5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
5DX1A 2IP2A 2G1PA 3C3PA 2AOUB 4RSRA 2XIMA 3GRZA 3PFGA 2G70A 4JXJA 3FPJA 3QOWA 2Q41A 2XYRA 1R00A 2QE6A 4C03A 1XLLA 4A6DA 5KVAA 3UA3A 3BWCA 3M4XA 4POOA 5F2KA 4UOEA 3LSTA 1XTPA 2P8JA 4YTTA 3OE4A 1I4WA 1H1DA 5EIWA 3MGGA 2R6ZA 5XINA 4Q7IA 3EEOA 4PFHA 3PVCA 3XINA 4GC9A 5FADA 4DVOA 1B42A 3ER9A 2QRVB 4LNCA 4YTRA 1WS6A 3FTCA 3ELYA 3AWIA 4RTRA 3BXOA 1BKYA 3PT9A 2ZFUA 1SG9A 3SGLA 4E33A 3HNRA 3SMQA 4ER6A 5DM2A 1SQFA 3PFHA 1NKVA 2BR3A 3E7PA 4EAYA 3NGFA 1YZHA 1DE6A 3DXXA 3A26A 4QEEA 3HM2A 3F4KA 3T7RA 3HCEA 4HSGA 4HTFB 2XVAA 3NMUF 3L23A 4EACA 3EVAA 2CKDA 1XLCA 4RVDA 5HFJA 4QVGA 1XLAA 2I6GA 2PKWA 1YUBA 2NQ9A 4GUAA 3A4TA 3JWIA 1NW3A 5EQJB 2HNKA 3B5IA 2GH1A 3V8VA 4C06A 1D2CA 4F84A 5LQUA 5H6HA 3E8SA 2I7CA 4RVGA 5E1DA 3SX0A 2PXXA 3T0IA 3G2OA 4BLVA 3T7TA 4ER3A 4US6A 3DMGA 4PCLA 4ZB0A 2ZZKA 2GS9A 5E8RA 5CVVA 3LMZA 5DLYA 5GINE 4RX1A 1KPHA 4QPPA 2YTZA 1QANA 2QUNA 1YF3A 2FK8A 1R6AA 4PWYA 2XBMA 1ORIA 2QW5A 3ELUA 1XLJA 3BWWA 4P7KA 3PX3A 4C05A 2HMYB 4EK9A 1FP1D 1F3LA 3FVMA 3HP7A 5B7YA 4BP1A 2HK0A 4XISA 2OYRA 3KBSA 5BXYA 3M0VA 3GJYA 3G7UA 2ZBQA 3MB5A 4DA4A 1SQGA 3NW9A 1MHTA 1DIEA 2FRXA 4EKIA 4PYJA 1YFLA 7XIMA 3HVIA 2G71A 2J6VA 2BZGA 1RJFA 5E1MA 5EMMA 3QYSA 4WVLA 3A7DA 4P7FA 2G4JA 1XICA 5HIMA 4A8NA 5LQJA 2I9KA 2JHCA 3KR9A 5FULA 3KPVA 1NW5A 4RVFA 3JWGA 4AZWA 3C6KA 4V0RA 5FHQA 4HRAA 3XIMA 1XLEA 4HGXA 3QXBA 2PV0A 3NWEA 3TQSA 3H2BA 3O4FA 3ITXA 3BDKA 3FUVA 1TW2A 1EJ6A 1XDSA 8XIMA 3VSEA 5E8JA 1VP3A 4GJIA 3M6WA 4ISCA 3OFKA 4QE4A 1MUWA 3EEYA 3VNLA 3LDFA 5EVJA 2YXDA 2OB2A 4QDWA 3B3FA 3M33A 3KQTA 4RTJA 1SVUA 2F8LA 3IHTA 4G56A 5H1WA 9MHTA 5BW5A 3KQQA 1KYZA 4RVHA 3U3HA 2QY6A 1JQDA 3KR2A 2PX2A 3BUSA 5DX0A 4M37A 4GOLD 3BWMA 4E32A 2NP6A 3SR4A 5LQKA 3C0QA 3P8ZA 3UJ6A 3EVDA 2QM3A 2VDVE 1I1NA 3HCFA 1BXCA 1YB2A 2R3SA 3BZGA 4M7RA 1NBIA 3QOXA 2WK1A 1G8AA 4FSDA 1NW7A 5EPEA 3EVZA 3R24A 3PB3A 4GLEA 4FSXA 1VIDA 3P2IA 4QE5A 1XLMA 1Q0SA 3BZBA 1EJ0A 1MJFA 4XUDA 5EHGA 2P7HA 2FYTA 4ZTBA 8XIAA 2OY0A 2AVNA 4XCXA 4PNEA 5DWQA 1FPQA 4FZVA 3IUIA 2BM9A 5GIPE 4DCGA 4BY9E 4O29A 3KTCA 3TM5A 1UFKA 4XUEA 3DOUA 1QAMA 2OKCA 2CMGA 4PIPA 3UJ7A 2ZIGA 4EKGA 5K0JA 2AN4A 1G6Q1 4WXHA 4HHLA 5AVHA 2Y1XA 4MTLA 5K09A 1AV6A 3M0YA 5K0NA 3FYCA 1Y8CA 4ER5A 1XP3A 4Y30A 3G88A 3OBEA 2QRVA 2ZZNA 2ZVJA 3DP7A 1JG1A 3G8BA 4A8LA 3UJ8A 3KQWA 4KVZA 2ZDSA 3C0SA 4DZRA 1XLFA 5T6BA 2AOXA 1SUSA 9XIAA 2AN3A 5FUBA 3DTNA 1ZGJA 4CXMA 4CKBA 3DULA 3U0HA 2V74B 4F86A 2UYOA 4FT4A 2B3TA 5GOZA 2GVEA 2PX8A 2G0WA 3HCCA 5ICEA 5AVNA 5HIKA 5EIFA 5CVUA 4PGGA 5K03A 4QDKA 3L8DA 4CKCA 2YXLA 5LSAA 3S68A 2C7PA 1F38A 4YUVA 3FTFA 5C9ZA 2A14A 1JSXA 3R6TA 4R6WA 3THRA 3A7EA 2NQHA 1P91A 3GRVA 4PONA 5D1HA 3NVKI 4E70A 2P7IA 3BWYA 3KR1A 3SSMA 4V0QA 1KYWA 5E9WA 2PT6A 2PXCA 1O54A 1XYBA 4HC4A 5IH3A 3KR0A 3FUTA 4P7GA 1NBHA 2O06A 4YV2A 1R8XA 4QQKA 3M0MA 4K6MA 2ESRA 4NECA 1INLA 3GWZA 1RJEA 4RTSA 3CBGA 3GRUA 3SVZA 3D2LA 2OZVA 4M36A 1QUMA 3AAMA 3VNJA 3SSOA 2PSSA 5M5BA 1EQAA 2PGXA 2NP7A 4B17A 1XIFA 2C7OA 2VZ9A 1D8WA 3DH0A 4AUKA 5XIAA 7MHTA 3P9IA 3HTXA 1NE2A 2K4MA 2VP3A 3CC8A 3UJ9A 1VBFA 4CTJA 2P3QA 3V97A 2NXJA 2H00A 2H11A 1WXWA 3K0BA 4DM3A 1L1EA 4Z2YA 3ID6C 1AQIA 2CL5A 3KCLA 4PYKA 4X61A 5FQOA 4A8RA 3UJCA 2C7QA 4KDCA 5BW4A 3LHDA 5K0GA 2HR1A 3GXOA 3B7PA 5E9QA 3TFWA 4YV1A 3RW9A 3TM4A 1A0CA 1UIRA 2N47A 2ZULA 1NW6A 5JR3A 4PYLA 5K0CA 3UJAA 3GRRA 3P9CA 3DXZA 5XIMA 2FPOA 5EEHA 3GCZA 4HNOA 2JH9A 1N7IA 5C0OE 4X60A 3KBWA 2VDUE 2OB1A 3LCUA 3FPFA 3PX2A 2WA2A 3OFJA 1RI1A 4KIGA 2Z6UA 3M6VA 3XISA 1NT2A 2GB4A 2NNWB 5DXJA 3BKWA 4CWAA 5DRYA 5GM2A 2P3LA 5ICGA 10MHA 1XYAA 3X0DA 5K0EA 2EJUA 3GO4A 4LWOA 4DCMA 4K1GA 5LQRA 1BXBA 3QV2A 2AOTA 2YUIA 1XLBA 5FTWA 5E9JA 1AF7A 1PRYA 2CWWA 2E5WA 3R9XB 3O7WA 2OO3A 5EKXA 3OZRA 3CGGA 1SUIA 2IDJA 1XLDA 2PXAA 4RTPA 3CNYA 3M6UA 3B3GA 5ICFA 4EQZA 2GPYA 3G2QA 1KP9A 2OBFA 2NXEA 2ZIFA 3AXTA 1G38A 3MTIA 1QZZA 3IYLW 2IBSA 1AQJA 2X7WA 3EGVA 1G60A 2ZLBA 3FZGA 5E2BA 2YVLA 3QC0A 3NVMB 1JG2A 5TNVA 3KCOA 3G2MA 4H0NA 5DTQA 3LECA 5E1OA 4OQDA 3UJBA 5EMLA 5GP1A 4ZB5A 1XLKA 9XIMA 1M6YA 3E23A 3P2EA 5B80A 1DL5A 3SSNA 2PWPA 5EMKA 4E2XA 4QVKA 3TPZA 1R18A 5DSTA 2P40A 5K8VA 4RV9A 2ZZMA 4HH4A 4XIMA 3BANA 1M6EX 3B89A 2QUMA 1JSZA 1RJDA 5EZSA 3EGIA 1WXXA 4ER7A 3GDHA 1XIBA 3P9NA 3UVAA 4X63A 1IXKA 1Q0TA 2EJTA 1QTWA 2Z6AA 5LQCA 3GGDA 3KPJA 3CQJA 1R74A 3ORHA 3O31A 3FTDA 2Y1WA 2JG3A 3EVFA 3ITTA 1KR5A 1XDUA 3C0KA 3ELDA 4QTUB 5K0LA 4E31A 5ICCA 2IGTA 3DMHA 3M6XA 2YX1A 1XISA 1BC5A 1G55A 2EG5A 4FP9A 4C04A 5K05A 2GA9A 5DXAA 1L3BA 2XYQA 4OQEA 4BP3A 3OZSA 1JTEA 1QAQA 5ERGB 2AOTB 3DXYA 3G5LA 1VPTA 2ADMA 1I6NA 1KPIA 1P1CA 1JR4A 3CCFA 5CCBA 3VC2A 5FQNA 4KWCA 5LQAA 2KW5A 1RI4A 1XIMA 2IBTA 2NXCA 3KQPA 4C4AA 5B1SA 3NWBA 3OU2A 3FUXA 1XIJA 5D1NA 3GU3A 1QYRA 4FT2A 4IKPA 1DCTA 1BOOA 1XIHA 3MQ2A 3BZJA 2ZW9A 3KQMA 2QULA 3CJRA 2IPXA 2B25A 4K3ZA 2PBFA 3HCBA 3K6RA 5DTRA 4AZSA 5I7GA 4A8IA 4PYOA 5CCXA 1XYMA 1N7JA 4U7PB 4OVXA 3VNIA 3MAGA 1P1BA 3N4AA 4YMGA 4LECA 5DX8A 1OR8A 5U4XA 3NDIA 4OA5A 4EVIA 3LKDA 2P3OA 5CIYA 1I60A 5CVJA 2JJQA 5CD1A 5LR6A 3LL7A 3KWSA 3VC1A 3HCAA 2IH2A 5JUWA 2P41A 4C08A 2EFJA 3HVKA 2O0LA 2BR4A 2DULA 2B9EA 5HOQA 1K77A 3IUHA 1Z3CA 2V7EA 5K0FA 4BLWA 1RI2A 5P8WA 2XYVA 4M38A 4ATNA 3FPGA 2GUBA 3FRIA 3TC3A 1ZHFA 3HVHA 2XVMA 2GLUA 4GF5A 4PYMA 1QT1A 3DX5A 4RTOA 1L3CA 3THSA 1SKMA 2H1RA 2VS1A 3JWJA 2DPMA 3KQVA 3REOA 3FYDA 1DE5A 1JG4A 2JH8A 3CVOA 2PWYA 2NYUA 2WA1A 3I53A 3ITVA 2PX4A 4DKJA 3FPHA 3BGIA 1U2ZA 4DF3A 3B3JA 5K01A 4E3VA 1XLGA 4XSLA 3EPPA 1WY7A 1XXLA 4DUOA 4RTKA 4GOOD 1X1CA 4DQ0A 5DM1A 3BGDA 4IV8A 1S5MA 3MERA 3JU2A 2GAFA 3SXJA 2ZWVA 2OPBA 2ZWAA 3FUUA 4J4KA 3DUWA 4QPNA 2IH5A 1O1HA 1IY9A 3TMAA 2AR0A 3ELWA 3ME5A 4MHTA 5H02A 3G8AA 4OBXA 3TKAA 5EC8A 3SM3A 3DLIA 2UYCA 3CQKA 2O57A 3CQIA 3OU7A 4YTUA 3NTVA 5EHIA 2I56A 3ANXA 4CTKA 1X1AA 1JTFA 5EMJA 1I9GA 2UYQA 3LGAA 3G89A 3EVEA 1XCJA 5HIIA 3LKZA 4XIAA 4W4QA 3I58A 6XIAA 4MWZA 2ZBRA 5B7ZA 2G8NA 3FUWA 3M0LA 1XIEA 3LPMA 4GC5A 1X1BA 1XIIA 5DM0A 4CKEA 1HNNA 1G8SA 5GM1A 2AN5A 2G72A 4IWNA 5EKUA 3EVBA 1D2HA 2HTEA 1O9HA 1QAOA 1EG2A 1BHJA 4KW2A 5T67A 3VYWA 2BR5A 2IIPA 3KQSA 2P1DA 1KIAA 5DRTA 1HMYA 4LWPA 3AALA 3DMFA 4PGLA 4GOND 3CQHA 8MHTA 3BT7A 1X1DA 1CLKA 1TW3A 3EGEA 3KPWA 2P35A 3I5UA 3KU1A 3OPNA 3FTEA 5FHRA 3KBJA 3KCJA 3M70A 4X1OA 2AOVA 3ITYA 3EMDA 3KPYA 3LX6A 3MTEA 5EEGA 4Y2HA 5MHTA 3C0LA 4OA8A 4P58A 5FA5A 4PINA 1KHHA 4YUWA 2BH2A 3KBNA 5CM2Z 5DM4A 4LG1A 4PGHA 3UU0A 3LCCA 1UWVA 3MCZA 3A27A 1S5NA 4AZVA 1XINA 4HG2A 5CUQA 4OBWA 3KKZA 2ONZA 1ZG3A 1VE3A 4PYIA 3BKXA 1XIGA 1IM8A 1TZ9A 3LCVB 1T43A 1JQEA 5T64A 3TLJA 1XDZA 2EX4A 3NDJA 4E2YA 2ERCA 3P2KA 2UZ4A 2IFTA 3FPEA 4MQ4A 1XYCA 3KQOA 3E05A 1NV8A 5J8LA 5KS2A 2JHPA 3IV6A 2AVDA 3JWHA 4U7TB 3G5TA 1VP9A 2CMHA 4PYQA 2C7RA 1L9KA 2B2CA 4GOMD 1DIDA 3HVJA 1RJGA 3HEMA 3PS9A 1L3IA 1NV9A 4GQBA 2ZVRA 5IKMA 5KQRA 1A0DA 4R8SA 1NW8A 1YZ3A 5F2NA 3FRHA 3MCTA 4QE1A 3M0HA 2Q02A 3CJTA 5F2OA 2O05A 1FP2A 3IUDA 1JQ3A 2FHPA 4RWZA 5EG5A 4KRGA 1ZGAA 2JHAA 5LQNA 1VLMA 3U81A 4FS8A 2YQZA 2FK7A 4AX8A 2IDKA 1DUSA 1O9GA 4R05A 3VNKA 1XLIA 1P39A 3VYLA 5G02A 4MIKA 1M0EA 4KDRA 5KYGA 4PIMA 2ZBPA 3AXSA 4ER0A 2ZTHA 4L7VA 4XUCA 2OXTA 5DSXA 3TRKA 5K0BA 5FWAA 4C07A 1R8YA 3HCDA 4QTTB 3UXIA 3QZAA 2I62A 1KXZA 4KW7A 3UWPA 4EMSA 3ITOA 3UFBA 2NQJA 2OU4A 4ZB2A 3BGVA 4YUXA 1X19A 5HIJA 5DPMA 4RTLA 2PJDA 5HILA 5GWXA 1OADA 4PCAA 3LDUA 4QDPA 1WG8A 5DTMA 5EOVA 3P71T 1TPYA 2XISA 2AOWA 2PLWA 3T7SA 4XSMA 2BM8A 3AYTA 3ITLA 4RTQA 4DMGA 3UJDA 2FCAA 3GNLA 2UYHA 2Z6QA 5EGSA 1ORHA 3ER8A 3M0XA 4A6EA 4YUZA 3DBNA 3R3HA 5BP7A 4HHMA 2X7VA 3EVCA 2AS0A 1XCLA 4GJJA 5E2AA 2ZSUA 4HGZA 4PYNA 3KPUA 1YFJA 4QEHA 1EIZA 3TR6A 3OCJA 3R0QA 2PT9A 5DT2A 3C3YA 3DLCA 5C1IA 1XVAA 4ZBCA 3P6LA 5HEKA 3VNMA 3EMBA 3LBYA 3UBTA 4E2ZA 1VQ1A 3HA3A 5KQSA 3RIEA 3OZTA 2IH4A 1RI3A 4BLUA 2AZTA 4QDJA 3BWBA 3LDGA 2AOUA 1XYLA 1ZKDA 4FGZA 1D2GA 3I64A 3TKYA 4F85A 1GW9A 3WSTA 4HGYA 3A25A 4GBED 4RYLA 4X41A 2YR0A 3EVGA 3OU6A 2O07A 1XJ5A 3HA5A 4OX9Y 3P97A 2LD4A 3UA4A 2ONYA 5E1BA 1VL5A 3P14A 4R6XA 3WQOA 3P9KA 1EAMA 3CJQA 2NXNA 3G2PA 2QYOA 4RTMA 1N2XA 1YX1A 3NJRA 3Q7EA 1WZNA 3AY0A 3AJDA 1RI5A 3KBMA 4IV0A 3GNXA 3KHKA 3TVAA 2ZCJA 1FJXA 2HCVA 2ORED 1V39A 3GRYA 2HV9A 4YTSA 1XLHA 3I9FA 4FR0A 3KBVA 4YV0A 3TOSA 1DXIA 5CVDA 2GLKA 2VDWA 2ZIEA 2GYIA 4RTNA 4YUYA 1MNZA 4HTFA 5GIOE 1A0EA 3DR5A 1JG3A 4QQNA 2PVCA 2I57A 4P7JA 2PX5A 1PJZA 2YXEA 2B78A 3CWHA 2XINA 6XIMA 3RODA 4YTQA 3GIWA 2HK1A 2PY6A 1ZQ9A 4GEKA 5FWDA 3AYVA 4E2WA 3OE5A 5EZQA 3IEIA 5CVEA 3Q87B 5FCDA 4YMHA 3KQYA 3LBFA 3UZUA 5FA8A 3HA7A 3MHTA 3CKKA 2HWKA 1KPGA 3ERCA 1FBNA 3PLAE 4E30A 3PTAA 3C6MA 5HZMA 4AZTA 4XKMA 4KIFA 4R8RA 1XIDA
chains in the Genus database with same CATH superfamily
1B1YA 1R27A 3EZNA 1T99A 4ZQGA 4F3YA 4Z7OB 2YWDA 4M9RA 1QHZA 4YJHA 4MCJA 4Y7DA 4DAFA 1FSPA 2OBXA 3E58A 2NTVA 4RA6A 4X1IB 3IP9A 3INPA 1PFQA 8TIMA 5E3JA 1WUEA 1AKYA 1NBMD 3URBA 3OX2A 2CBXA 5H68A 3N0TA 4U5QA 3ZOAA 5CBIA 2HJSA 5ALYA 2ZT7A 3DEZA 1KFKA 4DDUA 2X0SA 1TEXA 2X2YA 1J0YA 3PAJA 4RDZA 3A4JA 5JH7F 3QNMA 1DWQA 3I62A 1RAGA 2I0FA 1W9BM 1XD9A 3DFIA 2JZOA 2XEDA 4MUAA 1ONXA 3LY8A 2ICSA 1UPBA 3U17A 2FTKE 4NF2A 1W59A 2CW6A 3O8LA 2XA9A 1G8PA 3CO4A 1ISGA 4RACA 2VPPA 1GK8A 1NNUA 4WA7A 3R1IA 2NX2A 1TYCA 3DXXA 4PZCA 1YE3A 1JHXA 8RUCA 4ATLA 2OGZA 4YCDA 5GGXA 3AOEA 3CLSD 4HTBA 2XN2A 4DCCA 1PR0A 1UMBB 5EBUA 4F8YA 4LAFA 3CLSC 3RSSA 4C0KA 1JDDA 1NF8A 5MN6A 3VR6D 3WK1A 3L9CA 5EQJB 3V5FA 3OCXA 3K1TA 4TMCA 2RGNA 3Q6NA 3V8VA 1SOAA 3E8SA 2I7CA 1C1XB 1W0MA 2PXXA 4D4HA 1IY8A 3JQGB 4R0VA 4BLVA 1VPLA 2OV8A 5JXIA 1X1QA 1D1PA 1M72A 1QW8A 3L4VA 3K5WA 4RX1A 4JXCA 4LHYA 3KVOA 3NV7A 1IY1A 5ADUS 1QR6A 4X66B 1QVRA 3RO8A 2QSUA 4QYWA 4ENRA 3VUSA 1UOZA 3TW9A 3L77A 3D3WA 1N3YA 1DKRA 1TI7A 3SCVA 3GFRA 3I9MA 4BP1A 1UPXA 4OHBA 1F8GA 5FF4A 4A0SA 4F46A 4PHCA 3KDOA 4IO1A 5L6UA 2FFBA 2BGIA 2JBAB 3GTHA 1I51A 1TUGA 2WZTA 3CAKA 3IJDA 3S3TA 2ACKA 2E3JA 2TSYB 3QMRA 5E1MA 2KWIA 3DKJA 2F2HA 4MV5A 6AT1A 1GPWB 2HMTA 2QPOA 3BA6A 4NYYA 4AISA 4CQ8A 4LXXA 3DKPA 2C59A 3SJZA 1M68A 1ECFA 2HUNA 3GGJA 1XNJA 3SADA 3U2QA 2VQTA 2VMFA 4MK4A 3N6HA 3UXAA 3LQ1A 4BE7B 3CXUA 2BTQB 3QPUA 4AZWA 2DCMA 1MEOA 5G2OA 2RI6A 1OILA 2BP7B 3M9LA 5JD5A 4N8SA 3VKFA 5EL1A 2HO4A 4DQUA 5EIXA 2H4FA 3ZQ4A 2IT1A 3KHDA 2WC4A 1G2IA 2C42A 4KQ9A 1I0BA 2R65A 4LDJA 1CLUA 3ECQA 3T81A 3OEWA 3KUKA 1QOXA 4M24A 1TWDA 1TM2A 5CQ1A 3EEYA 3JQAB 4MS3A 3L93A 3LLSA 1OD8A 3WJZA 4N42A 1JCMP 4OQVA 4YAUA 3B3FA 1WVGA 4RLIA 3I37X 4V2IA 4BBJA 1R9YA 1DOHA 4FGSA 3UXKA 2MSWA 4DMLA 2EWMA 4IJMA 3KR2A 1KIMA 4Q3AA 3ADKA 3BWMA 4L5AA 3IDFA 4LYEA 1UBRS 4BZPA 4BEUA 2H08A 4IQFA 3C0QA 4RW3A 4ENPA 4FW8A 3QM1A 4F2WA 4QNEA 2DMRA 4C0WA 3CL6A 1T6YA 3V6LA 3EQ6A 3LNPA 3A70A 3BD9A 3I92A 1G8AA 4FSDA 4UTLA 4GPIB 3A6GA 4P53A 5BYAA 2DZSA 1UKYA 1GRVA 1ULHA 4AZCA 4NWIA 1VFNA 5ILGA 3D4OA 2XHEA 4ZHQF 5E38A 1XRSA 1M2GA 3CINA 3B9QA 4B31A 1Z7EA 2P7HA 1QNOA 4ERIA 1DLIA 2PRKA 4CVWA 2VJCA 3T1VA 2OG2A 4B40A 1IL0A 4JICA 2Y4NA 2W2PA 3SNHA 1Z69A 4BFAA 4DVJA 4DJEA 5EJ8A 1KZ1A 4ID3A 4XTIA 3WNNA 1Q7QA 3ZZ0A 5D3MA 2IEZA 2G7ZA 3PC4A 2W5UA 1GZUA 2BKUA 4HEA6 1E94E 5C5YA 1G9XA 1G9HA 2OKCA 1U0NA 5KZMA 3AROA 4PZVA 4RYDA 3DWEX 5AIAA 1U4NA 5AJZA 1G6Q1 4LHSA 4Y9RA 1U22A 1PWHA 5AVHA 2APJA 2JKEA 4PHGA 4RJKA 2B8EA 4Y8VA 2PA6A 4H3DA 1QYWA 5K09A 2CDCA 2CHVA 2DFDA 5DE3A 1XP3A 4V24A 2B8TA 3OBEA 4R1TA 4D5GA 2VQEB 2G4LA 3T3IA 3S5ZA 2REQA 5JO9A 2X8JB 5BRPA 2ZUTA 1UQUA 1CVIA 2W48A 3JQPA 4JYMA 1HGYA 4AYGA 4QHTA 3UJNA 1Y8RB 3CHDA 4CQCA 1EFKA 2AN3A 2A9KA 3LPNA 4B75A 4YJGB 1RM0A 1IZ0A 3AB8A 2R6CA 3LQ2A 3UBMA 1KEZA 4J0EA 1R3DA 1P1HA 4YDQA 3A32A 3CIXA 1E6CA 4QRDA 1CDEA 2PX8A 3WJWA 1K5HA 1D2AA 4NYUA 1BE0A 2CV0A 5F7ZA 1KYTA 5ICEA 2XTJA 1ZVMA 1QSGA 2HA7A 3GRCA 2C54A 4WBNF 2PTXA 3WMXA 2ZXFA 2IYXA 1AJEA 3HB1A 3JQQA 1QRSA 3QPEA 1QPOA 1VYRA 1PIFA 4S1FA 2PV7A 4GIEA 5AB3A 2GF0A 3VE9A 2BG5A 4Q4KA 3WBAA 5D85A 3A7EA 3TJIA 3TNFA 1ZK2A 5AP9A 3ZLFA 3O82A 4RUKA 3S6OA 3U7FB 4YREA 3DHNA 4OTZA 3B5EA 4OGFA 4R5EA 3H21A 3R09A 3SCRA 3KLPX 3VV2A 2II6A 3N13A 3BJIC 3B1XA 3WMSA 1EVKA 2UZAA 5A3VA 3TL2A 4LJLA 1EC7A 1NBMA 2OWDA 3MMUA 3I9V1 1J9ZA 2Z2XA 4ZANA 2XTAA 5CNMA 3AZTA 1F1BA 3AAMA 4F6RA 2D4HA 3NPAA 4J0GA 3LC0A 1JDSA 4GDMA 3R7DA 2GHTA 4KLNA 1XIFA 4DI8A 5AM0A 4P8RA 1Y5MA 1KL7A 4YQYA 2E6UX 3T5MA 1QIMA 3B3AA 4G63A 3CH5A 1GKPA 3CC8A 3OKAA 1Y9AA 3NA8A 2FVXA 3H05A 1JMYA 1ND6A 2A8YA 4FEYA 3M5PA 1YRRA 1HE1C 4X95A 1OKKD 4LANA 5FD0A 3CQ9A 1PHPA 2FP4A 2V5JA 3ID6C 2CL5A 3U48A 3FNGA 3TFOA 1DG9A 3PUOA 1K8XB 4DI9A 4F91B 2JNWA 2GZSA 2GF2A 3T7IA 2BMEA 5FORA 2BFOA 2PS2A 1LGYA 3T3EA 2VJMA 1KJ9A 4HMOA 2IS1A 3V9PA 1RQHA 4BWGA 2CUNA 1FP4A 2F38A 1KK3A 1AIPA 3ENVA 1BYCA 1UJCA 421PA 4NK4A 3V42A 1OW3B 5K3FA 2QXYA 3SIMA 3IUSA 3KLLA 1RBZA 3VR6A 3KYCA 5I48A 1KFJB 1I6LA 4FX7A 1AVTA 2FR8A 2REBA 1ZLYA 1ZRNA 2YKKA 4XFJA 5AKIA 3FFTA 3OF2A 3PX2A 4I4TA 1W37A 3GBPA 2QZPA 3QN3A 2QT3A 5AHOA 2ZK7A 3BKWA 2CKRA 2GZDA 3VDCA 5TS3A 1O0BA 1K4YA 4B47A 3OLCX 1HH4A 2VEFA 2Z6VA 3C56A 3LL4A 4GJ1A 4HGQA 1RMTA 3ZWKA 4YP9A 4KRYA 3FVRA 3TQTA 3EEBA 3AK4A 5EJFA 3UAGA 4J03A 2V4UA 2V58A 3U7VA 2P10A 3LY9A 2DZBA 2YC2C 3LF2A 4WOPA 1JPHA 1TLTA 4RSGA 1JDUA 4EXAA 3PG8A 3GC2A 2E5WA 1A9TA 1JFXA 4IIEA 3K94A 2JGNA 4GD3Q 2QUVA 5AKEA 1HSOA 4MIYA 4JLNA 2C96A 1DJWA 3B6JA 1FCUA 4ACYA 1QWOA 3T5DA 4G1NA 1FUYA 4WY0F 1JU9A 1NBME 3QVSA 2RHBA 2HB6A 5JJLA 3VKHA 4BVFA 2VRNA 1MX9A 1QYCA 2PODA 4MIMA 4RFSA 1GCOA 5BSTA 4EWND 1KFLA 4IQDA 1SKAA 2AMYA 1EFZA 2I4NA 2ZIFA 3RQSA 4ACZB 1NXWA 5FO0A 4DJAA 1G38A 1GPBA 1TPB1 3H4WA 1SURA 4OK6A 1UKAA 3NORA 4XSVA 4MM1A 4ZXLA 3TGWA 3QZ6A 5LZ7A 3TQPA 5LIXX 5J4YA 5B53A 2JK2A 1YE6A 3W8NA 1RYMA 3F6RA 3A3YA 4C30A 5E6UA 1H50A 2RDUA 3JVDA 1FHLA 3HR4A 1DKMA 4NI5A 2I3ZA 2HNEA 9XIMA 3GHTA 1Q15A 1I3CA 4Q37A 5CH9A 5C71A 1CQJA 1OY1A 4LJ3A 5AW6A 2PWPA 4NYMR 5EMKA 4GZ7A 5KJFA 1UOEA 1ZGCA 4UR9A 3V2UA 1CDOA 5CKSA 4MUFA 2NO9A 2P8SA 3H6HA 1BEZA 4E46A 1R6WA 2WMIA 1WOBA 4Q4SA 3B89A 1RQ7A 2I8LA 1RJDA 4YHGA 2QV4A 4Z7JA 2GFIA 7ENLA 1BSIA 4N2YA 2D1QA 3F71A 2WB5A 2DZPA 1H11A 2Z6AA 1UR0A 2AQVA 2Q8NA 2XMQA 4HDRA 5DNYB 2ZZ5A 1MQ9A 3LM7A 1KYYA 1AOXA 3TG8A 4CCDA 4UBLA 1SUEA 5IKOA 3RIKA 2C5AA 2IHBA 2QVBA 3VQTA 3ITTA 3ETNA 3CR8A 2V5UA 2RJHA 5FWXB 4JFUA 2J0SA 4FIRA 3H18A 4C04A 1HT2E 1JPIA 1QDEA 5HKBA 1JTEA 2Z09A 4LTDA 3UB4A 2BH9A 1QAQA 2VC6A 2CVZA 3CTTA 4Z0NA 3UPDA 1B3VA 1M7OA 2ADMA 2O19A 3RSHA 1WF6A 1Q19A 1G0OA 4DT1A 1YKFA 4HX2A 3VC2A 2B4QA 3V7PA 3VIGA 4DPLA 2NWQA 1DWOA 5K7SA 2OQVA 1ENZA 1R3VA 5B1SA 1K7FA 4L22A 2J9XA 2QJFA 2Z1VA 1C30B 1TG7A 5D03A 2O7NA 1JA1A 3T1TA 2BI7A 2JB9A 2GRJA 2I1WA 1C80A 5FFMA 3ZE6A 4IMGA 3DL4A 4M83A 1FWEC 2ZW9A 3KQHA 3S1AB 4L2IA 5IS2A 4GT1A 2QN3A 4OMFG 2Y85A 1HA3A 1VJCA 1S3TC 3LNMA 1MEWA 1JJKA 4QR6A 1W6UA 3CZ5A 1CR1A 1SFRA 1IZKA 1J56A 4KRFA 4D0GA 4KUEA 1JHVA 4XGQA 1I1XA 3W23A 3CV7A 3BAIA 3OPYB 2OPHA 3GZNA 1ZJAA 3LW8A 3H2JA 3MAGA 3HZZA 3BJTA 3NQ6A 3A13A 3B5JA 1QLJA 5T57A 2AN1A 1LPNA 3KWSA 2QD4A 1T41A 3PUVA 3HH8A 2XM2A 4NPAA 4PC2A 3HVKA 2UDPA 4CDRA 4G9PA 2C15A 2WM9B 4A26A 4QASA 3K9QO 4BFLA 4BLWA 4DA6A 3UUWA 5LB2A 3COSA 5EQTA 3D59A 3QRWA 3AHTA 1A9SA 4BFWA 5C5EA 6CHYA 3O4JA 4DEXA 1JU4A 3UXDA 4ZGGA 4D0SA 5DGTA 3D4PA 5ILOA 1H09A 1PJRA 3ZQ9A 5D01A 5A69A 3REOA 4I9NA 2IQIA 4PR3A 1I2QA 1U8ZA 1XAHA 3NH6A 2FLVA 4KWHA 4MVJP 2YUTA 3F67A 2JFVA 5J2TB 1WZUA 1XH2A 1YQEA 3RS4A 2OYMA 3C1AA 3WSUA 1G98A 5HMEA 2E28A 4LF7B 1DIGA 5HJ2A 1L5QA 1M75A 5JPIA 4TWAA 4HR7A 4IIJB 3PD7A 4E2VA 3CZCA 2OT1A 3PHCA 5BWCA 5JO0A 1V5EA 3H13A 3EFBA 1NOUA 2GJPA 4Z3OA 2GAFA 3EISA 3HXLA 4X8LA 2OPBA 2MCFA 2WLYA 5C52B 5FL3A 1GQJA 3KYDB 2JGAA 3PXBA 5B3KA 2ZZ4A 1H0KA 1ZPDA 3DZHA 4H04A 1IY9A 2EGHA 3DBHA 2Y0BA 5K4GA 4LRXA 2JRLA 2PSFA 3DKVA 3LP6A 1G7RA 2Q4TA 1BTMA 5JPDA 3CWOX 3WUGA 2WSLA 1QKKA 2DG2A 2QCMA 4OMUA 2ORVA 4CZ2A 4E4FA 1Z13A 1W3JA 3CTMA 4RFLA 1V3QE 4B79A 3NC4A 1BU8A 3RE1A 1KM3A 2QTVA 3EXSA 1G6CA 2PURA 2WO5A 2PCJA 1Z7BA 4EB0A 3EA2A 3O7MA 3F90A 4Z3KA 2CVHA 4YXFA 1F3OA 4TKUA 1GKRA 4TMBA 1QXLA 2ISDA 2C98A 1GYRA 3SXUA 4J28A 3D4BA 2CKSA 1K86A 3DDOA 4NI3A 1OKKA 2P79A 4U7DA 1AG1O 3H5TA 4CNPA 1GGFA 2DETA 1SCUB 4HQ6A 3QKRB 1XPGA 1YMUA 1KEUA 1IOLA 1KTCA 3D7NA 5CK4A 1BG9A 3WNLA 1HZZC 3SRDA 3V1PA 1AS2A 2VURA 2XODA 1CRPA 3KQSA 4UBJA 1MVNA 5BSGA 2O56A 2OEMA 5E2IA 3F4VA 2AN9A 2IY7A 8MHTA 4YRMA 3O8BA 1XZBA 4FS9A 4BNJA 1G5IA 5LA0A 3KB1A 3FTEA 1KLZA 3FY4A 5LU8A 4DLMA 1SOVA 2R25B 1SHUX 3HGSA 1NXXA 2YIDA 2NSDA 5DGIA 1E6PA 4DOMA 4YRTA 1LU9A 4UNRA 5K6RA 3KFVA 1YU9A 4P58A 4B9EA 4XH9B 1I7SB 1G63A 2AQHA 5DRIA 4MNJA 3T5AA 2P2NA 4XQ9A 4M0CA 4I7EA 3FKRA 2C7VA 3R3ZA 3AHJA 1L4FA 4GPZA 1HNYA 1Z38A 5K9DA 3OPQA 4AMVA 2BAGA 2MSLA 3BGWA 3JCZA 3WK3A 2AJLI 4YRJA 2ONZA 5EMNA 4RU1A 3FGOA 4YLYA 2GM4A 1S5VA 3P19A 2E5BA 4YRIA 1QUEA 3ZNNA 3LDHA 4F4JA 3TLJA 2I7VA 1EYEA 1ZJBA 1P19A 3I4LA 4OKSA 1TUXA 2IFTA 1J2YA 2HRZA 4YONB 1JJVA 2J5KA 3ERPA 1C91A 2GDZA 2IEBA 4PIVA 3EPJA 3E05A 1TWIA 6ALDA 1QJ4A 2AVDA 3L8FA 3K5IA 1PZ2A 4U7TB 2X1VA 1VP9A 1T4MA 1XFCA 2I2WA 4KEUA 1DIDA 3IOBA 3K2BA 3ES9A 3F6EX 2Q3HA 2JVKA 5EJ5A 3PS9A 2ZAIA 5FJOA 2WM3A 5LP6C 3P67A 1Y80A 2ZVPX 3O4RA 2RJGA 4FE4A 3SFKA 3MCTA 1Q16A 3TZKA 1DTNA 4WTOA 1LNSA 1PCXA 3MILA 4DXVA 4E14A 1T2DA 3KE0A 3NIGB 4CL2A 1RALA 5FV4A 4DA8A 4DSUA 1VJIA 1PZFA 5H0IA 3C48A 2XTMA 3M0KA 2EERA 3CUUA 1DJGA 2QGNA 4MB2A 2V81A 2PDNA 5JAUA 2Z7KA 5BW8A 5HULA 3Q8MA 4QGAA 3QU4A 1UKTA 3TLGA 2VLIA 3SJUA 1UDAA 1Z06A 5A5DA 2IELA 4HYWA 2BZNA 3VAVA 4O33A 4XDYA 2ZTHA 1DL3A 4YI3A 3AXKA 1W9DM 1ST2A 5JSYA 1EO7A 2J9GA 4EK7A 4LWWA 3GIDA 2V7PA 1OTHA 3T4WA 1UOPA 3VKAA 4DX3A 1Y65A 1JCYA 5DZSA 2VSFA 3MMSA 3DO6A 4RY0A 4EXQA 1TPDA 3JQFA 4TTJA 1C7TA 2QG6A 4BV9A 1PBTA 4MUIA 4RTLA 1B76A 4F96A 1YIDA 4ZE4A 1XAIA 4BBPA 2E8YA 1NFQA 3ZSSA 1BA3A 3W8DA 3VU2A 4K8HA 1VKOA 2PBLA 2D3TA 3T7SA 3S1UA 3C7CB 3PWKA 1T5SA 3AYTA 4AB4A 3CUZA 3VKUA 4DPKA 1TZJA 2PZJA 4K9LA 3VGJA 3HCPA 3BULA 1GV0A 3J7AC 3K4AA 2E1RA 1BHGA 1TO6A 5AI6A 1H62A 2J4CA 3SZUA 3VOAA 1Z7YA 3U4IA 2G06A 4IDFA 2O8BB 3LXXA 2SBTA 4UAVA 3GG9A 2QN2A 4K9RA 4H15A 3OODA 2ESCA 2X2OA 1XVAA 2D1ZA 4YGYA 3TX2A 1BE1A 1VQ1A 3R6LA 2IH4A 1UMCB 4NUWA 3PHGA 2H6EA 2VEIA 2PLAA 3FV9A 4JGBA 2CLEA 3OPSA 3ESXA 1J7JA 1A76A 2C4HA 4OKIA 5DEZA 1NYTA 3P7YA 2Z5GA 3WD3A 3UATA 1EX5A 1J4EA 1M0TA 3OLQA 3ILYA 4HGYA 1VRDA 3WBXA 4GC3A 1EBFA 3NRBA 5IDYA 4C29A 4B0PA 4GX0A 4XGRA 1CB7B 4Y9MA 2WYHA 3IAEA 4NRRA 4U2YA 3MJMA 2AEEA 4AKHA 1WX1A 4XM2A 1BH6A 3WQOA 2O8EB 4ZEPA 5KYUA 1GZ6A 4RTMA 1Y4SA 1QGED 3WBFA 5DEOA 5D38A 4MLRA 4MWDA 2DQXA 3A0RB 4KLAA 5LXTF 1WB6A 3VR6H 4H8HA 2E4TA 3TR2A 4MDPA 6TIMA 4G2DA 3GNNA 3NT5A 1MAUA 2J5BA 2YCLA 4NBUA 2J3LA 4MKGA 1U3FA 2Z0IA 3VNDA 1MXDA 5EXTA 3ANUA 2Y6VA 2XKBA 1TA3A 1SUAA 3E4CA 4Y2QA 3QFFA 1E2GA 1OBCA 4TOQA 2GYIA 3A6JA 4N3BA 4EGFA 2PNFA 2YW4A 4XB2A 2E7FA 5HRCA 3NHPA 4NX5A 4C6SA 1AKTA 2R9VA 4GXTA 3T6KA 2PF8A 3ENWA 1V8PA 3HKBA 2YHIB 2Z83A 3SCUA 5IJAA 3OZIA 4RHTA 4ND3A 5IMSA 3LVRE 1ML4A 4DLXA 1K9EA 3Q87B 3LT1A 3NP7A 1QONA 2WC7A 4CCZA 1E3XA 1BQ4A 2C8KA 2B7CA 1XV5A 3QPCA 1WB5A 3ZLJA 2UZ9A 5HZMA 2NQTA 4LXYA 1MORA 1VJRA 2IP2A 1JR6A 4DVGA 5EXDA 2G1PA 1ORRA 4MROA 4C0BA 5C8BB 3OVMA 5FFNA 3INRA 4C03A 1VG9B 1FRNA 4Q9KA 2PZNA 1XDJA 4EBFA 3M4XA 4TWBA 2JDID 1OWMA 4J3JA 2WHKA 1HVXA 1P1FA 1YVEI 4R0NA 3ZV3A 1N57A 1DKOA 3E7XA 1O60A 3BK2A 3QFSA 1XRFA 1DIOB 2X6TA 4AF0A 1W1B1 4BNWA 1SIOA 3ER9A 2WSQA 5LMUB 2O4MA 1T6ZA 5DNWA 5CIWA 4MX8A 4ONVA 4JGIA 5LA6B 1TJ2A 4YVPA 3SURA 5A4IS 1NVXQ 5LZLA 7ODCA 1KETA 3FYUC 1F9AA 5DM2A 5FAJA 4M0XA 5KOHB 1NKVA 4GFDA 3E7PA 2B37A 3W4RA 2I1QA 3LHTA 2IVZA 4RCYA 2O8DA 1Q8AA 2VVSA 1E7RA 4W6QA 3VDQA 3ZWAA 2HHCA 1M3SA 1ITUA 2DR2A 4MPRA 4YPVA 3GF4A 1USVA 1W56A 2BMWA 2RDWA 2XGJA 3GTNA 2QENA 2EPLX 5FL7D 3UNXA 3ZCVA 3HB0A 1RJ9B 1C4KA 5DULA 3R89A 4DRXA 5HKLA 2E4VA 2Q6TA 1L0BA 2GH1A 3EGDB 1HDCA 3RAOA 4G5QA 5H6HA 2YZ5A 3RKSA 3H86A 4U63A 5KSOA 3A4XA 4QGCA 2DJXA 1X38A 2BFGA 1OD6A 2X0RA 4WPGA 5CW2A 2J9FB 3U7GA 1X87A 3N7UA 4JLMA 5J4VA 4AJEA 5L7YA 5DTJA 1HFBA 5LP6A 1FLVA 3N0RA 3AIEA 1Z2CA 2NSHA 4GGPA 4Q4AB 3VZCA 4UQAA 1IUKA 1UBEA 4EB6A 2R94A 4Z2GA 1E60A 3DCJA 1BHSA 4IPTA 3VKBA 3GBVA 3I05A 3SC2A 1BGAA 4OI4A 4GLFA 1ZM7A 5JQGF 4KXYA 2SECE 2ETVA 5B7YA 5CU7A 4DDVA 3ITCA 2A59A 5DBOA 3G82C 2QLFA 5KTSA 3REQB 2F6KA 3NYWA 1VIWA 1UXHA 1NVDA 4RD3A 4QU5A 5ESWA 3PNQA 5DU2A 1DIEA 2FSVC 1ZSVA 4PYJA 2BLLA 2G71A 4GMGA 4P31A 1XRTA 3TSCA 2QMEA 2WLSA 1F2DA 4MITA 2FB2A 4UVHA 5JBDA 5D32A 3G2HA 3DFOA 3QGVA 2D2FA 1V4NA 4LYDA 2GDUA 4QJ1A 1Y9DA 1F5SA 2FN9A 1V93A 4RLFA 1PX0A 3KPVA 1NW5A 4W1SA 5FNVB 1HO4A 2GXSA 5DBEX 5DDIP 1RYEA 3ICQB 3CUKA 3MSXA 4NCNA 3C6KA 4HXGA 3RTBA 1T1JA 3ONWA 4HRAA 2VX6A 4CLXA 2H9YA 3LXBA 3GD7A 4TYMA 5K4AA 2PV0A 1Z42A 5I3JA 4MS4B 3SRHA 3FOWA 1L7DA 3AHFA 1Q7RA 3MC5A 2DQYA 3G9QA 1H61A 1A5SB 1TW2A 2FZWA 2V5KA 1N77A 4FDMA 4Y9SA 4M82A 4C3VA 1MUWA 1ML3A 4JB2A 2XUPA 1A9ZA 4NC9A 2G0NA 2DWQA 3DE3X 3WLMA 1GWJA 4RXTA 2D74A 2F8LA 2DVMA 4G56A 4TTTS 5A5GA 2AB0A 1Y7HA 1TTPA 2QORA 1Q2XA 1GTHA 4ZYTA 4HFNA 2OO6A 3HDTA 4CKWB 3AUOA 3W7PA 1WBDA 1GP2A 1YE4A 3O3RA 1J4AA 4NVRA 1W85A 1E8DA 4QXPA 3UPMA 3TNYA 1KJ8A 2OQIA 1Z62A 2FR1A 1D7FA 2GYUA 2F3TA 3C8UA 4ARIA 1RCXB 2MWMA 4JLOA 1RMYA 1I1NA 2BSXA 1X7WA 3DHPA 4BVEA 3TW4A 1L4YA 2Y68A 1TK9A 4NV1A 4IZGA 5EUCA 4UUOA 1EJ0A 4MJ2A 3BZWA 2IODA 5DLQC 4BV2A 6Q21A 4QBFA 5MKGA 1V45E 2XF8A 8XIAA 3KEGA 1FL9A 2TECE 2P0EA 2Y7GA 5CHEA 3WJ1A 1H69A 1VP5A 5PGMA 1XCOA 2I17A 1DBSA 3C86A 4M3PA 2R1UA 1R5OA 3MHFA 3NWPA 4EYOA 3AZPA 2Q0XA 1G69A 1THFD 3PNOA 3F5FA 4GABA 4DY1A 5IKPA 3TM5A 1TQ8A 3QLDA 2X2EA 3RYTC 1KZYC 2OELA 1XRRA 5BQPA 1UINA 2JFPA 2ODWA 4JEQA 2QU8A 4BEQA 5A94A 1DC6A 3SS8A 3DAOA 4J29A 1TE2A 3C4JA 2ACSA 1QH1B 3QZUA 3RBAA 2FRVA 5K0NA 4U7JA 2A3NA 4EQ6A 4D9HA 1XPOA 3G88A 2ASHA 4WWHA 3PIDA 4DYJA 5LNUA 2QY9A 3Q3VA 3B78A 4JFRA 2BC9A 1XZ8A 3FBWA 2XPCA 3LT4A 2W0UA 5L7WA 2BEUA 3T1HB 1KFCA 2YMPA 1X6VA 2RKBA 2D3NA 4M76B 1CQZA 2FPLA 1M7XA 2WAGA 4HZUB 4JLSA 2NQ8A 2PMCA 2FLWA 2ZYTX 3ZHCA 3U7HB 3LWDA 4Q34A 4FLMA 3K2GA 3ARUA 1N82A 3PB0A 2YXLA 1CEYA 2E55A 2QTCA 2HWYA 1WKFA 3QVUA 5LWQA 3A5VA 4AT1A 4YUVA 4JJZA 5JW6A 1W0KD 2FPXA 5JXJA 1OLUA 2GZHA 2QRZA 1CRZA 2CXRA 2ZAGA 1EQUA 4BMCA 3KZXA 4A8JB 1QOPA 2NVUA 1GNLA 1B8OA 4MUPA 2AYZA 4INPA 4KXNA 5BROA 4JWKA 2YRFA 1ZESA 4DYHA 3ILVA 4L5ZA 2CZ5A 1O5IA 1TTQB 3P32A 5KCZA 3IP1A 1MDFA 3C5HA 1K7XA 3DC2A 1T3GA 4KYVA 1JNYA 3NT4A 2IUEA 2HXYA 1INLA 3EN0A 1RWVA 3IE2A 2OZVA 3V9AA 1TYGA 3HFYA 4DTCA 3WBYA 1FEZA 3WWEA 2O1WA 4XBKA 1YDYA 4LHXA 2OWWA 4IH9A 2C1GA 3Q0EA 3HV8A 5D9NA 3C3BA 3G7NA 5DF0A 3W2MA 4E3TA 1NQXA 1U0SY 1LPBB 1MW9X 2C4TA 1Z4JA 1E6EA 5B7PA 4G1KA 3CX4A 1TYBE 3FYUA 3MVEA 2VSNA 2YZMA 4QXMA 3OJLA 4KR0A 3D6TB 1VIZA 1B54A 2R1PA 1JHZA 3TCNA 2FZBA 4ETIA 1TPC1 1B00A 5AI4A 4A8RA 2VPWA 1IV8A 3VDNB 4ARZA 4QP0A 5J5CA 5K0ZA 1HWYA 4NV0A 5LZ4A 3LCRA 4DIFA 2N47A 1WM1A 3CCBA 3U9SA 3GUYA 2D69A 2E68A 1OWOA 5K3SA 3BCDA 3EWDA 2INFA 4ALJA 3LK6A 5FL7A 1ABBA 3DXZA 2QUKA 2WHRA 3GJRA 3WLSA 1KI1A 4X60A 3TN3A 1EZ2A 3KKPA 3WWOA 3FPFA 4M60A 4NBWA 4QYIA 1DDOA 1E6ZA 3OQIA 1ZI9A 4WKPA 3T52A 3W70A 1W1A1 3KD2A 4JEMA 2C2XA 3IJ9A 3TGLA 2ZYGA 1Y42X 4E5KA 2PDUA 5BSUA 3FB4A 5GM2A 3VMOA 2BP1A 3X0DA 3RRBA 2OG9A 4JLWA 3VBEA 4LWOA 1CR0A 9ATCA 3H53A 2LE0A 3DGFC 2R6DA 3CX6A 1MF7A 4AIEA 2GZ2A 2V0NA 1W73A 4HMCA 4AKSA 3QYJA 4ECLA 2E4YA 2JGQA 1P6CA 3ZV5A 2NSOA 4LBYA 2JLZA 1R0RE 1U0BB 2FSVA 1SU5A 1IZZA 4QDZA 4JTHA 1TU0A 1NR5A 3AHHA 3QEJA 1TKAA 3PRKE 3VPXA 4HN4A 1S3SA 4Q8VA 5FOWA 2PXAA 4KQFA 5BXQC 4PUDA 2RG7A 3FOCA 3QA3E 5JADA 3PUEA 2YHBA 3R76A 2R87A 2YBTA 2AGKA 4QM7A 1FFSA 1DC3A 3W87A 2J3QA 2P3ZA 3OQHA 4TKVA 2HRBA 4YRCA 2HWWA 2XVKA 3S2EA 4YT4A 4RO0A 6LDHA 4XVHA 4FN4A 5CTAA 3UWQA 5JSHA 4QC2A 5J1SB 1ADOA 4L1WA 2ZBTA 1TL7C 4LGMA 3H1TA 5DNVA 4OYYA 4BJ3A 5BMVB 2X0NA 5CGMA 3TL3A 3HG4A 3MINA 1SVSA 1OFTA 2XWQA 2RDTA 4UQOA 1RCFA 4NCHA 3ZLHA 1OXUA 3QBTA 4A1OA 2ZZMA 1NOWA 1UC9A 4Q1EA 1OY0A 2RAVA 5REQB 2V8OA 5H9VA 4KOEC 4MUGA 3BEOA 5G0WA 1OH8A 4O18A 2PEYA 3Q15C 2IKIA 1E4VA 2IF0A 3TAOA 3P9NA 1XF0A 3VDHA 4ZA2A 5FPPA 1AE1A 4BBAA 1U9IA 1AZ2A 2ATEA 1Z26A 3JUGA 1UJ5A 1Z5ZA 1ZNWA 2QX9A 4V33A 1U8TA 3HZRA 4DA9A 1EUYA 3G02A 4AW7A 4DSZA 4N5HX 2V38A 4FMPA 2FQQA 4EP8C 3WQRA 1XDUA 4LZLA 2OR3A 4DY4A 4AMBA 4QYSA 3HFTA 3PZ9A 4A3YA 5CB4A 4UTKA 3LOTA 1XISA 2O3JA 3T40A 2I7DA 2NUAA 4FYMA 2EF1A 4FP9A 3GG2A 3MWGA 5E70A 3R40A 4XD7D 2XFRA 4CR7A 4AWTA 3HU1A 3EWSA 5AYVA 1C7EA 2VZUA 2EG9A 2C5HA 3C3DA 2Y8VA 2VHYA 3ZGVA 2A6PA 3R5KA 4DSTA 2C19A 3WMFA 1FUEA 3NB0A 3R7BA 1EFTA 1CZUA 3HO6A 1GVYA 5FOSA 4EOUA 2XZ7A 2JCXA 3OP4A 2XD9A 2NXCA 4MUJA 4F0JA 4X6LA 1SKYE 3DOFA 1XIJA 3OCCA 1XGDA 3VYUB 3BVPA 3AIUA 4YP1A 2DZAA 4FT2A 1CEOA 4BMZA 3DAHA 2A3RA 4B3JA 3B8UA 4YRDA 5B7GA 2G4FA 1S2WA 3CRQA 4UC0A 3Q2KA 4K3ZA 4PRRA 3IS3A 3QYFA 3FB1A 2Q8XA 5EFZA 5IRCD 1Q1EA 1XYMA 1DTUA 1QU3A 4OVXA 4G0OA 2WZEA 3NVAA 3A4AA 2H4HA 3CUVA 5BW6A 3MA8A 2BWJA 1KTIA 1DKWA 1QH0A 1X15A 4NQZA 4FR6A 1G9SA 2I87A 3T3HA 1PZMA 2O0LA 1FFBA 4ASUD 4ILKA 1UZAA 5LBTA 2FQWA 2V7EA 1O94C 3QQ0A 3L40A 5IVIA 2ZC8A 1AK2A 4M38A 4HVAA 1KJQA 2AZ4A 4HH1A 3LQFA 4ABYA 1IQUA 4KN8A 3PXEA 2GLUA 4UBMA 1Y5LA 4WQ6A 1U2EA 5F1YA 2VA8A 3GMTA 3DX5A 1OGBA 1V9LA 2AKMA 2H8ZA 4FQ7A 4YC7A 1WUKS 1LRQA 3WMBA 3ZHVA 4LYAA 1G6HA 4D6JA 3UWUA 3FYDA 2HCRA 3EULA 5HJXA 2DFTA 3VBCA 4JWTA 1W0KA 1I0LA 2NYUA 3ITVA 5KINB 2XMCA 2Q3JA 3IT3A 4P4TA 5IJZA 4PO8A 5M2QA 3GG1A 2YINC 5C2GA 3CNNA 4QYTA 4PB5A 3BTUA 4LDZA 3MGCA 3KAOA 1C0LA 1EKOA 1QC5A 5AHLA 3AXXA 1X14A 3TE7A 4LY6A 4WW0A 1JSCA 5D84A 1RPNA 2H8GA 4MG4A 2Q01A 3OZ7A 3KZKA 4ZTUB 1ZXXA 1G8FA 4PE8A 2ZYAA 2Y77A 1KAOA 1TO3A 1KOLA 2ZDQA 1FNDA 2QRUA 2QM8A 3W3AD 1B3RA 1M2JA 4UDNA 1I9GA 1JN0A 3HYTA 2XLCA 1Y7VA 3PF9A 5DP1A 3KVRA 1I2RA 2ZI9A 2YVKA 3AJRA 1JRLA 1J8DA 1UEIA 5HE9A 3ONEA 1RACA 4ESHA 1JEOA 4GC5A 4JN8A 4O4VA 2WZQA 3WK6A 1RPXA 4N5DA 6REQB 4EARA 1FC0A 2E2WA 3FPAA 2AN5A 1SA0B 2WKWA 4CG0A 4CR6A 1HYHA 1KYXA 2WHMA 3DTTA 2P77A 1IE7C 4H8NA 2VHJA 3E1GA 5BT9A 1MB3A 4FGUA 1E5VA 4ROSA 5DMXA 3TJMA 2GJLA 4HA4A 1KAMA 3DFTA 2XUIA 3IBGA 3I2FA 1ZJZA 4EUEA 5JHGB 4NRDA 2OQHA 4WLVA 4Z8XA 5DH9A 3D5EA 4EW1A 3ZWXA 3BE7A 2DJIA 3H2HA 4TSKA 3EMDA 1HZJA 3VK5A 2YFOA 4PSCA 3N15A 4OA8A 2F17A 4HAYA 3KHJA 4HV4A 3JQ8B 1BYIA 2QYTA 4MYRA 2OD7A 1UR3M 1JHAA 5KMYA 1TVMA 3OVRA 3EHEA 4KWUA 1DAFA 2VPTA 2NSYA 2G77B 2Y62A 2X13A 1L7EA 1JDNA 4V1XA 3VH3A 3D8BA 4KBGA 1ZJIA 2J5QA 2OB3A 1OFUA 3LCVB 1LDGA 2ZUEA 1HT3A 4L8WB 3PF3A 4GLJA 5K99A 2IPGA 1Q14A 4MLCA 1QG6A 2EX4A 5K3CA 2HJVA 4FYJA 3NDJA 1GZJA 1TTTA 1G17A 4WVXA 2A3CA 2EZUA 1LUAA 1M2OA 2OT3B 3FVWA 1QVBA 3NOXA 5J8LA 1XA3A 3UZWA 1U3DA 1A88A 3IXMA 2O1EA 3SCNA 2CBIA 4R7TA 4U2EA 4QBIA 2PAFA 3E53A 4KQMA 3MF4A 1Z22A 3ORYA 1KI4A 3HEMA 2F64A 1YHYA 3KDPA 3U56A 1W5QA 2HZGA 2QM7A 4KBXA 4LWQA 1GYNA 4M89A 1G20B 3KHUA 4ZOLF 1Q0PA 3MMTA 4KUHA 2Q02A 1EP1B 2HRQA 2O05A 1E4IA 3A22A 3BREA 5EJGA 4BQ2A 1V8DA 1I9CB 2YYTA 1LLWA 4MA5A 4TRRA 1SVKA 1DOZA 1OZMA 2YQZA 4S38A 2P6UA 1OFQA 1TM5E 2GD0A 5D2TA 2QA5A 4PSDA 1ZRMA 4D8XA 3PQ2A 4A3UA 1WPGA 3KZPA 2NN3C 5LZ8A 1WAMA 1QP4A 3VX0A 4FNOA 2ZBDA 4OKNA 4PUNA 2D0FA 4N5NA 5D87A 2R1TB 5JVDF 1B1CA 3WQEA 2ZJ2A 2GVYA 4ONEA 3UK2A 4NASA 4R9XA 3ANLA 5CYPA 4ZEWA 2V6AA 3M7SA 3W7DA 4KW7A 1OIFA 5FJUA 3IJEB 4NMWA 1W3KA 4QIHA 3BXHA 1A97A 1Z68A 4C5BA 1UH2A 3UFBA 4GBMA 1G21A 2VZ8A 1NNI1 1YNYA 4KKXA 3IALA 3IVCA 1HX0A 4XD7A 4RK7A 4NMXB 1XQ6A 5G3ZA 3RCBA 4DXAA 4JZKA 2VX7A 1RLJA 3MW7A 2XIBA 3EYPA 3G77A 2GSJA 1LFDB 2X0IA 2PLWA 3AQUA 1LL6A 4RLHA 2DORA 1FX0A 1JRCA 3R7SA 5KQGA 4KCWA 2GQ9A 2MNRA 4K68A 5C5CA 5LU9A 3FWKA 3JS5A 4KE9A 5A8MA 4NJOA 4CLOA 1QBBA 1ESEA 1NG1A 4GR9A 1ZGHA 1AQHA 3GGOA 2B8WA 4RZXA 4Z2JA 3QKSA 1GUZA 1AW5A 1EIZA 4I9TA 4MP8A 1GSHA 2ISQA 2XB2A 1W5BA 2WMHA 4F0SA 2FEOA 1LRNA 1YS4A 5GONA 2VJXA 3UBTA 4PMQA 4MI3A 1DX4A 1Q4NX 3EQ2A 4BFZA 4FVTA 3BJEA 1TPWA 4ZT4A 3ZHSA 4DZIA 1U1DA 1UWTA 3UZZA 2V45A 4WASA 1YB5A 2YYAA 2IQ5A 3FN9A 4DLUA 4AF8A 1O94A 1YK1A 4ASUA 1OXBB 2FXVA 3APYA 3F5QA 3NBAA 4IZOA 1LBIA 1JNEA 3RYIB 2WSYA 1J0BA 4RHYA 3OJFA 4MAVA 4IZHA 3FWHA 4FFWA 3RRZA 1GY8A 3P97A 1M1NB 4YT8A 3MNFA 3BC1A 4B84A 4K9MA 1E9RA 3W6MA 1U33A 2QYOA 1B5TA 4BCDA 2NZXA 3MOSA 1YJAA 1YOBA 2I4LA 1QIDA 4C6NA 3GNOA 4OMDA 4J16A 4L9WA 3ABRB 1LQAA 4URWR 3E1SA 4ME6A 2WIFA 1YS9A 1UOQA 1NPTO 8CGTA 1FS5A 1SULA 3NNSA 3RV4A 4FR0A 4UCWA 2EFYA 5A4FS 3TOSA 2XSZD 3R58A 1G21E 3B36A 2ID9A 3QE9Y 1JDBC 3MJCA 4BIIA 3QFTA 3CW8X 1SKQA 1RDFA 2ZQYA 3TW8B 1CY0A 1VDZA 3ZV7A 4N8DA 1GA1A 1PJZA 1O1YA 1XTRA 4D6PA 3V46A 2P2GA 1C3OB 1T3LA 4XEHA 1FLDA 5L45A 3AO0A 5DBHX 3ZWDA 1CYEA 1XNQB 4QFBA 4HNQA 4PCUA 1X2EA 4MDFA 4WGHA 9LDTA 1D9EA 3ZG6A 5DGDA 5IM5A 1Z37A 1TEVA 3W3AA 5LKRA 2DR3A 5HINA 1NX9A 1JEYA 5AY7A 1MJNA 5AFDA 2WTMA 3CV1A 2J4FA 1AMUA 2GXUA 2VPXA 2X0KA 3HGOA 4ZVNA 1N5IA 2VTEA 1CR2A 5D2XA 1LQ0A 1HG3A 1OYVA 3PEWA 3R9KA 4FZ3A 5HJYA 4UM7A 3AI2A 1V8OA 3GHYA 4RM2A 3B9PA 5DX7A 2ZYFA 4O3FA 5B4UA 5F2IA 2AOUB 4JXJA 3L92A 2QGZA 2VSOA 1XN1A 1BPLB 5D6OA 1I3OA 5DYWA 2FTPA 4E5VA 1KI9A 1XLLA 1OZGA 3K9LA 3UA3A 3CCCA 2WE7A 1Q6YA 3R7AA 1UH5A 2AEFA 1HKHA 5ULLA 5FBWB 1L5NA 3TDMA 1OZAA 4PC1A 3R2JA 3GW8A 5GOTA 3VGGA 3C8NA 1I2OA 5XINA 2J3DA 4D8LA 2I3BA 4R84A 4OGKA 2A30A 5CRIA 4HDSA 2ZM5A 2XB9A 3LP8A 3BF8A 1UR5A 3HV0A 2WD7B 4LA4A 5TQLA 5C8ZA 1B0IA 1VG1A 3ELYA 4J5NA 2B81A 5DNDA 4CNNA 3LU2A 2EWVA 1PG5A 3VNYA 5A9SA 3RS8A 4QCFA 1SQFA 4LVBA 4NCIA 5A6SB 2BHTA 2VO1A 4EAYA 2RONA 2A9OA 3LUCA 1LW6E 2GJNA 5JJIA 3F6PA 2JQXA 3AEUA 4OD0A 1MW2A 1U80A 1KQGA 1KEEB 1YONA 2GN2A 1NQKA 3R74A 1V6SA 3NMUF 5JZVA 4G0WA 5A3QA 1XLCA 4WH0A 4KEVA 4F0KA 5TGTA 4Q4QA 1GW1A 4NZYA 3DT6A 3GW3A 1YBQB 4RFVA 1ZIPA 1KFWA 1C9EA 2E09A 1G19A 4XCVA 3SUVA 1DFIA 3LX9A 3KLKA 4MKRA 5T6MA 1TT7A 4B9YA 4BYMA 4NU5A 4KWEA 4LFBB 2GK1A 2BV9A 5FTMA 1Z35A 3T7TA 4BJ1A 1CRWG 1D8TA 2BMDA 5EZYB 4G07A 4OMCA 1F6PA 4WKOA 2RH9B 3I3EA 1WJGA 3WA7A 4Q4JB 1R6AA 1XEWY 3AFOA 1ZK3A 5IH7A 2FZ8A 1QZ3A 3FX2A 1NN1A 4AD5A 5EL0A 3ABQB 2CLHB 3NQCA 3KSRA 1CXIA 3WLHA 1ZVQA 1AUVA 4TS9A 3POCA 1GQ2A 2QBYB 5T3YA 4GP7A 5I3FA 1ZBQA 4TXEA 1XBXA 3U3ZA 4QQ3A 2NLIA 3MB5A 3H9EO 2GBGA 3ARWA 3KJNA 1MHTA 4J07A 4C1NB 2M2IA 4Q1CA 4RS4A 1YU6A 2X0EA 4BXOB 1V4YA 1CUHA 3VKJA 2PDGA 4X22A 3PJEA 1IBCA 4OYLA 3HG5A 4BRUA 3DKLA 4FXPA 3DFFA 1HGWA 4PTNA 2BHZA 2CWDA 3TL6A 1AQLA 2WZBA 3GXBA 4ZGBA 2DLCX 4OHOA 4MFDA 3AOGA 3IH5A 3ZE9A 1LWOA 1C8BA 2W6CX 1LLUA 1LDBA 1GQFA 2WKQA 4WSKA 3DFZA 3P2YA 2IYFA 1XBYA 4H35A 1KBBA 1PHWA 1N2CB 2PL3A 1L9XA 3K8QA 3DGBA 3SOPA 4HNAB 5JH7B 3R5SA 3G2KA 1L9WA 2W2TA 1LTHR 2WJYA 1BJKA 2Q45A 4KQCA 2AFHB 2F67A 4J7XA 1T8PA 1JD9A 4B76A 4NK5A 1RHQA 4GQRA 4L73A 2YCEA 3POHA 4QITA 1LQTA 1N3IA 5TJ9A 4HN2A 3PHAA 2W4XA 1PQ4A 3RC7A 2FMNA 1M6NA 3P9RA 4JB3A 2Q21A 2ZUBA 4F2GA 1XA4A 1XZKA 5E3IA 4GL2A 3H22A 3SZOA 3INYA 5DX0A 1KI8A 2K5UA 4G0MA 5JJ5A 3UOAB 3RBZA 5L3RA 3BK0A 2OHHA 5CT6A 3SS7X 2I6FA 2JBHA 4EKDA 4IJRA 3VNUA 4ZO6A 4CEHB 2JAWA 1GZ5A 4E12A 3H2IA 4BAGA 1NW7A 2IHYA 3EVZA 1MZPA 2DPLA 1GT91 1V95A 5CSYA 4MYHA 4Y2RA 3K2EA 5LLDA 3S28A 4MKHA 1CGWA 3B9OA 1OOEA 1VG8A 2AKZA 4EPYA 4AROA 4MCIA 2G6BA 2K2WA 1RM5A 3FBGA 2BFBB 5IJXA 3GLQA 2LGJA 3EWUA 3L01A 3WY9A 2BM9A 2VUSA 3E3LA 2CYGA 5B2FA 3PXDA 3W2UA 3F6YA 2CD7A 3Q5EA 5FO1A 4G9EA 3DOUA 2YB1A 4B8YA 4CN4A 4XUYA 5FB3A 1RVKA 2XEXA 1AB6A 3WDIA 1A4LA 1YKGA 4U9UA 2ZIGA 4XO7A 4HU4A 3AUXA 1ZWLA 4K9DA 2G40A 1FDVA 1DBTA 1X9HA 3BGOS 3FDZA 4BGVA 3TTYA 1ZH8A 1UDXA 1Y8CA 3O9ZA 3PFKA 3QR0A 3OT4A 2JLYA 1QM5A 3PPXA 4O2AF 2LKDA 1I7QB 1MJGA 3VR2D 1JBEA 1LK5A 4OKDA 5AXDA 5T6BA 2AOXA 3IGHX 2R68A 3QUAA 2CVPA 1GYPA 1Q0ZA 2HA4A 2XSZA 1CVRA 5DCYA 2NU9B 3U44A 3T38A 4XZNX 3GYBA 4UFLA 2OFJA 2WNNA 4PLHA 1RBYA 4MTVA 4QGSA 4DJDD 4JOMA 1POXA 1BYUA 4PGGA 5E0OA 4DJDC 2RJ3A 2HPIA 3C6BA 4CKCA 1ST3A 2XFYA 3C5QA 3RHGA 1NVMA 2O7QA 1PZ1A 3MP4A 4AO8A 3DEHA 1Z07A 4OK5A 1JYNA 2XIIA 1KY3A 4H77A 4F5YA 3GEMA 1VHWA 3W25A 3VX1A 3GJ4A 3DWIA 1JSXA 4QAWA 1YTEA 1A4IA 1J8YF 3KTAA 4R3NA 4MYAA 4FEEA 3WIVA 5IWAB 5A0VA 1YCFA 2NAFA 1A9RA 3LRTA 4D9KA 4OU4A 2B8NA 4E70A 2P7IA 3BWYA 1YDFA 4HCHA 4X44A 5H59A 3TLLA 4EHBA 4FA3A 4OSEA 1O54A 5TSDA 1EM6A 1DTEA 2GZ3A 2IXBA 3H23A 1NBHA 3L46A 2AUMA 3FGNA 4CMCA 2O3UA 4AN1A 1STOA 2GCOB 3EUEA 3WGGA 4DILA 1WZKA 3PCXA 5JMTA 1RV8A 1XGEA 4AY8A 2BOEX 2BSQA 3HPRA 4NENA 1AUXA 3PEUA 1J8MF 5ALQA 2PX0A 4FDUA 4V02A 4ZHQB 4C7MA 2IXFA 4YEDA 3KXQA 3DH0A 2JZCA 3WH6A 1VMKA 4QATA 2WMOB 4IUYA 2EO7A 3FHQA 2WQDA 2P6MA 4CU8A 2FDCA 1OEPA 3WHLA 4ZRNA 1B90A 5JAZA 3RLUA 1ZM4A 1IPHA 3OD5A 4JQ4A 2DT1A 4HPGA 3CVXA 4HKTA 4B5UA 5EJ7A 2LDBA 1CI1A 2WJZA 1L1EA 1AQIA 1TV4A 3WL6A 4DO4A 1Q8JA 4GIAA 1XWIA 4QDOA 2RFLA 4XEUA 4KDCA 2R7KA 5H70A 3IAAA 3ESDA 4QJ4A 3OIXA 4FDVA 4G0YA 2QTMA 4IDNA 3U1BA 4K6OA 5IDIA 3P0RA 1NW6A 2CDRA 3WUFA 3O8QB 5K0CA 3GDFA 4MIOA 3LN3A 4P8VA 2VATA 3QVGB 1V4VA 2OV3A 2H63A 4KXFB 4PX5A 1MHPA 3CEAA 2OZEA 3LLFA 1NDWA 3BERA 3WYCA 1VOTA 4G5OA 1AC5A 2QV7A 3G1RA 4A27A 3H5IA 1M7BA 1BN7A 5KYYA 3FJOA 3GBDA 2WWVD 2OCBA 3FN4A 5BQ5A 3E70C 3PB2A 2GB4A 1JNDA 2WUEA 3W1EA 1Q3KA 3ADBA 1E55A 1TJPB 1WXGA 1ZPTA 1Z56C 4MPKA 4KPUB 3O91A 4L95C 4YCJA 2G9NA 4IF4A 1N34B 1CWUA 1AKQA 4O08A 4GK8A 4WBNB 1NUPA 4EA6A 2JJ2D 3QV2A 4AIUA 3DF7A 3LXUX 3Q72A 3GLKA 2WU0A 1AMNA 5E9JA 1TJ4A 1SVOA 3TXZA 3S5OA 2J77A 4QECA 2D0IA 1M67A 1GD1O 1KMNA 3BQNB 3WYBA 1WB4A 3VDBA 2W2KA 4PLWA 1FDIA 3RU9A 3ZDDA 3CPUA 1TUBB 1BYBA 3PBKA 1ODSA 4FHCA 4MY8A 1NQ6A 5J47A 2F43B 4RTPA 3RJTA 3UAYA 1CGVA 1W29A 1TR1A 3HA1A 1C93A 4XUGA 5AM1A 4OLJA 1L7PA 2E4XA 1XSJA 3T4XA 2WJ6A 1X6LA 2E0PA 3EXG2 3BFXA 4JJ8A 1YVDA 5JY1A 2O0KA 4YCLA 3TOPA 1J99A 3KVYA 1QZZA 4H4CA 4O16A 4PAGA 2LUOA 2BFEA 2IBSA 2AG6A 4PPGA 2HEIA 2AFIB 5HVNA 4H0NA 3QNWA 1MDBA 4KDFA 4HB3A 3JQ7A 5GP1A 5FUQA 2OXIA 4AFNA 5FF3A 4DV4B 3D8RA 4PRTA 1U28C 1A5CA 3MFQA 4XB3A 2COUA 2BBWA 1OTXA 2X5JO 3N4EA 5EIEA 4KERA 1SRRA 3E23A 2OHGA 4E5NA 4QVKA 5EUMA 3OOQA 5K8VA 1GPFA 1OGYA 3BIJA 4IDPA 1FXQA 4O59O 3EB4A 4HPXA 3W7KA 1XVUA 3JYOA 4ACAA 5FPQA 1V0NA 2HLDD 2X1UA 4PRKA 3EWXA 4PHTA 3DF9A 1GSAA 5JV5A 3RTCA 3A9IA 4IH1A 2NT1A 3IKTA 4D6DA 3CQJA 2FPIA 1UKVY 4PULA 1BHO1 3BWEA 3K1ZA 1Q57A 3O31A 3PUGA 4DAIA 1Y8ZA 4LCBA 2PTDA 3HB5X 2XGGA 1OFUX 1W35A 3BMNA 3EVFA 4K8EA 3AP1A 4PTZA 5CBPA 1CLXA 5FPHA 2DSVA 4JTFA 5ICCA 3EA4A 3CGWA 2XH2A 1DP0A 1TAQA 3W3AH 2YDRA 5LXEA 1WL8A 4K37A 4L3WA 4Z9BA 4UAJA 1Z6KA 2QXWA 4MAFA 1U65A 4C3OB 3A1DA 2R47A 4LW8A 1U6IA 1V0JA 1HUVA 4B2LA 4NP7A 1J1IA 4KK3A 1OG6A 3UF9A 1FMLA 4B4UA 1OH7A 1P1CA 5F4SA 1RXEA 3KL4A 1Y6ZA 3RSCA 5LNVA 4F97A 3TIIA 5D7BA 3LQRA 3AUFA 2C31A 1BG6A 4IJKA 5BR7A 3G2IA 1K6JA 4Y9NA 5K3VA 1UR9A 2Q49A 4CRWB 4DV6B 5K9ZA 3CB8A 1Z73A 4TV9F 2CY0A 1TREA 3DIPA 1FA9A 2OK7A 5I5GA 2R7MA 1ICEA 5ALGA 3F3SA 5HQMA 3JW8A 3TIVA 3DV0B 4WGFA 1OIMA 1JXAA 3M1LA 1VR6A 1J12A 3Q8LA 5C8VA 3QP9A 4CLRB 5IBPA 4WLFA 4JBHA 1EXVA 1E2IA 2FZ5A 3UC5A 5CYGA 4MPQA 1OFBA 3COWA 1GDTA 5A2BA 3SFWA 3F8TA 3H5WA 3DZBA 4WY0B 3U7QA 2HT1A 1ES9A 3VR2A 5U4XA 1W8DA 3I2JA 1MJGM 4HAIA 1SC3A 4RMNA 4B6RA 4UE2A 5G1YA 4QAJA 2DSWA 1EH9A 2ZDHA 5ARDA 1TDJA 1J2RA 2B9EA 4ZP1A 3LV8A 1DC8A 2A3HA 3S55A 3F9IA 2J46A 3K4PA 5H8MA 3EHDA 4G97A 4LF9B 4J2MA 3OAAD 4Q02A 1X0XA 2HIHA 3KE8A 7TAAA 4L5BA 2EJVA 2RCYA 2ZGVA 4DJDA 3CHEA 1FSFA 2XGZA 3Q37A 1QK4A 2PD6A 2VUNA 4JLAA 2QAGC 4ORMA 1OZFA 4LSBA 3TCXB 4GO1A 4X65B 2KX9A 3O94A 1I5RA 4EPKA 3ROKA 2DPMA 2MR6A 1NMYA 4FR2A 2FF5A 2ZTJA 1FTSA 3MPOA 4KQ6A 2I6TA 3HQNA 3B3JA 1R6UA 1TTHA 3A21A 3EPPA 4UMBA 1Y3AA 5B37A 5ENZA 4RV4A 3WJXA 1R4NA 1YZTA 4ZC1A 5IJ9A 2DHRA 3N8DA 3SXJA 1PDZA 3LQLA 3A6FA 1I10A 3ZD9A 3TZNA 1A50A 4WMLA 3JR3A 3E27A 3ELWA 3ONDA 1PV2A 2BUBA 2E1WA 3PC2A 1SPBS 3OG2A 3CQKA 4UC5A 1Z6GA 3PJRA 3MUAA 4R5HA 2VWHA 4YRGA 3PTKA 5A8GA 3RYCA 3MDUA 2B1GA 1BMDA 1Z4QA 5HIIA 4XIAA 3NUZA 1TCDA 2C9MA 5DHAA 4MWZA 4JYBA 1NX6A 1HZZA 4X0EA 3M0LA 5IFKA 2PRLA 3M3PA 4FAMA 3KXLA 1X1BA 1YRBA 1UCFA 3SF0A 4IGEA 2R2GA 3Q1KA 2GPBA 2P3SA 5G53C 1G8SA 5DSZA 4CLEA 2F1OA 2HL6A 4HL6A 1K4MA 1O9HA 1VHQA 1SW3A 1NVKA 2CZCA 5HW0A 1OREA 4L5JA 1ECPA 4GX5A 2PDWA 3GMIA 1GPYA 4NX2A 3HM9A 1J6PA 1ODKA 1A5ZA 2NVBA 1GAXA 3S4TA 1VLWA 4XAFA 1Y6GA 1YZKA 1U1IA 1XR2A 4XD5A 4UFKA 1ZCJA 4I50A 3E0QA 2AT1A 3CURA 1Z47A 4J0QA 3ZR6A 3I9KA 1OI3A 3SDOA 3KBJA 3HSSA 1TV7A 1KI3A 2K7ZA 1H94A 1M5RA 1RQ2A 3GX9A 1XEXB 4IIGA 2HPAA 1WSWA 1KH1A 1C7IA 5EFDA 5J4LA 1FVPA 2NSXA 3E1F1 3C0LA 1RPKA 5D2VA 4J1SA 2X3FA 4L28A 2C2OA 4BUZA 2BH2A 1WCGA 3RT1A 2J6HA 1UD2A 4GBDA 4IOMA 1RD4A 1GPUA 2WWDA 1M66A 1T8SA 3FCYA 2YZGA 3LU1A 5CM2Z 3KE9A 1ILWA 3U40A 2G3JA 2AXQA 2VVTA 1UWVA 2K7FA 3A27A 2HGZA 5I23A 1JU3A 5T91A 2JFFA 1ZAIA 4PS1A 1Z0UA 1H1ZA 5G4HC 2JJ2A 3UJ2A 4CGTA 4ZCQA 1TZ9A 3N05A 3OOEA 2RHGA 1MENA 4NJKA 1EGVB 4HNSA 3RC8A 1DZIA 1TUFA 1QP7A 3VOIA 3FDKA 5FEMA 4RKEA 3ICVA 2XA1A 5FPYA 1JEDA 2UZ4A 4AAYA 1V5WA 4D3FA 4EY3A 2ZTMA 4O1IA 3MG9A 1PKYA 3F3KA 2YW3A 5EN4A 1LQ2A 3CZGA 3NHBA 3ZU3A 4XTCS 2C13A 1CENA 1ISSA 3TQKA 1IRIA 1AB5A 4WINA 1TVEA 3UCXA 4QRIA 3UWKA 1Z9BA 1VHNA 2WABA 1OXVA 2X7XA 2FDSA 4QG6A 1WEKA 3M4YA 1E6QM 2LRHA 3QW3A 1BCSA 1DWHM 1EM8A 3RAFC 4RGVA 1MIHA 3KEHA 3DUFA 4OGGA 2QI9F 3VI4B 1U28A 3N07A 3PHBE 3ILHA 1RRPA 5F77A 5LIKX 3DCYA 3MS4A 4A0HA 4FUTA 4IFEA 3TBHA 3CNLA 1OX5A 1XXHB 4KN9S 2QRJA 5LQNA 2JEQA 2VWTA 3WJ7A 4L3VA 2VD8A 1XYGA 4WNAB 5JCJD 2J27A 2WJJA 3O0FA 2X7JA 4A2PA 2HLDA 3GC5A 1ZUWA 3M34A 1E3MA 3EMVA 3PNPA 3VGBA 1ISYA 4KDRA 5JBNA 4H9XA 1JFFA 3J7TA 1ZUD1 3RYHA 1Q1NA 3ONFA 4Z2HA 4AZHA 3TQOA 3RABA 3D1JA 3DEAA 2GTHA 4XWYA 1RTTA 3AM1A 2AYXA 1EJ7L 2J9ZA 1NQWA 3GPBA 4L3OA 1FF9A 3MYRA 4UVDA 1N6IA 2DP3A 4YJ2F 1LC3A 1TVNA 3GFZA 2BD0A 4WNCA 3VI3B 1R4AA 2PC4A 4PBTA 1KJWA 2DT2A 3PUJA 4J3XA 1OADA 1P9LA 1TFVA 3KX2A 1LBSA 2FA9A 1TWWA 4HDMB 3A1NA 1OFGA 2VFHA 3ZTYA 1N36B 3O7UA 3UNTA 3NZEA 2BLNA 4FGWA 5K9CA 1GU1A 2W6JD 4G7EA 2RHHA 4V2XA 4OU5A 4XQGA 1K06A 1KI6A 3E2IA 1BRMA 3RTDA 1IVSA 2G83A 3NHJA 1SC4A 3T95A 2C1EA 2IY8A 3MRVA 5FUVA 2Q62A 1TV2A 3HB7A 5KJ1A 4AZ3B 2Y0CA 2Q4RA 4ZQFA 1VI2A 3O5AA 4INZA 2V30A 4HHMA 3PVSA 2VDOB 2DXIA 2AHOA 4L61A 4QEHA 1L5KA 1ZK1A 3TECE 2L2QA 3OCJA 1OQAA 3CUYA 5KNDD 3HU3A 3DLCA 4O1HA 5CB8A 2XSXA 1WAUA 1KO1A 4JJAA 2YDYA 1E5LA 3RFVA 2HWUA 1OV4A 3SCSA 2EATA 4QTYA 2LP4Y 2JJMA 3R8CA 3BWBA 3VI2A 4R9NA 2A9QA 1TYZA 1KYIA 3V1HA 4Y6LA 3ZEAA 3E4DA 1EUCA 2YY6A 2IYAA 3MTGA 3L68A 4PMDA 1AVAA 4CM8B 1ELOA 5FD8A 2RSLA 4W8GA 4NIMA 1XJ5A 3WLNA 4R83A 4DY6A 3GQYA 2NQ5A 3IPLA 4BKUA 3OAAA 1M34B 3VC3A 2QMZA 2XKAA 2ACRA 4BNZA 2QAGA 3P9KA 1KKUA 1ZI6A 2NXNA 3NYIA 2PA3A 4JX9A 1GITA 3HP1A 1FWJC 1TM7E 2VTFA 4IWXA 4NEQA 2INEA 1DHRA 5EJAA 1PW7A 2AUTA 4O4JF 4G84A 4AZ5A 1U0OC 3H9QA 2Q3CA 2OSWA 1AX9A 3CO0S 3W3OA 1D9ZA 4JPGA 3VPGA 2BTEA 1RBMA 2IY9A 1E1FA 1J8VA 3EIEA 1EVQA 2HZ7A 4R51A 2GLKA 1JHQA 2P69A 1MNAA 2ZRVA 3ZEIA 3X1YA 4FI4A 2VHLA 1UJNA 4GVFA 1PV1A 3AY7A 4JT9A 2OXRA 2YXEA 4G3XA 2C97A 3GVWA 3H2NA 2BLEA 3WB1A 4RIEA 4WX2A 1FOEB 3WEZA 4OGLA 4RIFA 4J76A 2HE8A 2YHAA 5FWDA 3E22A 1UR4A 1J6UA 2Y0DA 4KBFA 3ZYCA 4DBZA 1E4YA 3I68A 2H1FA 3U13A 2A1UA 5PNTA 4GWEA 1WBHA 4GI1A 3N17A 3BW3A 5JG7A 4YWSA 3AMLA 5JT1A 1PZ3A 1DEAA 4RVSA 4OT7A 1ATZA 1U0HC 2XDQA 2ID8A 4HY3A 4NY2A 3GEPA 4U6NA 3ZVHB 3GVCA 5H9WA 1M9NA 1VE5A 3CHFA 3C6MA 5CDYA 5FCZA 4MR9B 3L1VA 4R8RA 1USKA 4UQCA 5DW0A 3KZSA 1VFLA 1GKIA 1Z83A 2WKRA 1C8VB 1DTWB 5B4TA 1X7ZA 2R6AA 2CLDX 5DASA 3GRZA 1FWBC 5HQ3A 1O87A 1U7UA 3A6PC 1A8PA 3PR3A 1CNMA 3ZR5A 2GL5A 1QYVA 5I5EA 4W7IA 4AUNA 3GNPA 2VUHB 4WJEA 3HU5A 1C0IA 3BURA 4QEKA 1BKSA 2ZEJA 3R11A 3FKSD 3HGJA 2JGDB 4R1LA 2GCEA 3AR5A 1HYBA 4XVQA 3N28A 2I6QA 2XCLA 3TZCA 2N75A 3WD4A 2PH3A 2B4YA 3LZ3A 3QWFA 5H8PA 1ZJ5A 3B4YA 3C7TA 2QRVB 4JDUA 4QU0A 3CPEA 1X92A 4XVDA 1PWYE 2I5QA 4DHWA 3HN6A 2HWXA 4K9SA 2YWXA 3W1NA 3FGPA 4UUAA 1ECJA 1AH2A 2GPJA 4JBRA 2GTPA 3TWOA 2GBIA 4XAZA 3AGPA 5FI3A 4Z0PA 1Z0KA 4BASA 1KGXA 3T7RA 3F4KA 3H8AA 3WTCA 2Z28A 4W99A 4P08A 5LXTB 4LF6B 3ZGNA 3EVAA 1P6UA 4MCHA 3U19A 2I6GA 4L4YA 1WCYA 4RBNA 1GEEA 3L7YA 2IEYA 3RVKA 1GTG1 1SKBA 2CUTA 4CV2A 2JLUA 5HJ5A 4PGAA 1Z4NA 3ZJUA 3I3DA 3EODA 1SJ9A 3G2OA 3RIMA 2ZR0A 3ENZA 3SCWA 2WNWA 4W4TA 1QS0B 1HDGO 4D9GA 3TEJA 1FRQA 3T0FA 3AR2A 2AQ8A 2FUCA 1DRVA 3VYVA 2FK8A 2IZZA 2KMLA 3IJ8A 3U9LA 1QNPA 4YFVA 4FE3A 4JHMA 4D25A 2VOTA 1HGXA 1XKYA 4LMPA 1QGYA 1N3LA 4Q9LA 1F3LA 2VAWA 1KB3A 2HF2A 5ALTA 1II9A 3GEDA 4FX5A 1XZIA 2W7TA 5F1UA 2IQTA 2GBPA 5BR4A 2D22A 3JD2A 1EUQA 4RUBA 2OYRA 4M1EA 3KBSA 3THCA 4LXQA 3APTA 2VJPA 1DADA 4IIUA 3AMKA 3T9DA 1SKUA 1Z32X 5ALZA 5EE5B 2DH6A 1UQYA 2WJWA 5ALXA 1H8ED 1UJQA 4JUBA 3Q12A 3P3BA 5JCJA 3FCAA 4IJUA 3E7DA 4F2PA 1XTJA 3B38A 5ENVA 4EEKA 4L4OA 9ABPA 3IS4A 3OZBA 4KO3S 5K6AC 1NUTA 5DI3B 5JRZA 4L0QA 4ZKEA 2WZHA 3SX4A 1W5TA