA 3W9SA 2B94A 1UKQA 2IYVA 3TYBA 3V48A 4YACA 4NICA 1IG0A 5EGSA 3O15A 2JFZA 2JNWA 4P38A 4EP1A 4QU5A 3W2TA 4C5BA 1BHO1 3BZJA 2G17A 2J48A 2P0EA 3BD8A 5KQPA 2J3LA 1V1RA 4EHLA 2J79A 4CEUC 2XGBA 3NS7A 4C1NB 2CNOA 1GONA 3RASA 2V0CA 4RELA 2O8DA 4EUNA 1NF0A 3HNRA 4F6RA 1C1XB 2PP3A 3CJPA 5IJ0A 4F0RA 5TQ0B 1Y3IA 4UEWA 3BK2A 3QXXA 4GPTA 2B2CA 4BZPA 4Z1YA 2TYSB 2OQHA 2ACWA 2LWIA 5K4AA 1XPOA 4C7DA 1TPVA 1P1XA 5T4HA 1HF6A 3U4QB 5LA0A 4BQIA 2Y8VA 2Q3FA 1SU7A 4BGDA 1JQDA 2QLTA 1Y5WA 1A50A 3BUVA 3MW8A 5L3VA 3SUWA 1TKBA 3NJ8A 2I2DA 1J5XA 1YL5A 3E23A 1EC8A 3OLDA 2FUG1 1YASA 2YXDA 3CLTD 2HA4A 1MB2A 3ZGYA 2OCPA 2WV8A 3I5UA 5FBWB 1H66A 3W73A 1GVQA 1QSGA 4U31A 3R4CA 3UXYA 1HKKA 2PDWA 3G0BA 3R0XA 1QGYA 5B3AA 3G6KA 4IM7A 4UBNA 4DRSA 1PKXA 4P8WA 2CV1A 5AH0A 3IEMA 2BDEA 4MLCA 2NSHA 4D9JA 4Q1FA 1S1PA 1MTOA 5HNTA 2QN2A 1E1EA 1G3MA 3CVXA 1HQDA 4XPZA 4F66A 1II9A 2YS7A 3DT8A 3F6YA 3RS9A 4RE5A 4E46A 3NBKA 3TRJA 1N78A 1I7DA 1AUOA 4Q3BA 3SEAA 1RHJA 2C00A 4BVJA 3C8NA 2TODA 3A4NA 1K4KA 1WYIA 3WN6A 3MSDA 2ODQA 3L7MA 3W7LA 2BEKA 1USKA 3LUGA 5BN5B 3TVYA 3U49A 2B82A 5CYFA 3L8DA 3VOGA 2PGNA 3B03A 1RZ3A 2QVBA 1LBEA 3WLNA 4JBLA 2AOXA 4FX7A 4C0AC 4ETWA 3H6KA 2BWGA 4DPKA 2VX6A 3FUTA 3TGPA 3GRYA 3QWAA 4ACAA 3MI6A 1R7OA 1BN7A 1YR7A 4DIUA 4DAEA 2LZ0A 1OKKD 1YR3A 3WP0A 1SG0A 2YTZA 3UNDA 5HMSA 4B35A 3F4BA 3FPLA 1LLCA 4ZV4A 3E0WA 1MFZA 4MYSA 4M5PA 2OEMA 3LGGA 1NBME 3KEFA 4RJKA 1YE3A 1KOGA 2TPSA 5J59A 3HVIA 1HDEA 3JVEA 2IHKA 2PQ0A 1I36A 4IJRA 2C29D 2VQ3A 4TMVA 4TTPA 3RC7A 1S2UA 1MRQA 1C7ZA 5HQ3A 3V0SA 3GOHA 4F2WA 1JU4A 4OMFG 1MW1A 1FOEB 1OC6A 3B1JA 4WBNA 2GFQA 3JVDA 1DJWA 3AVVA 1CEEA 1DE6A 4DVOA 2ANUA 2WNHA 3PDHA 4AXNA 5D33A 1NT4A 5H0IA 4IIJA 2X1RA 4V2UA 4BWFB 1ISHA 4GM1A 2V6MA 3GLCA 3MSGA 3U7BA 5KZDA 1ZD2P 3L7IA 2WKPA 3GIQA 4XXHA 3CNLA 4IPLA 4MOZA 1K7FA 4HQ6A 1GPAA 2FY8A 4R0MA 2Y92A 2BEVB 4HFRA 3CQHA 4X71A 2C84A 1XLIA 4QLOA 5AC5A 3ESXA 1G0OA 1A5BA 3FNQA 5HGJA 2P7IA 4F2PA 3KYIB 3C3BA 5A04A 1E61A 2OWCA 2OO5C 3MLBA 4DLRA 2C9ZA 1R4ZA 4R0NA 2ZZ1A 1GPBA 3EEQA 3R7FA 1B0UA 1CY2A 4DUZB 5FF0A 1DEHA 1SD2A 4EDFA 1MV5A 1W36B 3ENQA 2C5LA 3BXPA 1JYWA 1WVIA 1VBRA 3SQNA 3SI7A 3GAKA 1ODJA 1SIUA 2VDVE 1W9XA 2ADAA 2QKYA 1K98A 4MJ2A 1XR3A 1OLOA 2Z4GA 1SEPA 1J9ZA 2VPYA 5JTTA 5LFAA 4D4IA 4M0LA 2YKGA 3ES9A 4JLWA 3PSWA 2TRSA 1OLUA 1NR5A 1ZP4A 1S46A 2BVDA 2R6GA 3DXFA 1Q0LA 1JG1A 4I9TA 2G6BA 5AY7A 2FPPA 1DPMA 3P45A 1WRBA 2YQ4A 5CT9A 1TEZA 3LFTA 3EWWA 4CNQA 3PUWA 1XCXA 1S5TA 4PO9A 5AKXA 5KOJB 1DVRA 4ZAGA 4J03A 5J5RA 3D4NA 3NONA 3D6NB 4AD5A 3AI0A 1YCHA 2BH9A 1Y9EA 4K03A 5JSZA 2WFMA 2OXRA 1QGZA 2DZXA 2OHGA 3HS3A 2ZI6A 3MBFA 2WF5A 3LBFA 2EX4A 1LG2A 2C18A 3P0XA 5DYWA 3N7TA 1ZBWA 4GOXA 1CWYA 2OZ3A 2IXAA 3FBTA 2V7TA 2WM8A 3KQWA 4E13A 3V00A 4MKIA 3VR6A 4GC4A 4TQGA 4JHMA 1S1RA 3H6GA 3FPGA 1BMFD 1ZKDA 4JUCA 4MQFA 3AF2A 1NARA 3T7EA 3PYMA 2IEBA 2FHBA 2F3TA 3ZY6A 1NUSA 2DQKA 2B3TA 4OHRA 1TYZA 2GNOA 3FDJA 2UU9B 4OSEA 4RD3A 2C19A 2VJOA 1AIPA 4G5XA 4ZCIA 5EWMA 4PHFA 4MLZA 3QC3A 4KT2A 3PRHA 4UFIA 3D3KA 2H7VA 2OEKA 2Z9CA 3OT1B 4GWEA 4Y30A 1D1TA 4QXRA 2ZTMA 4RCVA 4PEKA 4AC1X 3CRNA 1OT3A 3FB1A 5FO0A 2WHXA 3PR2B 4KIUA 2XQVA 1L5SA 1FUYB 5FYDA 5JIBA 3J7HA 3ZUPA 1FW8A 2H1VA 4JCLA 3Q3CA 1RI2A 2YICA 1Q6GA 2HSWA 4A8PA 1VCIA 4S2EA 4IX0A 3KZNA 3CV2A 1X3SA 1P91A 4DO7A 4FZ3A 5BRJA 3D8UA 2ZVDA 3GZ3A 2V8OA 2IHZA 4ZYXA 4E2ZA 4Y9PA 1F2VA 1HQYE 3L4TA 4TKVA 4PMQA 2NUPA 4BFCA 1XTIA 3LPAA 3PGLA 5CA1A 2UBPC 2MYUA 2R1ZA 3AY7A 3WH7A 421PA 1Z6GA 1P4AA 1ZSYA 4LYPA 1P44A 4PUWA 2R11A 1I01A 1TT7A 1PEYA 5K9ZA 1XAIA 1BOOA 1FLDA 2PQMA 4LRTA 2DPMA 3I2GA 2FGLA 5K2MA 4FGLA 1MZHA 4DV3B 2GTHA 1SVIA 3LYAA 1VBJA 1UMDA 3KC2A 4RD2A 3QVKA 121PA 1C1DB 4RW0A 2H1IA 4F2HA 3KHJA 1IOWA 2WT9A 3M34A 3WAGA 5I47A 4U7GA 2PGRA 4D8UA 3S8MA 2EJBA 1QHNA 3TQQA 2FX5A 2AC2A 3W83A 4PXYA 5MKGB 2UZ9A 4IIFA 4QXAA 1DBTA 3SB0A 2O06A 2RIRA 4MUMA 2NWSA 5HKKA 2GM5A 3ABXA 3EK2A 4MIKA 3EA1A 1JS1X 2VDKB 5EUQB 5LWHA 4BWYA 2X22A 3V2GA 2P35A 1PJCA 1OYCA 4J4KA 1E0SA 4DZIA 3ZGOA 1G60A 2E67A 3GMIA 3A47A 4FB4A 1Z37A 3HPRA 3Q65A 3M4ZA 2FSVC 2XADA 5EXSA 5JH2A 4X20A 3CB4A 1PWEA 5C70A 1VE6A 1O95C 4DG9A 4IQGA 3OLEA 4MVJA 1XBVA 2W2KA 3C0LA 2I6QA 4V1CA 2NSOA 3SCVA 3DH0A 2RDUA 4V1XA 1O4UA 4NYIQ 1UPBA 2HBXA 3PTQA 1Z4KA 3GVVA 4PGLA 4ORMA 3U1TA 5K7JA 7ADHA 3N9KA 2HWUA 3BIJA 4EI8A 5JJLA 1RFLA 1J2EA 5FTNA 5F9MA 1ZBQA 1YGPA 4H6RA 1Z0SA 1XSKA 4R41A 5HWSA 1MA0A 1M41A 1XDLA 3KWJA 3OYZA 3EXSA 3BA6A 3RSGA 1QE3A 3UWDA 4HAIA 1HFJA 5D05A 5ABPA 4F0LA 3IAXA 5IJ9A 2I76A 3IKVA 4CCEA 1YFKA 2W2MA 1RJQA 4A6XA 1CI1A 4GOAA 5HBFA 2V7UA 1CCWA 4Z99A 2PMDA 2REBA 1F6PA 1FHDA 1PTJC 3MJHA 3UWPA 1JZ6A 2R8XA 4PZVA 1TT5B 2ET6A 3QEKA 5BV8A 1FDTA 3FYUA 4C08A 1UFVA 3DERA 3CUGA 4NZ5A 2XCOA 3G0UA 1PAUA 1AQNA 4PSPA 4EG3A 2RGRA 2HXTA 4FOJA 4MKXA 1Z47A 4O11A 2QV7A 2O3SA 4W8GA 3SUSA 5A1JA 3PJUA 2H06A 1NWRA 1K7EA 4DC1A 1SU8A 1XPRA 3IPCA 4C6KA 3D7NA 1NHGA 3V4VB 2FEPA 3EEYA 4QA9A 5U1PA 2R7LA 4OQQA 3PXAA 2A3RA 3T7SA 1HPLA 4PF1A 3TZHA 4EJSC 3FYCA 1LQUA 3C45A 4XB3A 4QM6A 5CPTA 4LX4A 5LYJB 1WU7A 4XWWA 1THFD 2CL0X 5IZCC 3QWIA 1ZIDA 2E4WA 1SBCA 4NEQA 2DVMA 3INPA 3CEPA 4FK8A 2G3MA 4IJCA 1G291 3CLHA 3KTCA 3VOCA 5HKOA 3GO2A 4L8LA 4L0QA 4Y2HA 3TIMA 3PJGA 4EB8A 2VDWB 3FLAA 1VQ1A 2WSBA 2ZRPA 2R6HA 3KTOA 3NHPA 2QW1A 4RPPA 4F4CA 2D1TA 3AS1A 4AS2A 2Y5EA 4AVFA 1FFXB 3RS0A 3S4YA 4DWVA 1J2WA 4LNHA 4LYKA 2WF9A 5H6HA 1DRKA 3UYKA 4E4UA 1T0HB 4I6VA 1EP2A 1BWKA 1H4SA 4J2PA 4M1BA 5H83A 3IODA 3AZSA 4HG2A 2WNQA 4WKNA 3KWXA 5DISB 4G63A 4UM9B 3FCSB 1L6IA 3WGOA 2AE2A 4PGAA 1GZSA 4GXMA 4Q33A 2AEEA 2H4ZA 2J09A 2AYXA 5HOSA 5FJRA 3QEMA 4Z49A 3GUWA 3R25A 3HMKA 1SQ0A 2B30A 2VZ9A 3W1XA 3KKMA 3H17A 4LN1A 3SYNA 4Q4HA 4XTIA 1T9GS 1E4IA 5JAZA 3T3OA 3CHCA 4EUEA 2HLPA 2P11A 5D51S 1LDGA 4LSBA 1YIAA 4DBLE 1E9FA 3BN3A 4ESEA 2XNKA 4AY4A 3AL3A 3GHTA 5CDGA 2MNRA 1AURA 1QWOA 2CXGA 1TELA 3GAAA 3ZS9A 2GYUA 4J0JA 4HPNA 3TRFA 3UJ9A 1KY3A 1NUHA 2C1HA 1A9PA 4OI0A 1N4DA 2ETVA 4UTTA 2Z7KA 4PRWA 1ES9A 2NU9B 1TPH1 4OOZA 2C79A 3BC9A 4D0LB 2PDQA 4Q0MA 2C4UA 4IINA 2IL1A 5FLYA 1F8GA 2XQIA 3BXXA 3GRVA 2YW9A 4M9ZA 1N25A 3LXAA 2FP4B 4EW2A 1OLXB 4CN1A 3KBMA 2QW8A 2JGEA 3D54D 2GBPA 3F3SA 1UMYA 2FU5C 1CUBA 3AINA 5KQGA 1ONOA 3MTBA 3RF9A 2V0TA 1JVSA 1PT9A 3UBMA 1JAXA 1JLRA 3C8HA 3BVPA 4ERIA 2NZWA 1M53A 1VG1A 4GY1A 1EF3A 4PC6A 4LJ6A 1O12A 3ZZ1A 4WASA 4HNHA 1DCMA 3SYMA 3TMKA 1HNWB 1GNRA 1J99A 1B3BA 2WIJA 3VCRA 5LMZA 3MGBA 4Y2WA 1RCOB 1H0RA 3HPXA 4FDAA 1KMHB 1GADO 1PI3A 2ZR8A 4DCSA 4MZXA 4EG1A 4KH1A 4C3ZA 1MJFA 2J66A 3T35A 2PDGA 1R8JA 1N9KA 3D46A 3O21A 4WCFB 1U2GC 1UWSA 3M3PA 4AZ5A 2Z2BA 2AR0A 4JFTA 2JVKA 2WJAA 3W1NA 2QM0A 1B3XA 4W1PA 4IMFA 5AICA 4MPDA 2VENA 3DB1A 4FQ5A 5LIUX 2KS6A 5CBPB 1NBAA 3VIHA 1PYDA 2ZXAA 5JATA 5DEOA 1Q7CA 3ZJUA 1A5SA 2E09A 1J01A 4PZDA 3GXIA 2HLDA 3GT4A 2GJ9A 2UZ3A 3DV9A 4FM9A 3QVWA 1GPLA 1G9TA 4E8DA 4LJAA 1PKLA 5LZ5A 4GU5A 4RTJA 1OXXK 4HOWA 2GLTA 3C1AA 3BCUA 2OG9A 3A4LA 5FBRB 3DKPA 2R8YA 4FDLA 3KL3A 3AUJB 3NFUA 4PZPA 5AFDA 2HF2A 4ZVJA 2A4KA 1VF8A 2FR1A 2O2HA 4BAUA 5FPSA 2V5JA 4PS0A 4FS3A 1V9LA 2H4YA 4BF5A 4Z53A 1KIAA 1UXHA 2VG8A 4C20A 1JQJC 5KYKA 5BW6A 1GVNB 1VH7A 1HYGA 2ZB2A 5A3SA 2WABA 2G3FA 3OA5A 3PQ3A 4HAYA 4J2HA 4H0NA 3F03K 1S2AA 4TWJA 5IAJA 2CBXA 4TRRA 2TAAA 4GLEA 2EXXA 1GZ3A 2VDMB 3NZEA 4F1KA 2AEFA 4KI7A 3BFKA 3NPAA 4QM1A 1SXJA 1DXEA 1RJEA 4MQMA 4C0SA 3L6BA 1W5OA 4ALMA 1IE3A 2HRZA 4AKGA 1NMXA 3EIWA 4FQ7A 4RH3A 1SUPA 2VZEA 4IL5A 5T3YA 3BD7A 5H9VA 4AG5A 2CPUA 2IZZA 1N2EA 3F6PA 1W0KD 3HURA 3QLLA 1QC5A 4M83A 1JYXA 4RC9A 4JTDA 4LUSB 3ARRA 1FH7A 3WQSB 4MYRA 2GCPA 3RC2A 3QGVA 4S23A 4DCGA 1DOZA 4HU0A 2J6CA 5IN4A 1SVMA 4EA9A 3FTQA 3AVPA 3QR0A 4E21A 1O08A 3THQA 3EOEA 3E2RA 5ADHA 4XD3A 1SHTX 1E1LA 3I58A 2ABAA 3FUCA 1WKFA 3CRW1 2B83A 2BM1A 1J39A 5KVCA 1QOPA 2J0QA 4YC7A 4RY2A 4INZA 2IF2A 1E1QD 4JT4A 4AUEA 4FP1A 2V69A 3V4LA 3R9IA 5CDTA 1P62B 1H2RS 3SQWA 3DHPA 2Z95A 3SC6A 4TV8B 1JHPA 3CAVA 4RE0A 2A9RA 2JALA 3WL6A 2DHDA 4HWOA 3VQTA 5CFOA 1N8IA 2GSWA 2RHBA 2EG8A 5CFRA 3M0JA 4R6XA 4Y9UA 2JD2A 1Y3BE 4L8FA 3MMUA 4S1VA 5DYIA 3DIPA 2Q46A 5EGNA 5LNVA 3VNRA 1J5TA 3GH1A 3TX9A 1YMQA 3AUJA 3QPCA 4BA0A 2OA0A 4R5HA 4R71A 5A1AA 1I3KA 1RWNA 3LUAA 2FE1A 1HJUA 2OYRA 1X94A 3L1HA 5AVHA 1P4GA 2CFRA 4FHAA 3NM5A 3TAHA 1OIMA 4EM6A 1EFDN 2IQDA 3O2LA 4ND4A 1GVHA 3SU8A 3AXIA 5LNRA 1K92A 2VT2A 1WF3A 1E4VA 2REOA 4PGMA 4OQYA 2VCEA 1UADA 2QV0A 5IMSA 1MV8A 2HHHB 1V4YA 2ZDGA 2YXNA 2NO0A 2ZUWA 4WZAB 7TIMA 1IT7A 5IOBA 3QPWA 2V7GA 2G8LA 1CS0A 3FNEA 4JJ4A 1GZ5A 4ZT4A 2J78A 1GTSA 3K0HA 4UMEA 4XSGA 3UGQA 2FIQA 8RUCA 4FFWA 1WUYA 3PCRB 5LD2B 1X92A 4BBAA 2GGIA 3M6YA 4H6KA 4X2PA 4A5OA 1N2GA 2CVQA 3NYIA 4NXNB 3GVRA 3MUCA 4GICA 2WZCA 3LO8A 3HI4A 4M0PA 4PW0A 5B57C 1NFQA 2VF4X 4F96A 1S3SA 1OFAA 3RVBA 1UCWA 4TN5A 1SRQA 4PLWA 5IVKA 4ER6A 4F5YA 1OJXA 2V9PA 1KFBA 3CWNA 2REQB 3AS0A 1OYOA 4IDAA 2XCLA 4R1MA 1R47A 3CNEA 1UWRA 9LDTA 4CIAA 2ONKA 3BC1A 3TQKA 2J7PA 3VYUB 5E9XA 1K1DA 2C1GA 1SBTA 4AS1A 3JQAB 4O8ZA 3ET4A 1L8QA 1YXMA 4FOPA 4J40A 3K35A 1V39A 3WLPA 5EJEA 1UJPA 3C98A 1JF8A 3TQ0A 3EGEA 5TMPA 1SCNE 5FB3A 2WQ7A 2ZE7A 1L1QA 4EYOA 3DE0X 3ETGA 1R5JA 1YBMA 1TZ7A 2X4IA 1SC3A 3K5WA 4RD0A 4TYNA 4IILA 4YR9A 4QJIA 4DJFA 3WICA 1Z44A 1O9GA 1JUDA 1QHEA 5C9RA 2JRCA 2VX7A 3H55A 5JHHB 3K1YA 4BC0A 4NKRA 1G7SA 2V6GA 4AZCA 2OYCA 3GEPA 5H8PA 5CLHA 3QEMB 3TLBA 4LOIA 3DZJA 4YPJA 1ORRA 2ZBUA 1GEGA 4Q4OA 2IXTA 1WIWA 1FP2A 1BRLA 1JIIA 4MK4A 5CLQA 4CEIA 5KOIA 3FWKA 1PDYA 3GEDA 4HZUB 5FEZA 1CQXA 3RHZA 2QPOA 3RSCA 5GNZA 2A0WA 3M6LA 4J1TA 2SKEA 4P4SA 5BVHB 2EZUA 2WQPA 3JQ9A 1X1OA 2W90A 3VU3A 1Q1BA 3NAGA 5K3FB 1ADGA 3OLXA 2IYUA 3F1LA 4XRGA 5FRDA 4U3JB 2OGYA 2ZIDA 3CLKA 2RHGB 3VC3A 5A6SB 4LYAA 1YIOA 4GGHA 4HN8A 1FFQA 2GEJA 4LGMA 1LEHA 5AB3A 1DUVG 3THAA 2INZA 2OVFA 2J3QA 3CEPB 2MYPA 4DAFA 2BXZA 1O4WA 4RTKA 2CLKA 4CMCA 1WPCA 2ZSUA 1HL9A 1B16A 1TKAA 5AUQA 5B1SA 4YLWA 1ULSA 4QBKA 2WAOA 2RGLA 3SCRA 2OBFA 4OLHA 3COZA 2IODA 1U2RA 3WRXC 4XTDA 4R9NA 1KBQA 3D4IA 1R8SA 4H0CA 3QUBA 2ICSA 2OHHA 1AGNA 1DWUA 2BE7A 5B1HA 2BBSA 2I7TA 3WDJA 3A64A 3PRKE 5M1TA 1JG6A 4IIJF 2HBYA 3WYNA 1KQOA 2G77B 4DN6A 4P54A 3TR0A 1GN8A 5BXSA 3QYAA 2HMTA 4KO8A 3GNXA 4JTKA 1A4MA 1ADCA 4OJQA 3U81A 1UZ1A 3AHJA 4LV8B 2AFHA 1QGAA 2W6MA 1XQKA 5TLSA 3NDBB 2G5WA 5A8GA 4OQXA 4P36A 3K6JA 5CP8A 3NZGA 1E3QA 2V6BA 4WBNF 3E9RA 4M6UA 3CVYA 4NE2A 4YK7A 4G89A 3AI7A 3IEKA 3VCNA 4H9GA 3VU9B 2X0DA 5ENDA 1B1AA 3O4HA 1BKSA 3G2LA 3RVNA 5REQA 2ESCA 4HTBA 2V1XA 2ZANA 4P61A 4TXLA 3VU8A 4LE0A 4L6AA 4XDYA 1HG0A 4LE1A 2GF0A 1CEYA 4ZI2A 2BLNA 3ELBA 2FPIA 1OFOA 1BWLA 3D8BA 3VKHA 3H4MA 3W22A 1ZJAA 4KMRA 3L9WA 3U5TA 3H9BA 4G24A 4XGRA 3WQCA 1RXYA 1O7JA 3AIUA 3BB4A 5JHGB 1VLIA 3LEPA 2JD1A 1XEWX 3PSAA 2ZS8A 4DJ5X 4TYWA 1GKKA 3VPFA 4AN4A 1LP6A 2R79A 2WWGA 2GMWA 3MANA 5C0QA 2X7WA 1Q6EA 3R3HA 5BXQC 3IMFA 3TIGA 3AMVA 4L15A 4WLEA 2EBUA 4DSZA 3LCXA 4O1FA 4K6FA 2NYUA 2PR7A 5E2AA 4J7CA 3RNDA 2WDZA 4ZEOA 2E3JA 4BMNA 2I2WA 1TK3A 3OTWA 1FL9A 4NMMA 1JNYA 2WJPA 4BUZA 3TQFA 3B97A 3HB9A 3E12A 3KOYA 2FQXA 1NXQA 5HF5A 4LYHA 5A6SA 3WIOA 1JZTA 1EDOA 3BZGA 4J0EA 4PAOA 2O3UA 4OQZA 5AKQA 3TTQA 5JAMA 2I1LA 4R9XA 1YQDA 2IZOA 2HK0A 5ECGC 2Z2JA 4G67A 5TARA 4KV9A 3PXUA 1UR3M 1KBIA 5LZ9A 3TYCA 3PZBA 5BVHA 4LE2A 1JCMP 3PHJA 1AXGA 3NTQA 3ELWA 3PU6A 1E5LA 4H27A 4M99A 5D09A 3JQGA 4L65A 4TXHA 1Y80A 2VOTA 1K8YB 4HGOA 2FTPA 3ADPA 1HJVA 5H91A 2PWUA 4CTOA 2ZJFA 4EPXA 1NY1A 4IGHA 3VR6H 4XWYA 2DETA 4INFA 4BNFA 5A6LA 4H3SA 3BMCA 4NG3A 4YTQA 1VM6A 4NQRA 5IH3A 4AMVA 5K4HA 4L4PA 2QM3A 1VB5A 3MOSA 4BXOA 1A9YA 1T9AA 4EG8A 1E6WA 3FOBA 4TWIA 4UZFA 4EO7A 2OAGA 5I9BA 3DCNA 1GKYA 1Z6AA 4F97A 1ISJA 4QTXA 1DFGA 2OKGA 4WDTA 2IXUA 1WKEA 2D1SA 2VS1A 4P22A 4ZQFA 5FUYA 2D3WA 3GFOA 5JROA 5TVKA 4YJ3B 2WO5A 5EWMB 5LQNA 4KKXB 3NDYA 2W2KB 3NBFA 3HG5A 3EXIB 1C3OB 3NZPA 4ND5A 3M7WA 3IBGA 3MFYA 3NEJA 3UTDA 4Z1MD 4QG9A 5AW5A 1GQIA 4B3MB 3KKKA 4INOA 1AL7A 3FCAA 2D1YA 4EAYA 4CEXC 3V32A 3LA8A 3IMEA 1PFKA 4AFNA 1BHGA 1DB3A 1DEDA 4JBRA 4N48A 2PBGA 4LW8A 1AQYA 5JAQA 1JYSA 4HVLA 1Y6QA 1Y5IA 1NJSA 5HUHA 4DQXA 3L3BA 2D62A 3V3KA 1T0PA 1HT0A 3MNFA 5EJ5A 1U7WA 3QBVA 3NJ4A 1PGOA 4B34A 1QLWA 3ITVA 5BW8A 3FR8A 4EHHA 2C7RA 1LW7A 3OFKA 2J85A 1N6IA 2CFSA 4OLBA 2HKIA 1SNYA 3UCCA 3GRRA 1FH9A 1GRNA 3TBHA 2H65A 1NE2A 4MWAA 5NLLA 4R1LA 4R2IA 3LIIA 4NCIA 1W0KA 4JTRA 2EPOA 1PL8A 1JXMA 4UZEA 4YMGA 4BWLA 1MRZA 1GCUA 2Q8XA 1UWQA 4FLFA 1Z34A 1HKVA 3VGJA 3VFCA 1G8PA 4OK6A 5AW9A 2C2YA 4HQLA 4TL9A 3LA6A 1ADFA 4ARVA 4A91A 1XWYA 3L07A 1D03A 1BRLB 2XKJE 1GITA 4CU6A 3ZLUA 3H21A 1F5SA 3L49A 2J74A 4TV9B 2GN6A 1N8NA 1U6IA 1SVUA 3KB8A 3VMPA 2BVTA 2BMVA 1P7ZA 3PC8A 4EWJA 2ZRKA 4DLKA 3OH8A 3U3DA 1E0XA 4AZCB 2NXJA 3KYCA 2ZZ4A 3C4JA 3QH4A 2PRSA 4Z86A 3GDOA 1J12A 2CLHB 3R5FA 2OG1A 5COAA 3NYQA 4HHPA 1MX5A 4KS0A 3U40A 4IPTA 5JJ5A 3RS2A 4RHXA 3GG9A 5JECA 4HGZA 4Q4KA 4L6IA 4NNAA 1J00A 3K3PA 1AG9A 3SRHA 2H0RA 4W5TA 2HSEA 4G7EA 3ZDBA 1F8MA 3R58A 3SHTA 1RKBA 1FMFA 2DH6A 3NVTA 5LP6B 2OILA 2F1JA 1XQ9A 1PNQA 2KX9A 1PTJA 3UV7A 5JNLA 3B9DA 1YS2X 1ZCAA 2J3HA 4L9RA 1YR1A 3PUZA 1MC8A 1XYLA 1H2EA 3DBNA 3E53A 3UJDA 2VDRB 2VEFA 1QJWA 2WJJA 4IQJA 2DQYA 4RDCA 5DM0A 3R9XA 3HYRA 1JJVA 3ZI0A 4W9NC 1Y1LA 2QTVB 4KU4A 4B33A 4IUGA 3VKJA 4GFDA 2WJIA 3VVGA 4IUBS 4US0R 1WTCA 3VKDA 3PZQA 1VKFA 2QD5A 5E1QA 3OOEA 1IZZA 2DDXA 2XVPA 2F8TA 1T5BA 2YHIA 2Q49A 2H1HA 5AECA 4P93A 3T12A 1QF7A 2X0KA 2CK3D 3S6OA 3WISA 1GZUA 5EJIA 4M1WA 5IZCA 4V0OA 4G4GA 1NM5C 2GJ4A 1V6VA 3AHVA 3WGIA 1WAWA 5KJFA 4HYVA 1KRBC 2YUIA 1TCDA 5DSXA 3DDUA 2TMGA 2O55A 2J4DA 3V7NA 2VHJA 1MTZA 1I45A 1QI3A 1E9DA 3IVGA 1AVTA 1J49A 2BZ1A 3NGJA 3K2EA 4QLAA 4YRAA 3TX2A 3KL0A 4NMLA 2QR6A 3T41A 5DM70 1BA3A 2Z2KA 1KEUA 3I9MA 2VFEA 1RJ9B 4QQ3A 3NKLA 2YXBA 5DTIA 3UVAA 4EMTA 3GAYA 2Q5JA 2NT0A 1OHLA 4RHYA 5IM4F 2QMJA 2C95A 3PQ7A 4DXXA 3MTGA 4LZZA 3C3YA 3WVNA 2RHWA 3WK6A 1GUYA 3S2EA 3KRBA 2JKPA 1RPTA 3LLMA 3THRA 4CMGA 4KQIA 3F4VA 1M1ZA 1ZVMA 4HWKA 3NV7A 5JZVA 4LRWA 3VFLA 3SZOA 4CPDA 1X7XA 1DPFA 4XD6A 3S1SA 2WTUA 1I5RA 5AW4A 1A5SB 1F0PA 4R1UA 3VOAA 5THXA 1FXSA 3VPLA 3MUAA 3RFUA 3Q9UA 1GA1A 1ZN2A 3IBCA 2AX4A 5DBEX 2HBRA 4CG0A 4GYYA 3OM9A 2GWGA 1IK6A 1GNSA 4OUDB 1RY0A 3VR6D 4PCVA 2J3MA 4I2NA 1N6NA 1BYBA 3AZRA 2QDDA 5ABFA 4Q02A 4PO1A 3NHYA 1FNDA 1FJ2A 3E7XA 3GIYA 4N6EA 3V1LA 1VPQA 3LCMA 2PE5A 5JSFA 3ZCPA 3A1DA 4KW2A 1QHGA 1ZI9A 3AFHA 4UQCA 1LBMA 5AW2A 1DKOA 4XASA 1O66A 3PYLA 3U4QA 1CUGA 4JP2A 2AXPA 3DZIA 5CA0B 2JF7A 2YYUA 5LKAA 2E49A 4CMIB 3UMYA 1QKJA 4S05A 3S1WA 2I6TA 2F4VB 2R68A 2H2AA 4DPMA 3QELA 3WD1A 1OB0A 5H3LA 1Z83A 4E6PA 3E05A 3T3DA 4CCDA 1UBFA 1WB5A 3BJZA 1DRWA 4OHKA 3NDJA 4M24A 3I65A 3LRXA 4W8OA 4KN8A 4QZVA 4FYJA 5BR1A 1MT3A 3W26A 5LP6C 4RDWA 4F3TA 4YN3A 5FADA 3IUDA 1RI4A 1Y5XA 1J0IA 3N28A 3KAOA 5B1IA 2BTQB 3D4PA 4GBDA 1JE0A 2FDRA 4J5NA 4BU1A 4XO6A 1YXCA 5IC4A 3VA7A 5DU2A 3VK5A 1T2EA 1G21A 5JALA 4BNNA 3T9DA 1B3ZA 4LBSA 4HYEA 1KYXA 4G7EB 1V7AA 1E9VA 3WBBA 3AESA 1V6CA 1GVEA 4DR2B 3G49A 1C92A 3KR1A 3BKXA 3BREA 2YRFA 3PFCA 3A5VA 5AI0A 4FGWA 4MB3A 4KWOA 1CEQA 3WGYA 4QX4A 1GOIA 1N75A 1SB9A 4IL2A 3ISTA 2CLHA 4H9TA 2AAAA 7GPBA 4OUEA 4JBWA 3UD6A 5FIUA 3CZLA 5JQ9A 3S46A 5ESWA 1Y1SA 2V74B 1ZYUA 5DNDA 2XGOA 1U31A 1H63A 4ROTA 3HB1A 3R10A 1EFCA 5E1DA 2POTA 3AERB 2QU8A 3QOXA 1I14A 3GRZA 1LJYA 4NPHA 5LDGA 2J7BA 2SCUA 3IA7A 3A1FA 4JR0A 4EPBC 3HVUA 3HK2A 2C4KA 1NRWA 4NFHA 4CTKA 1XUOA 4IJQA 1Y8BA 3BO9A 4G5FA 4RCZA 4BEBA 1AHNA 3TA9A 4W5JA 4GXQA 3E74A 2WCAA 1H42A 2OC9A 1KPGA 4AZSA 1ZMTA 4A8IA 1BHSA 1XLTC 3IQHX 4O2AB 1DKMA 5DPMA 1XAJA 3ZOKA 2XIIA 1T4CB 1A5KC 1K7CA 3W8FA 1BTOA 4A8RA 1LQ2A 2TYSA 3B5JA 2R6ZA 3SC2A 4GLLA 2LE0A 1UEXC 1PFVA 2QW5A 4XSVA 3N18A 2OGTA 2VDWA 3DYOA 3F8SA 3EXRA 3FFSA 4CU8A 4NFLA 2PEVA 3HCDA 1ITZA 1DAPA 4CWAA 2E18A 4ZDIA 3AUTA 4G2TA 1R9ZA 5DHRA 4DJAA 4WXYA 3EWXA 4IJWA 4W4QA 4EQZA 1I33A 1SVSA 1XCFA 2E5WA 4NHOA 3BH0A 3D64A 2C58A 3K13A 2EW8A 2VBIA 1AX9A 1SIOA 1M68A 1QNLA 2O2SA 4HAXA 2JAWA 1V3JA 1Z4OA 3BHMA 4KEZA 4KMOA 3ZC3A 3AT1A 2XB4A 1M8JA 2PO5A 5CYOA 1GNQA 4M0CA 3JRWA 3OC0A 1EFHA 4MKHA 4AP9A 3B82A 2RB4A 2WHPB 4XM0A 2IGTA 4G65A 4NP6A 1X8XA 4NBVA 3IACA 5D2CA 2VR1A 2LPMA 3VDQA 2CWDA 3IO5A 2FZ4A 4BPRA 2GARA 2P1RA 3LKBA 4P3XA 4UM9D 1RVDA 3DPSA 1XTTA 1M75A 3GVCA 1UMKA 4HXYA 2PHZA 1XNQB 2BHNA 1IN7A 1RW4A 3H0CA 5JD3A 1RM4A 2VFAA 3WLSA 3KNZA 1NN0A 3UGKA 1G8FA 4EX4A 1ZXLA 1FZTA 1X7FA 3DXIA 1V8BA 4YREA 2OK7A 3B7PA 4BC1A 2GQ9A 4RWZA 1G8MA 3SS7X 8AT1A 3JYNA 3STFA 3TZLA 4S3AA 4B9AA 3TJXA 3O74A 1ZS9A 4F2TA 3NDZA 4DX3A 3D3JA 4L5CA 5T4EA 4DOMA 3LY0A 3TN6A 4EJ2A 1GXSA 1FFXA 3OUZA 821PA 3W87A 5BV0A 3IQZA 4ZR8A 4ME6A 3HRHA 3ELDA 3WK0A 4P1ZA 4MJ7A 4BHTA 4JSTA 4Q05A 1XMPA 4FGUA 3PANA 1AGXA 3ZX4A 3BBLA 3RJTA 2JAHA 3W79A 4LV9A 1US3A 5HNRA 3R3JA 1THGA 4HSGA 2BHTA 2NUYA 2XZTA 3PJRA 3EUWA 3KLOA 1XKQA 2B34A 2PAAA 4KQFA 2ECQA 3RSZA 2QRVB 1VJCA 3CNHA 3RFFA 4LZOA 1QHXA 2FZKA 5ED0A 2K7ZA 1CJUC 3M5ZA 4FR0A 3CZKA 2IZ6A 4WERA 2V5LA 4W99A 3DBHA 3RIEA 5KZEA 2HD4A 3B5EA 3UYLA 1FFSA 4IAOA 3CAWA 4YY3B 3VMFA 2A9VA 2X76A 2OOSA 2CVPA 3A32A 4L76A 2PFGA 1JCNA 2Y1EA 1B3OA 2ZC8A 2PGDA 4P84A 5AN7A 2W22A 1VLMA 4MQEA 4K7VA 1DZ3A 3BF7A 3EQZA 3O7MA 2OFOA 3SQOA 1WE2A 4MB6A 1WP9A 3WEZA 3GVWA 4TKZA 3OLGA 4C6TB 4H9XA 1Q77A 5EP4A 2FVMA 4KRZA 1WULS 2NZ8A 3PJWA 5G2OA 3PK0A 8LDHA 4ZJUA 1BAPA 1SQFA 1EXBA 1XLAA 4B6JA 3AR9A 3TJZA 5CT4A 4OTKA 1ZR2A 4O33A 3FS2A 3FXGA 4F2BA 3RT7A 2XQJA 3ZVNA 2Z2AA 2UVQA 4D7AA 4E22A 1F2TB 3WRVA 4UXIA 1N2JA 2RBEA 5A6BD 2JKYA 5JAOA 1V6TA 3LDVA 4OQLA 4FKBA 5IJ9B 4DLBA 3I6ZA 4EHNA 2A9JA 3GDKA 2IUFA 1JILA 4JHZA 1ILWA 3ZUGA 4LOLA 5K0BA 4F2DA 2R14A 1J25A 5GOTA 2QR5A 1WDDA 2CL7X 4CHGA 1OJLA 3ASUA 2G37A 3JVIA 3LT5A 1AW1A 1PJBA 3NG3A 2ORVA 2AOVA 4X9YA 1E0DA 1K86A 1WPRA 1NOUA 4K7JA 4U2GA 1S2WA 2EYQA 3CM4A 2BMEA 3ABOB 1TYBE 1PCXA 2AN4A 1T5AA 4LXHA 4NY1A 2QD1A 1OG6A 2WWCA 4DWSA 3S8HA 3IPLA 3DXYA 2ZSKA 3I4CA 3HKDA 1QK4A 1ZD8A 3LERA 4RY8A 1K8CA 1Q7EA 4QFDA 1YZUA 2R7MA 4GZ7A 2IS7A 4ZKDA 2LVBA 1AJ2A 1XBYA 4JXJA 2EIXA 2ZYUX 3F3KA 4WKHA 3NUQA 3LXCA 3CN7A 3CZ5A 3ZCQA 3OZOA 5GADl 1GL3A 4B40A 4IHJB 5AOVA 5JSZB 3H7UA 4ZSTA 3OZAA 2JIDA 2KM1A 3NRJA 3USES 3WXMA 4CM7A 4F71A 1N6OA 1N7IA 3M5CA 2V68A 3TKFA 2JHAA 2FNAA 3DHEA 4UTFA 4PUJA 2IH5A 4QDMA 5IHPA 4YWHA 5CLWA 2ON6A 2ZRHA 1M04A 1HJQA 3R0JA 1QOXA 5CYGA 3ON5A 4YAUA 2MIIA 2QWXA 2ZJ7A 3M83A 5I4CA 2QM7A 2KX7A 3CSDA 1U5JA 1HURA 4AJLA 3RE1A 1V3VA 4JHOA 1RHUA 2COUA 4LRTB 4PMJA 2ZX5A 3P4XA 5I3JA 4BFWA 3A6ZA 5EERA 1OLUB 3VD4A 1UMBA 4YCMA 1KTBA 3P9SA 4RABA 2MSNA 2P9TA 5DMXA 4HSOA 4H7IA 3IULA 2H2IA 3GGDA 1FNMA 3QKTA 3UESA 2VZSA 4DJED 4LA4A 1HDZA 5D87A 1QJCA 1A2BA 3SYLA 1F6DA 5IEJA 3Q67A 3S29A 4KGXA 2RGBA 4EL5A 1ADOA 2AXQA 2GJAA 2PXAA 3RJ9A 2XIQA 3IBYA 1I0IA 3OQJA 2H7XA 2PSJA 2D0HA 2OX4A 2VA8A 4LJSA 4L8YA 1S2IA 2X7VA 1K8RA 2V7QA 1JBEA 1QP4A 2O07A 1KDPA 3OJFA 3G1FA 3ZHTA 2J67A 4DJJA 4I08A 1RAAA 3H2CA 3EWNA 1V26A 3HA1A 4PZAA 3TSYA 3L8HA 1H5YA 3BQMB 1UWIA 3LUJA 1XLLA 3U3ZA 1UQZA 2BSLA 3JQAA 4QDZA 2AGTA 4C6IA 3PVCA 2ZVPX 2G63A 1QH0A 1O6BA 4GUGA 1H94A 5IAGA 4ZT2A 3VKFA 4B0PA 1MD9A 4QBXA 1K6IA 4ZODA 4AJPA 4CNSA 1H0IA 3MJYA 4GX9A 1LROA 1W94A 1DVJA 3KSDO 3W76A 3FSTA 1E7MA 4HN4B 4K05A 2DBQA 3AHHA 4GGBA 1DKNA 2PDFA 1S3FA 2R47A 3AM4A 5BWMA 2C7QA 3B8WA 1U99A 3OU6A 4HBZA 2WIAA 2GUYA 2HISA 2OR2A 3SLRA 4D72A 4L4YA 1B3VA 4K46A 3WOHA 1GP2A 5ALZA 4Y9MA 2FGBA 4QUGA 3ZD9A 1AGPA 1WD5A 1BLIA 3G1UA 5KOJA 4ZRMA 3M9XA 3GVHA 1OH7A 3FUWA 3UXHA 3BARA 3AXTA 2VMFA 3S1GA 1L7VC 2G9VA 1ZUNA 4S3DA 4EPRA 5DLEA 4WZAA 2J7DA 1QQ5A 3AUXA 4JTCA 1LX7A 3T7VA 4CVWA 3I32A 2C57A 3ENZA 1LY1A 3DG3A 4Z9BA 2Z04A 1ZGHA 3MWFA 3NWPA 3M07A 2WW8A 3SPXA 5JO0A 3RO6A 1QCCA 3DG7A 1YC5A 4ZZ0A 1GY8A 3IUNA 4XUEA 2EO7A 1ZW1A 4PSVA 3PB0A 1EVKA 1WUTA 2VFGA 1X1SA 1J7JA 4W7SA 4O2RA 3QITA 3BK7A 1CQJA 4KWIA 5KCMA 3WIJA 1VP3A 4Q8WA 5DBIA 2WB2A 2Q8NA 4XRRA 5DCYA 4E5MA 1YKGA 2Z00A 2R2GA 4ZI3A 3NUKA 1GPH1 5TJHA 3A5FA 3CWHA 2O48X 3S8EA 1XE3A 6A3HA 1VTKA 3TF5A 5EYWA 1GOQA 1EP3B 1DIRA 1ABEA 3OO1A 1KZ1A 2PKQP 4L1WA 3S47A 3PSHA 4BQPA 4QNRA 2ZPTX 3QM3A 2QRPA 3AEUA 3RMJA 4QJ4A 5C2GA 4O1HA 2FSIA 4DWWA 1X7ZB 1Z0DA 1V11A 2B1RA 1D04A 5IM5A 1YXYA 1G20B 3D7KA 1Q65A 5D3MA 4DEVA 4AJ4A 2NZ2A 2A7NA 5I8WA 2Y70A 5LSMA 3UA4A 1Q0UA 4EZEA 1J1ZA 4YTSA 3E2MA 4K6CA 4DRYA 2SBTA 4Q1VA 5T5QA 5DIZA 2WXDM 1PW7A 4YS6A 1I2NA 5EAIA 5FUMA 2WZQA 5L3ZA 3EWUA 2PAFA 4NYJR 4HTFB 3SIMA 1V8PA 4UOEA 1B0AA 1PT8A 3FVVA 2YFNA 3JR2A 3OTQA 1T2FA 5EZSA 4EENA 4D8YA 2Q3EA 2J5RA 3ITKA 2PCLA 1SKBA 4GZ5A 4XJXA 3LQQA 4EUHA 4GVLA 2IIPA 4N0MA 2YRXA 4U2FA 4KODA 4X24A 3WQDA 2C96A 4JGDA 1MB3A 1UBTS 3USCS 3GNSA 1DKUA 5C7HA 2RGCA 4RL3A 2IC5A 4Q00A 1FYXA 1QPQA 1CPYA 2VSYA 1ECQA 2MR6A 5JSQA 3V7YA 4U2CA 3TD6A 3LT1A 4DGQA 4BATA 4IVRA 1C29B 2Z1XA 4GLOA 3GG1A 1O54A 2D2IA 4TZKA 1RHQA 1B0IA 1AHIA 3LWDA 4A6PA 2WV9A 3RARA 3V4OA 5KYGA 2XWQA 3GC4A 2NO1A 2PX6A 3PG8A 1MFPA 4JFUA 5FWXA 1OYYA 3K8LA 4F1WA 3DEHA 4JU9A 1RCUA 3VKBA 3Q7IA 3MRTA 5D7NA 5ALTA 1JQ5A 4WF7A 3DL7A 2P75A 3CIVA 2NPIA 1P6XA 2DMRA 1WEKA 3B4UA 5CHEA 4PTNA 2ZCVA 1G4AE 3EZYA 3ONFA 3MDWA 3VGFA 3H54A 3T2PA 3W7RA 4S3MA 5GQBA 4GUFA 5IYZB 4DQWA 1KQZA 3TR5A 1XD2B 3FMIA 3AJAA 4O4LB 4ZOCA 2GAFA 4BQOA 2N1MA 1UQRA 3PXCX 1DT5A 2C5GA 3VOFA 3GG7A 2J4CA 4FE7A 3R8CA 2W8BA 2DZUA 1FUUA 5DCLA 5CJNA 1H1LA 1WBDA 3ANSA 1XYFA 2RK3A 1HG3A 2R1VB 3RGTA 5C9XA 3D6UA 1P3DA 3PXDA 3TGLA 3AOFA 3P32A 3ZDAA 3JRNA 1L3CA 1P8JA 2RH9A 1F0YA 2J46A 3CZ8A 3DPUA 4RKQA 5KYYA 4O4JB 2QCLA 1ZM4A 5BQ3A 4IMAA 1DKQA 3W1LA 3O6VA 2I6UA 2XMSA 4OLJA 1HT3A 2X2YA 3R7SA 5BR4A 5HR6A 5E0KA 3T1HB 1IUPA 3IGXA 4OM7A 1WOYA 3ZNPA 3EDKA 3NANA 4AKHA 1RSCA 3HHEA 3R6DA 1UJ2A 1XALA 2B3DA 1L2TA 1VECA 4C1NA 3C5CA 3ZY4A 1X19A 1FLNA 5CAHA 3OHMB 2Y9MB 5CXUA 2D74A 4K5QA 2W9XA 2F3PA 1BXGA 5BWOA 3F3YA 4UQBA 4HMPA 1XELA 4G6CA 1AKWA 1KFLA 4LCBA 4AZ0A 3OTGA 1CGWA 3OIUA 3A13A 4JFRA 4FO4A 1CJTC 10MHA 3L6DA 4RIHA 3RPEA 2A9FA 5K0GA 3PG5A 5E3HA 3Q8KA 2VJPA 3DWIA 3Q8WA 3UTCA 2I78A