5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
2ZZMA 2GLUA 3N4AA 5B1SA 4MIKA 1UWVA 3BGDA 3HA5A 3DULA 1H1DA 4XUDA 4ATNA 4AZVA 5P8WA 2P1DA 2JJQA 4LWPA 3E23A 2I9KA 3DUWA 2AOVA 3KCJA 3TC3A 3HCDA 3K6RA 3GRUA 4HTFB 5EPEA 5FA8A 2C7QA 3PLAE 4XUEA 5E9QA 5JR3A 2GAFA 3UJ9A 2C7OA 3EEOA 2GPYA 4HGXA 3HEMA 2BZGA 1QT1A 3AJDA 4PYJA 2IDKA 4GJJA 4M37A 4F84A 5K0BA 4IKPA 1A0CA 2ZZKA 3I5UA 1EIZA 3BZBA 4PGHA 3V8VA 3PVCA 2FHPA 3CQHA 4XSLA 1G60A 2XIMA 4OVXA 1ZHFA 2B25A 3XIMA 1DIDA 1JQDA 3BANA 3DLCA 1HMYA 1L3CA 3EEYA 1XYMA 4U7PB 3TLJA 4QVGA 3T7TA 2LD4A 3RW9A 1KR5A 2PX4A 4BP3A 1XYAA 2GB4A 1KHHA 3ORHA 1EAMA 3LKDA 3EPPA 5B80A 1R6AA 1YFJA 4BLUA 3MCZA 3O31A 4RTLA 5BW5A 5MHTA 3HCAA 3ANXA 9XIAA 4YTQA 5DTMA 1XINA 5K03A 3FYCA 2PXCA 5HZMA 1KPIA 3FUXA 3LBFA 2AN3A 8XIMA 4V0QA 1Q0TA 3FRHA 3BWMA 5ICCA 4UOEA 2YQZA 5CM2Z 2EX4A 7MHTA 2YX1A 1XICA 1NE2A 3PX3A 4RTMA 6XIAA 5DXAA 2R3SA 3C6KA 3FYDA 4PWYA 3U0HA 2FCAA 5CD1A 3FTEA 2FK8A 5DT2A 4RTJA 4HSGA 3AXTA 3GRVA 1YFLA 3TKAA 4XISA 2YXLA 4IWNA 4EKIA 3C6MA 3P14A 4PYOA 3TKYA 5H1WA 3EVCA 5E9WA 3TR6A 1TW3A 1RI3A 2ZW9A 3BWYA 3E05A 1JG3A 3HVJA 4PYNA 4BLVA 5HOQA 3XINA 3G7UA 1UFKA 1FPQA 3B3GA 3G2QA 3S68A 5AVHA 2VDVE 2GS9A 3JWHA 4RTRA 1SQFA 4RTKA 4ZTBA 3NVMB 5E1DA 1MUWA 3QZAA 4IV8A 3KPWA 5K0CA 1SUSA 2PY6A 1XIFA 5K0GA 2BH2A 1S5MA 1M6EX 1NBIA 4HGYA 4PYLA 1SVUA 4GF5A 3KBWA 2R6ZA 2ORED 5ICFA 3SVZA 1QAOA 2G1PA 3KQMA 1SKMA 1RJEA 5B7YA 5E1OA 4KIGA 4Q7IA 3VC2A 3A27A 3CJQA 5BXYA 4C03A 2AOUB 1L1EA 3KQYA 3BZGA 5K0EA 3AALA 4IV0A 4PIPA 5KQSA 4DUOA 4GLEA 2H00A 1V39A 2ZIGA 4CKCA 3ITOA 1QUMA 5C9ZA 3DR5A 1X1DA 3BWCA 3IHTA 3OFJA 4RTNA 2ZCJA 3TM4A 1G55A 4DM3A 4C06A 3GNXA 1RI1A 2ZVJA 3ELYA 3PFGA 2UZ4A 3G8AA 5EMMA 3DBNA 3G88A 3LSTA 1D8WA 3IYLW 1N2XA 4U7TB 1EJ0A 1NKVA 1XLJA 2ZDSA 4GOOD 2QW5A 5D1NA 2P3OA 3LPMA 4ZBCA 5DM4A 5GM1A 2C7PA 2UYCA 4K6MA 1B42A 1XCJA 3ID6C 5LQCA 5LQNA 3P97A 2CKDA 1Y8CA 2OXTA 4RVHA 5FQOA 5E1MA 1KP9A 1KYZA 5CVEA 5EVJA 4E33A 3OCJA 3C0SA 1XLBA 4QE4A 2XVMA 3LECA 2PJDA 4OBXA 4XUCA 3RODA 5K8VA 1VLMA 2CL5A 3T7SA 1XP3A 3F4KA 5LSAA 3FTCA 3R3HA 3ME5A 4R6WA 2XINA 1D2HA 3A7EA 2NQHA 4EACA 3CGGA 3EGIA 3KU1A 4M7RA 2NP7A 2ESRA 5KVAA 10MHA 1MHTA 4FZVA 5I7GA 3GXOA 4RX1A 3V97A 2VDUE 5FWAA 2FPOA 4QE1A 3TPZA 3OPNA 4RWZA 4YTUA 2QM3A 3KR1A 3DMGA 2ZVRA 4HGZA 4HTFA 5HILA 1N7JA 2XYQA 2IPXA 3QXBA 3LCVB 2V7EA 3SXJA 5HIIA 3OU2A 3M33A 2B2CA 2B3TA 3P9KA 2I56A 3T7RA 3THRA 4RTQA 5K0JA 5GIOE 2NXNA 3A26A 4KIFA 3QOXA 1NW8A 2OPBA 3CC8A 1ZQ9A 5E1BA 3FUVA 4LECA 5FQNA 4EAYA 1ORIA 4KVZA 3KBVA 4FS8A 4PNEA 3KKZA 3CWHA 4DVOA 4ZB5A 2YTZA 1SQGA 3G89A 1M0EA 4F85A 4ZB0A 1XLIA 2FRXA 3CJRA 1KYWA 1XCLA 2X7VA 1A0DA 1WXXA 1YZ3A 2K4MA 2PWYA 2ZIEA 3LBYA 4PCAA 3PT9A 1X19A 2GH1A 3IUDA 2ZWAA 1OR8A 4CKBA 4RTPA 5T6BA 2HCVA 4RVFA 5F2OA 4YV1A 5EGSA 1I4WA 3ER9A 3R9XB 3CBGA 3C0QA 4C04A 1DUSA 3K0BA 5G02A 2UYQA 3SR4A 4YUYA 3ITVA 2AOWA 1XYBA 2ONZA 1VE3A 1I60A 3DLIA 4MQ4A 1VP9A 3HVKA 5FHQA 3GJYA 2IGTA 3R6TA 5ERGB 5K0NA 3CNYA 1MNZA 3KWSA 4QEHA 3LMZA 3P6LA 2JHCA 2N47A 4KRGA 2Y1WA 2PXXA 4FSXA 3MERA 4HHMA 3DMHA 1O1HA 3GRYA 4YMHA 4E30A 2BM8A 1XTPA 3BWBA 3NTVA 3KPUA 2CWWA 3OBEA 2O05A 2XYVA 3CVOA 1PJZA 1XDSA 2OO3A 1XIJA 1XJ5A 4R05A 1QYRA 2AOTB 1XLHA 4GOND 5DRTA 2NYUA 4A6DA 2AR0A 2BR5A 2EJUA 2PT9A 2ZZNA 3VSEA 2GVEA 3BUSA 5DM2A 1NW7A 1P1BA 3C0KA 4ZB2A 1JR4A 3JWIA 3KPYA 4PYQA 4QPNA 3EVFA 1YB2A 1BXBA 4E3VA 5KYGA 3B5IA 4RVDA 2IH2A 2NNWB 3U3HA 5B7ZA 2ERCA 3FPJA 3CJTA 4AX8A 3UZUA 1IM8A 4YUZA 1X1CA 3C3YA 1DCTA 1VL5A 1O9HA 3TVAA 3C0LA 2IDJA 2IFTA 2OB1A 3HCEA 3M6UA 3NDIA 3QV2A 4ISCA 4Y2HA 4M36A 3SM3A 5LQKA 2HNKA 1P91A 3CQKA 1L9KA 2EG5A 3M70A 4YUVA 1JG4A 2V74B 4G56A 1DE6A 1XYCA 5J8LA 2O07A 4RV9A 3UVAA 2AZTA 2Q41A 5H02A 5LR6A 3UFBA 3TFWA 2GYIA 1ZG3A 3O4FA 2Q02A 7XIMA 2AVNA 2OYRA 1YUBA 4XKMA 4OA8A 2YUIA 3NWBA 5EIFA 5FUBA 4PYKA 2P41A 4ER0A 2HMYB 4QE5A 1ZGAA 3DP7A 2JHAA 1QZZA 4AZSA 2XBMA 5EHGA 3BGIA 4CKEA 3EMDA 5U4XA 4E2ZA 3BKXA 3ERCA 2QRVB 1AV6A 2B78A 3LKZA 4E70A 2I62A 4QDKA 1WS6A 2YXEA 4P7KA 2NQ9A 4PCLA 4R6XA 1O54A 3AWIA 2AOXA 1BKYA 3UJ8A 3BKWA 4QQNA 3ELWA 3U81A 4PONA 2XISA 2PX8A 3C3PA 2DULA 3GO4A 3P2KA 3PS9A 4KDRA 2IIPA 2H11A 3VNLA 2NQJA 4OBWA 1FBNA 2HK1A 4EVIA 4P7JA 3KBSA 2P40A 3KTCA 3JWGA 5EMJA 1D2GA 3WQOA 2JH8A 5DPMA 5K0LA 1XIIA 3SGLA 3IUIA 3VC1A 4AZTA 2GUBA 3BT7A 4EMSA 3FZGA 5HFJA 2KW5A 4BP1A 1ZGJA 2EJTA 3L8DA 3KHKA 3LGAA 5EOVA 3GCZA 1IY9A 3HM2A 3UA3A 2X7WA 3KCLA 1IXKA 4FP9A 3EVEA 2HR1A 2Z6QA 5EMKA 2G71A 2QUNA 3I64A 3MHTA 1RI2A 4LNCA 1QTWA 3IV6A 4HRAA 5CIYA 1AF7A 3KCOA 3LX6A 2BR3A 3GDHA 4MWZA 5GP1A 4ER3A 5K05A 3PB3A 2O57A 1XLMA 4LWOA 1XIBA 4QQKA 2NXEA 3A4TA 4CXMA 5EMLA 1XIHA 3LDFA 4HG2A 1QAQA 4HH4A 2ZFUA 4RSRA 2PLWA 1JTFA 5FCDA 2WK1A 3JU2A 3P9CA 9XIMA 4FT4A 1HNNA 5EHIA 1NT2A 1R00A 5K01A 2BM9A 1KPHA 4KW2A 1Z3CA 2AVDA 2ZULA 5DX8A 4GJIA 1XDUA 3AXSA 3SSOA 3G2MA 4WVLA 5DSXA 4CWAA 4PYMA 3EVGA 4K1GA 1NW6A 2PT6A 3PX2A 2NXJA 3GU3A 2G0WA 2VZ9A 4ER5A 3JWJA 3DX5A 1VIDA 1TPYA 3L23A 2VP3A 1EJ6A 3SSMA 3SMQA 1CLKA 1K77A 3OFKA 1G38A 3G8BA 4E32A 1AQJA 4AZWA 1XLEA 2JH9A 3UJ7A 1RI4A 1ORHA 4XSMA 1X1AA 3LCCA 3NDJA 4LG1A 5LQRA 3UJ6A 3B3FA 3A7DA 4EK9A 3GIWA 5JUWA 1XISA 1RJFA 2NXCA 3GNLA 3DXXA 5F2NA 4R8RA 2HWKA 5DRYA 4EKGA 2PWPA 3OU7A 2IH4A 4X63A 3T0IA 1F3LA 5BW4A 5C0OE 1F38A 2JG3A 1XLKA 3B7PA 1O9GA 2OKCA 4W4QA 3HCBA 4JXJA 1KPGA 3M0MA 1INLA 5GINE 2OY0A 3AYVA 5DWQA 3TM5A 2HTEA 1XIDA 3KBNA 4GEKA 1EG2A 3LL7A 3MGGA 3FUUA 3LCUA 4FR0A 3M0VA 4XCXA 1VP3A 2GA9A 4GOMD 3WSTA 2PKWA 5TNVA 1SG9A 4PGGA 4CTJA 5DTRA 2AOUA 1PRYA 1QAMA 4KDCA 2YVLA 5XIMA 3UJAA 2BR4A 5FADA 1JQEA 2OZVA 4RTSA 1R74A 2ZIFA 3G5LA 5GIPE 3VNKA 5KS2A 2ZLBA 3X0DA 4DF3A 1JQ3A 5AVNA 5FHRA 3AAMA 3MTIA 1I9GA 1JG2A 2ZBQA 4X61A 3FPFA 3DOUA 5FWDA 3O7WA 5CVUA 3TRKA 4DZRA 4Y30A 5EKUA 2IH5A 3FTDA 3IEIA 5T64A 1XLCA 6XIMA 5GM2A 1EQAA 4AUKA 4BY9E 1T43A 5KQRA 5CCXA 2OU4A 5DSTA 5XINA 3UJDA 2DPMA 3VYLA 4QPPA 3NJRA 5DX1A 1WXWA 4H0NA 3M0LA 1D2CA 5CVJA 3UXIA 3R24A 3P71T 3NMUF 3ER8A 1BC5A 3FVMA 2OB2A 1TZ9A 3AY0A 3EVAA 3LDUA 4A8LA 2PBFA 2UYOA 3P2IA 5DM0A 5FA5A 4Z2YA 3D2LA 4QTTB 1S5NA 5DTQA 3G2PA 3UWPA 5FULA 3BWWA 2ZBRA 4HC4A 4PGLA 5E9JA 4M38A 3FTFA 4P7FA 3CCFA 2GLKA 5LQAA 5E8RA 1RJGA 1ZKDA 4RVGA 3I53A 5BP7A 2PX5A 4PIMA 3QC0A 2C7RA 5DM1A 1JSZA 2PV0A 2IBSA 4A6EA 4ER7A 3VYWA 5E2AA 3B89A 5EIWA 5E8JA 1QANA 2O0LA 5FTWA 1G8SA 4POOA 4YUXA 1VPTA 2Z6UA 2UYHA 3DMFA 3VNJA 1RI5A 1WY7A 4NECA 3HP7A 2AOTA 4YTSA 5DXJA 1FP2A 1FP1D 1I6NA 3I9FA 3OE4A 3OZSA 2G4JA 1VQ1A 3BGVA 3KQTA 3REOA 3TOSA 4MTLA 3HNRA 4A8NA 2P35A 3NGFA 4FGZA 4P58A 5D1HA 5EZSA 2NP6A 2VS1A 5EQJB 8MHTA 4QDWA 3PFHA 4YV0A 2ZBPA 3OZTA 2O06A 2ADMA 2XYRA 1XIEA 5M5BA 4DA4A 4ER6A 1UIRA 3XISA 5CUQA 4BLWA 4X41A 4GBED 2WA1A 4GC5A 1XLFA 4X60A 3KR0A 2F8LA 5ICEA 2P3QA 4YTRA 4DCGA 2OBFA 1DXIA 1NV8A 1RJDA 2XVAA 5IKMA 9MHTA 5E2BA 3M6XA 3QYSA 3EGVA 4QDJA 5ICGA 3ITLA 3M0HA 3HCCA 3A25A 4FT2A 3UJBA 1XIGA 2FYTA 3DH0A 3GWZA 3G2OA 1MJFA 4C07A 5EZQA 3KQWA 2HV9A 4L7VA 5C1IA 4MHTA 3UBTA 4RTOA 3ELUA 3GRZA 2QULA 3KPJA 3M0YA 1XLGA 2IP2A 5HIJA 4DQ0A 3B3JA 3BZJA 1BXCA 1BHJA 3M6VA 3P8ZA 4PINA 5GWXA 3HCFA 3DXYA 4KWCA 4E2XA 3P2EA 3G5TA 4OQEA 4C05A 3FUTA 3MB5A 3P9NA 4E31A 1YF3A 2G70A 3LHDA 2CMGA 1SUIA 4YUWA 2B9EA 4FSDA 1G6Q1 4GUAA 1N7IA 1DE5A 3ITXA 4C4AA 3HA7A 4X1OA 5HIMA 2H1RA 1P1CA 3KR9A 2ZWVA 3EVDA 3HVHA 5EG5A 2AN5A 4E2WA 1XLLA 1XVAA 5DLYA 3MTEA 4GC9A 5K0FA 2I57A 3UA4A 3MAGA 4B17A 3MCTA 5LQJA 4J4KA 4F86A 3SX0A 4QEEA 5CCBA 8XIAA 2AN4A 3UU0A 3EVBA 3ITYA 2PGXA 3TQSA 4DKJA 2JHPA 1XLDA 4PYIA 3UJCA 4GQBA 3VNMA 3KQSA 2PVCA 5IH3A 4A8IA 4PFHA 4OQDA 3OU6A 5K09A 4E2YA 2Z6AA 3NVKI 5EEHA 3ITTA 2IBTA 3HA3A 1XLAA 2VDWA 4XIMA 1TW2A 2P3LA 2PSSA 3CKKA 3EMBA 3M6WA 2Y1XA 1G8AA 3SSNA 3MQ2A 3AYTA 1DL5A 2G8NA 1KIAA 2P7HA 3RIEA 3BXOA 3QOWA 3OZRA 1L3BA 4US6A 5GOZA 3EVZA 3FPGA 1XYLA 2G72A 2QRVA 1YZHA 3EGEA 1YX1A 1VBFA 3M4XA 2PXAA 3BDKA 1XXLA 1A0EA 5HIKA 1R18A 1M6YA 2QY6A 5EKXA 1I1NA 2J6VA 1X1BA 3HVIA 4YTTA 3FPEA 1NW5A 3CQIA 3LDGA 1JSXA 1R8YA 5DX0A 4WXHA 4O29A 4QDPA 1Q0SA 3CQJA 5F2KA 4C08A 4OX9Y 5XIAA 2CMHA 4GOLD 3KBJA 4XIAA 2QYOA 3KPVA 2QUMA 1WZNA 3H2BA 3I58A 3Q87B 3P9IA 4V0RA 5EC8A 3E8SA 1OADA 1WG8A 2I7CA 1NW3A 2ZSUA 2YXDA 3ELDA 2ZTHA 2ONYA 4A8RA 4QVKA 5CVVA 3TMAA 4DCMA 4P7GA 5LQUA 2E5WA 3DXZA 3KR2A 4QTUB 1XDZA 3M0XA 3R0QA 4YV2A 1P39A 2P7IA 1BOOA 1GW9A 3KQVA 1AQIA 1NBHA 3PTAA 1XIMA 3OE5A 4YMGA 4R8SA 1JG1A 2FK7A 2WA2A 2YR0A 3GRRA 1R8XA 2HK0A 4KW7A 4RYLA 3THSA 4EQZA 3NW9A 3NWEA 4HHLA 3Q7EA 3VNIA 4CTKA 2AS0A 2EFJA 1DIEA 3DTNA 3FPHA 3FRIA 2A14A 3KBMA 5CVDA 4HNOA 2P8JA 3FUWA 3KQPA 5EEGA 3KQOA 4OA5A 4DMGA 1FJXA 5HEKA 5H6HA 1L3IA 3IUHA 1U2ZA 1KXZA 2QE6A 5T67A 1JTEA 1NV9A 3E7PA 3GGDA 4K3ZA 2I6GA 3HTXA 3KQQA 2PX2A
chains in the Genus database with same CATH superfamily
3OBKA 3AVQA 5TVKA 3ETCA 4D6CA 3VUSA 2G3IA 2C82A 4OMCA 1PZHA 2QCFA 1RNLA 1YJ8A 2G96A 1XVLA 1CBUA 2DT1A 1N75A 4LY6A 2OG9A 3EPNA 8ADHA 3SZOA 1MO4A 1DQSA 5KZ6A 5CM8B 3FRHA 2OX4A 2FK8A 2P90A 3W2HA 1BD4A 4QU8A 3QLJA 5DX7A 2D1FA 1KFLA 2J88A 1S2AA 1UFKA 1Y7VA 4GAEA 3CHVA 3V2GA 1CQWA 3V80A 4FC7A 4WEOA 1LF0A 4YDSA 5JVDB 4HNAB 2V9CA 2XUJA 4XH9B 1ZJWA 2Q3LA 2HJPA 1WPGA 1DO2A 3BZGA 2WY2D 4L1WA 3E9MA 4LS3A 3E9EA 3EZ9A 4O4LB 2ZRLA 3JR2A 1SUFA 4PTVA 3FGCA 2D7CA 2YBUA 3QKZA 2VHVA 4K6MA 1MVLA 2FN9A 4D42A 1YHNA 5AKQA 1ZHHA 2BBSA 2ZITA 4FDAA 5JJLA 1LTKA 2J74A 2NQHA 3ZJVA 1YIDA 3L0IB 2C9OA 2VTDA 3CO0S 5FCZA 1JXQA 3OA5A 3S1AB 3VABA 4I9JA 3R0JA 2R14A 2HW8A 1N9GA 3WDRA 1JVSA 3NP7A 2A5LA 5L7YA 2Y5SA 5SZJA 5BNFA 3R7WA 3U1VA 1I0IA 3UJ3X 5ITVA 1QK2A 5AVUA 5M34A 4OFCA 3E3NA 1GUDA 1ZOSA 1AD4A 1U0JA 4YR7A 3S55A 3R6TA 4IRMA 1EKXA 3Q1KA 2JA2A 1RJQA 4I4TF 1OG6A 1CDDA 4IGIA 2AMJA 1VZ2A 3ZBPA 1DV7A 3OE1A 4O2AF 2PUBA 4HLDA 1QH1B 1CE8B 3K9FC 1L6RA 3P5ZA 1JBKA 3KKMA 1CNMA 4BWFB 1BXGA 4URHA 3ICJA 1EOKA 3GDRA 3VKUA 2FH6A 2C98A 3UVAA 3SG0A 5LBTA 3VHLB 3IRVA 1ID1A 1YVRA 3UWMA 1C7JA 1YMQA 5U4XA 2MR6A 2SKDA 3KT3A 5DBHX 2OO0A 3KTDA 3T94A 2JH8A 3ESYA 1XIIA 3HN3A 1Z15A 4P8VA 1XXHA 2OT3B 2J7PA 3HJUA 3I04A 4KTTE 1SEVA 4XLLA 4ZCWA 1YPIA 3IV7A 1G2IA 3RMEA 2G0NA 3NYIA 4CW7A 1TNDA 1XRLA 1UMCA 1GTMA 1NOKA 1BS9A 4FILA 2CFOA 1XTZA 2DWUA 3FWNA 1QSGA 1RHMA 5CIQA 1SC3A 4X64B 4NYIR 4B3CA 3N6RA 1SB8A 1XLEA 3KSMA 3AUAA 4LG1A 1FIUA 2A4KA 2RIRA 3DC8A 3DBVO 5IBCA 3TWBA 3H2YA 2PGAA 4PLZA 3NO3A 4HGNA 3H65A 4JX5A 4TV9B 1NATA 1G16A 1QHFA 2OYSA 5JI2E 3BB3A 4BO4A 3CKLA 4ZZ3A 4GM0A 3H2JA 3PDHA 3HV9A 1WULS 1P81A 3FOEC 3AAMA 2FA9A 5LDDC 3TXXA 2IH5A 1NVUQ 4N5IX 2X6RA 3VHRA 2F59A 4HP5A 2E68A 5IK2A 1S02A 1P75A 3RUCA 3W1TA 5LIYX 2AAAA 1ZBCA 2WWYA 1SKQA 3EIFA 4WKGA 1OU0A 3ZXUB 2BTQA 2ALJA 4PUMA 4DIKA 4Q8TA 2GEBA 4JTTA 3B6MA 1VFPA 1Y9DA 5TQ0B 1DWOA 3KQTA 3SM9A 4DBEA 1N9KA 3EOZA 3B7WA 3AIUA 2ZI3A 2PBZA 4PH6A 1A9SA 2H9YA 2Z8YM 1SJAA 5CTAA 4IM7A 4YAOA 3STXA 3LI0A 5LA2A 1N2JA 5J2UB 5K4ZA 1U0RA 3V6MA 4U0KA 3KHJA 4YPVA 3H9CA 3QHQA 5KTPA 4AB1A 4CD5A 4Y1RA 2VJPA 3IJPA 4LYRA 1NVAA 3B38A 4HBZA 4FNAA 3QMSA 3J81k 1JALA 5I7VA 1OXUA 4NSBA 3QUTA 1YL7A 5BN4B 3R3YA 3C74A 2YV2A 4QBXA 4ZMSA 3LA6A 4E38A 2FOIA 5PNTA 3LUTA 4PFHA 5FSDC 2VP6A 3AYTA 1PNTA 3AR5A 2W6RA 3RSZA 3HQ1A 3PIIA 5GQSA 2WZMA 3F90A 2VBFA 2J67A 4AUMA 1UWQA 1JFLA 2GDUA 4FZRA 3TFCA 3KLBA 3GPDG 2J13A 4YYZA 4MCIA 4LXXA 4UNIA 1P2VA 3EQ7A 3L8MA 2O0JA 3FKSD 3HHEA 5HRCA 2QDGA 1GOMA 1IZZA 1KI1A 3BV4A 4M1SA 2Q4TA 4UOQA 3VBEA 4NYJR 4EVSA 4GNVA 1C1YA 4HSNA 1S7GA 3U4GA 4CM4A 5CPLA 4WOZA 3FMIA 3QOYA 3VAAA 5P8WA 2MSNA 3EPLA 3EPRA 1DZ3A 2FXIA 1W0JA 1Z8DA 4OK6A 1GYRA 1S89A 1W94A 4OATA 4IO1A 4BB9A 4RZBA 2ONCA 4IXDA 5ENLA 3NTRA 1T3ZA 3OZOA 4I6JA 1DIDA 5CRIA 3IIOA 4K7VA 3LZ6A 5JSQA 3TCSA 4RVOA 4ZYWA 3HKEA 4OKIA 3EOAI 4LDAA 4LJRA 2FFCA 3CUIA 4U1RA 4IGHA 4X1YB 1LF1A 1KMHA 4KBYA 4X1KA 2R00C 2H48A 3F67A 4C5YA 1DAKA 2PK3A 1XSIA 2O19A 2GAOA 1O6BA 2PF8A 1AB6A 2DKOA 3NTOA 1Y6QA 3HHPA 4GBGA 4N7RA 3EN0A 4IIHA 3I6BA 1WZEA 3N2KA 4AZ3A 3WY1A 4HOWA 4DC9A 3LSTA 2QX6A 3M0ZA 2RHDA 4EGCB 2ZZ4A 3LPGA 3I3DA 1PV8A 1OD8A 3GDFA 1HYQA 2IC5A 3C0SA 3EQ8A 5K5EA 5KBYA 3SOZA 3GD7A 3CEMA 5I3GA 4W5QA 2VUNA 2OZPA 3G3DA 3O5AA 1WCGA 3S1XA 3A12A 3KUMA 4B45A 4OQNA 4A0SA 3ODPA 1XNQB 2W2LA 4LRYA 1DDGA 4RHYA 2IUSA 3UNXA 4D9IA 4NI3A 4K8RB 2B3TA 1RZUA 3QF7A 4PMQA 2J9FB 3WK5A 4R16A 1UL1X 3AVYA 4BU0A 2YBVA 5IDVA 1AQLA 1ORIA 4XFJA 1MO6A 4R9XA 3WMSA 3R79A 3FMOB 2ADOA 3OA0A 3N2ZB 3WYNA 4KNYA 5ADWA 1R0ZA 4FHAA 4X66B 1LFDB 4L65A 3G17A 5FLKA 1IE7C 3ZU3A 1L8XA 4FMPA 4O1HA 1KU6A 1K8QA 4P61A 3LLCA 2JLCA 1GZ3A 5I23A 1OFQA 1NY1A 3GELA 3VGPA 3UZUA 1GOXA 3VTRA 2F64A 4JK3A 4OG2A 1JG4A 4MOWA 5B2ZA 2LZ0A 3OMWA 4P93A 3WLTA 4D81A 2QT0A 4EW3A 4LK2A 5IT4A 1XEWY 3KYJB 2VA9A 1R8QA 4DXDA 1UPXA 4M1KA 4OX9B 4V28A 1UUQA 3FVVA 4EGSA 4L95C 3W24A 4UMFA 4XD7D 1TYAE 3ANSA 3K3PA 1R6XA 3P81A 2Y7FA 3RQSA 3CW8X 1CXLA 3LHIA 4D98A 4TV5A 4ML4A 2ZIXA 1LLCA 2PRKA 2O48X 1Z3CA 1VBNA 2WRZA 2ZIDA 1GEEA 1F61A 1Z6XA 3EH2A 4WNIA 3QVQA 3LUGA 4YB8A 1AMOA 4O6VA 4IGMA 4MGIR 1M34A 2RGAA 1NI4A 3RFVA 3CASA 3PDCA 4KV7A 1I0LA 5M29A 3DFIA 3RS3A 1G4AE 3NWRA 3A9WA 3OQIB 2XV1A 3B8WA 1DRVA 1EF3A 3ZWYA 5CX1A 2OCDA 4TQAA 1FQKA 1L4FA 1JDAA 3AIRA 2WUVA 3FPFA 4G1FA 3W0LB 4DV3B 3F1QA 4YXFA 1YVDA 5IXSA 1LH0A 1FRVA 1OFIA 5HNRA 2VBGA 3A3KA 1YE6A 3R8XA 3AC0A 3UWKA 3S5ZA 3OLEA 3JARA 3WLIA 4XCVA 2JFBA 3T78A 621PA 3T06B 1U3CA 3NHPA 4OJQA 1FHDA 2QT3A 4J27A 4F4IA 4QDWA 5DYWA 3THOA 4TQGA 1TIMA 4GH1A 4KN5A 5EI5A 1RP1A 2PUAA 5AHKA 4Z1YA 3C5CA 4E0BA 1L6SA 1JQBA 3GWZA 5TR9A 1ONPA 4YAFA 1D7OA 1FNNA 5HIJA 5IJXA 2CLDX 1IZ0A 5GV7A 2K2QB 1SVSA 5DYIA 4JAWA 5JAMA 1ZN2A 3L1IA 3N7TA 2I3ZA 2DVMA 5HUQA 1Z16A 5AKGA 2HCRA 1A5AA 1FU8A 4RDXA 3SS9X 2P5NA 3EOBI 1P74A 1L0PA 3HRKA 2I57A 1W5BA 4Y2YA 1YR6A 2Z09A 4DILA 1NQTA 2GEFA 4WGXA 1UBSA 2FMXA 2OAP1 1T8PA 3SYNA 1A3CA 1BTCA 3V5FA 2Z56A 4EXAA 2F2HA 1M6YA 1VCVA 1GL9B 4MV5A 4UFJA 1YDYA 4TYMA 2NX2A 1REQB 3I3SR 4YU1A 2VHYA 4K9DA 4KWTA 2AI1A 3R8CA 1PDZA 1M68A 5FBKA 4PTYA 3SN4A 1EJ7L 1NAHA 3F2CA 3QQWA 3PTZA 2HIAA 5HWSA 5DMYA 2GN8A 1C92A 3UNDA 1GTSA 1UOQA 1ZJ5A 1H1DA 4LF7B 2PDLA 1SUPA 1CX9B 4RDHA 5D01A 4AD3A 3HOJA 5J1TB 4UBNA 1ZOOA 4E21A 4EMTA 4CT4B 1IC6A 4JI6B 1D3HA 3ONEA 2D2OA 3FYYA 1W85B 2D0HA 4GVLA 1X97A 3OZ7A 2PS9A 4EWLA 4WDWA 1KPIA 3V2UA 5HJ2A 3NQMA 5A2BA 3OEXA 1F2TB 3SC4A 3W53A 1U98A 4HPXA 1WKCA 1YA8A 3VPSA 1QKIA 5ABPA 1K98A 3E4CA 3E03A 1CRQA 3T41A 2EBNA 4DCOA 1FU7A 1R6DA 1L8OA 1H60A 2G83A 2ORED 4M60A 1KAMA 5AB3A 2E1DA 2WW8A 1TVNA 4PUNA 5EZYF 4UD2A 3WQCA 1CG6A 2WG2A 4O4IA 1SUAA 3VC3A 3VU8A 3A6JA 3IBTA 1D8WA 1R9JA 3PPVA 4OHPA 1IIRA 1WXQA 3IGUA 4LF1A 2JI7A 2W6OA 2PKRA 3WLRA 4A2PA 4RJKA 3QF0A 1Q1BA 1ISFA 3D3WB 4YALA 3LCLA 2NU9B 5BMVF 4F2HA 3AU9A 4ZO6A 3GXOA 5EXDA 3IO3A 1TPUA 3EUFA 4O1FA 1ODJA 4DNHA 1HDRA 1LK7A 1C5KA 4DWOA 4Q4MA 2WTBA 2CXUA 2NXNA 5AJXA 4O4HA 1Z5ZA 2BFBA 4OHOA 3ZOZA 1VPVA 4LY3A 2Z8YA 4DA7A 3QI2A 1P33A 3EWDA 1TVMA 1LYXA 1T8YA 2I2FA 3FVDA 4JT8A 2PXXA 3QGAC 3UAZA 4XKYB 1XI2A 1GZJA 1QJWA 2FFAA 4Z9FA 3X2EA 5EE5B 5B5SA 3WDMA 4F0RA 2OHVA 3LG3A 2X3YA 1ZRNA 4GMDA 2QTCA 1C30A 3OUUA 2JIMA 5H02A 3A2MA 3TE7A 1OFHA 2YXPX 3MPOA 4QXAA 3B1WA 3ZE1B 1ZX1A 3A10A 1WU8A 5CD9A 3QV1A 4D4JA 4I5IA 2PP1A 3QX8A 2Y66A 4L9RA 2CMDA 2O0TA 1N25A 3IUIA 2FX5A 4EMSA 3LBNA 5FDFA 3M4NA 4KACA 1UJ4A 2VEIA 1OFGA 1Z38A 2J1LA 1JWLA 1RI2A 4RHCA 1YDMA 5IAKA 3NWPA 5JATA 4FI4A 3B20A 5E4JA 2V2DA 4TWAA 2GBIA 4B16A 3AT1A 4JP2A 2FJPA 4X44A 4HQLA 3R7FA 5I3DA 1UJ5A 2PMEA 1CK4A 1SKYB 1JNEA 1YS6A 2X41A 3B1XA 5T8KA 2ZRJA 3PSVA 1WLYA 1C9NA 3SUVA 4ZHQB 2W2QA 1W1UA 1XMXA 3QY6A 4P53A 4OGGA 1EZZA 2R6R1 4RPJA 3QPUA 1KI3A 2J31A 2B36A 3GY1A 3WGUA 1FUIA 5TNVA 3CNLA 4PBSA 2ZJZA 2Z08A 1QG4A 3WGVA 3I3EA 2Q50A 1IXRC 4YAIA 4OL0A 1GR0A 1C1HA 4BVLA 4FA3A 2C54A 1C8KA 1UDXA 3H5RA 3STVA 4WNAB 4OAOA 5HA5A 4DBDA 3RS0A 3W05A 3UKJA 2OBXA 4BNVA 1C30B 4UNPA 3VK5A 3VVMA 1XCWA 2YJ6A 1YS7A 2L0XA 2BFFA 5KREA 5ITSA 4KMMA 1QFSA 3VNJA 4ZI7B 1K5HA 4US5A 3KFVA 1V02E 3DG7A 4C60A 4MVJP 4DMCA 2VQUA 3AB8A 3PF8A 2CLKB 2P9HA 4IR7A 4DA4A 5K51A 4M0LA 2A9KA 2HLHA 1EWTA 2Q4RA 4AS1A 4U3AA 2W42A 3EMKA 4JKIA 1KXQA 1TX0A 1A96A 1GO2A 3YASA 5KYWA 3A4MA 1QRSA 3KSAC 4TS9A 3T3EA 1VIAA 3BZWA 3AR7A 5IDQA 2B9EA 5LGZA 1ZK0A 3DHEA 2TS1A 2PZLA 4QFUA 3JQ8A 3LENA 4I1RA 1B3OA 4PYIA 1HL2A 2VDRB 3BYZA 1JNXX 3H4GA 4OYYA 1ITUA 5F9FA 2Q0QA 4AL4A 3DZJA 3W2UA 3FHOA 3KSZO 2XE8A 3PUEA 1JQJC 1ISVA 1JEYA 4LHVA 1B3BA 3SHTA 1TF2A 1YJXA 5B30A 1I7NA 1FWEC 2J9XB 2YXDA 3V5CA 3VQTA 1W0JD 4GZ6A 4Q7BA 3E58A 4BGIA 2UUOA 1WSBA 3N0WA 1QGDA 3HPFA 4CQMA 2WMDA 4GVFA 2E5BA 4DR3B 4Q1EA 3KBMA 3M6YA 1EXBA 3ZWDA 1BD0A 2VZ8A 4AVFA 4XX1A 2IZ1A 3DP9A 2I99A 1Z33A 4Z0TA 1RVKA 2GQ8A 3TIVA 5DOZA 1V45E 5L9AA 3E0FA 4DSUA 4I5XA 5EPEA 4A10A 1X7GA 1RYBA 5AC4A 3H9EO 2A1UA 4BO6A 1J7KA 5IH7A 1JHRA 5KX5B 4A35A 4GL2A 3VNUA 1BVHA 1HMYA 1FYDA 3UGVA 2RKXA 3VZYA 5L9FA 3A24A 4CEJB 2GVZC 1D7KA 2ZE5A 5TDHA 4KT2A 4PCVA 5I4CA 3JQAD 1P80A 2EKQA 1K3FA 3K9BA 2PSDA 1E1EA 2XZDA 3MKCA 5D2WA 1H4TA 1CJUC 3G7UA 3M5YA 3UT6A 2AMXA 4WLNA 1W5MA 3SCPA 1WKVA 1A9PA 5BQFA 1PZ2A 2OWDA 1DJIA 2QQFA 1S5MA 1VIZA 4F5DA 4K86A 2EF1A 5ICFA 4FNRA 4YVFA 4PC2A 5IFLA 1ZS9A 1OI4A 3MINA 4GLEA 4CIVA 4LFBB 3S2IA 1XEWX 1VBMA 1F3XA 2QW5A 3LPMA 1ORRA 5DF1A 3K70C 3U3KA 4QIUA 3VIGA 4IFTA 1TR1A 1YUNA 1A9RA 3VZZA 2QP4A 3B7GA 1C29A 5DN6A 1UXJA 2GEVA 4UR9A 2VF8A 1IBSA 4MHOA 1FFHA 4ZZ2A 3WD3A 3SE7A 2XYQA 2BZNA 3U7JA 3P7YA 1H23A 5DW3A 1RCQA 2DPXA 3KD3A 2F4VB 4IG9A 3FUVA 4U9UA 3S2UA 2ZX8A 2TSYA 3SQLA 2DH3A 5CZJA 2JEOA 5TLSA 3LBHA 1JRLA 5HBFA 2R4UA 4AY1A 1U0GA 2AD5A 3CNYA 4HUTA 3PUIA 1LUAA 2ZATA 5HM6A 4BVHA 4FDTA 2AOTB 1YDHA 4HCLA 2VM8A 2QQ6A 4MYCA 3OX4A 2J5BA 3C3YA 5CJNA 9ABPA 5KJ1A 1V41E 1GL6A 4H6PA 4WSOA 1AGRA 4RESA 1RY8A 1OILA 3TSYA 1EQCA 1DEHA 5I9LA 4QQ8A 1GGEA 4PAWA 3DDUA 1N2EA 1W9MA 4FX2A 1YE3A 3N2IA 2YDQA 4UTOA 4ZE5A 4L5JA 2X5NA 5FL7D 1UMBA 4QUJA 3VR5H 5AOAA 2PZJA 2E67A 1U5HA 3N05A 3N0XA 1T4BA 1QVAA 3KYDB 3C7DB 3KHKA 3TNYA 3I9V1 3DYOA 5F51A 5I7EA 5AZ1A 1PLKA 2O9OA 2ZYIA 1ZGCA 2EHDA 1K7CA 2GF9A 3QJGA 1H5YA 1JF8A 4DM2A 2NVUB 1IBKB 1MTZA 3W6LA 4PC1A 3AF2A 2OYCA 1PFKA 3ZZUA 2VXCA 3IX7A 4GJIA 4EMUA 3HG5A 3SS7X 5JDIA 2O2IA 5K2OA 2QD2A 4ZVVA 1KYIA 1QRRA 1OYYA 1HDOA 4JUDX 4NE7A 4PPYA 4RZXA 2G3FA 3DDOA 1YZVA 2FX2A 3TW4A 5ALDA 5CR9A 1KA9H 1LOQA 3WJZA 1GT91 1HJXA 2QZ4A 4L76A 3W6PA 1X1NA 1WQ3A 2ZSFA 4RW0A 1LCOA 3BJSA 3QMPA 4INOA 4MJZA 4D6FA 2A4AA 1LPNA 1OYAA 1O6IA 1ZI9A 5TPZD 2RGNA 3KSDO 4RIHA 3ZSTA 2AQWA 2JF0A 3NEVA 4JDBA 3II6X 2WQZA 2X4IA 4BEJA 4EL5A 5GOTA 4V1CI 3P9ZA 3ZIZA 3HURA 5GAJA 5LNVA 3ZHCA 4O57A 2NOAA 4IXXA 4DRZA 2P6UA 4MWAA 1V3IA 3VCCA 5F2IA 1UXKA 3VM7A 2VBIA 5CBPA 1JI2A 2E4XA 3JQBC 2XT6A 5FB3A 4XAFA 3Q4GA 4MYHA 1IIBA 4G36A 4ENLA 1A4LA 2BM0A 2QT9A 3L0SA 1HT3A 1U9CA 2WJAA 2VGIA 3N6XA 2FZBA 3A4IA 2J27A 2O14A 3ZV6A 1BKHA 4ASUA 3GDKA 2OLKA 3BB1A 1QNVA 1MRZA 3UJBA 2XGOA 1RJ9A 1JXKA 3NORA 1UZAA 1PR4A 1OGYA 1AUXA 1BE6A 2FIQA 1TZMA 1G6Q1 4Q22A 4TVUA 1SO6A 1VF8A 5DCLA 5AICA 4DGQA 5HK4A 4GISA 1AGPA 3VDXA 2DR0A 1ONOA 1Q19A 4TYPA 1R37A 4ZEOA 1R9YA 2B8TA 3OSUA 1CWYA 5COQA 2G3NA 2BKAA 3WQ4A 1FMCA 3SU8A 2XDQB 1PL9A 2A1UB 3OOEA 3OOJA 5IKPA 4PZUA 1YL5A 1BG9A 2ZX5A 3CQIA 2MCFA 1WUHS 2ZA1A 3AFIA 1ZH6A 1TM1E 3LUKA 2UUBB 4KWCA 4D2IA 2NQ5A 3PCRB 5JS2A 3EMZA 1POXA 1QC5A 4XVQA 3W77A 2ZDQA 2Q46A 2WVUA 3HQNA 3LT2A 4GC3A 1DJMA 2VR4A 2XDAA 2QYTA 3F8SA 3OLIA 2AKAB 2FPGB 2VEKA 2I1WA 1QFEA 2QE7A 1CZ1A 2C3ZA 1IT7A 3K2EA 2XTZA 4PA8A 4FEEA 2W91A 4Y9MA 3C1TA 4HGOA 1M8GA 3U4MA 4CUCA 4MI1A 5MGNA 4GH5A 3KVLA 2QGFA 1ZC3A 1MKYA 4B31A 5KQGA 3EFEA 4WD3A 1SHZA 1AMYA 1YRWA 1ESEA 3EARA 1E2LA 4XCQA 2Y2UA 2OEJA 1IY0A 1GY8A 2C9DA 5K9DA 5AECA 3M5CA 3LPCA 1AUQA 1HKKA 5ESXA 5DT7A 1U7PA 4PU0A 1YJCA 1KZ4A 1FDOA 3M07A 3O63A 1NXQA 1E7MA 2I8LA 4YQFA 3UH1A 3RV4A 4O14A 1ACJA 2AOUB 1HKIA 1PCWA 2C2MA 5B6JA 5F7XA 3G8EA 1Y42X 2NAPA 3ZDFA 1E77A 2CDBA 3OHPA 1DQZA 3OIYA 2QDDA 3N3BC 4G41A 4US5D 3NL3A 4U2YA 1M0TA 3BSSA 5TRTA 2WM8A 1JEAA 3ICPA 1BRLA 4C6SA 5IUKC 2GD2A 2VP5A 3RC1A 3AXMA 3HN7A 5EJ2A 2I2WA 2H4WA 2QBYB 3OFVA 3AXHA 3FYUC 3DAQA 2HXSA 4GXWA 3ORSA 1P0QA 4M49A 1JIKA 4UQ9A 2FF5A 3R44A 4HNNA 1W5SA 1G9XA 4DELA 2VHLA 2V8ZA 4E07A 3HU3A 2ZJ7A 2FE1A 2JKEA 4NAUA 4NAEB 4MQ4A 2C2YA 2WZCA 2IS6A 4ZJUA 3ORYA 4H1TA 3JATB 3F6YA 1EBFA 3AEUA 3IDZA 2GCEA 4TX8A 4PRKA 4YXWD 3RYSA 1YFZA 4JY8A 2YL5A 1CUUA 1P91A 3APGA 2XJ7A 4ES4A 3MBKA 1BVNP 4FYMA 5FUBA 3MDUA 1M54A 1FH7A 3I2YX 4IPLA 2NMVA 3H7IA 4IDHA 5I7SA 1PO9A 2BUAA 4XRGA 1XBYA 2CLEA 2E4YA 3OEED 3G0IA 1VZWA 1OZ0A 3FGZA 3CRRA 1PKXA 4TLBA 3QKIA 1N0VC 3LY5A 4AMCA 5J04A 3A1UA 3C8DA 2CBJA 2BEKA 3KVRA 2P62A 4OOZA 1YZNA 2CDCA 3ESDA 3WV4A 5ARDA 4WPGA 4UTTA 2Q5CA 1XIBA 1Q6YA 3G22A 1E3DA 2MSEB 4JN7A 9XIMA 4CODB 3AHXA 4IOTA 2XXBA 1IUPA 3EXEA 2XNSA 5JAPA 3QY8A 2QZPA 4CQBA 5BV0A 3DC0A 2XUIA 2I2DA 1CGTA 1Q83A 3JD4A 5C2GA 1DPGA 2O3QA 4MJ3A 1IZKA 2D3LA 1S38A 4OQZA 3O7MA 5L3QA 2F1JA 3B1JA 1DARA 3SDZA 3KBNA 3LCUA 1HXHA 2FLIA 3A21A 3MDWA 1QAMA 1H4PA 3N3AC 1EAYA 3QEMA 2PBGA 1ADGA 4NNOA 5I3HA 2ZLBA 5AHFA 4LE1A 3RIGA 3W6OA 1ZD8A 4PSUA 5IRPA 4RUBA 4HF7A 1TIBA 2D8AA 2IEZA 1FTSA 2PRIA 4FNSA 1J07A 4B6EA 1B43A 2OGWA 5E2AA 4MRVA 3VCNA 5NULA 1L7QA 3GGSA 3NHKA 3WN6A 2CHVA 1TADA 4IIJB 3ARQA 2VNKA 3W90A 4MYAA 5HRUA 2JBAB 2ADMA 4QBHA 4LDJA 4PTLA 2C1XA 1N8NA 4ZAFA 2BBFA 1ZSNA 4JA0A 6CHYA 2QSZA 2YXGA 1JP7A 2PANA 3MWFA 4HWPA 1FU4A 3VUFA 3GRZA 5A4MS 3IOYA 4Q8WA 5JPIA 2GGJA 3EZYA 1O08A 4IPPA 3O6YX 3PSAA 2O59A 1Z0IA 1XDDA 4IFBA 4R2IA 3KZSA 2NACA 4KXXA 4DM1A 2NPFA 4QEEA 4M55A 3UCFA 1FFSA 4E11A 1KJ9A 2WZHA 2VX4A 1OTXA 1NRWA 3BRWD 3H2KA 1TG7A 5JCPA 3I7SA 1H5QA 2GAJA 1TAGA 3BTUA 2P4UA 2V54A 1KM2A 1NW5A 4H60A 1Q63A 1R8YA 3WFJA 2BBWA 1Q0SA 4MKZA 4RGVA 3B3DA 3FNIA 3EFBA 3OZWA 5ANRB 2Q3RA 4HN8A 4EJFA 4H2HA 2NYVA 2WWHA 5GZ3A 2B1GA 3CUXA 3GZ3A 1X6VA 1YAHA 4XVHA 3O2NA 3AS2A 1KQYA 1W59A 1S2NA 2WJ3A 4G8JA 4R3NA 5BSFA 4UOJA 1Z5VA 4WCVA 4ZQRA 4AB4A 4NZCA 2VCAA 4N41A 2P1DA 2V96A 2C42A 2V6IA 5HMLA 4PCPA 4LF9B 2ZRBA 5JS8A 5CCEA 1WCV1 1LLQA 1QH8B 3A6EA 5LZ2A 2BS9A 3CQHA 3CYVA 4JI8B 1U28C 1ZMRA 2P68A 3ASVA 1L7MA 4RPPA 3QLLA 1XC6A 3FCPA 1M41A 1WKEA 4LGVA 1QHHA 4H9UA 1XCPA 1OYCA 3NOVA 5AI5A 1ISPA 4OM8A 4CF5A 6AT1A 3D6MA 1BQEA 2BGJA 1N2BA 5D3KA 4BL5A 4MQLA 4LMPA 1K75A 1LBTA 4CCSA 1XIFA 5GJCA 4BNKA 4M0EA 1PGNA 1F0KA 1NVKA 3TM4A 5J5RA 1NXOA 4YRBA 1SCDA 2JJYA 3R4VA 4JUBA 4OFWA 1Z47A 4D8VA 1JAKA 5KEIA 1VCGA 1Q4NX 3CIWA 1K63A 1QB8A 1T6YA 1SBYA 4J29A 3NO5A 5JD4A 1OJXA 1KEWA 1XK6A 2EX0A 3KXLA 1ISYA 3X43A 2C8VA 1NDWA 3GKFA 1X8JA 3V7UA 2YIJA 1BYAA 1VMDA 2PUDA 2G06A 4LDNA 3CTMA 2X2OA 3K1YA 1E9AA 3I72A 2RKWA 3JQ7A 5AC6A 5F9MA 3LBYA 2C7RA 4B2LA 1LU9A 4JKMA 3CV6A 4JYBA 2PKYX 3ER9A 2VVNA 1EA5A 3TDNA 2OFXA 2PRYA 4ZHQF 1E3ZA 3HLYA 4N4QA 3OA3A 1T0IA 4JQ1A 4W8HA 5AHXA 4EPXA 4AQYB 2GVEA 1XFDA 2BMEA 3MVEA 1NLYA 4R1SA 1ZUAX 5TNXA 3GUGA 4HRVA 1V6AA 2G4VA 1E6ZA 1UKOA 4JA2A 4GE3A 1TCUA 3W5BA 4MP3A 4RW5A 4BF5A 1Z37A 1SPXA 3QPZA 1U28A 4C5ZA 3PWIA 4S2EA 4IDBA 4HB3A 5CYFA 3ENWA 4O4JF 3BE8A 1OM0A 1N57A 2FPLA 1YIOA 5C55A 3AHHA 3WIDA 2AMVA 4I6EA 2KW5A 2AEEA 3RC8A 4LPKA 2VP8A 3HL0A 1OH8A 1PV4A 1G7CA 2NU7B 1IV8A 3AUXA 3MLBA 3V7YA 1AHNA 4HBGA 1J0ZA 5JTUA 3N7UA 3IUJA 1SWWA 3IULA 3O4JA 1ULZA 2PRJA 1UC5A 4M6WA 4DXKA 5JXHA 3G1VA 1JHQA 4JYCA 3MJDA 3CIOA 4LC9A 2OXFA 4GJ1A 3GUYA 2EKGA 3AUTA 3KKQA 2OSXA 1X2BA 4MVCA 4G1MB 1CF4A 1LWNA 1P8JA 3KVNA 1HTTA 3ADPA 3BSMA 1GPWB 3TONA 1HMPA 1US3A 1GHRA 1XALA 5BW6B 3HXMA 1NU8A 1Z5GA 1ONRA 4P35A 3T1OA 2OXCA 4FFVA 4JMLA 3H9GA 1KY3A 4BP9A 4TVKA 2H7YA 4V15A 4KP7A 5BCAA 3ER8A 2YL2A 1H5NA 4AJEA 2WKQA 1QCDA 3C39A 4QTTB 1OVGA 4CI9A 3LA8A 1KERA 1V5GA 3WEOA 2VQ3A 5JO9A 1V0NA 2RGXA 1BXNA 2CKMA 2H2HA 4KFPA 1TA0A 4RK4A 8MHTA 4QDUA 3BMVA 3KAJA 3D46A 4BJ1A 1FFYA 4YTRA 2COEA 1H8HD 3C6ZA 3T9PA 3T9FA 4N7QA 2CHFA 1XZBA 1ZEMA 1V5WA 3GLUA 4FQ5A 4PIVA 1R9MA 3KRBA 2XB8A 3UT5B 1XKJA 4IP4A 3FVWA 3IGHX 3LD5A 1J79A 2V7GA 3KR9A 1O5XA 1XVAA 3TK1A 2QNIA 5K0FA 5JNUA 4OP2A 3V42A 3FNDA 1XUUA 1XJWA 3UATA 3OT1B 1G3QA 2PGXA 1CZUA 4GQBA 4LTDA 3TL6A 4EF5A 2CW6A 3F5KA 4BRWA 1XFBA 3MELA 4ND8B 3CUFA 4ENVA 3LQGA 4UAJA 5LU8A 3VDNB 3AY7A 3CEHA 4I4LA 4DA6A 3OMXA 4C2UA 3WD4A 5TJ9A 4D8TA 1ZS2A 1CTQA 4QTUB 3L43A 1O4VA 4N2YA 3BFPA 4R8SA 2OQVA 4AMBA 4IFEA 5K4AA 4QLBA 4LY9A 3TIIA 2PUCA 4Q7EA 3R8HA 1MX5A 3KHTA 2NYRA 2OJPA 4BZQA 1ZD2P 4POCA 1TQ2A 3TLKA 3BFXA 3BUVA 3HO8A 2XJ9A 1GORA 1R6TA 1FXUA 3F1LA 2DIJA 5D8DA 2GGIA 4MPDA 1QT1A 2H4ZA 4IKPA 1FWHC 2W0UA 3W8NA 1YR2A 3UC5A 3MXTA 1JZTA 4QJ5A 1W31A 2Q7XA 1Q6RA 2JGEA 1CTNA 4JVMA 5DELA 3OFND 2FEAA 2KX9A 3SP1A 4Z5XA 3GUVA 4Z9BA 3ZH9B 4P8XA 1M1NA 4EH1A 4Z53A 3BWYA 5EHQA 1XJQA 3TE9A 3QH2A 1E56A 2VDVE 1ENOA 3WK9A 1ZALA 1EFRD 4GMXA 4HGYA 1NKSA 3L68A 2CNWD 1OA1A 4KR2A 3ZHSA 3M41A 3QE9Y 5JSHA 4DLFA 4GHRA 1YNQA 4XZMX 4ZZ0A 1XTKA 3BE6A 3AP3A 4Q7LA 1FVFA 5ERXA 2VQTA 1Q7EA 2D2JA 4BQSA 4FN4A 1UUOA 5IASA 1ZIPA 4PMXA 4DRSA 3IJ6A 1VPYA 5LQCA 3WDJA 4JOQA 1SJCA 1EWKA 5LA6B 2AMYA 5LSAA 3KKOA 1V6WA 4Z86A 4FYYA 4NAFA 2D23A 3S7TA 1QMPA 2Y0DA 3FMFA 1NKTA 1W75A 1LEHA 4XOIA 3AR9A 4J16A 1OJLA 1TUBA 1K5PA 3S2EA 4KH0A 1KR2A 3EB3A 1RQLA 3TNOA 2Z2BA 2YTZA 3L93A 1SURA 3VOFA 4YMIA 2YMLA 1B3WA 1MJGA 3EE6A 4KCTA 4HNSA 4GOXA 3HKDB 4GO9A 2TMDA 3SOPA 1SSGA 4GYJA 4GYYA 3I34X 4PM4A 5IU6A 1SUDA 2WNZA 3GRYA 1SC6A 5D85A 1OCEA 4JKKA 2ZSIA 5CH3A 2X1MA 5H81A 3NXSA 4IDDA 3DFTA 2I17A 4O4JB 4AX8A 1MYRA 2XSZA 3NYQA 2NVOA 3M6UA 2V82A 1P7ZA 2PDKA 1E9RA 1FNMA 1E1CB 3GO2A 3M70A 3RREA 3R77A 4GYPC 2OYRA 2FEMA 3ANLA 4K1XA 4OI2A 1JDBB 2BMJA 4JTDA 3SICE 2Y1KA 1GPH1 1MV8A 3FSTA 1TJ0A 4IP0A 2FZ9A 2R8PA 4I9UA 3UH0A 1KQNA 2IYVA 1Z22A 1EE1A 3ZQUA 2DJIA 3LUBA 1ZTVA 5E6UA 4F9FA 1I4LD 3M43A 3M6AA 4DF1A 1EWEA 2XLBA 1IR2A 1JAEA 4J6FA 1UK9A 3FD8A 5AJYA 1B54A 1A9TA 4CV0A 1BJRE 2B9VA 3FAZA 5G1NA 2PJZA 2WK1A 2PU5A 1HNNA 2J0SA 1KPHA 2IZ7A 3VKFA 1VCIA 2X2GA 2ZBGA 2YQ4A 3GU3A 1VIDA 4TX1A 2RHRA 4FLSA 5BQPA 3DZCA 1G5PA 1SA0B 2OGYA 5AI4A 1XGKA 3CUTA 4QISA 3UMCA 1FUYB 5F2NA 4DQWA 4K9NA 5ALTA 3RFCA 3UZ5A 3OU7A 4TKVA 1QC5B 4LQDA 1IF2A 3BM5A 1XQ1A 3WGIA 5M17A 1Q84A 3WQRA 3N8HA 2I7XA 4CMKA 1CGUA 2IYTA 2O3RA 1B3VA 1KLYA 4IJCA 4MUYA 5LOVB 3GNTA 3LI2A 4OF4A 4IIUA 3AY6A 3D5EA 2BUBA 3AJXA 2Y89A 1DG9A 1W30A 1NZFA 2Y8KA 2QU7A 3FNBA 3SUTA 1FYWA 2EHHA 3I52A 3IIIA 4OPMA 4CD7A 1EHCA 2OB2A 1ZD5A 4E13A 2PBFA 2BTMA 1EHYA 3MSRA 4F96A 2F1OA 4D6IA 3V4PB 2P2GA 4JD4A 1RXOB 3N9RA 2Z4GA 3R7NA 5F3DA 3WNDA 3WQFA 3FPAA 4RY2A 3TL3A 3P45A 3TOSA 5EQJB 3L4BC 4WX2B 1MTOA 5CNKA 1RLIA 2QTVA 4RL6A 3U37A 2NXIA 4KCGA 3BWXA 3C0JA 3U7BA 1NV8A 1J01A 2ZYHA 2OEMA 4OH7A 2Y24A 1VSTA 4NVTA 4RM3A 2OT0A 1K5GA 2ZR9A 1Y8ZA 4LGMA 3QX7A 3EIUA 1YR3A 4U2FA 1WL8A 1QIEA 4UTRA 2AL2A 4US0R 1MB4A 4ADUA 3T6CA 3KJHA 4MPKA 1GG8A 4JTGA 2D4HA 2YXBA 1G3RA 1UOZA 1WCYA 1T5LA 2HMCA 5EEHA 1GARA 2X86A 1VKRA 4CMBA 2WF6A 3D6TB 3OYZA 1ZH0A 3SZLA 1XYLA 1BNCA 1PJ9A 1T2CA 5DZSA 3KHUA 1E72M 5CEWA 4LYGA 3T0BA 3HK2A 4O33A 3WRXC 3LBCA 1DIKA 4KAXA 1ODLA 3L02A 1IXQA 2OBNA 3GX1A 4DBLC 3WH5A 3P9IA 1GNSA 4NCIA 1YHZA 3DCIA 3KCQA 4NZNA 1VBKA 1NQ6A 2C4KA 1CUBA 3FS2A 2QX9A 4HQVA 4J0QA 4ASUD 4IIVA 1MW8X 4JTHA 1NBOA 4IFOA 3DTNA 5CVDA 1WVMA 4W99A 1BRLB 1AUOA 2YFHA 4OJTA 1HYEA 2ISQA 4G97A 4B5VA 1NWSA 4NJGA 3AVXA 2QRHA 1JLRA 4FIDA 4ZXLA 2E4ZA 2B7QA 3TLBA 3MV01 1R5OA 3VTKA 3SQXA 2ZVIA 4IQJA 2Y1FA 4DZAA 6CGTA 1Q6OA 3DL2A 2PRLA 2LD4A 1KR5A 3W3OA 3O73A 3CHFA 3ANXA 3K4PA 4QTYA 4BEQA 3W7CA 3QJAA 4G9PA 2WM1A 3PCXA 3FSRA 3EEBA 2O0HA 3PX3A 1M65A 3EX6A 1GU0A 3L7OA 1T9HA 4MWBA 3FLAA 5K8CA 1A8HA 1J1IA 3UXEA 3SX4A 1IZJA 5JLJA 2YINC 1RU3A 4MUZA 1EGQA 1PF7E 1L5OA 3LWDA 3LA4A 4KXVA 3SYTA 4IGSA 1ODFA 1HE1C 1UC4B 1AQMA 3WFLA 1HDIA 4OJKA 3L0KA 1U5CA 1WIWA 1KH2A 5L3VA 1GG0A 3VZSA 2PN1A 4O11A 2QS8A 4FIQA 3ZYZA 3ZWKA 4JX9A 3PK7A 4B87A 4HZ7A 4NX2A 1DO0A 3U13A 2VDOB 5EVJA 3P2JA 1HE4A 1W1WA 2XINA 1Y3CE 3SXPA 3KU1A 3DZHA 2Q5IA 1IG0A 3R4CA 3TYDA 2Z30A 2XAAA 3CMCO 3AVTA 2IBMA 2Q4BA 3ZDCA 2IELA 4MQFB 4D0RA 5FWNA 4AMVA 2NWRA 1DRWA 3EEGA 2JVKA 4K6KA 3RX3A 3MGKA 5JRZA 5K8LA 1N9ZA 5LLTA 2OXRA 1F6DA 3AVOA 3CJRA 1U0OC 1CZKA 2QNRA 4G07A 1NH6A 4ZARA 2A21A 3GJYA 3QM3A 1L4NA 4XG1A 1P8AA 1OFTA 5DN9A 3RKRA 1JFVA 4DRYA 4PC7A 2OGUA 1Q1EA 1A69A 2AQVA 4PUWA 1EGMB 3HR8A 2EJUA 5ICSA 4ALIA 3IA2A 3B2EA 5ESDA 1V6TA 1C8XA 1NRXA 4TT3A 1VLIA 5CAHA 2B98A 1IWPA 2R8WA 4J3XA 5DBIA 5CYPA 3KFTA 3RVOA 1GJPA 4IQ8A 1JH8A 1UK6A 5A8MA 3K0CA 3O91A 3TOPA 2YNMD 2ZYRA 3BKWA 4OSOA 3ZGLA 3JQAB 5LC1A 4D7AA 5REQB 1Z4NA 1RR2A 4CFYA 1GDTA 4NRDA 1ZGJA 2HF9A 3ZZMA 1AKTA 1W19A 2FN7A 2ZBTA 2AQKA 4F7WA 1QVVA 4JUAA 3DJFA 1XZIA 2VZSA 1UBSB 2G1AA 1WDQA 5ICMA 1YDOA 2WICA 3H4XA 4UMVA 3RK1A 4CWAA 1LDBA 4FFNA 1W5NA 3UMSA 5KB3A 3WZ0E 1F7BA 4CM9D 1NTRA 3K71B 2Z00A 1X1AA 4MA0A 3PYMA 4O4LA 2NO6A 4CL0A 4DFDA 3V75A 1GQOA 3GIWA 1JMYA 1KH3A 4EABA 4UTVA 1YH3A 1LRQA 2BI4A 3GPCA 2I0FA 4CV1A 1YQ2A 3BWDD 1T3GA 2NZYA 2GA9A 4CTJA 3DNPA 4FVTA 5ALYA 1E1NA 1HLPA 3S27A 1R74A 3TSCA 4M2LA 3LQQA 6REQA 1UD3A 1E6WA 2PDUA 3I42A 1NZDA 3PK0A 2X9VA 4U4AA 1UQZA 4IKOA 1PYGA 4NOMA 3BMCB 3B9RA 4HJXA 4MPRA 3HV0A 5ALHA 4KQKA 3ZKWA 3OE4A 1DORA 4MUNA 3DPUA 1G59A 2OECA 4Q32A 4RABA 1A9QA 2REQB 4E88A 1VHCA 1TKAA 3HQOA 4W1RA 3SBOA 3K94A 4D26A 1CY2A 2XTAA 1ZP3A 4Z3OA 5JFOA 3VDGA 3GRCA 3UFXA 2G70A 1SY7A 5K6TA 4YVPA 1JG9A 4F40A 1KK2A 3L9CA 3LQ2A 3PFBA 4AT1A 4XOUA 5HQ3A 1K7EB 2NN3C 5ES3A 3LY0A 1IHPA 3NRBA 3JQPA 3CIVA 4CU5A 4RPHA 1YGYA 3TO5A 2VOMA 4WNYA 4AULA 5EGRA 1NR5A 2VDPB 3KKKA 2Y4SA 3V1HA 1LV8A 1S01A 3WAKA 2TSYB 3K8OE 3KOUA 1TGVA 4GXNA 4DWSA 3Q3GE 3IH5A 4V1CB 2X1UA 1M2WA 2ZTHA 3QR1A 2CFIA 3LT0A 4R2HA 2VDMB 1Y0BA 2EU8A 3R7LA 3I61A 2DZWA 3WBJA 2OUKA 2QPSA 3K6KA 2YHAA 2Q3HA 5KWSA 1NIUA 1DIAA 3BSYA 4M7SA 4HAZA 1V93A 2BFPA 5A5VA 4DZ5A 4TYYA 2HS6A 4PMYA 3AJDA 1GSAA 1QOPA 3KWFA 4XEUA 4ZQHA 1DCMA 2VZTA 4D43A 3J7HA 4HS9A 4CIAA 4H3KB 1AA1B 1JSLA 1JPMA 5F7OA 4R7JA 2J32A 4L57A 2BEVB 1VHJA 1HJVA 3VZCA 2E6DA 3U4HA 1BMQA 1QQTA 3EEIA 1UUFA 5E0OA 4QATA 4DR1B 1XCMA 3XINA 1FPQA 3EDCA 5A4FS 4RTRA 3NVMB 3BXGA 3GG8A 3MTJA 3W5SA 1GAJA 2DAPA 3PXUA 1OSNA 1DELA 1E0WA 1H9AA 3R94A 4YP9A 1NASA 4GGMX 1TQJA 3DU0A 1QM5A 4J2HA 3E6EA 4J1TC 4NDNE 4AW9A 4D0GA 2C8NA 2WQPA 4QIHA 5KAMA 3DMNA 3LS9A 2JKYA 3S44A 2IPNA 5AHRA 3M5PA 5A4AA 3AHTA 2G7ZA 3F71A 3IIXA 3G1RA 2DORA 2CJWB 5FJRA 2O4UX 4JJAA 1MAHA 4IY1A 1XWYA 1TD1A 2QG4A 2G9RA 3FGOA 3U4CA 1Q6FA 3CW2A 2WVJA 3AY3A 4KVZA 1CQJA 1WUJS 1XQVA 3A6GA 5E2BA 2GK1B 4G67A 4AJNA 3SR4A 3TXVA 1I60A 3DEFA 3W7AA 1MW0A 2J8GA 1V0LA 2XQJA 1JPNA 3FDFA 1D6SA 4GICA 3HMQA 5JROA 3GGPA 3A06A 1VXRA 2J09A 3HE3A 3JWIA 3KPYA 4WDQA 1WB4A 1LG1A 1FTGA 2VJYA 2IFTA 4HYWA 1N4AA 2NUWA 1CUGA 2WF5A 2PO5A 7REQA 1O2DA 3QEBZ 3TRIA 3EWXA 5COAA 2AZ4A 4G0WA 5BNZA 4WDUA 3PWKA 3QVJA 3OAAD 4P7KA 3IQXA 1BKYA 1U2SA 1E3TA 4RF2A 1MWOA 3NHSA 2HWUA 4AZTA 1YRQA 2XZLA 3S5NA 3LY8A 4B3LA 3NNTA 4IDEA 3WOVA 3VINA 3M1YA 2UVDA 3ZJUA 1TZBA 3FPCA 4K40A 4HCJA 4BV3A 2PCQA 1XIHA 1DKPA 2H63A 4O2AA 1XQ9A 3R5KA 4JHXA 1MAAA 5K3DA 5DSXA 4W5HA 3ABOB 4M0FA 1F2TA 4L9AA 1XTBA 3C14C 4DWWA 1Z83A 3JRNA 3N8KA 5B1YA 5CLJA 4F12A 4TXLA 4KN9S 1JFFA 2V6AA 2IH4A 2XHYA 3Q3IA 3I65A 1CJVC 1CXIA 4JEMA 2PAJA 3CR7A 2XA9A 1FBAA 2BZSA 2JLXA 3PS7A 4P36A 4D1IA 4XI9A 4G8DA 3V8RA 4C7KA 3BAXA 5GM2A 5SY9A 1Y8QA 4GO1A 4Q48A 2YWDA 4K68A 3S2CA 3CSUA 4J7UA 1ZI6A 2WB2A 2ECOA 4V1YA 2CLLB 2FZGA 2Y3IA 4PX9A 5JIPA 3EB2A 1SXJC 3W84A 3WLAA 5IK2D 5AOVA 2V59A 3DMFA 2GN4A 5FJPA 5FSEC 4NBWA 3LTEA 3HNRA 2WMOB 3NGFA 2JLBA 4M99A 4P86A 4ZFCA 2V3FA 4FSHA 4C2BA 3AWOA 4BFVA 1R9GA 4EHHA 3OYXA 3LSCA 5CUQA 2HMVA 5DEOA 3NQ2A 1U1JA 2VO1A 4RMNA 4BECA 5DMLA 3TYAA 2DFPA 2BCEA 1JIXA 1ICPA 2F67A 5FIPA 3G2OA 4RJEA 2XVKA 3WWEA 3EIXA 4OQMA 3ADBA 5F7ZA 3ZQ9A 1P77A 5EJ9A 3WHPA 3HZOA 4QE3A 4N8DA 1NSFA 1A5SB 1KFCB 3P2EA 5FLXA 2A0UA 5TMEA 3AMKA 3PTKA 2QMEA 3Q67A 2VF4X 5JV5A 2YICA 1UMLA 3IEMA 1UZHA 3GJ0A 2MSWA 1T3LA 1UMCB 2Y4OA 2ZYTX 3KJIA 4BNHA 4IDCA 3VFDA 1T2FA 3WEMA 3H2ZA 1PNOA 4S2UA 5IMBA 3SQNA 1LX6A 1FPMA 1FFGA 3ODGA 2Z7GA 3NIFB 4WXHA 5IM5A 1UFQA 5L8VA 4OSPA 1WHTB 3HJRA 3JQ9A 3KYBA 3TQKA 5BMWA 1TEZA 2GLXA 3GG9A 2F61A 1KKOA 1TL7C 4PE8A 4XDGA 4KYTA 3WJ1A 1EJBA 1JG6A 2FG6C 5IMSA 2YMMA 1SVMA 4NG4A 1IY1A 4IJ6A 2HLDD 1D3GA 2P5SA 3OZIA 1Z3IX 3IT0A 4GCAA 1R3VA 2DFNA 3AMLA 3U9IA 3VZRA 1XRMA 1SM9A 5ABFB 2ZXBA 3ABRB 1V08A 3GZNB 4NPAA 3LXMA 3ZV4A 1NF0A 4PO3X 4IHCA 1LBSA 5FWXA 3GLHB 4W84A 3D8HA 4RTLA 5JAOA 4KXNA 3R3UA 3K0AB 4JQSA 1QOQA 3B6ZA 3NFUA 3EH1A 2ZPAA 4CBVA 1GTEA 1ONXA 5E9WA 5CCDA 4HDOB 4OYLA 1TWWA 4LV4A 4NG5A 3B3GA 3E2IA 3BW3A 2BGQA 4FU0A 2B99A 3AFBA 2G7MC 2PEZA 4GMGA 5BXSA 2YA1A 4DLXA 1X1SA 3A11A 3AALA 2ZCVA 4NJEA 3K2BA 5IFTA 3A1SA 3LCRA 4CHGA 1XVTA 1O96A 3WDSA 4GXTA 1Y1KE 1E55A 2F43A 4JI5B 4LGXA 3SKVA 4J7AA 4O28A 1XYFA 1JNDA 4YCMA 3T5GA 2HRQA 1VFMA 4AN1A 1PWZA 1X7DA 4KWOA 1H1YA 4BVKA 2EPHA 2NZUG 3E1KA 5EQTA 1Q7CA 2FP3A 4R2JA 3F5QA 2ZVRA 2CF5A 4PZYA 4B2PA 1IRIA 3IPWA 5ALWA 4JZ5A 2EFEB 1H6AA 3FA4A 3G6WA 1QORA 4OU1A 3P82A 1KW1A 1WAUA 4NMXB 1BS1A 1QF7A 1NY5A 3SI9A 4RF4A 3H24A 1X19A 4O2BA 2CF6A 2CFFA 4HVCA 1H5VA 4YAUA 4XD6A 2AJBA 2J3QA 1P9OA 4L8LA 2YQ5A 1SZRA 1M66A 5D05A 1QZXA 4HHMA 1BS2A 2CXTA 2G25A 3JALA 5E3JA 3QQ5A 2EKPA 3BH6A 5CVCA 2VYVA 4J35A 2X7JA 5JQGB 1JNYA 4MHSA 2ERCA 1IZ9A 2WYUA 1PEKE 3E1F1 5DN6D 1X1CA 2EP8A 3W73A 1OZGA 1G1MA 3NDIA 3W70A 3AI1A 3NZGA 1JWBB 3EXFA 1O77A 3H7RA 1PWEA 4HD5A 1Z4KA 2BJVA 4XVUA 2J66A 3MC5A 4JFAA 1JCYA 1LQUA 4DIMA 3IQEA 4ONVA 2PB1A 4IQDA 1JKMA 4TU1A 4DB7A 3VJLA 2H2IA 4NC9A 3TW9A 3C7KA 1D0SA 1EJSC 1P6QA 4HEHA 3I64A 1J8VA 3ILVA 4V02A 4AG3A 1TUBB 3N15A 1ZU5A 5CIYA 5M03A 3JD2A 1E60A 5ECDA 4HQFA 5J4LA 2RGLA 2C58A 2WQ7A 1FWGC 4W5ZA 1R87A 2CV2A 1Y5MA 2X15A 1ZNXA 4DJDA 3V1KA 4LWZA 3A6KA 4JXKA 4OXXA 5I06A 5CXSA 2JI6A 4QAJA 4C91A 1B8NA 1SRQA 4K9PA 2C79A 4XDYA 2QW0X 3P3BA 3FOAA 1LRLA 3RVKA 1YS2X 1FW8A 3WXBA 1UWUA 4UPVA 1OBFO 3OIWA 1F5SA 1E6NA 4M8IA 4CT0A 3DOUA 4QXPA 5T91A 2PJUA 5C4MA 3STEA 1JCMP 5DT9A 2A85A 1RHCA 4KQNA 4D9FA 1MG0A 2WCGA 1RR6A 1DQWA 1J23A 2I7TA 1ZLYA 2YWXA 2V9DA 2GBPA 2VFGA 4BWLA 4HWTA 3T38A 3V48A 3EHDA 2ZJ0A 1NBMA 4YNGA 1QONA 4XTRA 3PHCA 3W01A 4XYMA 5E5CA 1Z4QA 4FGZA 3N8DA 2Z1KA 5DCEA 2FR1A 4X1KB 3EXG2 1NPDA 2BCJQ 4A3QA 4MV9A 2JKZA 1IJKA 1CE8A 1RJWA 1QW7A 4J07A 2LIVA 2X16A 3UXAA 2P2SA 5DIFA 4OUDB 2RJNA 1D4AA 4IQ0A 4H4EA 3W5IA 4TMTA 5EZQA 4MY9A 1QPQA 5C7HA 5TGTA 3KPJA 1MJNA 3LC1O 1SMDA 1JHZA 2B7PA 2QCHA 1KKRA 5LXTA 3WGOA 4B3KA 1NG9A 4G0VA 1AH2A 4GFDA 3BC1A 3MP4A 1UKTA 5MGBA 2AN4A 4LKOA 5LOVF 3D02A 1FP4A 3DZ1A 3R7SA 3A3OA 2VDWA 4BVBA 1NEYA 1H2JA 3ZOAA 4AJHA 3NZRA 2DUAA 1YZHA 3NAGA 4NAVA 2CLIA 1MGOA 2BLNA 5GGYA 4PN3A 3UB2A 3OLGA 1UWAA 3UBMA 3A23A 3UKDA 5B6PA 2QGNA 2H9AA 5DU2A 3COWA 3KC2A 2POZA 4O3MA 1KY5A 3Q85A 4XIGS 2P8JA 4GE8A 3AGPA 2GUWA 2VZ0A 2RE8A 3WLQA 4ERNA 2L5HA 2CV0A 2K7ZA 3DEYX 3W6UA 1O0CA 1ZK3A 3I7RA 3FXYA 1XWWA 5AI6A 4PNHA 3EOOA 2G0TA 1G60A 3XIMA 2W27A 2WD7A 1EGVA 1P3DA 3TFQA 4EGAA 2GB4A 1QQAA 3DOEA 1BKDR 1RWVA 1QIJA 1Y5NA 3TZCA 3NM4A 1KL7A 1IJFA 2ZYUX 5K2MA 4PSDA 5ICCA 4JNCA 2RHMA 3KL2A 5G3ZA 3KSBC 3C6KA 3FYDA 1W3KA 2V7VA 5IEJA 3SUWA 3EGCA 4RR4A 2OBBA 1VYPX 5JALA 3EWAA 2OYMA 4C3UA 3ZR5A 3ZLBA 3ITEA 4IWWA 1O94D 2J9GA 5IZCC 2VT0A 5EVCA 2O1SA 3IHLA 1SXGA 2P9BA 1W2GA 2IYLD 4JR5A 2O2JA 5AY7A 3G0GA 3W5DA 4ZK2A 3KJZA 4C0AC 3S2FA 1SVWA 3OAAA 2VCBA 2X23A 1C3EA 5T8KC 4OZOA 2QGYA 4GC4A 2QRJA 4D9MA 4JL6A 1U2DC 2DDXA 5JJKA 1R2RA 1GG5A 1DKRA 4M7TA 2XVYA 5F5LA 2Q5HA 3TXAA 4CQMD 1Z0AA 3BCSA 1DBWA 2ZT5A 3I2IA 4FMVA 3AR3A 3OU2A 3M33A 4W88A 3OQJA 3K8QA 1SCIA 5JH7B 1XYYA 1IULA 4S1WA 1T9KA 2HRRA 1R4MB 1BVWA 2PWYA 1XX6A 4YEDA 5A5DA 3HKBA 1QHSA 3Q3HA 3GHSA 1WW8A 3EDJA 4MDYA 2JGFA 2QQ0A 3IQWA 2CWWA 4N4AA 1R88A 2I4LA 2VXOA 3VSEA 5H8WA 1G7SA 3FA2A 16PKA 3B9AA 4DDWA 3WLSA 3T1QA 3C70A 1Q74A 3QFRA 3PEYA 3TCXB 1DE6A 2Q41A 3TFWA 4OV9A 4R1QA 2D2XA 1KFJA 4FI3F 4Q3OA 1IPHA 1VCNA 1BOFA 1ZK4A 4RQBA 2DBRA 4PQFA 4ILKA 1C7SA 3JQFC 3GO4A 3SS8A 2CLSA 4OHRA 2A5HA 5CNIA 3T7IA 2PYIA 3AESB 3VPDA 1PL0A 3FHCB 1KDTA 4D8WA 1HNWB 5C9RA 1A04A 1OWNA 2WFZA 2JJ2D 1PW5A 2QLMA 1MC5A 1P5HA 1Z8FA 4O16A 1QLWA 1Q0ZA 4N8SA 4P54A 3F5FA 3ZWAA 1FSPA 1NU5A 1CLKA 1PYFA 1FNSA 3K0AA 4PFJA 3TQIA 4MDHA 2UZ0A 2R5FA 2QCCA 1E2UA 2HBVA 3CA8A 3DXFA 3GW0A 2PGRA 2AJDA 2NXCA 1T25A 1YE8A 2FPVA 3RJZA 3OIHA 1S96A 2B83A 3S83A 2HOQA 1Q7ZA 2YVLA 4FIRA 5EFFA 2AFIE 3FAXA 4JBLA 3GK0A 4E8GA 2D7DA 3OA2A 2I9UA 1T96A 4PG8A 3QA3E 2BY3A 4PXYA 1VFTA 4WY0F 3UMVA 5I3KA 1H09A 5HW0A 4Q6JA 1H2ZA 1UWLA 3NJ8A 2YOGA 2BDUA 2CLHB 5ED4A 3QPYA 4MSSA 5EL1A 3H5VA 5CXUA 4X7PA 2OWWA 1J7JA 4UTPA 4BNTA 3BGVA 3BILA 4E2BA 1VEOA 5E4FA 1RYMA 4ENRA 1GRVA 2JATA 3K8YA 1IWBB 3FSJX 2H1IA 3MCUA 1NFFA 1SW3A 3Q2DA 4CM8A 3FJYA 1Q7MA 5EXPA 1B2LA 3VPXA 2JEPA 3TN5A 4W87A 5COBA 3KRZA 3VYSB 3TYEA 3W71A 3OZVA 1M5WA 2PTHA 3DMYA 4AJIA 2Z98A 3IQGX 2II6A 3QPDA 1QOXA 2PH1A 2C0HA 4H3DA 3HCOA 4BDSA 4ZI7A 3DBLB 3ITTA 2Y1XA 3ORFA 5AESA 3EDEA 3WG9A 1DQUA 2H1HA 1IXPA 1JDBC 4FDMA 4FOLA 4DUZB 2Q5LA 1XF0A 3K1ZA 5TXGA 4IQFA 1FDWA 4O0QA 3HXKA 1MW3A 4FX5A 4D8XA 2FQQA 3KYDA 1RYZA 4V2IA 5E6SA 4M86A 1MO0A 4CL3A 3UN1A 3D8SA 5JQGA 4XUGA 3QXJA 4ENPA 3RYHB 4DBLE 3K35A 1N2GA 3SLGA 1HI9A 1EFTA 3OHMB 4D02A 2X5XA 3D43A 5DK6A 1TUGA 4RY0A 4MPQA 4CU6A 4XZHA 4P82A 2WYVA 4LHZA 4W5TA 2W6CX 2VHZA 3K30A 1OBAA 4PC8A 4TMWA 1Y1TA 4GVPA 4TVOA 1C4WA 5BW5A 2FSIA 4UD6A 4G26A 1GPBA 4FJ2A 3NIYA 2R3SA 1LBIA 1WB0A 4B6RA 3PXBA 4BKUA 2XT0A 2BHSA 5G4WA 3C7CB 2I80A 2F4NA 3L84A 1SMKA 1M5TA 4AZGA 1VHWA 4DLLA 3JQEA 3R3WA 1RAGA 3M3HA 2WYSA 1ECFA 4ZIRB 1S8FA 2KI5A 5BYAA 4C7BA 2YKKA 1NN3A 3OJXA 1AO3A 3HCRA 1VJ5A 1NXPA 1QX3A 3HZZA 1TIPA 5JAIA 2GF0A 1VBGA 2FHCA 2A5YB 4U5QA 3KJQA 4B43A 4LYFA 1D2EA 4AO7A 4Q1VA 5C37A 3PA6A 3P32A 2ACKA 3P94A 4GWLA 2DZAA 4JIPA 2WNQA 2FXVA 3OPNA 3QXBA 1NQAO 2HU2A 1L5WA 4KI7A 2XE6A 4JL8A 1XD9A 1C41A 1FYEA 5DNAA 2PVSA 2XQIA 4A9AA 1GU7A 3THWB 3SNHA 4AJ2A 1JI0A 3A6ZA 2W0SA 1XYBA 3OQOA 3TW7A 3M5DA 2EVWX 3CS2A 3T4UA 1Q0QA 3LW8A 1YPFA 3L4WA 5AYYA 2C78A 3Q9NA 1UXIA 3JTMA 4JJFA 3UG8A 2VT6A 3D6JA 4W93A 3FN9A 5KSWB 2GM5A 2G07A 4PRYA 5CDUA 1P31A 4G7EB 1M53A 3NL5A 1Y8RA 4NHVA 3AI3A 4XWYA 2B78A 1XGDA 4FUQA 1WS6A 4CEJA 4RKAA 3EX2A 1CUZA 5JXWA 2XQGA 1T35A 3P9YA 2BX7A 4BWLC 5A05A 1L6GA 2P27A 3BCDA 1XAGA 3QLVC 2LKCA 4YHGA 4X1YA 1HBJA 3QOKA 4TWRA 1B23P 4LAOA 2XZTA 4HB2A 2B7NA 3V8BA 2A30A 4BJ6A 4LJ3A 3V36A 3P9CA 4GABA 4PCSA 2PT6A 4YI5A 3IERA 2FR8C 3OQNA 3O8BA 4CFZA 1JJVA 2QEZA 5ILOA 3RKSA 3RSCA 4RNIA 1FLDA 3ZW8A 5DDIP 2W2OA 4YIHA 3GJ6A 4LW8A 4POAA 2H1SA 3NRCA 3REFA 4XCXA 1KNQA 1JZ7A 1EGZA 3FVTA 3NPAA 3GIYA 2WPGA 3PKIA 4KTVE 2PPVA 2B4KA 3F1KA 3WWPA 3QY0A 2MDTA 2YWGA 4TZKA 1YQGA 2PDQA 2OMEA 1P9WA 4ALNA 1XQWA 3C2YA 4CIYA 2E37A 4WA7A 1KQGA 4X9YA 2H7CA 4HC4A 4F3HA 2V2HA 3QVSA 3I53A 3BERA 1D03A 3G1HA 3I0MA 4E3TA 2Q6KA 3S6OA 1IK6A 1OC7A 4LEIA 1HRDA 2R00A 2W58A 5KNDD 2A8YA 2CUKA 1SEPA 3PSHA 1E8DA 1X1EA 3MB9A 5GPBA 4JOBA 3PBUA 3GE7A 3OO1A 4B75A 3VKGA 4J1QA 1BCSA 2ZAYA 1J39A 5CA0A 4KU4A 3TQTA 2V7PA 4KC0A 1RKVA 3RHZA 2QAFA 3BZJA 4O4HB 3CPHA 4Y9DA 1QBBA 3ITKA 3DR3A 1KXHA 4FSDA 4IJ5A 1H42A 3CWQA 3KUDA 1P1HA 3I5XA 1YVPA 2VZOA 2HZGA 1WZIA 3OX1A 3BH4A 3D7NA 1MXDA 1ZRMA 4O1MA 4G0PA 3NHWA 1KJZA 3RILA 3NL2A 4EJ2A 2BRUA 4D4KA 3GR4A 4FK9A 3PC6A 3WLEA 2RHLA 4ZAVA 1GA1A 2JJ2A 2I67A 3SRFA 4UU7A 1N34B 4OQQA 2AFIA 5KMGB 5GJBA 4KV9A 3EZ6A 2CKRA 4L2IB 4GKJB 5K03A 2DTXA 5AI8A 4YECA 3WRWA 1K7SN 4ZEMA 3TIFA 1W9XA 4ZRDA 3O6DA 5HDRA 2G9VA 4FHGA 3KS5A 1CHDA 3LE8A 4EM6A 4PTZA 9GPBA 1PJ2A 1M04A 5JFTA 4TT3D 2JGDA 4XZ9A 2QE6A 3CZRA 1JTEA 4S35A 5ENDA 4RE6A 5A94A 5EJ5A 4XWWA 3PUWA 4PZEA 1WDSA 1QP4A 3KLKA 1U8UA 1J0BA 3TOCA 2XIQA 1JDFA 4UJ3A 1XH0A 1ZR2A 2FHPA 1TRKA 4GOMD 3I9V6 3ROZA 3QG5A 2ZIXB 4NVRA 4HQRA 4NZMA 1YQXA 2YQZA 3THAA 3PQCA 1MAUA 1VB5A 2DY0A 3VO2A 2R44A 2WBGA 1XTJA 4C4RA 1EEPA 3O21A 1OCNA 3M47A 2VHTA 3X1ZA 3EPJA 5AYXA 3NJ3A 4I9AA 5EU9A 2VUIB 4UFKA 2EZUA 1AZTA 1GADO 2X0KA 3VR3D 1KVQA 3KAPA 1QV6A 4KWEA 4LJ6A 4U7TB 3DS8A 3DKKA 5I7UA 3ABZA 1SA0A 3GRFA 1OXXK 3MILA 4D9GA 3W9UA 4L7ZA 2J45A 4PULA 3GDTA 1ZHOA 1VG0B 1W4RA 3OBIA 1E4LA 1ZJ6A 1QU3A 2AA3A 3MW7A 5MF5A 3AHEA 3DL0A 5JWOA 3EXIA 1Q14A 3W6NA 3RJ9A 4V0SA 4KPGA 1PK8A 3K0BA 1W2WB 3VMMA 1QKJA 5CJ5A 1YZTA 2JHCA 4Y6LA 1DJHA 2FWNA 2ZR7A 2FHSA 2HHJA 2JGNA 1RDFA 1HO1A 4JENA 4CCYA 2OUIA 3OZXA 4A6DA 3FHQA 2VLBA 1NP6A 6GPBA 4YP7A 1AM4D 4AQ7A 3NH6A 3PDIA 4JIGA 5DO9A 4AWUA 4OXNA 4B2IA 2Q02A 3MS7A 4X65B 4WVFA 3PZIA 3HBMA 2FUNB 4H7DA 2DKFA 1IFXA 4E70A 2PT7A 1K4KA 1TM5E 4CUKA 4ZREA 1RYHA 3Q72A 5FBLB 5DOVA 1GGOA 1Q0HA 4K8OA 2YIVX 4PICA 4D74A 2XUFA 1KSHA 5FF0A 1BCRB 5G3YA 4BP1A 5E93A 4NBKA 1M2VB 2IW1A 2BR3A 4N6OA 4ZALA 2YBDA 2E9LA 2HPZA 3MQFA 3ZHZA