5FA8A

Sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
156
Chain Sequence
YVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase, putative
publication title aKMT Catalyzes Extensive Protein Lysine Methylation in the Hyperthermophilic Archaeon Sulfolobus islandicus but is Dispensable for the Growth of the Organism
pubmed doi rcsb
source organism Sulfolobus islandicus (strain m.14.25 / kamchatka #1)
molecule tags Transferase
total genus 49
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa8A00
4YUWA 4R8SA 1AQJA 5FA5A 2V74B 1R6AA 5K0JA 1P1CA 2FCAA 3FUTA 3M33A 3G2QA 4HSGA 4C03A 3CKKA 2F8LA 1INLA 2CMGA 3JWGA 2PV0A 3DLIA 3OU6A 5ICCA 2UYQA 2AVNA 2PVCA 1X19A 2VDWA 3HTXA 3EVEA 3DXZA 2JH8A 4C4AA 3A27A 3FZGA 4NECA 3EEYA 4BLVA 4CTKA 4K6MA 3KPUA 3RW9A 4KDCA 5EMKA 1BC5A 2IBSA 4RTNA 5DXJA 2Y1WA 5FWDA 1O54A 3LDFA 5DX0A 1X1AA 2GS9A 3FYCA 4AZVA 1R18A 2UYCA 1UWVA 3OCJA 4U7TB 4QVGA 5DT2A 1PJZA 1I4WA 1WXWA 2ZBRA 5DPMA 2EG5A 2PWPA 5E8RA 2PWYA 1MHTA 5K0EA 1Z3CA 3DMHA 2HTEA 3P8ZA 3BKXA 4DCMA 4FGZA 4X60A 5EMLA 3NMUF 4YUXA 4V0QA 5FULA 5H02A 2AOTB 4DMGA 3CJRA 3ANXA 2NXJA 3G7UA 1SVUA 3B89A 3M6XA 1D2GA 4C08A 5E8JA 2IH4A 5FQNA 2PX5A 4ER0A 1KP9A 2GA9A 2ZFUA 2G72A 3GWZA 1JQ3A 3DMFA 3MGGA 3OE5A 1P1BA 5DSXA 2OPBA 3B3GA 1KIAA 3MTEA 3M4XA 1EJ0A 4FT2A 4F85A 2YVLA 5KVAA 2P7IA 3EVCA 5EVJA 1RI2A 2P7HA 2VZ9A 2OYRA 4EVIA 3FPFA 1SUIA 3P2IA 3NW9A 3THRA 3OU2A 3TM4A 4A6DA 2ZZKA 4EKIA 2G8NA 4RVHA 5FADA 4YV1A 1KPIA 3P9KA 3OFJA 3QV2A 3M6WA 4LWOA 4MTLA 4O29A 5CVUA 1NBIA 4RTQA 1QYRA 5FTWA 3TPZA 4AUKA 2PLWA 3P97A 5CD1A 3ER9A 4BP3A 1ORIA 2P3LA 1XTPA 3G5LA 4HG2A 4P7JA 3ER8A 2ZULA 3NVKI 3A26A 3EVZA 1G60A 1JSXA 3UJBA 1P91A 2DULA 1NV9A 3HP7A 1Y8CA 4RVDA 2Q41A 3FTFA 4ER7A 3UJ8A 4QQKA 3FTCA 3B5IA 1QZZA 2NXCA 2OB1A 10MHA 4YMGA 3G2PA 3GO4A 4E70A 3EEOA 5HIKA 4EK9A 1JTFA 2G70A 4M38A 3P9CA 3OFKA 3LHDA 4QTTB 3GDHA 4DQ0A 5DRTA 3WSTA 5EC8A 5CCXA 1PRYA 3LDUA 4IKPA 2AOXA 4GC9A 4RX1A 3BWCA 3CGGA 5EHIA 1JG3A 3DP7A 3KKZA 5EKXA 3TM5A 3GCZA 2C7OA 3LECA 1SQFA 2B3TA 1DL5A 3G8BA 4PYNA 4OA5A 3S68A 3SM3A 8MHTA 3FPJA 4CWAA 1JG4A 3JWHA 3R6TA 1BHJA 4CKEA 1VLMA 3ELYA 2PY6A 3MAGA 4PIPA 3BWYA 3R24A 5DTQA 2ZCJA 5E1BA 5EOVA 4PYIA 2NP7A 1JR4A 3CJQA 2EJUA 4GOMD 1AF7A 2XVAA 3HEMA 4GQBA 5CM2Z 4AZWA 2XYRA 2PJDA 5E9JA 5E1MA 3REOA 3C3YA 4KIFA 2N47A 4B17A 2Z6QA 4QPPA 2IBTA 2IFTA 2QRVA 4E2ZA 1V39A 1YFLA 4WXHA 2OY0A 3KQSA 2AOVA 4FSXA 3TKAA 5DM4A 2GH1A 2ZWAA 2PT6A 4HTFB 5ICEA 4KVZA 1BOOA 3H2BA 5EKUA 4DKJA 2IPXA 2OKCA 2PGXA 5C1IA 1TW2A 1NW3A 2DPMA 3IHTA 5K8VA 1G8SA 3BT7A 2PX8A 3DLCA 3KQPA 4GEKA 4HTFA 2AR0A 2K4MA 2PBFA 1JQDA 4XCXA 5DRYA 4JXJA 1XDZA 5LR6A 3G8AA 3I64A 1YUBA 4LG1A 4G56A 2UZ4A 5P8WA 1JG2A 5GOZA 4X1OA 3GIWA 4QTUB 4PYJA 3GRZA 5K0LA 2LD4A 1RJEA 3EMDA 3DH0A 3M6UA 3Q7EA 1G55A 3AXTA 3UFBA 2R6ZA 1VIDA 2EX4A 2VP3A 3NDJA 4C05A 2YQZA 2KW5A 1MJFA 1KPHA 3GJYA 3BGDA 4AX8A 2YTZA 3O31A 4ISCA 2ZVJA 2XYVA 3KQOA 3OPNA 5F2OA 2XVMA 4OBXA 3I5UA 3UJAA 3A4TA 1EQAA 2FK7A 3BGVA 3CBGA 3EGIA 2FYTA 3FRIA 3KQMA 3M70A 3ELWA 4QDKA 4Y30A 5EMMA 2JHCA 5DTMA 1YB2A 3DR5A 1OR8A 3UJ9A 4YUYA 2B78A 5K01A 3B7PA 4HGZA 4E30A 3G88A 3HCBA 2O06A 5FQOA 3VC2A 5EIFA 3FUXA 2IDJA 5HILA 5F2NA 3NDIA 1P39A 3IYLW 2C7RA 3CJTA 5HIJA 2ADMA 2CMHA 2E5WA 4C07A 3EPPA 4BLUA 3PFGA 2VS1A 4P58A 1R74A 5EEGA 3E8SA 4E2WA 1RJGA 4POOA 4PONA 5K09A 5T67A 3KPVA 4RTRA 1DCTA 3PLAE 4FP9A 4F84A 4X41A 2OXTA 2AN3A 4AZSA 5ICGA 1XCJA 2JJQA 1EAMA 2B9EA 3BGIA 4FZVA 4DCGA 1QANA 3ID6C 3NWEA 2ONYA 3UJ6A 1UFKA 1WY7A 4XUEA 5U4XA 2PX2A 3VC1A 4EMSA 1X1CA 3O7WA 3LCCA 1NW7A 2IDKA 3LCVB 4OQEA 4XUDA 1TW3A 2AOTA 2ZTHA 5DM1A 3EVBA 3GRRA 4R05A 3EVAA 3VYWA 2BM8A 1X1BA 3AJDA 3D2LA 2UYHA 5K0FA 1FP1D 3G2OA 3P2EA 4FR0A 4PINA 4PYQA 5EGSA 5CUQA 2EJTA 1N2XA 2ZIEA 3BKWA 5GWXA 3LPMA 4FT4A 3HCFA 2GAFA 4XUCA 5E1DA 3TMAA 4YUZA 5CCBA 1ZHFA 4HGYA 1VQ1A 3SX0A 1F38A 4RYLA 2JHPA 3MB5A 4X63A 3UA3A 2ORED 3FPEA 3T0IA 4EKGA 4FSDA 2NXNA 3EGEA 1IXKA 4GOOD 4Z2YA 1VBFA 1EIZA 3SSMA 3MHTA 1KR5A 2P3QA 3TFWA 3NWBA 3B3JA 2UYOA 5DXAA 1H1DA 3OE4A 4RTOA 5MHTA 3UJ7A 2H00A 3P9IA 1KYZA 4OBWA 1HMYA 1VP3A 4ER3A 4RTMA 1JG1A 2BR4A 1NE2A 2PX4A 1NKVA 4E2XA 4GOND 2I9KA 5JUWA 3PT9A 3CVOA 5C9ZA 4HC4A 3KR1A 2P35A 5CVEA 2ZZNA 2AZTA 5LQRA 3BUSA 2HV9A 1X1DA 4PYKA 2AN5A 1XCLA 2ZBQA 1SUSA 2AS0A 4X61A 3KR0A 4RV9A 4V0RA 3R3HA 4P7KA 5D1HA 3T7SA 1RJFA 2IGTA 3PVCA 2ZSUA 3QOWA 3C6KA 5K0BA 2BR5A 2I7CA 5IKMA 1VE3A 1XJ5A 3A25A 4YUVA 2IH2A 5E9WA 1G6Q1 2WA1A 1I9GA 2AOUB 3E05A 4PIMA 1KYWA 4OQDA 2AOWA 3GU3A 3KQYA 3KQTA 3NVMB 4OX9Y 3EVFA 3SXJA 2JG3A 2IP2A 2YXLA 1D2HA 3KPJA 5C0OE 2H1RA 3DULA 1KXZA 1XVAA 3G89A 2NXEA 3CC8A 4GF5A 5JR3A 1JQEA 1QAOA 5FHRA 5LQJA 1WG8A 4CKCA 1Q0TA 4RTSA 3GGDA 3TOSA 2CL5A 3KPYA 2HWKA 3GRUA 4WVLA 2CKDA 3OZRA 5DM2A 1YZ3A 3ERCA 2BR3A 2OB2A 3LX6A 1I1NA 2I62A 3HCAA 5K0GA 3PFHA 4ER5A 3FPGA 3PX2A 1QAQA 5EHGA 2XBMA 5E2BA 3AXSA 4GOLD 4A6EA 1M6EX 1NW6A 1JTEA 4IWNA 4BP1A 3I9FA 1ZQ9A 1RI5A 2QM3A 2YXEA 2YUIA 1YF3A 1KHHA 3HCDA 2ZIGA 1FBNA 3C6MA 4R6XA 1L3BA 1F3LA 1Q0SA 2P40A 2P41A 3HA5A 4E33A 5LQUA 5EMJA 3FPHA 2BM9A 1KPGA 4MWZA 3PS9A 3I53A 3LGAA 3R9XB 2P3OA 1VL5A 2OZVA 2ZWVA 3C3PA 3DOUA 3MERA 2WA2A 5K05A 7MHTA 3LKDA 4Y2HA 5E1OA 3BWBA 1M6YA 3T7TA 3MCZA 2OO3A 3AY0A 4PGGA 3LBFA 4UOEA 2CWWA 1R8XA 3OU7A 5HEKA 4MQ4A 4RWZA 3KR9A 1U2ZA 4U7PB 2O0LA 2PT9A 1O9HA 4M7RA 5HFJA 3TKYA 3RODA 5LQNA 1RJDA 3R0QA 3UBTA 2WK1A 2IIPA 1FJXA 4MHTA 4RSRA 3RIEA 3E7PA 3KHKA 4OA8A 5ICFA 3UJCA 3DTNA 3FUVA 4P7FA 3GNLA 3GRYA 4LECA 2O07A 5E2AA 5LQCA 2V7EA 3PB3A 5EIWA 4PNEA 1D2CA 2B25A 4P7GA 4R6WA 2EFJA 1AV6A 4C04A 1XDSA 3EMBA 3LKZA 3THSA 4RTLA 1WXXA 3IV6A 2XYQA 1L3CA 3SSNA 3HVJA 2FHPA 3SSOA 3NJRA 4DF3A 3IEIA 4YMHA 1SKMA 2BH2A 2JH9A 5DSTA 3A7EA 3DUWA 3HA7A 2NYUA 3QOXA 3X0DA 5BXYA 3P9NA 3CCFA 5GIOE 2ZBPA 4QVKA 2AVDA 1QAMA 2G1PA 1L9KA 5D1NA 2JHAA 3G2MA 1XDUA 3ORHA 4YV0A 2GB4A 1G8AA 1NW5A 3Q87B 5K0NA 5HIIA 5FCDA 5FHQA 1HNNA 4EQZA 3HA3A 4F86A 5HOQA 1NW8A 1IM8A 2O05A 5EG5A 3UA4A 4E2YA 2HR1A 4L7VA 4KIGA 5FWAA 1IY9A 3KU1A 4GBED 3OZSA 2R3SA 3HVHA 4M37A 2ZW9A 4MIKA 2P1DA 1DUSA 3E23A 3JWIA 5T6BA 5T64A 4AZTA 4BLWA 2GPYA 3TRKA 2HMYB 5GP1A 1L1EA 4CKBA 2QYOA 4KWCA 4KW7A 1ORHA 1R8YA 2Z6AA 2PSSA 5CVJA 1AQIA 3MQ2A 3BXOA 3OZTA 3K0BA 2A14A 1TPYA 2ERCA 4CXMA 5GIPE 4RTKA 2ZZMA 4ER6A 5DM0A 2PXXA 3SR4A 2FPOA 3V8VA 2OBFA 4PYLA 1L3IA 1T43A 4HRAA 1RI3A 5BW5A 5ERGB 2NP6A 4PCLA 2YR0A 4YV2A 1ZGJA 2FRXA 1ZG3A 5GINE 3HVIA 5G02A 3P71T 2O57A 3ELUA 1BKYA 3LBYA 3FTDA 3LCUA 2ESRA 5BP7A 3MTIA 4IV0A 1N7IA 5KQSA 3JWJA 2G71A 3FUUA 1ZGAA 1ZKDA 1YZHA 4GC5A 5F2KA 2ZLBA 3SMQA 3FRHA 3HCEA 2NNWB 3KQQA 4ZTBA 3DMGA 4H0NA 2IH5A 2B2CA 3BZBA 3G5TA 1R00A 3KR2A 4PWYA 1XXLA 3MCTA 3P2KA 5EZSA 4GUAA 3VSEA 4PYOA 3SVZA 1FP2A 1RI1A 3TLJA 4RTJA 4ATNA 2C7PA 2ONZA 3PTAA 2C7QA 5CVVA 4IV8A 5B1SA 3C0KA 3A7DA 3ME5A 5DX1A 4DZRA 2YX1A 3PX3A 5DX8A 5KQRA 4KRGA 3I58A 2PXCA 3FYDA 4KDRA 5K03A 1EJ6A 3L8DA 4PCAA 2AOUA 2Z6UA 5CVDA 5DWQA 2H11A 2HNKA 3M6VA 2Y1XA 3HNRA 3UZUA 4LWPA 3DXYA 3KQWA 4QQNA 4E31A 2PXAA 3FTEA 2VDVE 5FA8A 4PYMA 3O4FA 3LL7A 5EZQA 4HH4A 5BW4A 5LSAA 4M36A 5GM1A 3ELDA 1VP9A 3LDGA 5DLYA 3UJDA 4E32A 3AWIA 1NV8A 1EG2A 1VPTA 2QRVB 5IH3A 1G38A 1FPQA 1N7JA 5LQKA 5LQAA 1B42A 2YXDA 3UWPA 4FS8A 1SG9A 3NTVA 3EVDA 3FUWA 4DA4A 2VDUE 3K6RA 5KS2A 3DXXA 4DM3A 4QPNA 2QY6A 3SGLA 3B3FA 5FUBA 3T7RA 2I6GA 1NBHA 5E9QA 4R8RA 1WZNA 1YFJA 2FK8A 3HVKA 9MHTA 5EEHA 3V97A 5HIMA 2ZIFA 4CTJA 3TQSA 3KQVA 1M0EA 3EGVA 1RI4A 3GXOA 3KPWA 5DTRA 1WS6A 3GRVA 5EQJB 5GM2A 4RVGA 5K0CA 1UIRA 5HZMA 4RTPA 2GLUA 5KYGA 5M5BA 2PKWA 2P8JA 3LSTA 2QE6A 3TR6A 2BZGA 3BWMA 4QDJA 4RVFA 3F4KA 5EPEA 3HM2A 4BY9E 1JSZA 1SQGA 1O9GA 4C06A 2AN4A 4PGHA 3HCCA 3EVGA 5CIYA 1NT2A 3U81A
chains in the Genus database with same CATH superfamily
2PTHA 1E7YA 1SC6A 4J2OA 3BDVA 5IVKA 5CJJA 2JLCA 3TTVA 3E8XA 4DADA 3EDMA 1RWWA 1UZAA 1M5UA 2Y2VA 1N8KA 1FJHA 1N5JA 2GHRA 2OCDA 2P2CA 2PVCA 3ADOA 4YJ2B 3EVEA 3KJIA 5JG7A 5IK2D 1YD7A 4ZVUA 4LRYA 1UPCA 4NECA 4BLVA 3GLFB 3D4BA 1BQ4A 1N4DA 2WBLC 3Q8XB 4KDCA 4LKRA 3TVTA 4D9KA 2Y1WA 3EOZA 1NXQA 5H70A 2O3QA 2WJJA 1ABEA 1AQUA 1NNEA 5DI3A 3SQXA 1T4DA 1DJQA 3EY9A 1PZNA 4TSFD 3PIIA 3O4IA 1O6FA 1IQ0A 4U7TB 5F1OA 4CIVA 1D1SA 3IVGA 4RD6A 2PWPA 2W9XA 4J9VA 3OZBA 4RKWA 5FBQB 3W8RA 1EK0A 3K94A 2FPGB 2DT8A 1JWAB 2ZVPX 1R6VA 4BU1A 3KOYA 4W99A 2VP4A 3QTTA 2WJ4A 4HDAA 1DRKA 3I42A 2EDCA 2QUZA 1IY8A 3A4YA 3G7UA 2GZRA 4FX2A 1CFZA 2OHOA 2ABWA 3E7FA 1WW3A 2BMWA 3WLIA 4BVHA 3LVQE 4C5AA 1QYCA 4YJHB 1GTZA 1NC3A 2DPYA 3OX3A 4V03A 2XUKA 4HAUA 1NJSA 1NVGA 3G49A 1KEPA 2ZRBA 4D92A 4HXFB 3WGUA 4Y2VA 1XK6A 3H0CA 1XYGA 2J85A 5LIPA 1I7QB 4QPZA 5EVJA 4ZAYA 1G16A 1KBQA 3ZD8A 3MJHA 4ZQFA 4I2NA 3SDSA 5C4IA 5JT1A 4RMHA 3AP2A 2G8NA 4N3AA 2HK7A 5CA0F 1BH2A 2J0QA 1DC6A 4O29A 5LQMA 1BXKA 5KX5A 2EFGA 1IN4A 1NKTA 3DLPX 3DTVB 4QFMA 5IVHA 2Z5VA 1TLFA 1USUA 4WY8A 3STUA 1ND5A 2V55B 1RHUA 5JSZA 3RFXA 4CGYA 2XNSA 3PQ6A 4PHCA 4UXIA 3L0CA 5IDWA 5IJ9A 3BFXA 3U44A 1V11B 2OGUA 3H2SA 4QLAA 2FUG6 1IBSA 1DEHA 2PNJA 5BV2P 1QGUB 1XYVA 3K5PA 4IRXA 4WN9B 3W5SA 5ALXA 2DWQA 2GWRA 3CWCA 4MOWA 4JI0B 4EK9A 4GMDA 3BRWD 2AEJA 2G7ZA 1I2BA 2QVBA 1W5BA 1MA3A 3NALA 3CH7A 3T1VA 3RSLA 1FVXA 1KZ1A 1PRYA 4MYHA 4EY6A 1OAOA 4HQ6A 3BWCA 4JJIA 1XI2A 1XC7A 3OA2A 2IGBA 4PSUA 8MHTA 1DL5A 2B8NA 1QO0D 2BFEB 3BA6A 4I1RA 5L95A 2OSVA 1SBIA 2TSYB 3GMTA 4I50B 1T4GA 3P1JA 2D5LA 4NK4A 3QQ5A 1KO7A 1Q92A 4QECA 1EVQA 4CKCB 3R0XA 4FYKA 2CLMB 1MQAA 1KEZA 3YASA 4BNGA 1G5IA 1E2NA 3ZCUA 2OHJA 1G9XA 4OSEA 3K5HA 4MW5A 3V55A 1S8OA 3KTFA 1JILA 3F96A 4U02A 4Q15A 3DEKA 4E2ZA 1V39A 3JQGA 1MJGM 1R4MB 2WNHA 3QTLA 4GP6A 3LRPA 4IS2A 1HNWB 1SD5A 1KSFX 3W3AD 2AR9A 2GJAA 5CB4A 1IN8A 3R7SA 3A1VA 1U3VA 4I4TB 2AZ4A 5FPHA 2JIRA 3CLUD 2G06A 4MI6A 3HKBA 1M5TA 2FDRA 5B12A 1G8SA 2D74A 4LJYA 2O8DB 5HJ2A 1KY3A 1L7QA 3KYBA 2VUTA 3N7AA 3OY7A 1S2GA 3K70B 4QRIA 1JLRA 2FKNA 1JJIA 1YS2X 2B37A 3MCUA 4CLDA 2ZSHA 1D1TA 1NVEA 1Z88A 1LBTA 4PYJA 4M1YA 5FT9A 1T9DA 4FFOA 1AKVA 1QH1B 3DH0A 4L08A 3EPLA 2NT3A 1VI5A 3VPGA 3KDPA 1MPXA 5ER6A 1MO5A 1V5EA 3UGJA 2BOVA 1XZBA 2J41A 3LBHA 4FJ1A 4RIGA 1XPOA 3O3NB 4O2LA 4B71A 4D5EA 4YA6A 4MCIA 4G5FA 1KRHA 2QJOA 4TL9A 3N1UA 3BXZA 2I2CA 2LIVA 3OI7A 4GMHA 4ZZIA 3COWA 4D4JA 5FV4A 2V97A 4ZYXA 1U1FA 3FNRA 5DYIA 1TYEB 4YDQA 5K01A 4KOAA 1JWBB 1OI2A 2FB9A 2P30A 3P0EA 5D86A 5B3JA 2M6SA 4Z4GA 3F5FA 1MP0A 3KQUA 3E22B 1GNQA 3TK1A 5JRJA 2GVDC 1VG0B 4CKXA 3RS7A 4ARVA 2RGNA 2QTAA 2H0QA 1NAIA 2YV1A 5EZ6B 3IE1A 1PJ4A 2X9LA 5EJ6A 1K6EA 3OETA 3L4KA 3GLIE 1HX7A 2JANA 3C7CB 3KPVA 1Y4SA 4KUHA 3TPFA 2OCGA 2WF9A 4FP9A 2UVPA 3LXUX 3IAUA 4ZOLF 3EIWA 1ZISA 2MHCA 3HUUA 4M60A 2WKWA 3VU9B 3PXEA 3TD2A 1AHPA 2XKKA 1T8WA 4P34A 2ZUVA 1P3Y1 5CNJA 2EKBA 3BF7A 5F5LA 3ZY3A 2PX2A 2V1XA 4KO8A 3VXKA 3PNSA 1GA4A 1U3FA 3WYGA 5JDIC 4XA8A 4OQEA 3R0JA 4R7TA 2ZTHA 1N32B 6NULA 2I0FA 3KOOA 1C8LA 1DBPA 4BYGA 4G63A 2V7GA 1SKUA 1G3IA 3CNEA 2CVPA 2MSKA 3IKLA 2MINB 4EY7A 3AV0B 4WSOA 1ZY2A 4H3SA 3OCYA 4DRZA 2D0PB 2C5FA 2XSZA 1UZLA 1L4MA 1N6KA 3NBZC 4L9WA 3T1NA 1F38A 3PJFA 3MB5A 3PQEA 4ALKA 3ZQ4A 3QLVA 1QMPA 3QKRB 3WFIA 2NXNA 3EGEA 4B81A 3I8XA 1FMCA 3CRW1 4JJ8A 4JVMA 4LE1A 4Q1AA 1H1DA 2Y92A 3O2SB 1IDN1 2OLKA 4O2BA 4QYIB 3M4JA 3DDUA 3L07A 2PNFA 2HHAA 3SC2B 1BVYF 3TBFA 3H8JA 2A84A 4B6JA 1JG1A 4HLUA 5KDDA 4E2XA 2XE8A 1UDAA 3DE2X 4F4HA 1RYYA 1N2BA 1ENZA 1VE5A 4MVJI 2AZTA 4E15A 1GO2A 1II8A 1RIFA 2O7NA 2NU7A 2HV9A 3KSMA 3EPHA 1OF1A 2YY7A 4JBIA 6Q21A 1Z6YA 4WK2B 4V0RA 3GZNB 4ID3A 2GYVA 4P7KA 4JP8A 1RQGA 3G02A 4TPKA 3HKEB 4EBFA 1WXEA 5I7FA 3TCNA 4OTZA 1WF6A 3F46A 3JD3A 1LNSA 2NWQA 3L79A 2C2HA 3MOIA 3RUIA 2C78A 3C14C 3TOCA 3V4ZA 4B7XA 2PKQO 4Q66C 4XWWA 1QQ6A 4KR6A 1ZI9A 5HRUA 1TQDA 3AVQA 5AQ1A 1HDZA 3BHMA 2QV7A 2UVQA 2G6BA 4I19A 1YQEA 3STWA 5EXDA 1B6RA 5JDCC 1YQGA 4ZDWA 3EVFA 4LGVA 4CQLB 7MDHA 1W7AA 2JG3A 3CWZA 5C0OE 5LJIA 1SU6A 1MKYA 1KXZA 1UBGA 4LXGA 3TR5A 4B6EA 2XV1A 4WOKA 4LJ5A 3GGDA 3SQNA 1EVKA 4K2HA 1S9DA 2BGKA 2SHKA 2PMKA 1SUEA 3FKQA 4JCOA 1NWCA 1YZLA 3BIOA 1GVHA 3WL3A 1H8HD 3A9UA 1LS6A 2OKGA 1PD0A 4MQ6A 5HR5A 1HFWA 1Y6QA 4KYTA 3HLYA 2D4HA 3L7YA 4NCKA 1GDTA 3UHJA 4WN3A 4XD2A 1T15A 1IXZA 3PFWO 1UJBA 2G9RA 1DKMA 1GYRA 3LW8A 1OFTA 3KVNA 1E79A 1ZD8A 1KO8A 3C6MA 1GPDG 3B7WA 2E1PA 2FMKA 2R4TA 2WQZA 1TZCA 4KE6A 4TTQA 3FPHA 4F3RA 4Z3DA 4EELA 2H57A 5IKEA 2WF5A 3ONVA 2L18A 1PT8A 2J3HA 5JANA 1C2YA 4JP1A 1RXUA 4XIYA 5G40A 2A35A 4TSRA 4CFZA 2X41A 2NZWA 4L5IA 3WICA 4W8GA 4K3UA 3CE6A 5BSWA 3A9TA 4Q3LA 3ACCA 4Y2YA 4ZCQA 1GRQA 1MD9A 2I1WA 1O9HA 2C7GA 4KXFB 4EDFA 4QUBA 3TKYA 1PIWA 2C4TA 4FOLA 3ABOB 3ELBA 4WOCA 3R9KA 3ML1A 4OJNA 1DAPA 1QIFA 4GPZA 3KD2A 3LSYA 1CE8B 3QKWA 3AHJA 1AUPA 1VTKA 3K16A 4K9OA 3HXKA 2GBLC 3QWIA 4IL5A 3EIUA 4LECA 4MV4A 5EIWA 1JF8A 2K7FA 1EWYA 2FGKA 4RE6A 4F8JA 2ZVQX 3MOSA 3Q6IA 3A1CA 4AW9A 2B82A 4D6YA 1YCDA 4LTDA 5L4SA 5F64A 2F48A 3ZTYA 5FLXA 2WAXA 2P5YA 1N92A 1R2QA 4WRRA 3WV5A 1J9ZA 3SSNA 4UPDA 2XGMA 4G8CA 1H1TA 1ODIA 1O2DA 5DDIP 1SKMA 4E5PA 1VHWA 1G7CA 2IU4A 5JLAA 4TVSA 5CCEA 3LWDA 3BVPA 1D8TA 2G1PA 5JSQA 4QIHA 4TKLA 2JHAA 1XQ1A 3G2MA 3I73A 1FUKA 3C98A 1BMDA 3UK0A 3WRWA 1NW5A 3D54D 4W6QA 4F9TA 3J81A 1HNNA 2A5FA 1FX0A 1UKVY 4JAVC 2EQ5A 3RSHA 3TLKA 3M1AA 3SYTA 4EUNA 1J21A 3CNLA 5J58A 1VG8A 2G09A 3E9DA 5TJHA 2HSGA 3UNXA 2ZKIA 3JQ9C 1DAKA 1U3GA 4JUFA 2ISQA 4QC2A 1JNXX 2QX4A 3GH3A 5CURA 3DGFC 1DZ3A 3CCCA 4P08A 3DZBA 4NESA 3HVHA 3EJ6A 6ADHA 3FI0A 2ZW9A 3DEAA 2X9VA 1I2MA 3WLKX 1U7ZA 3JCZA 1PQPA 3LUJA 5IBQA 4J1TC 4I6GA 2CSXA 2QU7A 5KI6A 4HWGA 1XP8A 1Y5RA 5EP3A 4NC9A 3RRNA 1NXXA 4WAUA 3JQ7B 1QYWA 1HEIA 5J9FA 2WZQA 1VMEA 2Z6AA 2X1VA 1VJ0A 3IJRA 3KZOA 3OEHD 4PG5A 4TWIA 2OCKA 4LIPD 5EWMB 8AT1A 1BTOA 3GEBA 4HT3B 2EW8A 4FEYA 3FFAA 1MC5A 3L40A 1GADO 3DKPA 1KGDA 1XQWA 3M9LA 1ZGCA 5B37A 2I6TA 4HADA 2C7VA 1GFSA 4NDAA 5B2FA 5HXAA 1LFAA 3AYZB 1R7RA 4X84A 4JV5B 1P8JA 3BHIA 2J4DA 3GEGA 3IRVA 3V46A 3V6MA 1ESMA 1GTL1 1BN7A 1BYUA 2D5AA 3F2IA 4TRMA 1K7CA 2HW8A 4L8GA 4JYCA 1MVNA 2PH7A 4A36A 1MGOA 3D81A 4DJFC 1YGYA 4YI5A 4KP7A 3RREA 5ITWA 2Q2WA 4YR7A 4D97A 3LCMA 1L5FA 2QXTA 4RZSA 3SMQA 4G89A 1S7CA 1VXRA 5CEFA 2HA5A 3F90A 4H0NA 4MVJE 4BDTA 4HOYA 1PJ8A 2DUUA 1SCNE 4GI5A 5EZYA 3IKJA 1RM4A 4PTYA 1EHIA 3HDJA 1HYHA 3ZE2B 1C3VA 3ZWVA 1BQ3A 3FD8A 4GQAA 4BZQA 4RTJA 4C4OA 5MN5A 4GECA 4QYTA 4D98A 1NC1A 1JIIA 3CFYA 2MDTA 5HVNA 4ZAXA 2CLEB 3CHYA 4OHFA 5BOSA 2YZMA 4XFDA 1OI4A 1Z5WA 4JGGA 2NMVA 1ECBA 1AK1A 4KHZA 2AYZA 2Z6UA 3JRXA 3ZI7A 1I6KA 5DWQA 5LN1A 4UUPA 2BYTA 5JE8A 3UZUA 2IOYA 4KQGA 1G6KA 4KAAA 3UTDA 3G0CA 1U6JA 3HBFA 2I7XA 2VSOA 3BE4A 3JSAA 3LO5A 4JYMA 4R3NA 4RMJA 4C9BA 4NOMA 1L5HA 2X5KO 4M36A 2H8GA 1OVGA 1CJKC 3PC6A 3ZHCA 2R7AA 5JLJA 1PR5A 1IUOA 1QFXA 2O2YA 4H16A 1NV8A 2Q6VA 2K6GA 3O03A 1C4WA 2P5UA 3O90A 5LQAA 4BO9A 1FYVA 3UWPA 4LCJA 1ESDA 2H6EA 2NU8B 3EVDA 5G1PA 4GRIA 1Q0LA 5JCXA 3RSQA 2BCJQ 2JZNA 1DC4A 4HZUA 1NY6A 3DXXA 1J00A 4EYQA 4FFBA 1GKLA 1II0A 5DNYB 4Y9TA 1M2NA 3EA0A 3SY8A 5LKRA 4ZEXA 1HE2A 4BNJA 1U3UA 2OECA 3RTGA 1J8FA 3S2UA 3ZJ5A 1GLNA 3CLHA 1FOEB 2IHUA 1O6BA 1R3DA 3VH2A 7AT1A 3IUSA 2YHIB 4RTPA 2VDOB 4GL2A 2B7BA 1YO6A 1KHTA 1YBHA 5HUHA 3R9XA 2A9VA 3QP9A 4KR0A 4MV7A 4ARUA 4EM6A 2L69A 4LJ9A 5DN6D 1Y7HA 1ZRNA 4W1PA 2NOAA 2YRFA 3E9QA 3GZJA 4H0FA 1IH8A 4JC5A 3OX2A 2CCGA 1WX1A 5I9IA 2R6AA 4R1QA 4E5DA 4ESOA 1C7IA 2AN4A 3I01M 1TL7C 5AJWA 4Z8YA 5E6RA 1T9GR 3A9VA 3IP6A 2HSWA 1ZDMA 1N0IA 1P74A 1PFKA 3T6KA 1F0NA 5KYTA 4KRXA 1YBFA 3RJTA 2M1ZA 2G88A 3IELA 3EGXA 2HRRA 1VA4A 1JT2A 2IBMA 2GX6A 4FILA 4KO1S 2QVLA 1BJKA 4DBLC 5LXTB 3KNZA 1AQNA 4ZV4A 3RTCA 1FMFA 4CMEC 4D5GA 3CX7A 4QT0A 1LBEA 2PKRA 2LV8A 5LYJF 1QFMA 3C5EA 4PO8A 3PD7A 3IVCA 2XADA 3O75A 3X3HA 4ZAVA 3EUEA 4UQOA 4L9AA 2FP3A 1MX9A 3A1UA 3HU5A 3LDFA 1DX4A 2R5FA 2X19A 4MGHA 3HXOA 4YMWA 3IUJA 3KKKA 4HLQB 3DMRA 4BQRA 2DETA 4DMUB 3AFIA 4J76A 2ZGVA 3PG5A 4P32A 4B2PA 2EARA 3OO0A 4OQZA 1QFYA 2X5XA 5DFAA 2IEDA 4JI6B 2FE4A 4BKQA 4XTCS 2W11A 2PH5A 3EARA 1WKBA 1SVKA 4IIGA 4HDKB 3I9OA 5EMLA 5C1OA 3P9ZA 5FNVB 1DJMA 4TM7A 2VDJA 1GAXA 3EGOA 2GZAA 2Q27A 4KQ9A 3HABA 4BO8A 1N9GA 2I6FA 4R2LA 5FNZA 1AZSC 3QLUA 1ID8A 4OL0A 2ACVA 1HLDA 2C77A 1ATIA 2XDAA 4QD3A 4AMGA 3IDSA 1U65A 4QGFA 1YASA 2FOLA 1EJ0A 3LV8A 4JVLA 1S89A 3UBMA 3WJ7A 3ZWXA 5H3HA 1XPRA 4K5QA 3EVCA 4ON9A 1RHKA 1YGPA 3FWZA 2WUWE 3WQRA 3EX7C 2W6ID 4CQMD 8ATCA 2GM4A 4P0TA 1JPVA 4KWEA 4R2IA 3NW9A 1UXGA 5DOVA 4ACAA 1BJTA 2HA2A 1KPIA 1F48A 2CEAA 1H2RS 3L7MA 3TN7A 2EWMA 4RPGA 4RAOA 3PD1A 1WCWA 1W2HA 4TS4A 2EW1A 3OBBA 1XHFA 3DL2A 4PX2A 4AZ3B 4MR9B 4BJ6A 4IDDA 1FYEA 1PWEA 2PMFA 6REQB 3WYCA 1JQLB 2WTXA 4KO2S 2H52A 4KRYA 4LK3A 3UMYA 4PO9A 1PZGA 1RP1A 1LI4A 2XMRA 2XIQA 2FEWB 1PX0A 4MRSA 2ATXA 2NXCA 3K9HA 1I14A 1IN6A 1E5XA 4PGMA 4RXTA 1UQTA 3DL0A 4RBNA 5IWCA 4ZQGA 3JYOA 4LA4A 4D41A 5CB6A 4QTTB 2HQOA 1CUDA 2RHMA 4CF7A 2QOEA 5EC8A 3ZHTA 1C3LA 4HN9A 1J25A 2PL5A 1JX6A 2HMTA 2Z1NA 4CEHA 1V3VA 5K3DA 3SX4A 2IYLD 2WHPA 4L0CA 4F21A 4HR7A 1JG4A 2J0UB 4JIGA 3T5TA 1J2TA 2R1VB 1SXJB 1WSBA 3K0AA 1E92A 2CLHB 4P7BA 2IUTA 3MAGA 4MJ7A 4QO7A 1NVVQ 1YONA 1WV1A 4FONA 1RW4A 2ZB4A 4YP1A 1DAFA 3G13A 4IS3A 1QK4A 4N0QA 1QWSA 2ZBVA 2E4XA 3NWJA 1L5LA 3TGWA 3SF8A 1O6CA 1CY6A 3NBFA 4NR0A 2P5SA 4MWTA 2X40A 2HREA 1WHTB 4AUNA 1CDZA 3HXPA 4QGSA 2B0JA 4MVJH 3UW3A 1TU3A 3BTOA 4RHTA 4XD7A 2OY0A 1GTRA 3UAXA 2AOVA 3VDRA 2FPRA 4DNPA 1YAHA 3CSDA 4IF6A 1BOOA 2CLOB 4R1OA 2ZRPA 2VLIA 1ZCJA 1O94C 3B1JA 4JI5B 5K0ZA 1EFVB 3K1YA 3O47A 4ILKA 4BGIA 2WZCA 1QM5A 1PKEA 1NW3A 2I2WA 3C3KA 1U4OA 2Z2YA 3G9QA 4IXTA 4MDFA 1Q21A 4MHOA 3DL4A 1H1LA 3PXGA 2UZ0A 1I51A 5IZCA 4B4DA 3HJCA 5EJEA 2IYNA 4A0HA 1JB1A 1IJEA 3AUFA 1ZNXA 2Y1EA 2X9GA 2ZI9A 4RADA 2AXPA 2C2BA 1G55A 1Z5VA 3LPNA 4F96A 4GOKA 3TWOA 2WILA 5DU2A 4FLEA 1QV7A 5SZHB 1U2TA 4EGQA 3C24A 2ZT8A 3D6JA 5DHAA 3NASA 5TEVA 2WICA 4QM6A 1A1SA 1C9NA 1WMSA 2D2VA 3RU2A 1Q1ZA 4FW8A 4MV1A 3L8GA 1RRPA 3DE3X 2NAFA 3QKIA 2FYTA 3KFVA 4YGXB 5AHRA 3FSGD 1Z5GA 2C31A 4ZI7A 1GYPA 3Q6MA 3ZDBA 5FRDA 5G3YA 3BSFA 1R5OA 5A0VA 1PT6A 2B78A 2VF4X 2VJPA 1AD2A 2XB6A 1HETA 2YS6A 4C6TA 4OGLA 1LDNA 1Y5LA 3ZHZA 4L27A 2WWGA 2B94A 3KZNA 2Y0CA 3OHPA 4D4HA 1RE0A 4I55B 2XUIA 4QYMA 4KC0A 4AYTA 4HVCA 3OLWA 1FIUA 4INJA 2DBYA 1R74A 1VKZA 1EDDA 3JZDA 1F8XA 3RUDA 2ZJFA 2D2FA 4E2WA 4POOA 4WKOA 4DR7B 1REQA 2C5SA 2VDKB 4X41A 2QM7A 3KL4A 1L5GB 4PR3A 4G5RA 3SKXA 1HYBA 5KQLA 1UMCA 2HDWA 3CUYA 3PPIA 2JBHA 4AM8A 4XVCA 3DDZX 3HDGA 3ZGOA 1PQYA 1SUPA 4HGOA 5U4XA 5AM3A 1T3LA 5KTKA 5T8KA 5JAQA 3ZWBA 4EP1A 4JFAA 4XUDA 3GRCA 1SJ9A 2A0YA 2E2WA 1TD1A 4OHKA 1OXTA 3GRRA 1XE3A 3LUPA 4LYDA 4JLAA 3H18A 3U61B 4OFZA 4OX9Y 3LY9A 2CBXA 5H4HA 3L8FA 3KHTA 3IV9A 1PHRA 5AHOA 4FBLA 5BXQC 3DOFA 4ZCPA 1YQDA 2FSGA 3L7OA 3ZWAA 4EGFA 3ILHA 2ZIEA 1P5ZB 7REQA 4EHHA 3LPMA 2PG3A 3URMA 1GZ3A 4L0MA 5E1DA 3HB4X 3RYCA 3LMKA 4HGYA 2Q0XA 4GD3Q 1FFDA 2HA0A 4K9DA 2B61A 2E4YA 3OJ0A 4IOJA 3AY3A 1J8QA 2BI7A 4DW8A 2BM0A 1RPAA 5J43A 1BWPA 4GICA 4PHGA 3IR7A 4Q3EA 5FV7A 1NOJA 3ES9A 3B9BA 2ZS9A 1TUEA 4KXMA 2Z3ZA 3II6X 4PAMA 1T9BA 3B1XA 4YX9A 4LJRA 5D84A 3TCXB 5KTYA 3P9IA 3DTTA 4KTVE 4QXOA 2PIAA 3OZDA 3WLSA 1VP3A 1XZHA 3WSWA 1R0RE 2VO1A 3PU6A 2OV6A 4NXMB 1C0PA 1GFWA 2JGDB 3OC6A 3SEAA 1KQPA 1YKGA 4LZJA 4PSVA 1B6SA 3M6IA 4QGGA 2OQIA 2IKQA 4FQ7A 1NYRA 5CM9C 1WNTA 2FDXA 3SYLA 3CH5A 3MWGA 2P4UA 4L5CA 5JXGA 4XFJA 5IUJC 1SVNA 3LF2A 3NT5A 3F3YA 3BWVA 3HKDB 5IMSA 1T24A 4TWRA 3AF5A 5AI4A 1ZQ1A 4UEJA 5DJ5A 2I7CA 5LOVA 5IKMA 1E61A 4CM8B 4MW6A 4RJIA 2FJPA 4CCYA 2FR8A 4KQHA 3OLQA 4PC6A 1ZOLA 4GLJA 2J3EA 3JYNA 2V8BA 1LQ2A 3C6XA 3E05A 2JLRA 4JJ4A 4UBJA 1Z07A 1W93A 4HAWA 5CFLA 1TCVA 3IPAA 5I4CA 3AF0A 2W8BB 2WIAA 4XPZA 2IP2A 2LWIA 2XTZA 1D2HA 4UMVA 4D3SA 3ZVNA 1HQCA 1LFDB 1FMLA 2AYYA 3M6MD 3GJSA 3SZ3A 4D9JA 3U9SA 5JMWA 1O0SA 1QAOA 2ZPTX 1OE0A 1R0CA 3ZWYA 3KPYA 2G08A 3FHOA 2LCFA 2R7LA 4HXEB 1BCSA 1HY3A 3QMWA 5FYDA 2X7XA 4RGQA 2IHTA 2A5YB 4NE9A 1KSJA 4U6NA 2E5FA 2QYSA 3RFUA 4QO8A 1Y6RA 3PX2A 821PA 3MUFA 4Q3KA 3P2JA 2PE5A 1OZGA 4OLFA 1DC5A 2B7LA 4RWEA 4WKNA 3O8QA 1RI5A 3RVRA 2GN1A 4BIIA 4BVFA 4ZK6A 5JNVA 5B6IA 3FDZB 5AM0A 4ND1A 1D6SA 2AFIE 3NLLA 4E13A 1S6YA 4XIGS 4BLQA 4EF4A 2WJGA 1DS6A 4M1ZA 3EEFA 3PUVA 2RKWA 5JRDS 4PSAA 1E2BA 1AB5A 4Z0NA 3VOAA 1HE5A 3H1EA 4PZUA 5KPJA 3QK7A 2XVZA 4Y2HA 3LY5A 4QPDA 4WCFB 4WFIA 3S29A 3AY7A 2GWHA 1L4KA 3CLKA 3LA6A 2C1XA 3JALB 3QHQA 3O8BA 3R5TA 4XM1A 4DRXA 1K5HA 3VR6D 1QRUA 2A0WA 2FPWA 2VG8A 2PT9A 2J4CA 4LJKA 5FUWA 1BRMA 5EUBA 3P2OA 1UOOA 3PSAA 5T3UA 3FM9A 1Y6FA 4DL9A 5I5EA 4FYIA 2H63A 3QPVA 1GZ6A 4LRQA 4OF4A 4PBRA 4ENVA 1LSUA 4XLZA 4PNEA 4KQFA 2WIKA 2Y0EA 2C2XA 3JWPA 4M0PA 1F51E 4OUDA 4EMTA 4YFYA 1C4OA 2P79A 3EMBA 3H5NA 1QHHB 2BJHA 5HIAA 3ABIA 2OR3A 5CT4A 1YR6A 1LGYA 2WNIA 1SB9A 3O3OB 2WM2A 1JYEA 2DY0A 1B3BA 3I1JA 3ZGXA 2NYUA 3QOXA 3EA5A 5A3QA 5L6LB 4WERA 3UO8B 1Z83A 2XGSA 4YV0A 4WINA 2GB4A 2WE7A 1G8AA 1QUEA 1ZX1A 5JH7B 1NXSA 4EARA 5C52B 5AFSA 3GPCA 1E1CB 1KYIA 1Z2CA 1QVRA 5E6SB 2C8KA 2KPOA 2DFKB 3DPUA 3GRAA 1C7JA 1WDWB 1YR8A 4H3VA 3J81k 1KZ4A 4RIFA 4GZMA 2PRZA 1PNVA 3D4OA 3FAKA 4KJXA 4U1RA 1N1DA 1NG9A 1QGAA 3ZY5A 3VNSA 3DD1A 2JVJA 1TKCA 1EB9A 1GUYA 2VQ6A 3HR7A 3V4SA 1X15A 3MUEA 2NN3C 1NVTA 1NQXA 2HDNB 4W9RA 5C37A 2C1EA 1AQIA 4LS3A 2KB0A 2O8FB 3O26A 3RC8A 3U4MA 4QWMA 3W1WA 4EBBA 2GNOA 1PLLA 3JZAA 1AZLA 4V38A 2ZSKA 2XT9A 4KPYA 5C80A 1D9ZA 2GHIA 2QE7A 1MENA 2C4VA 3ABZA 2EFCB 5BO5A 1BFUA 2WSYB 3C2QA 3GB9A 3G79A 1QE0A 3NM4A 1ZLYA 4JBGA 3HYRA 5TMPA 3JSXA 2Q0SA 2HPHA 3F5MA 4DLBA 1FP4A 3L2OB 3U4CA 1KJWA 2AMJA 2FPSA 1TAQA 2GCIA 3ASUA 4M88A 5GQSA 1I0IA 1TGVA 1GKIA 3RYHA 3M5CA 4XGIA 3HCEA 1Y34E 1GTG1 4FMBB 2GDJA 2P0EA 3ROMA 4GUAA 4F72A 3SVZA 3SK0A 3K8QA 1J0CA 3HJNA 2I1QA 3OUTA 2DWPA 4IIVA 1KI6B 4IV8A 4JUDX 3ZCXA 5GZ1A 3VNUA 1ZN7A 4EHNA 3A58B 3UMJA 2E6KA 3PK0A 3G7NA 4KBGA 4PC1A 2OZPA 2Q9CA 3W0LB 3WWEA 3QKTA 2I54A 3I28A 3INNA 4LUCA 1ENOA 2CK3D 4MI9A 3EUFA 5FR2A 1JJVA 1B6GA 4WLFA 1EHYA 4DBZA 2PZFA 4KPUB 2LKDA 3PHIA 2LIPA 2ISSD 3AI1A 4ZT4A 3QU9A 3TKLA 3U48A 1AMNA 1I6LA 3PNYA 4FFLA 2C95A 3UANA 3R0ZA 1EVYA 2HQRA 1UFQA 3RS2A 1YB4A 2VDVE 3P4XA 2JLXA 1MCZA 1EFLA 2AJDA 1CJMA 5KTRA 3LCRA 3I61A 5JJLA 3NUQA 3KSAC 2AFIA 3EZ9A 3CW9A 4OK5A 4BMOB 1N77A 4S2UA 1KMNA 1YA6A 2XTJA 3OG9A 2GJ4A 1VPTA 3DE7X 1IBLB 1XRQA 1XNRB 3LS2A 4ZEVA 4HDNA 1DG1G 1AKWA 2FZWA 4D8UA 4FS8A 2QR2A 4B4UA 2VUUA 3I2KA 4G6ZA 3TLYA 2GAIA 4JR0A 1EX9A 2FZVA 5I9MA 1BSVA 4D8TA 3HBLA 5KVCA 3AIMA 3LVFO 2GF9A 4NEQA 4G5GA 2I6GA 2XCIA 3IESA 4RA9B 3IJEB 4F6RB 5FI0B 1S2OA 2QD4A 3HG7A 3KJZA 5EUQB 2DXIA 2IU6A 2WQ7A 3Q0IA 3L8CA 5EEHA 5HIMA 4HDMB 2DHEA 2IU3A 4LZOA 2A7QA 5B55A 4TWBA 4RKFA 4ABYA 1QGYA 4OYHA 4V0ME 1R12A 3B85A 2L42A 3ENKA 2DE0X 1V35A 4NBRA 2PKWA 3NYQA 2QPLA 1RSZA 5J2TA 2QAIA 1US8A 2F8SA 5J3JA 3BWMA 3MM4A 4G5OA 4QDJA 4LCEA 4BY9E 3DDWA 4FXOA 5DLDA 3EXHC 3DC2A 2X1HA 2PFKA 5FOQA 3N5CA 4V0NA 3JQFA 3TSYA 3UPDA 4F4UA 1UBJS 4Z49A 2GFHA 4PSDA 2V74B 1M8KA 1RPZA 4EKDA 4WFQA 4DY6A 2CUZA 4S1VA 3G2QA 4HYYA 2N1MA 4ITUA 1ZUNA 3F0TA 2Y0PA 3FB1A 3LQYA 1EA5A 4NNJA 4PX9A 5C7OO 3HTXA 2YMLA 3TOVA 4TT8A 3ZKWA 5AVQA 2GCOA 3DBHB 3H84A 4YACA 3AZPA 5DHSA 4FW9A 2E9SA 1TYDE 1BC5A 2DBRA 1QDUA 2Y2UA 3H6GA 1FDWA 3DJYA 3IUBA 2GAOA 2O8EA 3C3MA 1ISMA 4M54A 2JLQA 2XCTB 1YVDA 4OD0A 1QQAA 3B1VA 1QX3A 5DT2A 2PBZA 2CHUA 2VBFA 1G20B 1USGA 5E8RA 1XALA 5BN5B 5GONF 2PZJA 3JXEA 4DQVA 4Q9NA 1A8IA 3LH5A 3QU5A 2D0OB 1EBFA 3REFA 4DLZA 1VFPA 4ITVA 1M2WA 3K9WA 3O4HA 3WSVA 3DMTA 3IODA 5EJIA 3OIYA 5A04A 4Z6KA 4NARA 1G4UR 4R54A 4UEQA 4DV7B 4DR5B 5DBGA 5DNAA 4B7ZA 5IKPA 3DMFA 3R4CA 4D96A 2FUCA 1EGHA 1T0HB 3L05A 5AW5A 5FH9A 1JDUA 3ICVA 3TSAA 1CUUA 2C98A 1EM6A 5DSXA 3VJKA 3BL6A 4FT2A 2P7IA 2VNJA 1P8AA 2Q4TA 4LJLA 1YDHA 3F67A 4YLEA 2GEBA 2GPTA 2I6XA 3E4CA 3FPFA 1QUFA 1SUIA 2YOFA 4IHJF 4Y9DA 3W05A 3PDJA 3CG4A 4O1MA 4INPA 3LW7A 2POCA 2MMCA 2YHAA 1NG1A 3JQBA 3P9KA 4PBSA 3JAWA 4PNPA 4KLZA 1QYRA 2ZPUA 4MS3B 4BNMA 3TFOA 1HO3A 2NV6A 2C88A 5U4QA 1I2CA 1K3TA 4G0WA 3TUZC 1Z25A 3CUSA 3MJVA 4FGLA 1AHIA 3SHTA 1JSXA 1VMIA 4BBZA 5IZ4A 4RVDA 4XCVA 1ONOA 1G6HA 3E5RA 4DIBA 4BN5A 1ST2A 2W2QA 3UXEA 4CF3A 2IEIA 5LM3A 1UH5A 5KYUA 4YMGA 3EXG1 3B6JA 5TEWA 5G41A 1Q1QA 5L3VA 2JLSA 1GAWA 3PQ8A 1O5OA 5DRTA 3NWPA 3WSTA 3PWTA 3GEDA 3GK3A 1ZVVA 2FWBA 1PS9A 2X76A 4F7DA 1KH1A 3R6TA 3QM1A 5GZ6A 3F78A 4O8ZA 2Q2NA 1AKEA 4I4IA 2BI4A 2H59A 3UXHA 3PD0A 1H23A 2X7JA 4E7OA 4X8OA 4M0LA 2IV7A 3D31A 3JQGB 4M7WA 5MN4A 2F3PA 2VJOA 3WGYA 2G0TA 4MA5A 4RABA 1V4BA 2ADFA 2FHSA 3ITDA 3S5JA 2DLCX 1J22A 5CB4B 2I33A 3I5XA 3T3OA 1N5OX 3DPIA 4V0MA 3IVMA 4NEGA 4BFYA 4KN9S 3E3AA 5AUQA 4WXHA 1X7YA 4I1UA 3WP1B 3S55A 1KTVA 4EHBA 1BWRA 4RHEA 4AS1A 1TM3E 4RIHA 5AW6A 1Y9EA 2JGIA 3MJDA 2H1FA 4DV1B 4DKJA 2NUAB 4DJJA 1MO4A 4LYYA 2W42A 3PHLA 3KWMA 1HSOA 1JQDA 1T1RA 1ZMTA 1ADYA 5F98A 2AGVA 2OGTA 4WDQA 1N6NA 5HM8A 2OAP1 3N76A 1KORA 4PGFA 5CA1F 4CLRB 4HLCA 5JYDA 5I3CA 1VPLA 3VOBA 4RD2A 1Z15A 1ZD5A 1C30A 1V47A 1XMPA 4K9SA 4CFSA 3K0FB 2ATEA 2BJWA 3DHYA 2PRSA 1GNTA 1X8LA 1YS7A 3O31A 5IMBA 1VRCA 2Z43A 3OJFA 4QSHA 5DOZA 1EFPA 1I33A 4X5OA 1UPXA 2KHZA 3IAS6 2XVMA 1U7XA 4GSYA 2XGGA 3BGVA 3CBGA 4Y3UA 3VC3A 3MS2A 2QZ4A 4GI2A 4W1QA 3RK1A 2FEAA 1PN3A 4R51A 2ZYDA 3U4IA 2JLUA 4J8PA 4AURA 2BGJA 2Z09A 4GS5A 4UHFA 3S7TA 3UJ9A 2TMKA 1N34B 2OLJA 3PLNA 4DEVA 1N2CB 4L15A 3G88A 4FKZA 1JKFA 1X1RA 2OCIA 3OLZA 3O1JC 5FQOA 4WBNB 2DR2A 4ZI3A 2Q3LA 4W6ZA 1JG7A 3LXRA 2QDXA 4BFXA 1F14A 3TXXA 1ZONA 2WEKA 1D3AA 1JLLB 2VDPB 4QNRA 4P3XA 4DJDC 1Z6ZA 2HA6A 1U80A 4LC0A 5BQFA 1GVNB 1R8SA 4M1SA 2VK4A 1LU9A 2NUBA 3N2KA 2ZM5A 1P1HA 3O6VA 1OLSB 4PQFA 4RMNA 3WMGA 4AZSA 3T1HB 4LOHA 4DT1A 5FAKA 3K6SA 2F90A 2BFBA 2EJBA 3G17A 3LRXA 1D04A 3I12A 4XUEA 1K8QA 3W4KA 3GLHE 4CQJA 1YZTA 4G0ZA 1OXUA 4I1SA 4L0DA 3W6NA 1YSCA 3HWRA 5FBVB 3TGPA 5C8DA 2MSDB 2RG1A 2C83A 3KTDA 4NY1A 4RJJA 5DYNA 4C3VA 3VAAA 2I65A 3G2OA 3TQRA 4AJHA 2JIPA 3VYVA 4IIEA 4CMAA 1RXEA 1NJ5A 4UDNA 1IUNA 1EXWA 2AJCA 2I1VB 3CX6A 3HCFA 2CXSA 3UMVA 5DK4A 2GPWA 3WIVA 3ZZ1A 2JAXA 1IE3A 2R85A 3ZKAA 4DIUA 2X58A 4EI7A 5BR8B 3AHCA 4G1CA 3DW1X 4Q39A 3U0BA 1PVVA 3EB9A 3LBAA 2D2XA 2XSZD 4RJKA 3ZLUA 1Y8ZA 1RPTA 4DSZA 2JFPA 1B16A 2P2SA 3CPSA 4JEHA 1KR5A 5HCIA 1CEEA 4IDGA 4O4JA 3OJLA 3OE4A 1JEAA 1AS2A 1F2DA 3RKRA 4F9GA 2H00A 2MSCB 2QD5A 2B20A 4QQRA 3K9FC 3FFWA 4PZEA 3MRSA 1DEAA 4TL7A 4YMLA 1NE2A 3PE6A 2FAXA 2E6UX 2FPXA 4KN5A 3PT9A 4CHTA 5C9ZA 5JUWA 5JYBA 5H59A 4MVJG 1T5BA 5IT4A 3K70C 3KK0A 2BGLA 2ZSAA 2FR1A 3NZEA 4JJZA 3K9LA 1YS6A 4EUHA 2G5CA 2BH9A 4R1NA 5THXA 4DAOA 1GLGA 2X8JB 1LS1A 1SUSA 1H42A 2AS0A 2E4WA 4RPLA 5GVSA 1TEZA 4U00A 1NR1A 3C4VA 2O8BB 1ECGA 1R6BX 2IK8A 3P9SA 5HF9A 3IPRA 5REQB 1JIVA 1FNBA 2BUBA 1VE3A 1XJ5A 1P81A 1VJ5A 3DT8A 2DQSA 1FFEA 3GXBA 3PI6A 5FOVA 1I7PA 4IGAA 1J9EA 2HXYA 2XMSA 3PXAA 4J4HA 2WA1A 3CXUA 2CSUA 3DS8A 1W6RA 4ME6A 4A1FA 1HR0B 4G8JA 1CZNA 3PGA1 2PKEA 5KDLA 5PNTA 4NMHA 3T3HA 4S04A 3KQTA 4NBTA 4YK7A 1LW7A 4XOIA 4AN1A 4EIWA 3FLAA 3FSEA 1DCKA 3MSXA 4C5BA 4QXQA 3B51X 5FUQA 2FTKE 3HB5X 4GF5A 5EUCA 4ETMA 4S1OA 4YJDA 4E94A 3TOSA 3RIGA 4H6XA 5IULC 1B0ZA 2VWQA 2WHQA 5DT9A 4WVLA 3E5MA 4D7AA 1CULC 3WAKA 3U0VA 1H65A 1J8VA 3AHGA 1Y82A 4UE2A 4A2QA 1Q3HA 3ANYB 4RD4A 1EP2B 3T1QA 2O1XA 2X0RA 3HCAA 3KEFA 3A1WA 3ONDA 3FPGA 3GYBA 3QNWA 2V0NA 2Z3VA 5F4BA 2PS1A 2HCBA 2MMGA 2J67A 2JJ2A 3ITKA 3QEMA 4K40A 3V7WA 4BP1A 4JI8B 4D4GA 1T2DA 3RANA 4LN1A 4X85A 1L5NA 1JH8A 3TZEA 1DIOB 3SBDA 1SBZA 1LZKA 4RXMA 1NW9B 1F3LA 3O1IC 4ZVPA 1E79D 3TLEA 5LQUA 4HDSB 5H4GA 1C0EA 4MWZA 4LGCA 3HADA 2VWHA 3NKFA 2DGDA 3LGAA 4OGKA 4BL5A 2EU8A 4PSCA 4HBGA 2A0KA 1GWNA 3PKJA 1HRDA 4CI0B 4LHSA 1PFVA 3DD5A 1DG3A 5A3RA 3AETB 4D43A 1IEQA 3ZV4A 5HP4A 3V1LA 1DKLA 1VI6A 4NNOA 2XNHA 3VDNB 1RWBA 1N5IA 1R8JA 3PA6A 4BYMA 3GP8A 4KNYA 3UH1A 4J0IA 3VKHA 3UBTA 1RJDA 1SCAA 1M67A 3NJ8A 1RMYA 1F0KA 2GD6A 4V39A 5E2AA 4YJ2F 1PNOA 1EDEA 3KHUA 1DDOA 5BMVF 2E7ZA 1QPBA 1CVIA 1KBZA 4A8HA 4LBZA 1QRSA 4KHPB 4QBFA 4TKZA 1EE9A 2R8YA 1SUFA 3M3DA 3SJBA 2JGNA 3OESA 4BQEA 2ZPAA 1QONA 4PRYA 3NJRA 1JDZA 3GLHA 4R01A 1NDQA 4REQA 5IUNC 2QM0A 5DSTA 1UK9A 1MMFB 1DBWA 3IRUA 1MDBA 2GK6A 2ZTVA 3GUCA 1PL0A 1S0UA 4G36A 5DWDA 5BXYA 4EPVA 1L9KA 2X9QA 4PNZA 1CLEA 1XDUA 2EBHX 2FSVA 3LNCA 3CURA 4F4IA 1T4CB 1FSZA 4U7FA 3E81A 3RGWS 2GYYA 1JKXA 5FCDA 2PU5A 3I0ZA 4JX9A 5K3FA 2O5VA 2Y77A 3C87A 2CFRA 3L49A 3UOGA 5CFMA 3RRZA 4CEJB 1S2MA 4U0KA 2QGFA 1PGQA 3B53X 2HQBA 4PZ0A 1ZH8A 2XQKA 3C6YA 3LP5A 3ILVA 3VVMA 5JS2A 2C4KA 1D7OA 3BXEA 2VTBA 4JELA 2YIDA 4UDOA 1WR8A 1NP3A 2F6RA 1NBOA 1L1EA 2Y1OA 2ZAMA 3ENNA 4DFDA 1N5RA 1MXFA 1YB7A 1A8HA 3BD9A 4HDOB 2RH5A 4KWCA 5CBKA 3B3QA 4WXMA 1HL3A 1H5QA 1GY8A 4YNBA 2IXDA 2DUJA 1YFKA 3HWWA 3MD9A 4PG6A 3QWAA 4FS3A 5FI3A 3QF4B 3WIDA 4HEA6 2HHHB 2Q5IA 4ZT2A 2FH5B 2Z4SA 4BKOA 3PVSA 5IC6A 4A6PA 3PQCA 1L1QA 2XAUA 1G3UA 3DFUA 2QN2A 4F11A 2Y4OA 1K0FA 2JI7A 5B1HA 2ETVA 2GRAA 1BFKA 1HDXA 1SVIA 2O57A 3GROA 3C39A 1CJUC 3ND8A 1FS6A 3QVXA 1RP7A 2P27A 4ZAFA 4EHLA 1JI3A 5D3KA 1XDGA 1TM7E 2HFKA 3K73O 1J39A 3R3SA 1ZMRA 1O0CA 3DYVA 1KJZA 4AYXA 1GEGA 2ZREA 1KSGA 2NSYA 3IB6A 1NONA 4OX9B 1TA0A 5I9BA 5EJ5A 3ET4A 1WHSA 2J3LA 1NF2A 2IY9A 4NYJQ 2QK4A 5LP1A 5EJMA 3N6RA 1AGNA 3GAMA 4CTMA 2OC9A 1F8FA 2WKSA 1G6OA 3AZQA 3CNOA 5SY9A 3LC1O 4RQBA 2XTNA 5E7IA 4Y2SA 5TPWA 3QFTA 3PT5A 4KL8S 4OHMA 1XMJA 1KI7A 3FYDA 3GCWA 4WXPA 1G8JA 4G4GA 1G3MA 4IVPA 3RC7A 4IVRA 4EW1A 1C9YA 4NE2A 3A28A 3M6VA 4JT4A 5J63A 1KYVA 3NIGB 3O38A 5JQGB 3CUTA 2I76A 5B2EA 1JLMA 5KJFA 4BNLA 3T0GA 3NM5A 5KTSA 1QYDA 3KT8A 3MUNA 4COOA 5C3MA 1KWKA 3NATA 5LSAA 1GUBA 2JIZA 5AW3A 1VGVA 2LDBA 4RLQA 1ORWA 1C50A 1KZYC 2VPZA 5H82A 4BWVA 4FFPA 1VHLA 5IAEA 1LZLA 3V33A 5I9TA 4AKIA 4FDTA 2QRPA 2AK2A 3IAFA 1F6WA 4EY4A 4IFIA 2VDUE 5C1DA 4LY3A 2QG4A 5J1TB 3DOHA 4IF4A 1P5JA 1X1QA 1ZM3A 1NU6A 2H2WA 1L4HA 4WK6A 2GNAA 4M87A 1RCFA 4U0JA 1BH6A 2C82A 1C4XA 1Y63A 2X13A 4H9GA 4IY1A 1I7DA 4EX6A 4QOGA 1RQ7A 4JC0A 3V97A 2G4VA 1ULUA 4L8YA 1GV0A 1RWPA 5DTRA 4X8MA 3FBTA 3WJ1A 3HSYA 4RGYA 2I7VA 3EUAA 2OZKA 3IH5A 2P8JA 4KI0A 2YV4A 2H08A 2W70A 2NACA 3HRHA 3D1JA 3DZGA 2F43B 4D26A 2BZGA 3V6LA 2BCEA 1WD7A 5ES3A 2O3UA 1JHUA 2RJOA 3OIVA 1K6IA 1UK6A 3LTNC 2D06A 2GEFA 2QX7A 4NJEA 3TZKA 1O4WA 2ODAA 1PGOA 4BQNA 1SVSA 2O2JA 5IABA 2GF2A 1DI0A 1PTJA 2B4RO 2QLNA 1UJ6A 5L3QA 3HUEA 4IFEA 4IQ0A 1HTWA 2XZDA 1FFWA 1MF7A 3ED1A 2JB9A 1GSHA 2XYHA 2CNLA 4HB3A 1NUPA 2VSYA 2AVNA 2GUWA 5G0WA 4BU0A 3KJFA 2YQ5A 5IYZF 5J5CA 4BEVA 3K9NA 2Q9BA 3DXZA 3KJGA 1XZFA 3CKMA 3IBSA 3JRWA 2GFIA 3FKSD 4PZLA 4FIZA 2A9OA 4HEQA 4PAOA 1A9ZA 1JU4A 1RPNA 2V58A 3OECA 3Q4GA 4PQYA 2PRIA 3WQQA 4O4IB 3RYFB 5KKCA 4CQNA 3ZWOA 4PE5B 5D51S 4V0OA 1U0JA 1JSRA 1X1AA 1P2SA 3OCJA 3WMFA 1U8EA 4N48A 1RAHA 5C35A 5GZ3A 5EAIA 3CRRA 1P4SA 2BONA 3Q3IA 1TK2A 2FSUA 3GEPA 1HK7A 1P77A 3F47A 1LPMA 3NYWA 3AEXA 3DB2A 3TLCA 4BEJA 3KVVA 3RS5A 5FFMA 3O2NA 4IDAA 5AMXA 3BKXA 1NZFA 2CLSA 1M6NA 1P72A 3ADPA 3MWEA 2IY7A 2JS7A 4C4ZA 1M10A 2PYIA 3HYLA 1XKXA 4J0JA 3LPLA 5ALUA 3RUEA 4YR9A 4E4RA 1GKUB 2CDAA 3WGLA 1J09A 3R6DA 2B7CA 3QI7A 3ZGYA 2HF9A 3FTNA 4O25A 1MZVA 4NENA 2YXBA 2P9HA 2Q1WA 2J6IA 1FTSA 2R00A 3A4MA 1XZGA 2YVLA 2DHCA 3FOBA 1NSYA 2FSSA 3D4NA 3QI2A 5L3RA 4WLEA 4OQNA 3UYLA 3ROZA 4ZYLA 3HH8A 1YXMA 3WGOA 5GJBA 1T9KA 2B1RA 1MGPA 1NMXA 2XNCA 3KWJA 1J23A 3LUDA 1CS0B 3O91A 2JBWA 1AX9A 4MVJD 5AOBA 3WR5A 4EKIA 5BORA 2JFHA 4D0LB 4KR7A 1L5WA 4L4SA 4DMRA 2JFBA 2C0PA 4AUKA 1QE5A 2NG1A 1IC6A 1T6ZA 3P97A 3HJGA 1RU3A 4K0RA 3ZDRA 3NIWA 3SHWA 3ZIUA 1DTWB 1XVVA 3X1YA 5BR4A 4Q4JB 4GDMA 4PO3X 2ZSEA 2ZRFA 4P7JA 3UAYA 5BRJA 4DDVA 1X39A 1HNXB 1V95A 1BGVA 4NONA 4PPGA 3UJBA 3F5SA 3H2ZA 2DULA 3PGVA 4K6KA 2FLVA 3CLTD 2P68A 4JVNA 4KE9A 4QXRA 5AOVA 3DW3X 3ZDFA 2GK3A 2ZQYA 2FW7A 3JTMA 1KY5A 5ITZA 1CIVA 3FWNA 3HY3A 3S44A 2ZAIA 1W36B 1LLCA 2HU5A 1GPLA 3CUUA 3RGGA 4EB6B 4TV8B 4CL2A 1D8AA 1I6MA 2ZETA 1J07A 1AE1A 3TJZA 2GAAA 1WDMA 1USVA 4C4TA 4EI2A 4I1IA 1N4AA 2FOXA 1DC3A 5EYPA 1MB9A 2WE8A 3WL8A 1M5RA 1FW8A 5ALRA 3SF8B 3JWHA 4CWAA 4U2FA 5ANRB 1CUGA 4F91B 2J48A 5AKYA 3KIPA 4AT1A 3AOGA 2VYFA 2YC4C 4QVIA 1Y6ZA 3UTCA 2C94A 2HB6A 5A2QA 1RZUA 5LQSA 5A05A 2O2HA 4OQYA 3E84A 4FHCA 5LYYA 3W4JA 4B2YA 3CJQA 4JJ6A 2C5HA 4IXDA 4BMXA 5CM2Z 1N8SA 3F4BA 4I5EA 1YACA 3LUGA 3QBTA 4ZZ0A 4TZ0A 1W4AA 4YIKA 4WT7A 1MOPA 3C3YA 1FU8A 3DZCA 1T6YA 1P5FA 1W0JA 2A4KA 3PEFA 2IBTA 1Y3CE 2P6PA 1L2TA 3AR4A 4PLPA 4RY9A 3KQSA 4OOEA 2C9ZA 3PJEA 4HDRB 4X95A 5EFZA 1WU7A 3V3KA 4XD7D 4OHRA 4RJTA 1COWA 1Q1NA 4WLVA 3AU8A 2PZ8A 4YONB 3CR3C 3HVRA 3CZAA 4LMRA 1TW2A 2JFNA 1PYOA 2FZKA 1W35A 1BWSA 4ESVA 3BT7A 1DKPA 3DLCA 1QLWA 2GRUA 2K4MA 2XMDA 4RA6A 2YIJA 2GOYA 3F6CA 1NVVR 3FPBA 3K05A 5DHQA 1CTQA 3H5OA 3I64A 4G56A 2QQEA 2PKXA 1M75A 1CZHA 2VZ8A 2QORA 2VBCA 4MGYR 4WK4B 5K0LA 4WUVA 4MKGA 4LZAA 1E9AA 4PZDA 4W8OA 4JBHA 1SXPA 2WUVA 3COPA 3OOHA 3Q7EA 5EXEA 4DTCA 1OPXA 2G0NA 3EGWA 3MW8A 5BQOA 2BMFA 2B34A 2Q6KA 5DGXA 4BFZA 1ZH0A 4NMWA 2BT4A 3PIRA 3AIOA 4DCSA 3KLBA 3B6IA 3WADA 1EGMB 1ISSA 1U9IA 4R9NA 2CZCA 5KDOA 2O2SA 3RUHA 3EHEA 4UTRA 3VZDA 4GSKA 2M6LA 4MP6A 4BASA 1I6WA 3H2HA 5FORA 7ADHA 1MOQA 4M3NA 2O8NA 1T6NA 3Q1LA 3AJ9A 4JC8A 1QDEA 1HXHA 3MJFA 4A8JA 5K3EA 1G98A 2WM8A 3GI1A 3Q7IA 4HGZA 4ZYVA 3AVVA 1TMYA 4DEXA 5D5HA 3LF1A 4RIIA 2IYRA 2BGUA 2QB5A 1FVHA 3JAKA 3JZMA 3NHWA 4D3YA 3AKZA 4DC9A 3LT2A 3ZW7A 1V8DA 1X80B 3W2EA 1PJSA 4H59A 1KF0A 3ZWDA 5I7WA 1E2GA 5EEGA 2GXAA 4CEIA 3QXJA 3DBRA 1RKVA 3FMVA 4GRAA 3SJAA 3U7FB 1XN4A 2WI8A 4YIHA 3FNFA 2HH9A 4IUBS 5ICGA 2FP4B 4J4TA 1NAHA 4GKAA 2RHHA 1DO8A 1PK8A 1GCIA 4W7SA 4DPKA 5ALVA 1RD4A 1PL6A 4R5MA 1V1JA 5IM5A 1IZZA 2FX5A 3PEWA 4XB1A 2GZ1A 4CG0A 1UBEA 3L0OA 3S1LA 3U3OA 2F64A 1NW7A 3KXKA 4UREA 5LCXA 2CUKA 4GWKA 4XYGA 2BHTA 3M9WA 3AVTA 1NN1A 1Z6TA 4B09A 1C0LA 1SXJC 2GILA 2PAAA 2RHBA 3FGNA 1AHHA 1OZHA 3K5WA 2BEJA 5CU7A 3KUXA 4ARZA 5DW0A 2WWRA 3JYQA 1M2OA 5EJ4A 2DRIA 3WGMA 1DRVA 4LSWA 4PCUA 4CDGA 1RRMA 1Y9DA 3VTZA 2H4YA 1V6SA 4RDHA 1P61B 4KLAA 1U2DC 1DPFA 1GRVA 3MWYW 4YP0A 5D87A 1CNMA 1XDDA 3TW6A 3A2KA 4FB4A 2YV5A 2RARA 5TARA 5KWJA 1KH2A 1L8AA 2EKLA 4MUBA 2SCUB 1UM9B 3UWDA 2X3YA 1OWMA 1R5BA 4R68A 1M7HA 5AQEA 2I7TA 4OSOA 2ZE8A 2CBZA 2N75A 3N2GB 2CFSA 5CPBA 4CG2A 1ADGA 1LJUA 4ND8B 4B3BA 1G1MA 3GX1A 2PGOA 3R0IA 5G0UA 4CCYB 2N3ZA 3TJRA 4DV5B 3MJEA 5EJAA 3P4YA 3T7SA 3PUJA 2W48A 3EXIB 4WLNA 2QLLA 2P4HX 1PV2A 2R5WA 2P2ZA 4ZCSA 1DMSA 3U7QA 1U1DA 3T3IA 3KSBC 1ZITA 4JDPA 1R0SA 4YAFA 1I9GA 4K3VA 2PWZA 3OICA 4FWIB 2OG2A 1GTMA 1RVDA 3KKLA 1NJ1A 3DV9A 3SXUB 3EEQA 3M6AA 3ESYA 4CG1A 4XJSA 3P9QA 1J0EA 3ZU2A 4DYHA 2VPWA 1W85A 1BCSB 2OCAA 5F5NA 2YIVX 4MITA 5BWLA 2N1BA 2LVBA 5A4FS 4KK4A 1HZZA 2W6CX 3G0DA 1IEVA 4J16A 4PXSA 2JF0A 4HYTA 4RVUA 5IBRA 1SOUA 3FCAA 1GCAA 1YZ3A 5J4VA 2KJQA 3G9TA 1U1IA 3PENA 4RSGA 1GIAA 1TUIA 4CL8A 1Y9AA 2A9KA 1SNYA 5EHGA 1ZW1A 3FXAA 1MQSA 1V1RA 3DOCA 3ANLA 4KX3A 2OXIA 2V7VA 4FE7A 2G83A 2W2VA 2YUIA 3A2MA 3K6KA 4MW2A 4LRSB 1UJ2A 3S8YA 1XTSA 3IBCA 4ZRMA 4AWXA 5JXIA 3VYRB 2P41A 1YJAA 1J1IA 1THZA 4KX5A 2WTBA 4K9QA 2IHKA 3AR8A 2VNSA 4AD8A 2P3OA 2ZWVA 3IKVA 3TEMA 1SC9A 3ZCTA 1FRFS 1N2HA 4ZO6A 3R3XA 4ZVVA 3WWZA 1JR6A 1JDNA 4BPBA 2QUIA 2Z6VA 3EIEA 1MT0A 3OH8A 1WD5A 1BX3A 2XXJA 4JI7B 1BG6A 2O0LA 1Z0IA 1G41A 3Q3CA 4OMDA 3PTLA 1ADCA 4R16A 2I7DA 4WADA 2BBWA 4HN4B 4RSRA 4OA8A 2BTQA 2IWRA 3N28A 4L2IB 1ODKA 1TC2A 4ZJYA 4YB8A 3VTFA 2RHGB 1O96A 4Z3OA 2GBCA 1N6IA 3FMOB 4YQYA 2O54A 1G1AA 1GCOA 3OQHA 4QOSA 1XU4A 1RTKA 2XXAB 221PA 1TFUA 3P94A 4RO0A 1X7DA 1XDSA 2Z58A 5JO0A 5FOWA 4XYLA 1ABFA 2DMRA 2XYQA 2EAUA 5AP9A 4FUQA 4GI1A 1XQXA 3E8MA 1CJBA 1U7PA 3HA7A 1GJRA 1FA9A 3OQ1A 3P20A 3BPSA 4R8MA 2J87A 2JBAA 2ZBPA 1LDGA 1K06A 2CXRA 3ZNOA 2GQ0A 4B3XA 2DKOA 3L6UA 4WZBB 5KSYA 2WJZB 3Q87B 3L82B 2AKAB 3RKUA 1ZOPA 2J9XB 4WJKB 5IH7A 3C6BA 3KT0A 2BGIA 3LBIA 4R83A 4TTTS 1ZN8A 4Q48A 4RVCA 3ZUPA 4C0QC 1EK2A 1LPAB 5FNVF 3WB2A 2H17A 2HADA 1N3IA 2ZOSA 3IUYA 4E2YA 2O05A 3ICQB 2NX2A 1K98A 1YJQA 4NV0A 3KU1A 3PUYA 5I4BA 3AKYA 2QSYA 2DT5A 5ARCA 2DQ4A 5LMUB 5ALJA 2GBFA 1HF3A 2C0QA 1GGKA 1ZJZA 2J6HA 4KW7A 2X1LA 1V4VA 1ZJYA 4FQ8A 3GH1A 2ZWPA 5DB4A 1XRLA 2JFUA 4RY2A 1XUOA 3AEKB 4Q82A 1CWUA 2IZ1A 4N6NA 5J2UA 4OAQA 2J5XA 4BMPB 1H3EA 3VKUA 4G1FA 2PXXA 3S2ZA 4ZMBA 1LY1A 3L8MA 1KIFA 1K2VN 1X9IA 1HV8A 3L6DA 1C1DB 1QQ5A 2PSEA 2QE7D 2XZTA 4Z4QA 3ET5A 1CS4C 4HUTA 5KSZA 1UODA 3RYHB 4B6OA 2ZJOA 5AJUA 5L4NA 3DF7A 3M82A 3R5JA 4YT5A 2C3YA 4PZCA 1E3DA 3IP3A 1QHIA 2QGNA 2FW0A 4Q9HA 4XM0A 4BFUA 4UTPA 4XOUA 1V5IA 4WUTA 4J90A 1E69A 3SXPA 721PA 3VH4A 2NNWB 3TMYA 3Q8WA 3DMGA 3GT3A 1NDHA 4RANA 2QTFA 3QUSA 3ORQA 5DBEX 2DBQA 4LOAA 3P2KA 5EZSA 1EGQA 1YFZA 3PITA 4H1VA 4Y1RB 1SEPA 4PLZA 3TLJA 3WK5A 1RS0A 2Y9MB 4QOEA 5KQGA 3PTAA 3L9XA 4LBWA 5ICSA 4ZPXA 2Z2IA 3G7SA 3GYGA 1NE7A 1NBME 3RRBA 3QEKA 5LDDC 1P1IA 3L18A 3TW8A 3I9V1 2VFAA 1QU2A 3HC7A 1IG3A 1Y1SA 1W5SA 2ZUDA 5CDYA 3R7WB 4REMA 1ECFA 1XB2A 1TTTA 1W1UA 3GLUA 1K92A 5F3RA 4B48A 4CDRA 1CQIA 2CF6A 2OG1A 2HDOA 3O73A 2WJ3A 3NRCA 3E3MA 4P3PA 4ZZ3A 1JEYB 1F8GA 4AQYB 4HMOA 4MKZA 2O20A 4HDNB 1CUCA 1IOZA 3UJPA 3NV7A 3W06A 4Z4FA 1ZM4A 3WIOA 2Q7XA 3NBQA 4LF5B 3LUFA 1LSSA 5FL7A 3AR2A 2QIOA 3BBLA 4W7HA 1L7VC 1G64A 5AM5A 4IDNA 3BMCA 4F8EA 1U1GA 1KBOA 2CB0A 2WYWA 2I9PA 3DDHA 3P2MA 1FPQA 4S0XA 4EY8A 5KNBA 1B42A 4O4HA 2P0YA 4YJFB 4TLBA 4LJSA 2C84A 3K1AB 2EERA 2FPIA 3W9BA 5MDHA 6ABPA 2BEUB 1BX1A 2ILVA 1XAIA 1OKKA 1ZIOA 3FOAA 4YMUA 1T8YA 4YHHB 2C42A 2CJWB 1HQYE 5KNLA 3SLRA 3K2IA 1T2NA 2OT3B 2FG6C 5E9QA 3HVKA 1U4SA 4S3MA 1J4AA 3AI7A 3TLGA 1GPUA 4MRVA 3EVNA 1E20A 1US8B 2QAGA 3I2GA 3TQSA 4MUIA 1BDBA 1XX6A 2CYCA 1BN6A 1PFQA 1TUBB 5K0CA 2RGYA 1F6BA 3HKCA 4KFTA 3Q5EA 4N40A 5DYYA 3T9FA 4S05A 3KXPA 3P9RA 2FJUA 3DE1X 4I5IA 2ET6A 4YEDA 2I5PO 3WK4A 5JOQA 3CPHA 2P4SA 3C85A 2IYOA 1CZLA 3SOZA 1J0BA 1HRKA 1RADA 2J9FA 3MJRA 3CVVA 1D9XA 3TE7A 2I66A 1Y33E 3VU3A 3BJMA 3RVSA 1E2FA 4RK4A 3MYYA 3PWZA 1SPBS 1Z0JA 2GCOB 4QOHA 3FDXA 1GPBA 3WFZA 2NUTA 1P45A 1QPGA 2C4WA 2BFFA 2CMGA 1U0HC 4YRLA 3LNTA 2VATA 4BKUA 1TVEA 4I46A 1HFJA 3PEUA 4HQ0A 1BO6A 2X8BA 2IPOA 4R1TA 3FF4A 1UOQA 3RW9A 2P9ZA 1OFIA 1YCHA 1L9XA 3PYXA 3W8EA 1L4FA 5A4IS 4RTNA 3UIEA 2DKNA 4G0MA 3A06A 5EJ2A 4B33A 2XF8A 3LBNA 4Z7NB 5HOEA 3ZY6A 4FFDA 1U28A 4PC3A 3BRQA 1Y3HA 3E9CA 3ECAA 1WJGA 4HNSA 1MHTA 1NX9A 2HAEA 2V6IA 3ITEA 3P8ZA 4URXR 4HAZA 4LBYA 2DWOA 3VR3A 1P6UA 1U8YA 3I0NA 4V0QA 4DMGA 3C48A 5ERXA 1JT9A 1SWWA 4DVGA 5D6OA 1ONBA 2VUHB 4DWWA 5ECYA 1A9YA 1SFRA 4HL6A 4MMZB 4ZQBA 3PQ7A 4QBHA 1ZK1A 3O21A 1KAEA 1AY0A 4Z4IA 2O4UX 2G72A 3JVEA 3NXKA 3QMPA 4JS0A 3N8GA 4WEOA 4ZKEA 4HNVA 3SCZA 4G07A 4GAEA 4YYEA 2XKBA 4TYNA 3MTEA 1ISIA 5HFAA 4R7ZA 1Q20A 1RPJA 3ETEA 3KQNA 1VYTA 2O3JA 2P7HA 2WC1A 4XVHA 5A4KA 2Q3EA 2PYDA 2ZB8A 3RHTA 3A9RA 4MYSA 1OBOA 2V7TA 3P2IA 5I9NA 4Q1FA 1Q0PA 4LDAA 3TM4A 3A9SA 1GYQA 4EGAA 4RVHA 2IXEA 4YV1A 3G0OA 3U4HA 4FYXA 4P92A 3HY4A 2C20A 4ZJZA 3C5CA 1NBMA 1A04A 2JK1A 5AJXA 4WNAB 4YAOA 3I2FA 1AVTA 3IALA 3P0HA 4LE0A 4E46A 5A7GA 3ZVKA 1PO7A 4MAFA 3IDFA 4N0DA 1C1XA 1CQJB 1DSSG 1JHAA 4HG2A 3FGOA 1I5EA 5KYUB 2JFFA 4MRNA 1YCFA 3LX4A 3F9IA 5F51A 4PRZA 3N75A 3CWQA 4LAFA 2ZR0A 3G68A 2QTWB 3ZJYA 1MG5A 2OMEA 4L8VA 2JCVA 1L7BA 1Y4DE 1WU8A 2J31A 1GQFA 2Y1LA 4R2MA 5BSRA 3SR3A 4B3HA 3VOTA 1UDWA 3GO4A 4WLUA 2GZ3A 3VZCA 1QTNA 2PDAA 3EEOA 4IZIA 3OFKA 3WB0A 4MS4A 4ZEWA 3INRA 3WGHA 4NIMA 3MSCA 1OZFA 2D1YA 2GTIA 4OU5A 3UHAA 2QTLA 4KKXB 2B6HA 5BQXA 3EQ7A 2ZDHA 1VOTA 4CF5A 3RVBA 3A6KA 1KEWA 3I32A 1U2PA 1SKYE 5TGZA 3GP5A 5WRFA 3D0OA 2R6FA 4RDCA 1XAHA 2BC9A 4GX5A 5BN1A 1BVRA 5HSGA 5E1BA 3CS3A 2ZCJA 3I6IA 1JR4A 3VZPA 2EJUA 4C7VA 1W25A 4G85A 1A7AA 1NI4A 1KAGA 4UBLA 4W8HA 1JFFA 2XYRA 1N1EA 3UICA 3WWDA 1DEOA 4B3CA 1U9YA 1KS9A 4KOEC 3REOA 3AR5A 3QX9A 4CJXA 4F92B 1ZUWA 4K0KB 3HMKA 1HZJA 3A4VA 2ZR8A 3DM5A 3N87A 4U5XA 1Y1RA 3BZUA 4P4TA 3EZ2A 5A9SB 3KLNA 4BRWA 1YFLA 2BKLA 4FYYA 2Q28A 3RG2A 1JQBA 1TRHA 2QJTA 2H51A 1CUEA 2DFDA 1IG0A 1KDOA 3BK2A 5EKUA 1NN5A 1WZUA 4JYZA 4UKDA 2NTYC 4IJUA 4WNYA 1V43A 1GP2A 3TUJC 3E27A 4F1WA 1JWLA 2BRUA 3DZJA 1J8MF 3KQPA 4IDBA 5KOIA 3WRYC 2R11A 3AQ4A 1Q7TA 3NOXA 4IEIA 4MIEA 5D3QA 1KAMA 2VXYA 3HCWA 1A71A 4J0CA 5CX1B 1EAYA 3ED5A 5FTNA 4NZOA 3BDAA 4GOJA 1XZCA 4GKVA 1QH9A 1YIDA 2ZIXA 4PHTA 3UMSA 1NULA 2HV8A 2F8MA 3OCVA 2XQGA 4YJ3B 3BGDA 4E5YA 1FLNA 4R8VA 2YTZA 3QJ5A 4FC7A 3MIIA 5JRZA 3IKMB 1U8TA 2RGAA 1J97A 4GSLA 3T1TA 1ZI6A 1OFGA 3GNQA 3QG5A 2JATA 4DPLA 3KQMA 3Q3HA 3EGIA 4TMZA 3BMNA 3S2SA 1FYXA 4ZI2A 4UHKA 2HT6A 3R6LA 1ODLA 3FYTA 4JXZA 2DFVA 3K4HA 4IILA 2CXOA 1PZFA 3NTRA 3DP9A 2FUG1 4OBEA 1RHRA 2KLHA 1A97A 2IPAB 4XEHA 3RSOA 3C6QA 4CV2A 3SQWA 5JH7F 5IN5A 1Z12A 5EMHA 1EWQA 5LP6B 4GPTA 3K6SB 3BFPA 1BGWA 1S2IA 5BN3A 3R5XA 4FN5A 5CDFE 1XLVA 3NNNA 4DBVO 3N74A 4MRMB 1UDBA 5ALHA 2RGRA 4A92A 3CR8A 4CG3A 1CUIA 3ZDYB 4I9NA 4M22A 3R8CA 2IDMA 2B9EA 1QG6A 3EC2A 3IILA 3EWAA 4MR7A 2NVUB 2XRYA 3UJ6A 4XZ3A 3OTOB 2QZ9A 5LDHA 3F73A 2DTEA 3V80A 1PT9A 1IN7A 1FY2A 1IPHA 2Z4TA 3D3NA 4I8XA 4QOIA 1PJAA 3U3RA 4DVJA 4I1PA 2J5KA 1FX1A 2HYDA 3AB8A 5SYAA 3U3KA 3DUFA 3AJDA 1Q14A 3RUAA 2BBTA 4ONEA 5HQTA 2NO1A 2NZ8A 1Z28A 4JSRA 4KCGA 4U2BA 4RSMA 4X20A 3VSDA 1VHQA 4MKRA 1N2XA 2NQ8A 4ES6A 4HAXA 4CKZA 4BX9A 3IBYA 3FVQA 4Z53A 3GVXA 4IWYA 2F8TA 3NANA 4E21A 1Z2NX 2O