5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
4CTKA 5IKMA 4QTTB 1K77A 4C08A 2OKCA 1XJ5A 1G6Q1 1DCTA 4ISCA 5DXJA 1KPIA 5EPEA 1QAMA 3OU7A 1AF7A 5XIAA 4KIFA 1RI5A 4MWZA 2UYHA 5ICEA 5EVJA 3PX3A 3I64A 1EIZA 1XLKA 1EJ6A 5GP1A 5LSAA 3TKYA 2PKWA 4OA8A 2FYTA 3VNIA 1XLAA 5FHQA 4GOND 2P7HA 5DSTA 4RVGA 4R05A 3VNKA 3GCZA 3OPNA 2NQJA 5FHRA 2KW5A 3Q7EA 3OZRA 1NW5A 3BDKA 2AVDA 4F86A 1ZQ9A 5EKXA 1A0DA 2FK8A 4PYQA 5DM4A 4RTNA 1QZZA 1KPGA 1JG4A 4P7JA 1NV8A 3O31A 3KPWA 1ZGJA 2Y1XA 1V39A 1X1BA 1VE3A 1BHJA 1XLLA 2VDUE 1KYWA 1N2XA 5HILA 4K3ZA 1D2GA 5EIWA 4E3VA 3FPGA 3PB3A 3LL7A 1AV6A 5DM0A 2ESRA 4DCMA 4GOLD 4KWCA 1XLFA 5K0FA 3DXYA 5CVJA 3FRIA 2UYOA 2VDVE 4AZWA 1L1EA 2GH1A 5CIYA 1H1DA 3DMGA 4PYMA 3EGVA 4XSMA 2P3QA 5DT2A 3M0XA 5FA8A 1JQDA 3XINA 1B42A 2QUMA 2PXCA 4PYJA 1SUIA 3CQKA 3WQOA 1XXLA 2C7OA 4BLVA 4CKCA 5EHIA 3TM4A 4RTOA 3UJBA 3NVKI 1YZHA 4QDKA 3C6MA 1M6EX 1DUSA 5E1BA 4EKGA 5BXYA 3S68A 1INLA 4FGZA 5E1MA 3M0VA 3EPPA 2NXCA 4A8NA 2O05A 3NWBA 4U7PB 2G70A 2G0WA 3P6LA 1ORHA 3NJRA 3QOWA 1WG8A 1ZGAA 4IV0A 4FR0A 2ZZMA 3I5UA 1G55A 4ZBCA 5K03A 1KXZA 3FTDA 5FA5A 5CUQA 2XBMA 3RODA 1O1HA 2YTZA 2OB1A 4WVLA 4Y2HA 3OFJA 3U81A 1XIHA 3NVMB 1XIBA 10MHA 3BKWA 1XLHA 6XIAA 1WZNA 4C07A 1JR4A 1TW2A 2ORED 3QC0A 2AOUB 3FPFA 2UYCA 3NW9A 2ZIEA 4A6DA 2JHCA 2P35A 3CCFA 4DVOA 2CMHA 4YUZA 3LKDA 3ITVA 1ZKDA 1EG2A 2HTEA 2JJQA 5T64A 3BWMA 1QT1A 2YXDA 3EGEA 5D1HA 3KTCA 2GLUA 2XVAA 5CVEA 4HTFA 3C0SA 2ZSUA 4P58A 1QYRA 4V0QA 3M6XA 3P2EA 2XIMA 4FT2A 3NWEA 2QM3A 2O57A 4RSRA 4IKPA 1RI2A 4M37A 4DF3A 5DPMA 4QE5A 1JG2A 1XIMA 2JHPA 2GLKA 3B3FA 3EVGA 2XYVA 3TVAA 3AJDA 4GUAA 2PBFA 4MQ4A 3KU1A 5LQRA 3DULA 4KW2A 3LGAA 1NW3A 4PYKA 2ONYA 2WK1A 3SX0A 3LDUA 5E9JA 5LQAA 5KVAA 3KQVA 5FULA 4EKIA 5ICGA 4PIMA 4FSXA 4AZSA 4POOA 1I60A 4BLWA 8XIAA 3EVBA 3TR6A 4K1GA 2K4MA 4GC9A 4OA5A 4X1OA 5GOZA 2P3OA 2C7RA 1EAMA 3CC8A 2H00A 1G38A 3OZSA 4JXJA 1YB2A 2YX1A 3P2KA 1ORIA 4XKMA 4XUDA 5K0CA 3CJQA 2QRVA 3DR5A 2OB2A 3VYWA 2IBTA 3LCCA 2NQHA 1Q0SA 1G8AA 1X1AA 4F84A 5HFJA 4EVIA 2I62A 3CQHA 3KBJA 4EK9A 3ERCA 1BC5A 3DUWA 4XUEA 1XLDA 1N7IA 4ZTBA 1SQGA 1XICA 1VBFA 5E2AA 4E30A 3C0KA 3TOSA 1U2ZA 3SVZA 3B7PA 1VQ1A 2A14A 3DMFA 3EVZA 5HIMA 5K0GA 3FTFA 5DX8A 2PX2A 2R3SA 4R6WA 3VNJA 3FUWA 3MGGA 1NE2A 2Q02A 3JWIA 5HOQA 4EAYA 4PONA 3SSNA 3L23A 4GF5A 4FSDA 4OBXA 1CLKA 3DOUA 2DULA 3HNRA 1MJFA 3G5LA 3D2LA 3AALA 4HGYA 4R6XA 2X7VA 3QYSA 1DE5A 3P2IA 3FYCA 2JHAA 2QE6A 4QDPA 1WS6A 3GJYA 3HVJA 4A8RA 1L3BA 4XIMA 5DTRA 3I9FA 4FP9A 1XLEA 1XYBA 4NECA 4RTRA 1RJGA 2ZIFA 2XISA 3QZAA 3G2OA 2GPYA 1RJEA 1XYLA 3I58A 1RJFA 5E9WA 4A8IA 2YUIA 2PXAA 5DM2A 3JWGA 1NW8A 3P9IA 1XVAA 3UJDA 5EZQA 2NP7A 1X19A 4ER3A 4HHLA 2XVMA 3FTEA 1FJXA 2PVCA 2G4JA 2IP2A 4QQKA 1QUMA 4OQEA 3KBSA 5AVHA 1XIFA 1XIEA 2I56A 2YR0A 3LCVB 3BZBA 4RTJA 4BLUA 2J6VA 5IH3A 5DRTA 5DSXA 5K8VA 4AUKA 3LBYA 5KQRA 4PYOA 1IXKA 1D2CA 2IH4A 3OBEA 1YX1A 2B78A 3DXZA 1FP1D 3ELYA 4DUOA 4CTJA 3JWHA 4WXHA 5CVVA 1F38A 2O06A 1R18A 3GRRA 5K0EA 5DTMA 5JR3A 3ORHA 2PXXA 2PGXA 1VL5A 5CCBA 4C04A 3KBVA 5FTWA 3T7SA 4P7GA 4Q7IA 4E2YA 3GDHA 1QAQA 2XINA 3VC1A 4GC5A 5EQJB 3KR1A 3UJ7A 4RV9A 2Z6AA 2QW5A 3VSEA 1O9HA 2NXNA 3NMUF 3VYLA 4M36A 5XINA 5T6BA 3M0MA 3FPHA 5ICCA 3UBTA 5K09A 3LSTA 2QY6A 2P40A 5FCDA 3KWSA 3BZGA 1XISA 5CD1A 1ZG3A 1KPHA 1NKVA 5EOVA 5B80A 4ER0A 3KR2A 3E05A 5DXAA 4RTSA 3V97A 2H1RA 3T0IA 2IPXA 3ITLA 3KKZA 2PV0A 2I57A 2E5WA 3UJ6A 5EG5A 5KYGA 3G8AA 3VNMA 1R8YA 3SXJA 1PJZA 3MB5A 4GLEA 9XIMA 3ANXA 3U0HA 1XCLA 4K6MA 4MTLA 1HNNA 3G2QA 1L9KA 1NBHA 3DMHA 4HC4A 2HMYB 2C7QA 5F2NA 4QDJA 3TPZA 3M0LA 4QE1A 2ZFUA 5B7YA 3EMBA 3TRKA 4MIKA 2I9KA 2OZVA 4ER5A 1T43A 2AOXA 4YUXA 3HVIA 2QUNA 4X61A 3BWYA 3P8ZA 5C0OE 2Q41A 1IY9A 1XIIA 2AN5A 3E23A 5LQKA 5G02A 4R8SA 3SSOA 4F85A 1ZHFA 2I6GA 3SGLA 5KQSA 2ADMA 4YTTA 3FUXA 2ONZA 4FS8A 4PWYA 5FWAA 2ZWVA 4Z2YA 4CKBA 3UWPA 3DH0A 4PFHA 4GJJA 3K6RA 1NBIA 1JSXA 5BW4A 3ELDA 1PRYA 4YUYA 5E1DA 2BR3A 1DE6A 2BH2A 3OE4A 1XLCA 1Q0TA 1F3LA 9XIAA 3G88A 4PGHA 4QEHA 4HH4A 1MHTA 3THRA 3SSMA 3EVDA 1TZ9A 3KR0A 3EVAA 2ZBQA 3M4XA 3KPUA 4E70A 2ZBRA 4HRAA 3M0HA 2N47A 3FPEA 3FTCA 1KYZA 4X41A 1JTFA 5D1NA 2ZTHA 4XIAA 2HK1A 2C7PA 3BXOA 4E2WA 2WA1A 3IEIA 3AYVA 2OYRA 5LQNA 1KIAA 1FP2A 3N4AA 4J4KA 3KQSA 1A0CA 5AVNA 1WXWA 4DZRA 3UU0A 4AZTA 3KQOA 1RI1A 5F2KA 5GIPE 4LG1A 5ERGB 5E2BA 3FVMA 4CKEA 2ZIGA 4IV8A 1UIRA 4PCAA 2IDJA 2G71A 3KBMA 3P97A 5P8WA 3KQWA 3ITTA 4HG2A 4IWNA 1BOOA 1P39A 2YQZA 3BKXA 5HIKA 5CM2Z 3FYDA 3DP7A 4LECA 3R0QA 4E32A 3R24A 2AN4A 2PLWA 3XISA 3BT7A 1QANA 2NQ9A 2P8JA 1XLJA 4OVXA 3AY0A 3LHDA 3B3GA 3EEOA 4PYIA 4YUWA 1JSZA 5BP7A 3IYLW 1AQIA 3AXTA 5H6HA 2XYRA 3CGGA 3LCUA 2PX4A 2IIPA 1JG3A 2X7WA 4A6EA 2EJUA 1XLBA 4GOMD 2B25A 5DLYA 3A25A 2WA2A 5EMJA 1NT2A 3ER8A 2GS9A 2B9EA 2JG3A 3B5IA 3HVHA 4EQZA 1XDUA 3UZUA 2G72A 4P7FA 3DLCA 1XDSA 4PINA 5CCXA 4HNOA 2CMGA 5HIJA 3P9NA 5CVUA 1IM8A 3G2PA 2GB4A 1X1DA 4RWZA 3HTXA 3A7EA 3E8SA 3HA3A 2ZW9A 1YFJA 5B1SA 5K01A 2QYOA 4BY9E 4ER6A 3P9KA 4KRGA 2AS0A 3AWIA 1R00A 5FADA 2ZULA 3GRVA 1XLIA 2O07A 3TKAA 3CVOA 4KVZA 1G8SA 3CJTA 3GU3A 1D8WA 2HV9A 3KQYA 2UYQA 4YTRA 1SVUA 3PTAA 3B3JA 1BXBA 2ERCA 3ER9A 3NGFA 2BM9A 4YTSA 2XYQA 4PCLA 2HK0A 3UVAA 2ZVRA 3VNLA 3WSTA 4DQ0A 1DIDA 3PS9A 1P1CA 1XLGA 1YFLA 5GIOE 3K0BA 3OFKA 5BW5A 3M0YA 4C03A 1DXIA 2CL5A 4X63A 5EIFA 5DX0A 2AR0A 4RVFA 1QTWA 4EACA 5HZMA 3C6KA 4DKJA 4DM3A 1A0EA 8XIMA 1UWVA 5ICFA 3PT9A 1NW7A 2B3TA 5CVDA 5K0LA 2LD4A 4LNCA 3C0QA 2Z6UA 1TPYA 1I6NA 4RTKA 3EMDA 5XIMA 2FCAA 2AOWA 2FHPA 8MHTA 2DPMA 5E1OA 3UJ9A 3CJRA 2P41A 3C3YA 1XCJA 3OZTA 1I1NA 3GRZA 3PLAE 3C0LA 3C3PA 4E2XA 4CWAA 4YV0A 4A8LA 2PSSA 5LQUA 3AXSA 1MUWA 1S5NA 4GBED 3TC3A 1XIJA 4W4QA 5J8LA 3NDJA 4C4AA 4ATNA 1UFKA 5K0NA 4ZB5A 5EC8A 3DBNA 3MCTA 5E8JA 5FUBA 5GM1A 5GINE 1XP3A 5LQCA 3FPJA 4QE4A 1JTEA 2BR4A 3I53A 5EEGA 1GW9A 2AZTA 3OU6A 3IHTA 3O7WA 2EX4A 4QTUB 4HGZA 1XYAA 3PVCA 1BKYA 3KBNA 3UA4A 4EMSA 3IUIA 5EZSA 4YMGA 4HGXA 4YTUA 2EJTA 5C9ZA 5EMLA 3MCZA 2NNWB 1NV9A 1SUSA 5LR6A 2EFJA 2OU4A 4E33A 3R6TA 3UXIA 1VP3A 1EQAA 3X0DA 1JQ3A 3G8BA 1R8XA 3OE5A 4HTFB 4H0NA 1XINA 4YV2A 4UOEA 1KR5A 3EEYA 4DMGA 3GWZA 2V74B 3R9XB 1XLMA 1AQJA 5EMKA 2FRXA 4R8RA 5FWDA 2NYUA 4KIGA 5GWXA 3OCJA 3OU2A 1Y8CA 4M7RA 3HCBA 1S5MA 5GM2A 3P14A 1O54A 3JU2A 4C05A 3ID6C 2ZBPA 3QV2A 3A7DA 2CKDA 2P1DA 4KDCA 2EG5A 2ZVJA 1OR8A 4XSLA 2VDWA 3SMQA 5TNVA 4QVKA 3IV6A 2IH2A 3IUDA 5E9QA 5B7ZA 2PJDA 4Y30A 3A4TA 1KHHA 3HVKA 2JH8A 3BGDA 3HA7A 3Q87B 3BWCA 1SKMA 4HHMA 3KQMA 2I7CA 1R6AA 2QRVB 3REOA 3MHTA 4RTQA 7MHTA 1O9GA 1YZ3A 5T67A 4XCXA 1QAOA 3GRYA 2VZ9A 4QEEA 4LWPA 4E2ZA 5MHTA 3LX6A 5EKUA 2AOTA 4QVGA 3KPVA 3BGIA 4OQDA 1VPTA 1XIGA 2NXJA 3MAGA 1FPQA 2PY6A 2H11A 4HSGA 1R74A 3EVCA 4RVHA 3GXOA 2ZDSA 3UJAA 6XIMA 4LWOA 1OADA 3FRHA 1XYMA 3GNLA 3DLIA 1P1BA 1RJDA 5M5BA 1MNZA 1FBNA 2PWPA 3TMAA 4BP1A 1YF3A 3GIWA 2AOVA 4C06A 3BUSA 4PNEA 5H1WA 4ZB0A 5EHGA 2GA9A 3CQJA 4DCGA 4ZB2A 3MERA 3BWWA 3RW9A 3MTIA 4X60A 3CBGA 3MQ2A 4L7VA 4XUCA 3UFBA 3QOXA 4O29A 3PFHA 3LKZA 2JH9A 3U3HA 3KHKA 2BZGA 3THSA 4US6A 4E31A 5HEKA 1D2HA 3AYTA 1TW3A 2IFTA 3ELUA 2GYIA 2PX8A 1XTPA 3KQQA 2QULA 3KQTA 2G1PA 4GEKA 1DL5A 3G5TA 3DTNA 3HA5A 2HWKA 1XYCA 2IH5A 2P7IA 2HCVA 4P7KA 2BR5A 3P9CA 3MTEA 2OO3A 3CKKA 2ZCJA 1M6YA 2R6ZA 5EGSA 2YVLA 3TQSA 3KQPA 3RIEA 1XIDA 3EVEA 4KDRA 1Z3CA 3NTVA 3BZJA 3VC2A 3LPMA 5JUWA 2VS1A 3CWHA 2PT6A 5H02A 3HP7A 4YMHA 3BWBA 2OXTA 2CWWA 3GGDA 2YXLA 2HR1A 2GAFA 4YV1A 1X1CA 3LMZA 1G60A 3ITOA 3CQIA 3GO4A 3GRUA 1WY7A 4B17A 1I4WA 5LQJA 2ZZNA 2ZLBA 5KS2A 3E7PA 4PYNA 2GUBA 4AX8A 1SQFA 3KR9A 4RVDA 3UJ8A 2YXEA 1RI3A 3KPYA 1KP9A 4QPPA 2HNKA 3F4KA 2B2CA 3TFWA 4YTQA 1BXCA 4PGGA 3ITYA 2AVNA 4QDWA 5DM1A 2UZ4A 4PIPA 3LDFA 4OBWA 3H2BA 3ITXA 3M33A 5K0BA 5F2OA 4RX1A 3GNXA 3BGVA 4KW7A 3R3HA 4PGLA 4RTMA 3ME5A 3UJCA 4CXMA 3IUHA 1YUBA 3NDIA 1P91A 3B89A 3AAMA 9MHTA 3BANA 1N7JA 4AZVA 3CNYA 3FUVA 1HMYA 4V0RA 4RTLA 3XIMA 2VP3A 3PFGA 3LBFA 3TLJA 2V7EA 1I9GA 3G2MA 4G56A 3TM5A 5EEHA 2FPOA 3LECA 3G89A 3DX5A 3LDGA 3EVFA 1WXXA 3M6VA 3UA3A 4RTPA 2NXEA 3DXXA 4FZVA 2AN3A 2NP6A 2P3LA 5U4XA 3M6WA 5HIIA 5K05A 3HM2A 4PYLA 4GQBA 1L3CA 4YUVA 2PX5A 3KCOA 3O4FA 3A27A 2AOUA 3ELWA 2FK7A 2Z6QA 4MHTA 2G8NA 3PX2A 4RYLA 1M0EA 5DX1A 2PWYA 3FZGA 3T7RA 5EMMA 2PT9A 3FUUA 1VLMA 3HCDA 1VIDA 4ER7A 2OY0A 5DTQA 3EGIA 4QQNA 4FT4A 4QPNA 3JWJA 2OPBA 5K0JA 1JG1A 2AOTB 3HCAA 3FUTA 3SM3A 2O0LA 3A26A 4GJIA 2IBSA 1DIEA 3M70A 3L8DA 2BM8A 4XISA 3V8VA 3SR4A 1RI4A 2ZZKA 3P71T 1SG9A 4DA4A 5I7GA 4M38A 7XIMA 1L3IA 5FQNA 3T7TA 3QXBA 1XDZA 3M6UA 1NW6A 1EJ0A 2GVEA 3HCCA 5DRYA 2OBFA 4GOOD 4OX9Y 4BP3A 1JQEA 5DWQA 3G7UA 3HCEA 3KPJA 5FQOA 3KCLA 2IDKA 2IGTA 2Y1WA 3KBWA 2ZWAA 1VP9A 3HEMA 5C1IA 3KCJA 3HCFA 5E8RA 4U7TB 2F8LA
chains in the Genus database with same CATH superfamily
4FHZA 4WJXA 5AVOA 3KALA 2AFHA 5H0IA 3MI2A 3GR8A 1Q7MA 4EB6A 4PFJA 1SJBA 2A1YA 1SXGA 4Z4FA 4QUKA 1ZVVA 4NCIA 4HAIA 1X8KA 5FWYA 2ID8A 3L6OO 3W1VA 5F1PA 4NZPA 2I6SA 2D20A 4K6AA 3LRPA 4G4SP 1D8TA 4MF4A 3GCXA 4YAJA 3S27A 1QW8A 2OOSA 4LZZA 1NDHA 2NLIA 3RF6A 1CUZA 3LGXA 3GNQA 4QAWA 3ORFA 1XLAA 2B4YA 3PSHA 3HK2A 1R3TA 5AC8A 4LRUA 4AAYA 2G96A 5DSTA 5FBRB 4CL0A 4TVCA 3EX7C 4AULA 1TF2A 5FHRA 2JAXA 4AD0A 3OZRA 5JD6A 1R27A 3HBFA 1PW5A 2QMUA 4YMUA 3WGYA 4EE9A 1B23P 3C5QA 1JJ7A 1E9ZB 3IV7A 1OFHA 3DP9A 4U6SA 1I0LA 5HCNA 1Z33A 3W4JA 1C1DB 4IIGA 4W8HA 4DA9A 1X86B 4I9HA 2A79A 4IM4A 2R14A 3EMKA 5HPCA 2VRCA 1E4EB 4C6NA 3NXSA 1M5TA 1JJIA 4AIIA 3A5FA 3BCDA 2AL2A 4PAQA 4TTIA 3KHSA 3HV2A 3W26A 1CY8A 1GWNA 1W1UA 1XYFA 4JBYA 4QG6A 3H6GA 3HN7A 3O8BA 2D6FA 1ZIXA 3EGVA 2W6ID 3HPZA 5DT2A 1HM5A 2VFIA 2XH4A 3LM7A 1Q7TA 5K6RA 3NNNA 1SUIA 5GNYA 4L4PA 1XXLA 2J3KA 4ZC8A 4N9DA 1SOAA 1VL8A 4DR5B 1NSJA 1IOZA 3CV6A 3C6MA 1GDTA 1CUHA 2YFHA 2OCYC 1NWHA 3LRXA 5DMMA 3F3YA 4R9NA 3F3SA 3LD5A 4Y7CA 2OPJA 2GJAA 2G70A 3RFVA 6REQB 2XUHA 1IK6A 2Y5JA 3HPSA 3GVHA 4YRJA 2Z5LA 4O28A 3AUYA 1VBJA 1MU0A 2FEPA 4R0VA 1AN0A 4DRXB 1AJEA 3EXEA 4MB0A 5K03A 2D1SA 4MWAC 3NRJA 1UIMA 3R8HA 3R5KA 4WVLA 3NP9A 1K8ZB 4PTNA 4D99A 1L4NA 1LCOA 2DU8A 2VYQA 1XEXB 2YYUA 4LGVA 2GO1A 3FGPA 1J96A 3S8YA 3H4GA 4WEVX 4KH2A 1JZTA 4X9YA 5IVDA 2XFWA 2JHCA 1YRAA 4ECEA 3LUTA 2CMHA 1TPFA 3GRCA 1PFVA 3OUUA 1JAIA 4FXOA 1E7WA 4CG0A 1UOPA 2BZ0A 2BPOA 1C3XA 3U5YA 3ZKWA 5T64A 3NBMA 4QRDA 4YBRA 4LRTA 2YXDA 2Z30A 3LGSA 4WD3A 2WQPA 1CUUA 1KBKA 4P22A 3ZTWA 4AMBA 5C1DA 4DV0B 2O3RA 3LDAA 4LYKA 4V0QA 2QUVA 1LWNA 2GGEA 2FPLA 2X3FA 2IRWA 4AXNA 1X8JA 1DEKA 4BZXA 2HU2A 2BOVA 4YAOA 2OEMA 2PWHA 3G1WA 4PW0A 3PKZA 3T6KA 3JWEA 2MSEB 2B3DA 3L4ZA 3INTA 3AF0A 5AJWA 1OX4B 1DBSA 3WD1A 2GWHA 2OVBA 2YWFA 4ALMA 5BXPA 2P11A 4TUYF 2DVUA 3RYHB 5IX8A 3E27A 2RJGA 1DUVG 3TDMA 4C6RA 1JWBB 3X1YA 1OLXB 2DH6A 3ZWSA 1E8DA 5JYDA 2DIJA 4FR5A 4YT2A 3LH5A 1JXKA 1Q7GA 3J7AC 3FMOB 2GQ9A 1A5SA 3DE5X 2HEJA 3HU3A 3U2OA 1DG1G 1WDQA 3KYJB 3T09A 2OB2A 1ZCCA 4Q03A 3VYWA 1G41A 1K8YA 1M0SA 1DQXA 3GD6A 1U3GA 2MYPA 2WZTA 3NQEA 1GJUA 2J7HA 3L0OA 5DI9A 3JQ7B 1F05A 3ERCA 2ZICA 1Y42X 3C4JA 3O63A 2CZVA 1VL6A 4JTGA 3BRSA 4IT1A 1YJBA 2OQYA 4L78A 3GUZA 4M19A 2ESCA 1IXOA 1HYEA 4O63O 4HO1X 4KGZA 1PX8A 1SXJA 1JKXA 1HIZA 1VBGA 4QAJA 2CNKA 3L7DA 1Q1NA 4NU8X 4MQ6A 3EOEA 3E2VA 1M74A 3UF9A 4UTRA 4J3WA 4JXKA 3U3KA 5BYAA 3SXPA 1FP8A 4H04A 1WHSB 1Q15A 4N0PA 1DQYA 5BMXA 4W93A 1TNDA 3CH9A 4R1NA 1BO6A 3NJ8A 1MJ5A 4J4BA 3DVAA 3GY0A 2YVUA 2VWTA 4XDYA 1E60A 4NKCA 4R3UA 1W1YA 3KTSA 3H7RA 2JFOA 2P2YA 2V2DA 4OSOA 1P43A 3G0HA 1XR3A 2Q6VA 4QQ8A 1KK3A 3WQ8A 1JXAA 5C8DA 3IAAA 5FP0A 1XLEA 4GAEA 1BW9B 4UZFA 2B36A 1UKBA 4BEVA 1E20A 1Q1AA 1TCBA 5AK6A 1XYLA 2E89A 1V1MA 1Z8HA 2IP4A 1LLDA 3LCHA 4MTVA 2NP7A 2LLEA 5EPDA 3WLMA 4HTYA 4LS2A 3WQBA 2ZRWA 4KQFA 3JQCA 2XVMA 4KKXB 3EIUA 2GFTA 4KO2S 3HJEA 3GG9A 1KVTA 3DC0A 5M03A 4G2DA 1GPUA 1XDMA 1W54A 3LNTA 3WEZA 1PQWA 1OMOA 2OP0A 2PT7A 4AX4A 2JIEA 3SC2A 3LMYA 3LCVB 2EYUA 3THXB 1JRCA 2J77A 4HNRA 4AJPA 2IKSA 4EHLA 3BB1A 3QWHA 2Y0EA 2XNKA 2R2GA 5CKSA 3THYA 4ZVOA 3DAYA 1DIKA 4C5CA 3CAKA 2XKJE 1J0CA 2JI6A 2C0CA 3DLTA 5BSTA 1PLLA 2C18A 2FGJA 1R18A 3N4FA 2DUWA 3ONCA 2GBLC 5DASA 2F38A 3VYSB 2J5BA 3IJQA 3HG5A 1CUDA 1PVDA 5FTWA 3T7SA 4P7GA 2JF7A 4RPLA 1WAMA 3UPMA 1DBVO 4J1QA 5DI3B 2H29A 4CF6A 3UIEA 1W6RA 1Q22A 4X71A 1G5IA 4NJJA 4ZK2A 2C13A 2RIRA 3NGJA 1P2UA 1A9XB 1WKEA 3NMUF 3F47A 4CCSA 3PJWA 3HDTA 2I14A 4CTOA 2QJGA 3Q15C 3S81A 1CIVA 2P40A 3FVTA 4ODIA 3C3UA 1U7DA 3HKCA 2V6GA 2PWGA 3RVSA 5CG7A 2ZZ6A 1JHUA 3IPXA 3IP3A 1C91A 4ER0A 2VH2A 1X7DA 4Z0HO 2ZE0A 3T0IA 3T4EA 1J2BA 3OHMA 2VNKA 1YOVB 3TSZA 4WKPA 4DAIA 2JHFA 3FKQA 3HXOA 4WDQA 2IV3A 1CX9B 5BT8A 1AU9A 4DARA 2WOQA 4XSGA 1J24A 2WABA 2A0KA 2GAOA 2E28A 5GAJA 5JWRA 1QR2A 3NCOA 5SY6A 3KYBA 1X9GA 5CBBA 1DOHA 3OKCA 4HC4A 4C7OA 5ES3A 4JNZA 3GFZA 4OXKA 3K8QA 3QPAA 5I3DA 1J06A 3BE7A 4P3PA 1SZGA 2AX4A 4ZFNA 1Y4DE 4XPZA 1P7CA 1JHOA 2R1KA 3D3JA 3RC9A 5JCPA 4IEEA 4BNZA 2AN5A 3GH3A 2PNFA 1BG6A 4R2JA 1U28A 3KWFA 5CLJA 3GNOA 6YASA 4LSGA 1L4KA 4UREA 3TJZA 5CPMA 1SZJG 2PUCA 4YRGA 2ICSA 2CBUA 1FCJA 1KS9A 2AR9A 3NIGB 3ZCRA 1A9PA 5IBXC 4O0QA 5AW0A 3DH0A 2BJHA 2X0YA 2ODEA 1YQWA 2VFEA 4L4UA 4OLFA 3S2EA 1EP2A 1NIJA 3B78A 3T3IA 1WE2A 3GXDA 5ITZB 4I5GA 4AQLA 4N76A 1CEOA 4PGHA 4QEHA 5BU9A 3M4ZA 3RG6A 2WFLB 5KSWA 3QNMA 4HRVA 3TW8B 3W05A 1UBSA 1TEHA 3KR0A 3OLDA 1W3HA 5HW0A 3WMFA 1P61B 1I2ZA 3RAJA 5CA1A 3ZX4A 2N47A 1BLIA 2NLOA 4J3JA 5AVZA 1MABB 5D9PA 4XIAA 1QHHB 4NICA 3UBPC 2WA1A 1RE0A 1ZUWA 3IEIA 3OX4A 1L4MA 2INEA 3EWAA 3KQSA 2X1VA 2W5FA 1TTPA 2Q3DA 1XEFA 3VK5A 1TMKA 2FWAA 1WOBA 3ERPA 4R9RA 1N6KA 4HWSA 2VJDA 2PDLA 2FR8C 3PL1A 1XVTA 1WP4A 1X7YB 2HPZA 4PMUA 5EAIA 2EJBA 3U5ZB 3HQPA 3H2FA 5FYDA 3T44A 2GJXB 5FI5A 3ABXA 2J48A 3P67A 4FSAA 1IJEA 3TTQA 3WIUA 1Q6RA 2FPTA 3KRUA 4UUIA 1DTEA 4CU5A 4KCUA 1FX6A 2YQ5A 1AUXA 4BB0A 3WGIA 2QDXA 5JSHA 1JRBA 2WCGA 2I5IA 1Z68A 1NC1A 3IOCA 1ENPA 1UKVY 1S3TC 1XLTA 3K20A 4MS4B 5JBFA 1RC8A 1T0IA 1IZYA 1C4WA 2A94A 3KUMA 2DWQA 1UWRA 1SG0A 3I3EA 4JLBA 4B9YA 1PKYA 2WKGA 3UGTA 1EBHA 2QJIA 4D26A 4PCTA 2YL5A 3D8TA 1E3JA 3B0UX 4AWXA 5A6MA 3DZHA 3AFIA 4UFKA 3K6JA 1IG0A 2PX4A 1V37A 4GKVA 3TLAA 3A22A 2DZWA 3BW4A 4JLPA 1NDYA 1HDEA 1VPLA 2Q8QA 4MNJA 1OC2A 4JFAA 5EMJA 1LC0A 2GS9A 2B9EA 2NV1A 1XVVA 1T5BA 1EI9A 3A6PC 4JN8A 3UXEA 1VHCA 2NQ5A 3UZUA 1AKQA 4MQFB 2VNCA 3K09C 1XXHE 3BLDA 2DZDA 2OCKA 3H12A 4UTOA 3GRIA 1DWUA 1JHPA 2Q0HA 5GPBA 1GG8A 4HEA1 2JS7A 4X64B 1F3OA 3HTXA 2E8YA 5JQ9A 3EZNA 4J1NA 1DI0A 2VAVA 1HOXA 2MT9A 1BH6A 4FR1A 1J2RA 5B1SA 5E9AA 4HBGA 2V58A 4O02B 1EU1A 1QZUA 4FXPA 2ASVA 1RQNA 4KB5A 4GX1A 4KYUA 1NM5A 4DQXA 4WKGA 2BVYA 2HF8A 3CIXA 3R0UA 3CVOA 3A4LA 1EFRA 3LI0A 3M9LA 3B4YA 4WVXA 3GC6A 2I8CA 2J9YB 3H2ZA 4CQMB 2QVCA 1EQUA 4DJDC 5CLFA 3A2KA 3DE7X 3GNDA 5HXMA 2CVOA 1YCFA 4YDSA 2R4QA 4P1ZA 1SM4A 2XYQA 3VBEA 3IBYA 1YB7A 4FPSA 1EIWA 3MXOA 1S2DA 3A6HA 1L4EA 4GPZA 1JUEA 1CUYA 5AFDA 3AHDA 5IABA 4WXZA 5JECA 1ZQ1A 1BXZA 4JFWA 521PA 5AUOB 3W2JA 2H4ZA 3C6KA 5M5DA 8XIMA 3I5YA 4MPTA 4TMTA 1CUBA 2B3TA 2WQDA 4ILSA 4LW8A 3DKLA 4ZAXA 4OOUA 1J0IA 4DUWA 5A5WA 1L6RA 2Q2WA 1KWGA 3SYKA 2QTLA 4HZ8A 4IJ6A 4X20A 1KKOA 4ZENA 4PRZA 4RJKA 3S2FA 1CJMA 3UZYA 2OCIA 1JDBC 1NNI1 4WLNA 1XCJA 1YMUA 4NESA 2OXFA 3B9AA 4BV2A 3DV0B 2F2HA 5C6MA 2PSSA 3UNXA 3NM6B 1AH3A 4JIPA 4RZIA 1QHGA 1BEZA 1OFBA 4NC9A 4RHEA 5K0NA 3QVMA 5DNYB 2F9RA 2Y8UA 3ZH9B 4S1WA 2APJA 2PD5A 3L7CA 1W4LA 3W7GA 3QX7A 1E3TA 3EBVA 1KI6B 1KKUA 3L7BA 3OU6A 2XUKA 4R8MA 5EY5A 1J4EA 4O53A 1ONWA 4MRSA 1Q2RA 2XA1A 3K5PA 1ZBQA 4MVJM 1EAYA 3TBKA 3FYTA 4TWRA 1AUPA 3E6EA 4YRIA 4R5HA 1FYEA 2X9VA 3S2YA 3L9XA 3LZCA 1M73E 2B4AA 3VR6A 5D32A 3ESQA 4WY8A 3TCSA 3MG9A 4ZXLA 1PSWA 1YRBA 3RAPR 2EFJA 1YQUA 3IXLA 1W581 4X1KA 3V8PA 4TYYA 3R8RA 3VDHA 3DDNA 1FP4A 2YIVX 3KE9A 4LB3A 1BMTA 1YMYA 4JEMA 1Y4SA 4X7RA 1P2SA 4UQAA 4E8DA 5E6YA 1N5OX 1A98A 4CR7A 3KOWA 1YXCA 1M34B 4EI7A 3CYFA 1SJ9A 1J0BA 5F51A 2FRXA 1EF2A 5FWDA 1EK6A 1DWIM 5DN6D 5EJAA 1NWTA 2H92A 3OCJA 5EWJA 4H1TA 3D6MA 5DHSA 5EP2A 4PPQA 3RBZA 2ZXFA 1D5CA 2WMYA 3F5KA 2XH2A 1JYSA 4ZXFA 5BU6A 3GJ6A 3AF4A 4FF5A 3QWIA 2DIKA 1ZFJA 5F7ZA 3BQ9A 3I9NA 3S2MA 4L07A 4IHQA 4MDYA 1TUBB 3HI6A 2W71A 1VZWA 1VBMA 2V6FA 3JY6A 4IXTA 2C29D 1BVUA 1BVYF 4MLCA 1PCXA 4Y1GA 4B4DA 3CMJA 3MVIA 3RVLA 3Q3JB 4IDBA 2AG8A 1MW8X 3Q87B 5EYWA 3EEZA 3AWNA 1GZ7A 3TOXA 1XVIA 1A4LA 5D8WA 2VM8A 3CUXA 2ICAA 1J9YA 2NT0A 2DRIA 5FORA 3UEOA 3U3XA 4YRTA 2JL1A 4E2ZA 1Q20A 2F9LA 4Z4IA 2CHVA 5I3HA 3UAVA 3W71A 1ODSA 3JAMA 1E59A 2A5LA 2I1LA 1Q7ZA 2YL9A 4DLUA 4IQ4A 4Y9AA 3CY6A 3A4IA 1RM0A 3URBA 4ZQEA 5AK5A 1CS0B 3W1LA 4B8WA 2NSJA 4GI1A 2GN4A 1MDRA 4F8JA 5FBZA 2BFGA 1OADA 4QKQA 3QA9A 3GNLA 3HKDA 1TC1A 3BTUA 1MWOA 3L8EA 5SV2A 3F9CA 1LX6A 4C06A 4YI3A 4G1BA 3UYKA 4ZB0A 2ID4A 3V7YA 3KXQA 5AHRA 2YW3A 4LX4A 1AHHA 4UWMA 3MQ2A 5F1YA 2ACEA 2MSLA 3APGA 1OI4A 1Q3KA 4LY6A 5CZ0A 2ZWYA 1Y5VA 5FX2A 4R3UC 4J0QA 4WGFA 3DONA 2UXBB 1U8TA 5IDIA 1COWD 3IUPA 3REFA 4ROPA 4MUXA 1XTPA 3MTDA 3ELFA 3EIOA 5IUJC 4HATA 4K9KA 4WXPA 3SJUA 3BG9A 4KKVA 3N2XA 3K8YA 2P67A 1MB0A 2M1ZA 1QIDA 3VGDA 2HCVA 3UR7A 3MSXA 2II6A 1BDMA 4LBYA 3G23A 3QFEA 3AS3A 1M6YA 5EGSA 4YP0A 3WOVA 3SNHA 2GNOA 3RIEA 1Z4NA 2YOGA 1P7WA 4DCVA 3LCXA 1Z48A 2WLYA 4FYIA 2YHSA 5DCDA 3V4BA 3AMVA 1K7FB 3VGJA 1GGJA 4I55B 3ICJA 4Q7QA 1CV2A 1ZQ5A 5G5IA 3B9BA 1W9XA 1Y34E 4D9EA 4BEWA 1VYSX 2XWEA 1R64A 4AKTA 3MXTA 4JBRA 3SKVA 4NABA 1EFHA 4K2SA 5JIBA 3SEAA 4YYEA 5CP8A 4CUKA 4G67A 5KYUA 5J4HA 1GR0A 3CH4B 1S39A 2NVUB 4KMSA 2XZTA 3PQ6A 3EX4A 4H1WA 3G9UA 3EOBI 3DLBA 4Z2JA 3VSBA 1HW6A 5TQVA 3TFWA 1XCPA 2CV0A 3S5JA 2OYLA 1G7TA 3ZCUA 2AVNA 3EH2A 1EXDA 2TODA 2HXUA 3FFSA 2XSBA 4A8JC 2FZWA 1H4PA 3IRDA 4DWSC 1R3VA 3W00A 3RUDA 4UM9D 1TIMA 2J3LA 4F3KA 4Q8QA 1TM1E 4PGAA 1TJPB 3OT5A 3SHFA 1Q85A 1VJTA 1EJTC 2PUVA 4PTLA 1OFQA 4JKMA 4P7OA 3HF3A 3LBFA 1Y8BA 1L5QA 1TWDA 4I5XA 2BHRA 3TM5A 1LH0A 2R6FA 3NAZA 3PP8A 4JFTA 4A3UA 2Y8EA 1EFZA 3ARSA 1B0PA 1Y9EA 1WV1A 2VZUA 2UAGA 3BAWA 4ABTA 4GR4A 2DGAA 1XZGA 2X16A 3BJSA 2NZXA 5B6PA 3LZDA 2AMFA 2O7NA 1RP9A 1U2GA 4MARA 5B3JA 2P3ZA 2VO5A 2CD9A 4BMNA 5IM51 4CN1A 1NZJA 3R5HA 3Q85A 2ZRJA 5EERA 1GRQA 1LVUA 5KWIA 1UMKA 4L9AA 2GL5A 5IEBA 1ZP4A 4M80A 2PWYA 3UFYA 3FZGA 3AVXA 4BS0A 2ZE6A 3CZ8A 1OUMA 2ACKA 1A69A 2A9RA 2PBGA 3TA6A 5BUCA 5ECVA 4L16A 4NXMB 1BAPA 1JG1A 4J1TA 2AWNA 1TV3A 4AKGA 2X9QA 3M70A 1U28C 1ZD4A 4DNHA 4E5SA 4NXKA 3KJGA 2ZUDA 3SY5A 3BB3A 3PZNA 2B8JA 4MB1A 1L3IA 1PYMA 1DQPA 2JANA 5A5FA 4CU6A 3ZLVA 1ENYA 5C8YA 4PMOA 1E9BA 3ZY5A 1GAJA 4YJDA 4QSHA 3BMOB 1FTYA 4CHTA 3PFBA 4B9EA 1YDVA 1JNYA 2ECOA 3WLNA 5JROA 5FACA 3QMVA 2FQYA 4LFCB 2E18A 1PO9A 4H4EA 4IO0A 2IDKA 4LS3A 5DZSA 1JYWA 4UC0A 3NHPA 3VJMA 4NSBA 2QVGA 4JXZA 2PDJA 1TCVA 5M29A 4FZIA 5KWSA 2Z24A 4AWEA 3F8WA 3FMGA 3LCMA 1HNZB 2WF6A 1J0AA 3ZDAA 1N5IA 4ALDA 2QGNA 1XJ5A 5FOVA 3N11A 3GLGB 1R50A 3PGMA 4AY7A 5I4CA 3QUAA 5ABEA 5EPEA 2BFDB 2VHZA 1ENZA 1Q0LA 3Q41A 1CVRA 1QS0A 1P1KA 5EHXA 3K73O 2VD8A 4Q3LA 5E0KA 1WNFA 3O1LA 5JATA 3ZI7A 2IOFA 1BJTA 5B1HA 4PZDA 4LC9A 4QR6A 1V7QA 4JB8A 3S4TA 3VNIA 5K6TA 3UAGA 4HP8A 4LS1A 1K97A 2PDBA 2FN9A 3HJBA 4GGOA 3NONA 5E93A 3L0BA 4QYIB 3PY2A 4LH8A 2HPHA 4DVJA 1RHRA 2R5FA 4FMBB 1EFUA 5LM3A 2WHPB 1W2PA 2ISFA 2VUIB 4EA9A 3WF4A 2CZCA 3ZLHA 2BGLA 1XLTC 3K3PA 3Q6IA 5FEWA 3ZWKA 4GLOA 2E25A 3ILXA 1EO7A 5IT9A 1YBAA 4L9ZA 4O59O 4ZDJA 2DETA 2EL9A 2ZRLA 4K7JA 2PC4A 3FY4A 2C88A 2VDUE 3LQ4A 3W7RA 2GHIA 4QJ3B 2CLCX 4K3ZA 4LHYA 1A4IA 2OX1A 4Z7QB 2B7PA 1URPA 3AU8A 2OMEA 4M1YA 1ISIA 4GACA 5DHFA 4C0HA 1YZNA 4H2CA 2WIAA 4X0VA 5SY4A 1H3NA 2UYOA 3VAYA 1S2WA 4E1BA 4H1HA 1OF8A 1L2UA 3SQNA 3DUFA 3QI7A 4NBKA 2XGGA 1CB0A 5FNVF 3ET5A 3FGOA 2ZIDA 2QN1A 4ZGGA 1F2DA 2C57A 3K53A 5JVDB 2HSGA 2A5DA 2OLJA 4D8VA 3LDHA 5GJMA 4S2EA 1TYDE 4BE7B 5CX4A 2ZKIA 3FNDA 3V36A 3UJBA 1NU6A 4PUJA 3VC6A 3D0RA 1YZHA 3QVKA 3ZE6A 2AC4A 1WB5A 2CITA 1VJIA 2OGSA 4N0MA 3W0KA 1E2JA 1UD2A 2GPBA 1CXIA 3WNNA 4TR9A 5B37A 3I0ZA 2DLCX 1GJWA 2OSWA 1SQSA 3ABSB 1PQUA 3WQSB 2I22A 4ZVRA 2WY2D 1R6XA 5CFQA 3UESA 4FR0A 5KQGA 4FYVA 3L9CA 3CLTC 4ES4A 3AY3A 3GQVA 2AXQA 4EG5A 2NO7A 3HWWA 2NO1A 4CLOB 1XG4A 2ZB8A 2B2XA 1E1KA 2OYSA 1XIHA 2VFHA 3N17A 1WZIA 4M49A 5BYKA 5DCYA 1FDSA 1DX4A 1Y7PA 3TTYA 3M2PA 5HTKA 3VGFA 1WXQA 1QC5A 3PENA 4LT9A 1FLDA 1YA4A 2ISSD 1IUPA 1XBVA 1I30A 4BQPA 4HHHA 3VVLA 2C5HA 3JR7A 2I4OA 1H11A 4B5XA 4PGMA 1PUIA 1EG2A 2JJQA 3OSUA 5BN5B 3CW2A 2J45A 3KTCA 4HA3A 3PDIA 1LUAA 4Q9IA 2VOTA 2FKNA 3RU8X 3DW3X 5DYTA 4BJHB 2BP1A 4CKWB 1J8VA 3D3WA 3UWKA 4FMDB 2PX3A 1E3MA 4QE5A 1JPHA 1AM4D 1V4VA 1U8EA 1QHSA 5JNSA 3QVQA 5BQOA 5HQLA 1AZ2A 1ZJYA 5AW8A 4A0HA 1UH4A 3SYMA 2J75A 2D69A 4NJEA 3LDUA 1S2MA 1S96A 1MQ9A 3MBDA 4TRRA 4F2UA 2XVGA 1EFPB 1H49A 1VJRA 3H8SA 2YHBA 4MWSA 2ZIWB 3TTTA 3FAKA 4W63A 3W7NA 3S7ZA 2LNDA 1NSYA 4BLWA 2IYLD 4R1UA 4MUAA 4J3NA 2EZ8A 4KEMA 1Q2XA 4HPXA 2DM6A 3DF7A 3NATA 3UKOA 1M2WA 4GC9A 1SHJA 1WDWA 4OSEA 2XTMA 1V79A 1EAMA 1TUIA 2H00A 5KWVA 5AW7A 5KYWB 3SRFA 2IPNA 4C7KA 3WY1A 2DFAA 3QBUA 2FE1A 4JX9A 3CB8A 1HSZA 2IBTA 3DYVA 1UBNA 1G8AA 3EDMA 4LJ6A 1VIYA 2J31A 4D0LB 3MYYA 4DM2A 4NYIR 2C15A 2GOYA 4LAZA 3H23A 3S5YA 1LQ2A 1W9DM 2AHRA 5FI0B 4CVNA 4DUYB 4EK9A 5HUOA 1KI2A 3C7DB 3UUGA 1XLDA 1AG9A 1OE0A 5AW3A 4LHVA 1SQGA 3CMGA 3EIXA 3S5OA 4IMGA 1ADSA 4H9VA 3L1KA 3MBIA 2JDIA 1WXJA 5CH9A 3V6MA 1OU0A 3P7YA 3W5JA 2NU6B 1J8YF 3HGTA 4OECA 1FX0A 2Q4DA 3JWIA 1KEUA 4AQYB 4BLTA 4E11A 1YR3A 1RXOB 2OBYA 3E22B 2CPUA 2J33A 3SSNA 5I01A 4JLOA 3HJCA 1MT0A 3U4GA 3MOIA 4MWAA 3S44A 4EK7A 2JCGA 1U99A 1Z7EA 1VJ1A 2PAAA 2ZTJA 2ASEA 2PMQA 1ORDA 4DA6A 4NJIA 1H2JA 4PTWA 1TC2A 5JPCA 4KLAA 4MPKA 3RF9A 4UEJA 5GPRA 3QOKA 1DE5A 2MNRA 1CYGA 2WLZA 1QGED 1XLVA 1GNVA 1TGYA 4XVEA 1N2VA 4MH0R 3QP9A 1OLUA 4JY8A 1XYBA 3H16A 3BN3A 3OQMA 1N2CA 2WB5A 3P0RA 5F4SA 1U2SA 5A7HA 3WLTA 3NZRA 3D02A 3ND8A 4XW2A 1WKVA 5GJVC 3HJRA 3T9CA 2H52A 1T41A 1NQWA 2GD2A 1MIOB 2PLKA 5DM2A 1RP1A 1GQKA 3FDIA 3W81A 1K5GA 1D4AA 3WEMA 1P1FA 2PIDA 3ITEA 4DMKA 1OPRA 1LTKA 2HNHA 2VTKA 5GJCA 5AKZA 2ZUTA 1ICEA 1SJAA 4OI2A 3VPDA 3OBAA 4P3OA 3OPMA 1ACMA 3LHZA 2W92A 3M4HA 2HPMA 1DAKA 4H7IA 5IKPA 3DBLA 3ROGA 3PPCA 2RAFA 2HSZA 1S2UA 3S0JA 3S7TA 2D2JA 2K2QB 1TJRA 3VYVA 3DUGA 4IMIB 1Q1EA 3ZDRA 1YXMA 1IXKA 2WM2A 1YS6A 3OBEA 1YX1A 2BGSA 4L56A 5AYYA 3KZ1E 2MSCB 1KCZA 4QT4A 3ANUA 3A4XA 3QYAA 1MDLA 1EUDA 3QEMA 1HQTA 4I4LA 2MUCA 4NIRA 3PZ9A 2Y77A 1SC9A 3VMPA 2IEBA 3B0PA 1IMOA 4TKMA 4OIFA 2XDYA 4L28A 3BLPX 5HNNA 1C0LA 2R00C 3QZ6A 3ZWDA 3FKSD 2PTZA 1OGGA 1TOAA 1PJCA 2QKYA 2FP4A 4D1YA 5F33A 4Q7IA 3M64A 1PV8A 3WMCA 2GCEA 3O3CA 3CURA 1YZTA 3WLAA 1YQQA 1N0WA 4FW9A 3D6UA 3FPBA 4UAGA 2Z6AA 2IYRA 4PB3A 6PTDA 2V1UA 2NXNA 3A6JA 4C5YA 1U7PA 2YJ6A 1P29A 4JC4A 3NQ41 3OE7A 4X65B 1AK5A 4AZ0B 1DX9A 1PDWA 4R2HA 3HJUA 1VS1A 1VFPA 3OX2A 3FN4A 4KSBA 2IPXA 3BHIA 1BAGA 3HVRA 1NBME 3JXEA 2XN2A 1FFCA 3TFCA 4I1SA 4GVHA 2Q5OA 3BXEA 4IH1A 4JWKA 2CJYA 2ORYA 3DYOA 3OG9A 4GI8A 4DMCA 4LTSA 3TPCA 1Z6KA 5G4WA 4IQ8A 2QMHA 1X92A 3KVYA 1E3ZA 3GYGA 4IWXA 2N9UA 2H07A 4OQ4A 4B3KA 3VNAA 1WM1A 1V11A 5J2UB 1M8GA 2QVZX 1KQYA 3O1JC 4FIZA 3BV7A 3PLRA 3OH8A 1ODLA 2AOXA 5KHLB 2EHHA 3QPYA 2Z1XA 1NIPA 2PP3A 4DTCA 3TSBA 2JRCA 5KJCA 2Q41A 4IPJA 1EMDA 1S6YA 1FU4A 1CUXA 1NOWA 3CLHA 1CC1S 2JGDA 1XH2A 2PK3A 4Y9NA 1IZCA 1TMOA 4MS1A 4COOA 1V6AA 1OZGA 1PV2A 4TV8B 1NUSA 2CLLA 1CK4A 2GGIA 2J9FA 2BGNA 3TG8A 5ER6A 1T9HA 4IEIA 1BEEA 3SPXA 1XYGA 3ANTA 1KVQA 4O08A 1Q0TA 3PULA 3CQ0A 1CHNA 3BB4A 4DY6A 3BFVA 4A73A 4KQ6A 1R85A 4JAVC 3LKBA 2ZBDA 1DORA 4H8UA 1QNPA 1DKUA 4B3MB 4CEHB 2X4DA 4ZTXA 3IEMA 3GJ7A 5KTSA 3CZEA 2BEWA 1FX1A 2F67A 2IHNA 1ZSVA 2ZSAA 4AFYA 1BS1A 1SD1A 3E5HA 4BNGA 2HB6A 3JD3A 1CZRA 4JTKA 2OAP1 1XSEA 1QGOA 3ECSA 5BOSB 2VJYA 3E0IA 3EBOA 1UFQA 1ZRHA 5C2XA 4HNGA 3N2IA 3QKSB 5AHOA 4WEQA 1XMIA 2GBLA 1N1GA 2BVTA 2GFIA 2YNMD 3RRXA 3IVSA 4D6EA 2Q3CA 3EDDA 4UKDA 3PZUA 2CNCA 3MWDB 3GFVA 4NOKA 4PM4A 4IV8A 5AT1A 7REQB 4TLDA 5CZTA 4P32A 1MX5A 4U9HS 3VGHA 4RXUA 2LWIA 2QR2A 4BEBA 3PTLA 5CU7A 2ZJOA 3V8RA 3CZ5A 4EBFA 3TYCA 1ZH8A 4FXJA 1GVSA 4G5OA 2OWXA 4G36A 4KNYA 1YMQA 3I10A 5FOUA 3LPCA 4QQ3A 5K8CA 3OHIA 1ZENA 1UP2A 3EQ8A 3N2KB 3SIXA 5DE3A 2D59A 3TTVA 2C7VA 4GI3A 1NN0A 1WD7A 4EJFA 3R58A 4GLLA 4L5YA 4AEFA 3V4VB 5CSRA 1GCYA 2NQ9A 1BYBA 3VOJA 1VLWA 2XUDA 3M6AA 4NX5A 4N6NA 2G3MA 3ZNNA 3OJOA 3EGDB 3R4VA 1AQIA 4WNCA 3X2SA 4HMQA 5CR9A 1ZSYA 2RHHA 2FF5A 1BF6A 1QIHA 3VHXA 2HA4A 2CHQA 1C3OA 2OMKA 4NNAA 1U5BA 3EC2A 5E3IA 1IEVA 1EK1A 2Y6ZA 5K5EA 3KUCA 2WMIB 1CXZA 4UDXX 1XDUA 2RK3A 2G72A 5A05A 1JEQB 1JA9A 1XDSA 5J63A 1OG0A 2JJ1A 1AE1A 4WNYA 1D04A 4MZ1A 1G63A 2ZJAA 2WKQA 4QJ1A 1KQ3A 5B2EA 1H5UA 5J4KA 4EKEA 1FNMA 1GO2A 4HOZA 3VDMA 5IBXA 3GNSA 1G0NA 4KGVA 4I08A 1GNPA 2QYOA 4XIGS 1C29A 5F4XA 4OKNA 1IN1A 2QTAA 3SR3A 2GK4A 2XE7A 5C1BA 2CMKA 1UL1X 4WK2B 4R41A 4DXAA 2Z3VA 2M1XA 1P5FA 3REQA 1H1ZA 1D6NA 2H8ZA 3AHCA 2NXHA 4KVZA 1I3CA 4IL0A 4K5QA 2PMBA 1CERA 2QG9A 3D6HA 2J0QA 1EYWA 3RMJA 4ZHSA 3IQEA 2XHZA 4DN6A 3AJ9A 4AW9A 3AU9A 3W34A 3C5CA 1QFJA 4G07A 3LA8A 2FPIB 2W66A 4WFIA 2YC2C 2GPJA 2C9CA 4RCZA 4I66A 1P2BA 1TK9A 4XPIB 2VNJA 3KS9A 3OURA 4JB2A 1E0UA 3AR9A 4IHJA 1EBUA 4ZTZB 1DXIA 1JX6A 2ZDGA 1OYYA 1QTWA 5F3WB 4HNAB 3GQBB 2D4AA 4Y2YA 3PUDA 2FR8A 2VD9A 2UVPB 3NIWA 2PUDA 2Z6IA 1SW0A 4UTVA 2QIOA 1G4HA 5E7JA 4MYTA 2IIBA 2Q29A 2B0JA 1TPYA 2VYNA 3AB3A 3FBWA 4QASA 2CNWD 5EPUA 1BKDR 3SX4A 5A9TA 1M3SA 3DHVA 4ZO7A 3N3TA 2NVDA 1ADDA 1PKEA 3PK0A 3V16A 2YWRA 1MEIA 4BYMA 2IOFK 4IPPA 1MUMA 4E2XA 3T5CA 2OBBA 2NXWA 5LQUA 4G1MB 2CYAA 4DBUA 5T4BA 4B9ZA 3NDJA 4I14A 2QN6A 2I2CA 5BVHB 1C7TA 3BULA 1P8JA 2F00A 4Z1MA 2FFAA 3FPJA 1X98A 1GKRA 4O16A 1UMDB 1GW9A 1SCNE 1L7XA 2JAUA 5EJ5A 3U4FA 1ECJA 1M54A 1FH9A 3D1JA 4JOCA 1WMDA 2BLEA 2XZ7A 2XGMA 4LWZA 4GVLA 1KEZA 4GYKA 3BAYA 1PT9A 2QPSA 1GA1A 5D5HA 1FHUA 2W48A 3UA4A 4YONB 4YMVA 1K5PA 3I01M 2C4MA 2IHTA 1WIWA 1NP0A 2EJTA 2WZDA 5G4HC 4MKGA 1UZ4A 5AVYA 4LJKA 4KUEA 4CFYA 2NVWA 1RXSA 1UKTA 2BP7A 2DSUA 1GKYA 2HUNA 3B53X 5AKGA 3LUKA 1LW6E 2E37A 3CQ9A 3PNBA 4CVUA 1XXXA 1EQAA 4B6OA 3KFTA 3K09A 1KFWA 4E5MA 4WN3A 2JJ2D 3OZXA 5KX5F 1XU4A 4HA4A 1OABA 1B7GO 3KZMA 1ZNXA 4D6JA 3NO4A 3BF7A 3JAKB 2IZ1A 1DWQA 2HWGA 1RLIA 3OFSA 3AZRA 2JIZD 2NYUA 4RDIA 4LCBA 2HE8A 1JZSA 1XPOA 2WD7B 5GM2A 3OI7A 1GILA 1EK5A 3EOOA 1Q77A 3ZK9A 4I9JA 1JA0A 2ZVQX 3STVA 2H16A 1CEEA 4WBNB 4RHXA 4UFOA 1VHDA 1WO2A 1W37A 1PL8A 3SGGA 4L4OA 4MKXA 3SI7A 5IRPA 3F8TA 3KT3A 3HLYA 5JVLA 3OLGA 4UUBA 3SMQA 1AH0A 2X8JA 1K9FA 1BMFD 3NT4A 2VOJA 3DERA 3K2IA 2I4IA 1Y65A 4DJDA 2Q2NA 1KVSA 2IH2A 1UP3A 2V68A 4WBSA 4KO3S 5FA6A 2AA3A 3A4TA 1EZZA 2HDOA 3TZKA 1WSBA 2R86A 4YMWA 2HXTA 2P62A 1DADA 3DEHA 1NI3A 3T54A 1FWHC 2I7CA 1R6AA 3ZGOA 4RHUA 3LVRE 5J40A 2QSYA 1I80A 1WXHA 3U3MA 4XCXA 5C9WA 3DAHA 5C70A 4Q8UA 2G0TA 2XCUA 5J4LA 4HX9A 4LBUA 3FNHA 1UA3A 1EG7A 3ARUA 1NPYA 3NDPA 1OFDA 1P18A 4EJSB 3BLEA 3AZTA 1YCHA 3SSJA 1R74A 2IU0A 4LWOA 3N8IA 5AXAA 4B16A 3AO0B 1P1BA 1RJDA 1H65A 1Q14A 1SA0A 3S1GA 4I3GA 2ZZ3A 4M9XA 1WZUA 1Z0AA 1T0PA 3WNKA 1H1NA 2QIWA 4IIBA 3CBWA 1NKTA 3OM8A 1XJWA 2BXYA 1R4NB 4OL0A 3ZQJA 1J11A 3BLLA 2QL9A 5TQ2A 4MPRA 3WQ6A 3O4VA 4JEHA 2XI4A 1MX3A 4H7HA 3JQ8B 3UFBA 3L0IB 4U2ZA 1Y3HA 3AEYA 4IPIA 2W4XA 4YTEA 4NPCA 1XAIA 4NAVA 4D82A 3VU9A 1HURA 3B8UA 3GLIB 2VLBA 3RAEC 2PS1A 1QZTA 1HDRA 3A4AA 1YDMA 2EZUA 5ALFA 3IAPA 3Q4GA 5KWEA 1JQJC 1XNRB 3H26A 3O84A 2HWKA 4MHBA 2JKEA 2WPNA 3DOCA 2C8KA 4NCAA 4D8AA 3U2CA 2TSYA 3PA8A 2R6ZA 4OXRA 4ZL1A 3GZTB 3UYIA 4J3UA 3MMUA 3UAZA 3NQFA 3NTVA 2VS1A 1XSIA 3CWHA 4RGVA 3SP1A 1SBQA 1GVYA 1KP2A 1PJRA 5F52A 1FLVA 3GGDA 2VH1A 2X42A 3LNPA 4B2LA 3F2IA 1R2TA 2IS4A 1QX3A 3O4IA 4ATDA 2DZPA 2I9PA 4MI1A 1DEAA 1DO8A 3NM1A 1M7GA 1XWFA 4DIUA 4US0R 4E2DA 1QKKA 2GCPA 2HNKA 3RNOA 2JNWA 3WGJA 4AMVA 5FH9A 3G8DA 3ZQ9A 2PQ6A 4BFUA 2PKRA 4BNNA 4F3NA 3LV8A 1NFPA 3GPCA 3HS3A 3DO8A 4RZ6A 3SVTA 1ZNQO 4RPIA 2OZTA 3H9EO 5G4LA 4IIXA 5KREA 4U5QA 3IUHA 3SCWA 5FO0A 3EIEA 5G1OA 4YV7A 2OUKA 3UWQA 1QPGA 4PMNA 5EP1A 4CV1A 3IODA 1C5KA 2PWDA 2YX0A 2FPSA 2BFEA 5CNMA 3NB0A 2IXFA 1T26A 3FJOA 3JZEA 2VDMB 2YV1A 3LDGA 2HFKA 4D46A 2B92A 4ROQA 1MMFB 4EXBA 3EWZA 1P4HA 3GLQA 3DXXA 4IPLA 2CWDA 1T36A 5HIIA 5IF3A 4M1RA 1LRJA 3N2YA 1J6UA 4FHDA 2I67A 4PR3A 1J10A 3C8ZA 3TZ6A 3R6IA 5IKEA 2GUUA 1U8ZA 4UBMA 1Z2OX 2PX5A 4G4GA 4DIOA 4O2AB 1E2PA 3WH7A 2W5UA 4KVFA 1NVMB 4PUUA 4AWSA 1MXFA 1UZMA 3EFOA 3RT1A 2E5FA 2H6EA 2DUJA 1CZHA 4H9MA 4RYLA 2O7RA 1ZC3A 1KDOA 1CLXA 4ER7A 1KZYC 1X80B 3IIJA 3Q3EA 2EJWA 3FKKA 3EGIA 3Q2DA 3RBAA 3KKNA 1E6WA 5GONA 3P27A 5G0WA 4B0PA 2ALJA 3VU2A 1JH8A 2BY0A 4X6XA 1NT4A 3FJLA 4Z17A 4L15A 1FTWA 3VPXA 3L8DA 3WBKA 1YTKA 4PPYA 2H7CA 2A2ZA 4X0EA 3SR4A 3PC0A 3FE2A 5LC1A 3U1VA 1IVYA 2X5NA 4DA4A 3B60A 2QTNA 1VMKA 3FYUA 4Z54A 3T7TA 4ND8A 3EKGA 1EJ0A 5H2ZA 3HY4A 3T0TA 1NXSA 3ITCA 4KEZA 3LC1O 4CIAA 3AFGA 3RVBA 5HWNA 1K2VN 2B83A 2HQAA 2ENUA 2HIHA 3R1ZA 1NOIA 5F3DA 3KPJA 2XUOA 4L73A 1QXLA 1FH7A 4OY3A 2PBLA 4H6KA 4MX8A 5FTJA 4ALIA 4WZHA 1RPZA 5MN4A 2FFHA 4NQ1A 1OHHA 5SZJA 1KOJA 2DUXA 4IUGA 3TYEA 4Q66C 3MJMA 4X2PA 1S4QA 4UMDA 2VA8A 3SUSA 3E2SA 5K8IA 4G97A 1NASA 5E0OA 3ZWCA 3CZQA 3BRWD 2ZI9A 3E0FA 4UNPA 4TVBA 4S3BA 4J90A 3OQBA 2B4RO 3BBPA 1AF7A 2E4YA 3DWGA 1JYEA 2O0KA 3H11B 5ICEA 4UR8A 2OV2A 3MLBA 4JLMA 4A8JA 3SIPA 5E7QA 5LOVB 1Z7YA 5G2OA 1XLKA 3JVVA 3HXQA 2GZSA 3PHJA 4DWSA 5GP1A 1EGVB 3OTGA 4HGPA 4I4TF 5CB4F 2Z2JA 2DTDA 3TO5A 4XOIA 4XV0A 3RSSA 1F3WA 2AEFA 4DF2A 5CAHA 1PE0A 4J76A 1NWUA 3VDNB 4JIRA 3VIFA 3U9TA 1M66A 5TBOA 1NVFA 3ANVA 1KBJA 4FOOA 3VNKA 4N6EA 4YLGA 2H3DA 2OZ0A 3HU7A 5JNLA 4QBKA 2XJ9A 4CU2A 3RJTA 5D05A 4UULA 4WY0F 1MNQA 3BDKA 3UXDA 4AJHA 3QBEA 2VBGA 5EKXA 3RARA 3VUPA 2D13A 2QTMA 3H19A 1L5HA 2W11A 1NMXA 3OIXA 1Z83A 1NV8A 2WINI 1KKLA 4P7JA 3O8CA 4JBGA 3OIWA 4JP8A 2DWCA 3ZR4B 3GLVA 1H60A 3I1YA 2PDMA 3N0WA 3OD1A 3DWIA 4ZZ3A 4GWLA 1C4KA 4G2TA 3RCBA 1BH2A 3ETJA 3W3AH 3IKTA 1QM5A 2GO7A 2WVHA 5F9HA 1XLLA 1E96A 2O4UX 3AKZA 5LCXA 3MS4A 2DY1A 2J87A 3QZUA 1FWRA 2WM9B 2LRHA 4FIRA 2MMGA 4RIFA 5C4MA 3ONFA 1EJSC 2D0HA 3H5WA 4AJ2A 1Z28A 4FFBB 2CFSA 1G42A 1H1DA 1H2YA 3NOQA 1XXHB 2B7QA 1FFGA 2I29A 3LSCA 1W7AA 3O95A 4GUIA 4H6PA 2GJKA 3KT0A 1UZHA 3VSCA 3AS2A 3BXPA 3NGMA 3TN6A 3HJZA 3M3PA 3TZLA 2HVMA 4PTDA 4O2LA 4WK9A 3CWCA 3IJPA 5J04A 5BXYA 2YOFA 1INLA 4NCHA 4UUAA 3CUUA 3DCPA 1DHRA 3N2LA 3A1FA 4ZIRB 3RDPA 4I7VA 3PGXA 2BGGA 4PLVA 4FN5A 1FCVA 3F7NA 1JPIA 2FN3A 3LOTA 3HGRA 5T41A 2UY2A 5C3MA 2N0SA 1J5EB 3SR7A 2ZUEA 1XMPA 4M53A 1GTHA 5CUQA 1HKIA 3T5AA 2ZK7A 3QRWA 1E1EA 1KM1A 5L8VA 3ZGVA 3N0TA 2I33A 1I36A 1N8TA 5LZ8A 3B51X 3MHGA 2FPGA 2AT1A 1JR4A 4UTMA 2KLHA 3MMZA 3T7AA 1NR1A 1Q6ZA 4FWIB 4DNQA 1FWGC 2AV6A 1XMQB 4HPWA 1RRFA 2AI1A 3B36A 3JZAA 1ZKDA 3COWA 1JGIA 2V5UA 1TV2A 2GJ8A 2B1JA 2X1UA 1K7EA 3T1YB 4LHEA 4R7OA 4A2SA 5C31A 2HYDA 3C0SA 4IUBS 1I2MA 4URWR 2O54A 5CNJA 1IE3A 4C14A 1QLJA 3WUEA 2BSQA 4OBRA 1XCGB 3B38A 1M1ZA 1UK8A 4FYJA 1RVGA 3LXBA 1X7WA 1GQYA 3K1TA 3R7NA 2GLKA 1JKMA 2XYGA 3QELA 2ZPUA 1T10A 2D22A 3IVGA 3NBZC 4XVCA 4MV4A 2GNPA 2YS6A 3H9JA 4N42A 4XEUA 5DYWA 1UWIA 4PUKA 1ECGA 2IU6A 3B1WA 2XZLA 4RK5A 5IXJA 3JQDA 3QTPA 1DAIA 5FULA 3CH7A 4IIFA 7GPBA 4AJ1A 2J4DA 3AW8A 2VOEA 3WBBA 4YLWA 4POOA 1YGPA 2OXNA 5AHFA 1BE8A 1D0SA 1Y5XA 3LXRA 4BKQA 4ACBA 4DEVA 4QUJA 4TYNA 3GIDA 3CXOA 2QM7A 1SZEA 3COSA 4O0ZA 4C6JA 2WJAA 3DKKA 3QMPA 4G5RA 1YOBA 5L9FA 1FWEC 2WJIA 2LVBA 1JB9A 4Q4JB 2VUNA 1F8UA 4XUDA 5LXXA 1FQOA 3HA2A 2BMDA 2H57A 1JEAA 1QG6A 5GJNA 4I5FA 1WULS 1GKQA 5B64A 4ILEA 1G2PA 2WHKA 3EXFA 2JAOA 3GW8A 1W48A 4OAOA 2NUTB 5AOAA 3VZCA 4GH3A 2PMKA 3EHEA 1ZU8A 2JB9A 3ENVA 5I47A 1W36B 1NLUA 4OJNA 2QD1A 3C2QA 1CULC 4E4YA 2AQOA 1N7IA 3DZBA 4WEOA 4UTPA 1FNSA 4F3CA 1C3FA 4LNHA 4HV4A 2BFFA 1H8EA 4KTVE 3CPHA 1U2ZA 3FSUA 2VX7A 1H50A 3NL3A 4R6WA 2TAAA 1R8JA 3SZLA 2J5XA 3A1DA 3RUAA 5LDGA 2YN0A 3FVDA 3ZDQA 1DG3A 1SKUA 3IT0A 5ALJA 1QYIA 3PR2A 5DGIA 3JQAD 2H31A 1L8OA 1FQ0A 2QCGA 5G4EA 5DIFA 2C1GA 1ENUA 2CLIA 1QQ7A 3VILA 3Q8WA 5HHTA 1XQ1A 1F8XA 4JP3A 2YBEA 3I4EA 2FJUB 3Q8MA 4KSYA 3QYSA 3T3DA 2B0CA 3QKRA 3E5NA 4LOHA 3BAJA 1P0BA 3QE2A 1PBTA 4CD7A 3AYRA 1DAEA 3SIWA 4GICA 1SQ0A 2TRSA 2OZPA 4IS2A 4KQKA 3A8TA 3M0KA 3C3WA 2E67A 4DNOA 1PO7A 2I7TA 3ZWWA 3H4MA 3S1VA 2IVZA 4RMHA 4CKCB 5EZYA 3AILA 1AK1A 3FVRA 2QP9X 5A04A 3UN1A 1EVJA 1US3A 4MQEB 2DG2A 3COVA 2DH2A 2HOQA 1E4YA 4DO7A 4MRAA 1P6UA 3PF8A 1WUTA 3EYWA 2OP1A 4IGKA 3HLKA 1MQSA 3IX7A 1Z0DA 4N7JA 4PZYA 4M8KA 3HBJA 3L1JA 4DBWA 4ZYYA 1BU8A 2FEAA 3QHPA 3F5LA 4DHWA 2YHAA 4MOZA 3CX3A 3R4IA 3S9IA 1GNTA 4HBZA 1AFSA 3ZV7A 5J58A 4B43A 3T81A 4WZAE 3HJFA 3K8ZA 3RRZA 1ZH2A 2ODAA 3U7QA 4A36A 4P2GA 2ZP1A 1DTWB 1EPUA 1TYEB 3OM1A 3LBYA 3MB8A 1OKKA 1ZNZA 5DW3A 2H2IA 1FP1D 3ELYA 3SBEA 1VBHA 4BB5A 1GTMA 1YR9A 4NHEA 2OR2A 1DHKA 3KDAA 4IQDA 2E4VA 4TMYA 4OQQA 4E2VA 1F38A 3EFEA 1ZXBA 2NZWA 4WKHA 4FC6A 4JDBA 2PM8A 3UO8B 3SEPA 2FTYA 1KC7A 3PRYA 3OG3A 3W6PA 5DFAA 2PZBA 4CQAA 3TA9A 4QXAA 4E2YA 1KFCB 4XA8A 3BS4A 4BNDA 3E61A 4UTUA 1DG9A 2QUHA 3NORA 2O52A 5T4FA 1CJBA 4EP1A 4R1TA 2AFIA 4PSPA 3QUSA 5FCDA 3KWSA 1UMBB 1VDZA 3KZVA 1F2TB 4RY2A 2IY9A 3V1PA 2W2KB 3CRNA 4E4TA 3MCVA 4RO0A 4XZBA 2JFWA 2Z8ZA 4IKOA 1D4ZA 4R3NA 3PITA 4EYKA 2Z1WA 1L2QA 5JYCA 3DEIA 3A13A 4F48A 4CW7A 3CX4A 3PUXA 2HA5A 4FEEA 3CVWA 3LYHA 1BE1A 3VNMA 3BXZA 4O19A 2PCQA 4KO1S 1UWTA 1LSUA 2XOKD 4OEHA 5G2HA 1HQYE 5J2TB 5GV7A 3W6OA 3VVMA 1E73M 1UOOA 2VHLA 4Y0AA 4N0EA 3V5OA 2WM0A 1EIBA 3WLSA 1MOSA 3LQKA 2DKOA 3I23A 4QULA 1K66A 1YA6A 2RONA 3VZSA 7A3HA 5D4YA 1KMCA 2RE8A 3CWQA 4FEGA 4DV7B 2C4WA 3JQBC 5KOHB 4AD5A 4ZVPA 1O97D 4XLLA 4RVUA 3PK7A 4FCVA 3Q58A 2CBVA 4MIKA 3ADPA 2XOEA 1W85B 4YUXA 4LAMA 1SCKA 4C1NA 3NQCA 4Y1RA 1LROA 1T9KA 2J9ZB 3N8HA 4J0IA 2V7QA 2COUA 2VCBA 4WXYA 1WCGA 3PDHA 1OSEA 3L6CA 4V2UA 2R84A 4Z2YA 4XLZA 2WM8A 4DPPA 3UENA 4B3ZA 4FB5A 1UP0A 2C0QA 5AJXA 2VFDA 1W34A 4DLMA 3FZNA 1IWOA 1NBIA 4CMCA 1MX1A 3C6BA 4MB5A 1P81A 2BBWA 1AKRA 4JCOA 1NQVA 1DE6A 4CNQA 3KWJA 1LLCA 1U8AA 2FPVA 2XB4A 5HR6A 4AQ7A 2YDYA 2HBXA 1C0PA 5JCJA 1MHTA 1V45E 3SC6A 3EPHA 3BD7A 3H22A 1SUBA 2P4UA 3M6IA 3MYOA 2BV3A 4MDPA 4GVPA 1KM3A 4GPIB 4I90A 1S2IA 3G5UA 3HG4A 1Z25A 1IEXA 4Z8XA 4HOXA 4X8MA 3OP4A 2C7PA 3I6RA 1SU5A 4XYMA 4JBXA 5JCOC 1CECA 3VUSA 1ZN7A 1A0CA 1E3EA 2XRZA 3T8LA 4P0PB 3EX6A 4MP6A 1T29A 2R00A 4RWEA 3PXDA 4RQAA 4M4SA 2HRDA 4JA0A 3H8AA 5L53A 1AK9A 1QPNA 3ZBUA 2AAAA 2HVOA 4JUAA 2NVAA 2FU5C 1XD8A 4R1QA 1VLQA 3TOZA 5EJ8A 1L4YA 3HFJA 3AS0A 3S1XA 4AZBA 3MMXA 4GCAA 1CZOA 5IC6A 4CLRA 3VO2A 3L4XA 1QRRA 1G4TA 4LANA 1G8MA 4MYDA 1Z0JA 1TKCA 4RS4A 4AHPA 3TX6A 3HB9A 1DJHA 4D41A 1BOOA 3P2YA 3RT9A 2IYZA 4EOUA 3EG9B 5BOEA 2E6AA 1QORA 4LFAB 2FZGA 4AUNA 3FYUC 3UQNA 4HDOB 4URYR 1XZNA 1GVHA 4JJKA 4Y6LA 3GXBA 4FFNA 1ZUNB 3UD6A 5A6AA 3ET4A 3PTZA 4B83A 4I9GA 2EARA 5DBOA 1E7QA 1V0JA 1V02A 3OZCA 1RQBA 13PKA 2PZAA 2WPGA 3GE7A 1JSZA 3LVFO 4EP8C 2IBMA 5LB2A 1KB3A 2FN4A 5FV4A 2J3DA 2GEFA 1DKQA 4HVCA 2Z8YM 5BCAA 1PQ4A 1REQB 5BSUA 1QHNA 2Y99A 1MF7A 2BS9A 4JIEA 2ECQA 3F2BA 3GJ3A 3R77A 4PH6A 5DLYA 3A25A 2WA2A 3QY7A 1OXMA 4XKYA 3B5IA 1RLCL 2ZRNA 1VMIA 2D1TA 2IV2X 2H4JA 4JQ3A 1Y1LA 3NYIA 1JXJA 3BC1A 1P6WA 1OI7A 3W6ZA 4QQFA 4MM1A 1HEIA 2EXOA 1SEVA 2P2SA 5HE9A 4I8XA 4YO7A 1LFDB 4JI4B 4H08A 3N75A 3EA1A 3GK0A 3GLHB 3UGQA 3L0KA 4BMSA 3DG7A 5K01A 4Y0VA 4TQAA 3S70A 4HT3B 1Z4JA 2ZANA 5DHUA 1CDGA 2NU8B 4B3RB 1FXSA 1M01A 2ANBA 4TUYA 1JB1A 3WMXA 5ADWA 1RHJA 4GC3A 1LOQA 5I3IA 1Z36A 3VNQA 4MNKA 3LZ6A 3JTEA 3IP6A 3N5KA 4JJZA 5ALRA 1DKNA 3QOYA 5CC5A 2ADAA 5K9XA 2WVGA 2NYVA 4KI7A 3GH7A 3LFHA 3SCVA 1EZ1A 1GZHB 4LZAA 2P9HA 4Z2GA 2W9MA 1K98A 4GXWA 4ERNA 2IUTA 3RS3A 2WLTA 3DHWC 3OM0A 4JHOA 4YTSA 1YD7A 1HQKA 1NMZA 4O11A 5AXDA 4PLHA 5D84A 3K6SB 2KMLA 1DOAA 4E94A 4PZAA 4MSSA 3AVVA 4RK4A 1PNVA 2R1MA 3OFKA 4G5SA 4TXJA 1O0SA 1OIXA 4TL8A 4KLZA 1NXQA 4BPBA 1YZQA 4YIWA 1UOKA 3UUFA 3DVLA 2WU3A 2BE9A 4O4IF 3UHAA 2HTMA 2DPYA 4FGUA 2LD4A 3BMCA 5F4WA 5TT0A 3UGJA 3QE9Y 1FXQA 1ZLYA 3TTEA 4RNFA 2F17A 2IQDA 1GL7A 2VJQA 4KH1A 4EDFA 3W87A 1C7FA 3ZY2A 1BYIA 3HRIA 2A3BA 3W1MA 3I8XA 4F9DA 4D74A 4XSVA 4W4TA 3WFZA 2CU0A 4LJYA 3B8WA 4F40A 1Y7IA 1ZD1A 2O2HA 1J0ZA 1HE1C 1OCQA 3KZXA 4KBFA 3TUJC 1Z7BA 3TXAA 1EGMA 1DBTA 4WKAA 2H54A 3WH9A 2EPLX 5KVVA 1ZS9A 1NTOA 5CLLA 3OIYA 4LMRA 3AU2A 1MBZA 4WRRA 1DE0A 5E8JA 3L7LA 5B7QA 3RABA 4BO9A 1OLSA 4G9BA 3HC7A 5IFPA 3S2SA 1TQDA 3VC5A 2ZX8A 3V46A 4U2BA 3V2IA 1PZMA 2QW8A 4H3HB 2JI7A 4WBXC 4WZBE 1YONA 4CPDA 1MEWA 4JTLA 3FXAA 2X15A 5ABPA 4JU9A 4LU0A 5HPOA 4A3YA 1ITXA 4WKBA 5IT0A 1LTDA 4HWGA 4R8LA 4MMYB 3WX7A 1NXPA 3QHOA 3CNEA 1EBBA 1A50A 1BDBA 3F1KA 2DEUA 5IW8A 2PDXA 2V5KA 1IXRC 4JPGA 3R3VA 4R27A 3LI1A 3P60A 1R8XA 1M67A 4IDAA 1V25A 5CDTA 3R9XB 4IFTA 3SY1A 4LALA 4HPNA 3C3AA 2CEAA 1ZIDA 4DO4A 5JIPA 2O6HA 3HMQA 3MWGA 1YR8A 4RNCA 2ACSA 4X1IB 3VR4H 1Q4WA 3ID6C 2CLEB 1EX7A 1QIJA 2G5CA 5PGMA 3QMWA 5A1TA 3O7UA 4ZOLF 3VIMA 4KDCA 2INFA 1MJNA 1VR6A 4WMLA 1GPJA 3MIIA 1YDEA 2VWQA 2ZRCA 1YMVA 3B1ZA 1K9TA 4DV2B 2INZA 3V7NA 5I7HA 4NU7A 5HE8A 1KGUA 1XDLA 4Q4SA 2B37A 1DYSA 2PS3A 3MOSA 1VDMA 1TV4A 5D01A 3A2LA 2DQKA 1D9XA 3OTQA 4H3VA 1VE9A 4F5DA 2BFAA 3BWCA 4B73A 3FJ4A 1VCIA 1XO1A 2R66A 1A5AA 3GHHA 4GIYA 4RZXA 3DG3A 1XX6A 4ESEA 2WTMA 3WRWA 2GN8A 7MHTA 3AUJA 5LP6B 2CXEA 1G7RA 3RADC 1O0CA 4PL1A 2FSIA 1H2AS 3CUJA 1SULA 4EG0A 3LX6A 2GBPA 4S05A 2IWRA 4M88A 3O0KA 4OQDA 3Q3VA 1EGHA 3B9PA 4N5HX 4FO4A 2GJNA 3HJNA 3NHKA 2JKZA 2DZSA 4HSGA 4EELA 3JRNA 3OE1A 1RWOA 1IQRA 4LVBA 1LJUA 3MWKA 3D2BA 1FVOA 2C9DA 2Q71A 5GNXA 1TQ4A 2JF0A 3LHFA 4UZEA 3ESBA 2JE8A 2QM8A 5ARBA 1QQ6A 1XAJA 3WV4A 5U1PA 3T0DA 1Z08A 2GN9A 5CGZA 3UFXB 3EOZA 4LF9B 1TZKA 3A64A 4OM8A 1Y8AA 3QPVA 2CVQA 4MUPA 4WESB 3H53A 3KL5A 3B0XA 4RW0A 3MYRA 3OYZA 1GPH1 2VNHA 3LKZA 2JH9A 4GUFA 1RPNA 3U3HA 2RH5A 1Z5VA 4BA0A 3DOPA 3BVJA 2ZJ0A 1VHQA 3PB0A 4ALNA 2QTWB 4IFKA 4IQGA 3H0EA 3MCUA 2RGXA 1WU8A 4L9WA 3AYTA 3CLRC 3S3TA 1W3TA 4Z53A 1DC7A 2PX8A 3KT6A 1KKRA 4LRYA 1LTHR 4C0KA 3O75A 2JH3A 3ARYA 3R10A 1GGOA 4U7DA 3GNNA 5C8VA 3OQ6A 3VYRB 1KRXA 3O8OA 3LPGA 1WR8A 1DP0A 3W70A 5A8NA 1GG9A 1GNXA 3Q45A 4PHGA 3CKKA 3ES9A 5D02A 3FHLA 3A1SA 3E2MA 1C0EA 2AGTA 1Y6JA 1WMEA 2EEPA 1AZWA 3KQPA 3FD8A 4CUCA 1OHLA 2CHFA 4TSKA 4CCWA 1LDEA 1YS4A 3MT7A 4D5GA 4JTRA 4R51A 3OBIA 4NLLA 1HGYA 2R6HA 2QX6A 3GDTA 1GGEA 2W0MA 4PLCA 1VE6A 5CLWA 4UQPA 2CFRA 4C6FA 4L6CA 4LCJA 3F71A 2BY1A 1QE3A 3WYBA 1Y6FA 4EF4A 2JFGA 2H2GA 3WHLA 4OYYA 4EW1A 3VTAA 2O8FA 1VP5A 5MKGB 1H6DA 1OH5A 1YRYE 1N2IA 4EY3A 3IAM1 2N75A 4XOUA 3LO8A 1SQFA 3RF7A 1ONRA 4BOYA 3LY7A 3OW1A 3ZGZA 4OJTA 1Q7CA 5I7UA 1MDFA 3HR7A 2N3ZA 2DWOA 2RDUA 3UZXA 4Q1FA 3PFCA 3NQBA 1CJKC 4CLDA 2HQRA 2Q01A 3MUIA 4R9SA 4AVOA 4BQRA 3HO1A 4RX0A 4FQ7A 4Q3AA 4WQMA 3GEHA 4Q24A 5JS6A 1T8SA 2OELA 1GU7A 2EERA 1AJ2A 1TO6A 2X3YA 4N9BA 4UEQA 1I2BA 3DTVD 1PKMA 4FI3F 1P0QA 3GD5A 1ULAA 1EZ4A 3EEBA 5IVKA 5K3FA 3AGPA 4M24A 4XWGA 3NWPA 3GS6A 4HX2A 4WOZA 1KH3A 1V2GA 4AD4A 3CH0A 2FPOA 2PL9A 4WOBA 2Z04A 2VKZG 3MWFA 4MLPA 2PKEA 3EY9A 3UCQA 1BOFA 2ZIZA 3MUNA 3SFTA 2JZOA 3M6VA 4KWHA 2G97A 1QPQA 4PVCA 1XDBA 4KQHA 4JHZA 3M6WA 1UPPA 1Z2PX 3AY7A 1F07A 1SM9A 5ALXA 1Z47A 3IV9A 3CIWA 2WZEA 1Q3NA 3CNHA 1CF9A 2J4GA 3EQ7A 3S2UA 4DX3A 1D9ZA 4EUSA 1XPGA 5D03A 2DQYA 1XYVA 3MW8A 1BXRA 4DWWA 3CUWA 1BFDA 2V0CA 1M0EA 4PVDA 5COAA 3TU9A 2C5EA 1CQIA 4D72A 1YVDA 4PYRA 1JIKA 2VGBA 5B53A 3A3OA 3O73A 3KFVA 1P6BA 1NYLA 3T61A 1EP3B 4B34A 1S3HA 4V28A 2AMGA 3AUUA 4IR7A 1D3GA 4BFWA 4LBSA 3MJFA 3V8VA 3I76A 6ADHA 4DBDA 5MN6A 1ME8A 4N9EA 1N7GA 1RM5A 1DIOA 2BGWA 1D3CA 4JNYA 7XIMA 4W88A 1M53A 3HDVA 2ATCA 1H2BA 4RV5A 1H5YA 1CZKA 2G8LA 1FSPA 1EA0A 5EMHA 2YB4A 1TO3A 1Y89A 4Y9UA 3EB2A 3IVTA 2X0HA 3MO7A 3S42A 5ILQA 2NSDA 4DC1A 2YOHA 1CUEA 1X6NA 5DKFA 1B43A 1UMCB 1HLDA 2PCEA 4DXXA 2GTHA 2O8CA 5GV8A 1FP6A 1XQWA 2P30A 4BE9A 3L4JA 2IL1A 5LBIA 2A6PA 4QDTA 1BD0A 1VCGA 3N0RA 1PD0A 4BFCA 5IKMA 4S12A 4QTTB 4MXDA 3WX0A 4HNSA 2AFHE 4JBNA 1O5TA 4H7CA 5TJ9A 3GJ5A 3E9DA 2V96A 1ISVA 5BYJA 1RSCA 4LJ8A 1T9DA 4MWZA 4KC0A 4CIDA 1FFHA 5EVJA 2CVZA 3ND5A 1H66A 1ZOSA 4DXKA 4U2FA 1U9CA 3QG1A 1HF6A 1VYVA 3WK9A 5CD9A 2PS9A 5HJYA 2PKCA 4M89A 4W5HA 3GOHA 4AZHA 3B1VA 4JEIA 3S28A 4LZPA 2ZQYA 4UM7A 1UR3M 3OPNA 4NXNB 3GPLA 3LPAA 2PURA 4R7GA 3S6OA 2VZSA 1M68A 3CXRA 3TAOA 3JZDA 5LIRA 1OCNA 1K3TA 2FK8A 2XDQA 5DM4A 1YR1A 3R9KA 1ZWKA 1PV4A 4PSCA 3CR7A 4REMA 3P5BA 4TT8A 3H2NA 4KCVA 1EXMA 3UUWA 4KZPA 4NMHA 1TFVA 4BJ5A 2X1HA 1UBHS 3ABRB 2DVMA 2JA2A 5IG2A 2EJVA 2VJOA 1QO2A 3ETHA 4MUHA 3ZX5A 1AV6A 2W6RA 1DPMA 4GOLD 5BYBA 4C0QC 5DCUA 5K0FA 4UR9A 1GKKA 4PYMA 4BNHA 5EFDA 3O93A 1PWXA 1Q6CA 2R6AA 2IXUA 1C9JA 2BI4A 3DAFA 3RUCA 4MJLA 5CYPA 1IZ9A 5C7OO 4BN4A 3LLXA 1IJKA 2UVQA 4Q1VA 4UMFA 4QPDA 3ZXUB 1GKPA 4RTOA 4PL2A 2YCLA 2PHZA 3R2JA 5CG1A 4QBHA 4XZHA 5JZVA 5HUPA 1XQ6A