5FA8A

Sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
156
Chain Sequence
YVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title aKMT Catalyzes Extensive Protein Lysine Methylation in the Hyperthermophilic Archaeon Sulfolobus islandicus but is Dispensable for the Growth of the Organism
pubmed doi rcsb
source organism Sulfolobus islandicus (strain m.14.25 / kamchatka #1)
molecule tags Transferase
molecule keywords Ribosomal protein L11 methyltransferase, putative
total genus 49
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa8A00
2FPOA 4Y2HA 1QAQA 5GINE 1YZ3A 4FSXA 9MHTA 3TOSA 3DTNA 3AY0A 1EQAA 5JUWA 2P3QA 4YV1A 3B3GA 4KDRA 1INLA 5FWAA 5ICGA 4PONA 1N2XA 5CVVA 1RI5A 1ZGJA 3ANXA 3PT9A 5D1NA 1X1CA 3P9KA 4DMGA 2P3LA 3UZUA 1RI4A 3ORHA 5K01A 1X1AA 3OU7A 4FS8A 2QY6A 3DXZA 4GQBA 1G6Q1 4MHTA 1EIZA 3O7WA 4R8SA 3B7PA 2AOWA 3KQQA 3ERCA 5B1SA 4E31A 4GOOD 5CVDA 3P9IA 5EPEA 3LDGA 4ISCA 4ZTBA 5CCBA 1R00A 1FPQA 3FYDA 3G7UA 2P7IA 3NWBA 3MCTA 5LQKA 2JJQA 1AF7A 1UWVA 4IWNA 3P9CA 3PTAA 3HEMA 2E5WA 3G2PA 5EHIA 2FK8A 1YB2A 4YUZA 3DLIA 2ESRA 3HA5A 3KKZA 4FR0A 3AWIA 3LGAA 1JR4A 3LL7A 3LX6A 1N7IA 5GM1A 5EG5A 4RTLA 4ATNA 2VDWA 2HNKA 3OFJA 3G8BA 5T64A 3EVFA 3HA7A 3WSTA 2VDVE 1G55A 2I6GA 3EGEA 3QOWA 4PYNA 4GBED 5FADA 3CC8A 5LQRA 1XDZA 3A26A 5CD1A 2BR4A 2F8LA 1RI3A 3LPMA 3KQPA 1XCLA 2R3SA 3RIEA 4DCGA 2PWYA 2UYOA 4OBWA 3FTEA 3LCUA 1V39A 3IEIA 3UFBA 4HTFA 3MAGA 4PIPA 2XBMA 5EGSA 4E33A 3UBTA 3C6KA 3LECA 3L8DA 2EJTA 2NXNA 3SSMA 4MWZA 4EMSA 1R6AA 3R24A 4QPPA 1RI2A 1O9GA 2H1RA 4ER3A 2YXDA 4OX9Y 2O05A 4POOA 2AOUB 4QDJA 2H11A 2OKCA 5CVUA 3S68A 5EEGA 1VLMA 3HVKA 5EVJA 2OY0A 4KWCA 5CM2Z 4CTKA 4C07A 2ZZNA 1QYRA 2Z6QA 3FUVA 3DP7A 2BM9A 2JHAA 3A7DA 1XVAA 3FUUA 5EHGA 3KQYA 3I58A 3BGVA 2BH2A 4PGGA 3OZTA 1O54A 3EVBA 1RJFA 3ELDA 3PB3A 3UJDA 2GA9A 1M6YA 2B25A 4V0RA 3PLAE 4P7GA 2CL5A 2AOVA 2G8NA 4E32A 3B89A 3THRA 5HIJA 3FUXA 1KPIA 3BXOA 3NJRA 3O31A 5E8JA 4XUDA 4XUCA 2K4MA 3DULA 5D1HA 5ICFA 5K0EA 2Z6AA 1KXZA 4C03A 2AOTA 2ERCA 5LQNA 1YZHA 3I9FA 4PYMA 1KP9A 5FHRA 2GH1A 5G02A 3UJ7A 3GIWA 2WA1A 4IV8A 3DOUA 1XDSA 3BKXA 2VS1A 3MTEA 5CVJA 3V97A 4CKBA 4IV0A 2NNWB 2ZWAA 4XUEA 3G88A 4KIGA 5EMMA 5CUQA 5ICEA 3LDFA 2NP7A 1WXXA 1D2HA 5P8WA 8MHTA 2IPXA 4PYIA 3A27A 2CKDA 3GXOA 3HCFA 3NDIA 3P9NA 5HILA 3MGGA 4YV0A 2Z6UA 2XVAA 2ZFUA 3KPJA 4A6DA 4ER0A 4U7PB 3JWHA 3FRIA 4LWOA 2G1PA 1JG2A 4NECA 5EZQA 3C3YA 3HA3A 1NKVA 2AN3A 2YX1A 4E70A 5HIMA 1ZGAA 5U4XA 5EIWA 2FK7A 2B2CA 4X60A 4RTKA 1ORHA 2OZVA 4RVGA 2PGXA 3TLJA 1JTEA 4PIMA 3VSEA 3KU1A 4DCMA 4ER7A 1NW8A 1FP1D 4LG1A 3TFWA 5DRTA 3KQOA 5DTQA 4RTMA 3DR5A 3AXSA 1ZKDA 4DQ0A 2YUIA 3ID6C 2H00A 3FPGA 3HM2A 3CJQA 3M4XA 4GOLD 4GEKA 5EMKA 1DL5A 1X19A 3FTCA 2ONZA 4FSDA 3NVKI 1P1CA 1NV9A 3KR0A 4PNEA 5K0FA 4Z2YA 5EKXA 1L3IA 2O06A 3DUWA 2HTEA 3DXXA 1PRYA 3GRRA 3GRYA 4WVLA 3JWGA 5DM1A 3RODA 2O0LA 4QVKA 3UA4A 4YUWA 4P7FA 2P41A 3CBGA 3MTIA 5CCXA 3Q87B 5K0LA 1JSZA 2DULA 1D2CA 5E1MA 2PV0A 1SUSA 5DTMA 2PX4A 5E2BA 1RI1A 1XXLA 3FTDA 3PX3A 3BKWA 2NXJA 2O07A 3OPNA 3T0IA 4FZVA 3Q7EA 5K0CA 2PJDA 3GRVA 4AZSA 3DXYA 3G5TA 3NDJA 3NVMB 2ZWVA 5KQRA 1BC5A 4AX8A 1YFJA 5K09A 5HEKA 5K0NA 3AJDA 3EGVA 3OE5A 4K6MA 4X61A 1SKMA 4H0NA 2CMGA 3PX2A 5FUBA 5T67A 1ZHFA 4QTUB 2ZW9A 5DPMA 3G2MA 4KIFA 4PWYA 4C06A 4IKPA 1KPGA 1SQFA 1SQGA 3FTFA 1NBIA 2YR0A 1JG1A 3T7SA 4PYQA 2G72A 3DH0A 3EVCA 3LSTA 4FGZA 4F86A 4P58A 3UJCA 1WXWA 3SVZA 2UYHA 2CMHA 4RYLA 2Y1XA 2JH9A 5DRYA 2GLUA 2V7EA 1M0EA 1UIRA 2N47A 3UA3A 2EX4A 5JR3A 2IBTA 5EMJA 4E2ZA 2IBSA 2JH8A 2G70A 5DSXA 2PXCA 4Y30A 4YV2A 2UYCA 1TPYA 2R6ZA 3H2BA 1ZG3A 4HGZA 3KPYA 2AN5A 4PCLA 1BOOA 4RVFA 3EVZA 2ZIGA 5EQJB 5GP1A 3BT7A 1F38A 3GO4A 2FHPA 4O29A 3AXTA 4QQKA 1O9HA 2ZBQA 4WXHA 3PFGA 5HOQA 2AVDA 4DA4A 4F85A 3KQTA 2EG5A 3TKYA 2ZBPA 4R8RA 2G71A 1AV6A 2IIPA 5E1OA 2IDJA 3HVHA 1JQDA 5FA5A 1H1DA 4U7TB 3PFHA 3NW9A 4EK9A 2PX8A 4F84A 2OO3A 1XTPA 5IKMA 1WY7A 2ONYA 3OCJA 3P2EA 3M6UA 1JG3A 2Y1WA 5BXYA 5K05A 3KR9A 3VYWA 3KHKA 1F3LA 2OXTA 3GDHA 3GGDA 3P2KA 5C9ZA 5KS2A 2IDKA 3G8AA 3KPUA 3UWPA 3MHTA 3C0KA 4R05A 1NV8A 4BP3A 5KQSA 3OZSA 4HGYA 4RVHA 5K8VA 4M37A 4DZRA 3FZGA 4AZVA 5HFJA 1TW2A 2PX2A 4KVZA 3HVJA 3O4FA 4GOND 3M33A 3UJ8A 5FA8A 2OPBA 3SGLA 1X1BA 4X1OA 5LQCA 3NTVA 1PJZA 4CWAA 1X1DA 2YQZA 3IHTA 1G8SA 4MIKA 4QQNA 3ME5A 1BKYA 2AOTB 2GS9A 2PBFA 4M7RA 4RTRA 2ADMA 2ZVJA 2FRXA 4RSRA 5E9JA 3R6TA 2HR1A 2HWKA 3MQ2A 5IH3A 4EKGA 1AQJA 1VIDA 3KPWA 3NWEA 3OE4A 1VQ1A 3VC2A 2AZTA 1BHJA 3GNLA 1TW3A 2GAFA 3FPEA 3FPHA 1RJDA 2B78A 4GC9A 4PYOA 3SM3A 3ER9A 5EKUA 2ZULA 3CGGA 4RTPA 2Q41A 2NP6A 4P7KA 5KYGA 5KVAA 3LBFA 5GOZA 1EG2A 2HV9A 5DXJA 5GIOE 4YMGA 2GPYA 3B3JA 3EEOA 2C7QA 3GRZA 2PLWA 3GWZA 1I9GA 3TKAA 1NT2A 2IH2A 3TPZA 5FHQA 3EGIA 3KR2A 2ZCJA 5HZMA 3LKZA 3OU6A 2ZSUA 1RJGA 3VC1A 3BGIA 3F4KA 3LBYA 2PT6A 4E2YA 1AQIA 5E2AA 3EEYA 4BLWA 4DF3A 1QAOA 2O57A 1Q0TA 2QE6A 1I1NA 1ZQ9A 2AVNA 4KW7A 4X63A 5FQNA 5FQOA 5FULA 1VP9A 4YUVA 3A4TA 4ER6A 5E1BA 3R0QA 3NMUF 1EJ0A 3SSOA 1G38A 3OU2A 5F2NA 2PXAA 3LHDA 3HCBA 3MB5A 4C04A 3T7TA 4C08A 3PS9A 1VBFA 2PXXA 1KPHA 4FP9A 3BWCA 5K0BA 3ER8A 1B42A 1MHTA 3EMBA 5CIYA 1EAMA 4M38A 1L1EA 4B17A 1QANA 3HNRA 5E8RA 5BW4A 3KQWA 1NE2A 1OR8A 2XYRA 4LWPA 3KPVA 4BLVA 1FBNA 2BR5A 1I4WA 5K03A 4R6XA 2PWPA 4RX1A 3KQSA 4HRAA 4HSGA 2IFTA 4FT2A 1SG9A 10MHA 1VE3A 1IY9A 5FCDA 5HIIA 2XYQA 3SSNA 3UJ6A 1HNNA 3HP7A 3HCEA 5DX1A 1VPTA 2PX5A 3P8ZA 5EZSA 5LSAA 1WS6A 2DPMA 2JHCA 3A25A 2PY6A 4E2WA 3CVOA 3MCZA 3UJBA 1KHHA 2YTZA 1R8YA 2I7CA 3U81A 3MERA 5DM0A 2VP3A 3UJ9A 2JHPA 3I5UA 3BGDA 1D2GA 4HH4A 2OYRA 1YFLA 4LECA 5GM2A 5FTWA 5C1IA 5BP7A 3ELWA 4R6WA 3I53A 4RVDA 3LCVB 1XJ5A 3DMHA 3FRHA 3HCDA 3BWMA 2P35A 5E9WA 2B3TA 3EVAA 3TMAA 5DT2A 4HTFB 5ICCA 1JQ3A 3BWYA 5DXAA 3B5IA 2WK1A 3E23A 4QPNA 4GC5A 5F2OA 5EC8A 4DM3A 2P3OA 3CJRA 4MQ4A 4C4AA 2KW5A 3BZBA 3I64A 4OA5A 5F2KA 4AUKA 5LQAA 2IP2A 5GWXA 3EVEA 1M6EX 1SVUA 1VP3A 2NYUA 2VZ9A 1KIAA 3THSA 3TQSA 3R3HA 3SR4A 1IXKA 3TM4A 1DUSA 4QVGA 5DX8A 1KYWA 4AZWA 3CCFA 4BY9E 3P97A 4CTJA 4PYJA 4YUXA 3P71T 4DKJA 3JWJA 1SUIA 3G2QA 3ELYA 1VL5A 1R74A 1HMYA 2BR3A 3QOXA 4OBXA 4HC4A 3TR6A 4BP1A 5MHTA 1XDUA 3IYLW 4GF5A 5DLYA 2BZGA 2IH4A 2QRVB 3E05A 3KQMA 1KR5A 5EEHA 4M36A 1R18A 1JSXA 3SXJA 1WG8A 2QM3A 2C7PA 1IM8A 3DMFA 1YF3A 1NBHA 5T6BA 2AN4A 2VDUE 3G89A 2PT9A 3QV2A 5EOVA 3C6MA 5E1DA 3FUWA 3FYCA 2PSSA 5CVEA 1NW6A 2OB1A 4HG2A 5ERGB 2ZZKA 4MTLA 4YMHA 2BM8A 3BWBA 3M70A 3SMQA 1ORIA 3K6RA 2PVCA 3M6VA 2ZIEA 2C7RA 3REOA 5EIFA 2JG3A 3HTXA 2I9KA 4RTOA 2WA2A 4PGHA 4UOEA 3EMDA 3G2OA 3GRUA 4PYLA 2P1DA 4RTNA 5FWDA 5EMLA 4EKIA 3E7PA 3R9XB 2XVMA 4P7JA 5DWQA 1KYZA 5H02A 1JG4A 2AOUA 2IGTA 2AR0A 1DCTA 5HIKA 5K0JA 2ZBRA 5DTRA 1QZZA 3ELUA 2ZLBA 2EJUA 2ORED 1JQEA 3HVIA 4AZTA 2GB4A 2P7HA 5C0OE 3FPFA 5E9QA 3OZRA 2YXEA 2XYVA 3HCCA 4OQEA 3FUTA 4QTTB 2I62A 5GIPE 1Q0SA 5DM4A 5M5BA 3SX0A 3B3FA 4EVIA 3IV6A 1NW5A 1Z3CA 2FCAA 3KQVA 4OA8A 4RTJA 2ZZMA 4L7VA 3TM5A 2UZ4A 3C3PA 1N7JA 3LDUA 3D2LA 3KR1A 4FT4A 1UFKA 4G56A 4X41A 3X0DA 1G8AA 2B9EA 3EVDA 3P2IA 2NXCA 1R8XA 4CKCA 4RTSA 3EVGA 4EQZA 3GCZA 4JXJA 2CWWA 4QDKA 4C05A 1L9KA 3E8SA 1G60A 4RV9A 7MHTA 2QYOA 2C7OA 5LR6A 1QAMA 4A6EA 4PCAA 2YXLA 5DX0A 2IH5A 1WZNA 3HCAA 4KRGA 3V8VA 5LQUA 3PVCA 1U2ZA 5LQJA 4XCXA 2NXEA 3K0BA 3EPPA 3DLCA 2ZTHA 5DM2A 3GU3A 4PINA 4E30A 2P40A 4ER5A 4YUYA 3RW9A 2HMYB 1NW7A 3M6WA 4GUAA 3OFKA 3CKKA 2QRVA 2YVLA 3GJYA 4CKEA 2A14A 4PYKA 2P8JA 1JTFA 3G5LA 2OBFA 3LCCA 4E2XA 4RTQA 2UYQA 1P1BA 2OB2A 4CXMA 1L3CA 1FP2A 1L3BA 3A7EA 2AS0A 1Y8CA 4RWZA 3M6XA 5BW5A 3T7RA 4V0QA 1EJ6A 3FPJA 2AOXA 3DMGA 1P39A 1XCJA 2ZIFA 3TRKA 2FYTA 2V74B 4GOMD 4BLUA 1YUBA 3CJTA 4KDCA 5K0GA 1RJEA 2EFJA 1T43A 1NW3A 1P91A 1MJFA 2PKWA 3BUSA 3JWIA 5DSTA 1FJXA 3UJAA 2LD4A 4OQDA 3LKDA
chains in the Genus database with same CATH superfamily
2DG2A 1X7GA 3GFQA 3TW0A 1SOVA 2J9ZB 3NALA 1M34A 1T1IA 1JR6A 1UMDA 1FUUA 1DKUA 2GRUA 2PSEA 2WDZA 1Z17A 3NPMA 4GMXA 4RKWA 3KFLA 4UJ5A 3UMJA 4FGUA 2Z2YA 5FI1B 1Q7EA 4Q4JB 2DPXA 3IIMA 4MR7B 1HE5A 3EXHA 4Q3BA 1F7UA 2WOOA 2A0YA 1MZVA 2YHAA 5HCUA 3JV7A 3RUPA 4FJ0A 1JE0A 4V0MA 4MYSA 4FZ3A 4LHSA 4YMIA 1BGXT 1KO5A 4O4LB 4IO1A 3RRMA 4B32A 1KQFA 3EPHA 3EG9A 3HN6A 1HL3A 1EIZA 1Y98A 2ONKA 1HEUA 1A27A 1R0BA 2XY4A 1W9MA 4C4PA 2VCYA 4TLAA 1IQPA 3OFVA 5ER6A 3RAJA 4B83A 2GFQA 1E6CA 4WQMA 1XVLA 2XA2A 2JJQA 1AF7A 4ND2A 1IUOA 1TEVA 3COZA 2O8CA 3FCAA 2FK8A 2J5KA 5EHIA 3OQPA 3FGOA 1S2LA 3KDPA 4GYJA 2YV3A 2ZGVA 3HA5A 4OEHA 2A3RA 2GAIA 4P86A 1FW6A 1LB1B 3EBPA 3IRUA 1SUCA 3OMWA 2R1ZA 2B1RA 1E9RA 2X8WA 1SCUA 1SUBA 2IYSA 2Y0EA 4GBED 3NIFB 4INPA 1M73E 2ILTA 1XN1A 5EFOA 4LK3A 2CXHA 4DLLA 1FS4A 2VYVA 1MAAA 3REFA 2B7CA 2VG8A 2ARKA 4PAMA 4FUQA 1V37A 3GVCA 3BILA 4IP0A 3HU1A 4GM1A 3RREA 3F6EX 4GR5A 5AJUA 2O2CA 1ADFA 5BWCA 4CF7A 1EX7A 3IDOA 3OUUA 4J07A 4WBNB 5TS3A 4EJSA 4MQEB 3PXUA 5A5DA 3IUQA 3I6BA 3PK0A 4G1BA 1RTKA 2IUYA 2QUAA 3R09A 1UPTA 4CQJA 5GZ1A 3I6MA 3RB8A 2D4HA 1QFSA 3IMFA 1EP1B 1P9WA 4DHEA 3FSGD 1K6EA 4XGRA 1GUFA 5JJLA 4QPPA 3FKSA 3RJTA 4RY9A 1ZS9A 4KWCA 3R7DA 1O6FA 1PZGA 2JLUA 1SCDA 4D7AA 2YRWA 3GLTA 2CL0X 1E98A 2B61A 3HXLA 3R44A 2RGRA 4Z0NA 1L5GB 5EHGA 2QNBA 2ABWA 3OZTA 3VDNB 1O6GA 5KVQA 4OUDB 1QONA 3PKIA 1FNCA 1T1EA 4M0EA 3A36A 2FUNB 5ERYA 1AZSC 4ZXFA 5IT4A 4UUNA 1VYHA 3ZKWB 1P2TA 4M49A 4MUKA 3UAVA 3VNUA 1O97C 2K4MA 1OLOA 3NS7A 3AHGA 1KXZA 4C03A 5AW8A 3L7OA 4KE9A 4HPWA 1VIMA 3AR7A 3GIWA 1JF8A 4YP6A 1B8OA 4L3WA 4Y2XA 5CVJA 1OILA 4BE7B 2PUFA 3PYMA 2IWHA 4AZ0B 5EE5B 2WZBA 2A1IA 5ECGC 2JJ2A 3FCUB 3OZFA 3AFMA 2FF5A 5TB5A 5HYVA 2GN2A 1U0OC 2C2ZA 3OAAA 4PYIA 5SY4A 1EWVA 1GY8A 2PH7A 1BFDA 3G2JA 4GU5A 4H1UA 5PGMA 2NU8B 3UWKA 4QG3A 3BA1A 1O0BA 2C42A 3QLEA 3I8OA 5FLKA 4BO8A 1NMSA 2G1PA 1MAWA 3EZ2A 4YX9A 3GH1A 5C4IA 4RGVA 5AWFC 2XYHA 3N2GA 3QKSB 1O5IA 4UOZA 2F55A 1NVWQ 2PGXA 3W3AA 3U3JA 5EYPB 1ACMA 1B26A 4BNHA 3B52X 2ZSBA 4A0HA 3VVLA 2G7ZA 3A2MA 3OKCA 3ZBQA 1B1CA 1DJOA 3UOGA 1QS0B 3DLBA 5EMKA 3V7NA 3HDVA 1C41A 2GLXA 2GSDA 1G41A 4PGMA 1GU7A 6AT1A 2BGJA 3HU2A 2H1SA 1K4KA 1AZTA 2V7UA 2O52A 3N8KA 4GZMA 1RQRA 3BBLA 4CG0A 4PG8A 3TF5A 1E7QA 3HDTA 2Z8YM 4FDTA 2J48A 4IKOA 1A50B 1XD2B 3HWWA 3COJA 2Y99A 4DHWA 2D1TA 4GKVA 2YHIA 1O57A 4MVJH 4JVSB 5CT8A 3EA4A 3OT4A 1V2HE 7REQA 1SUSA 2KLBA 1W2GA 4IIJF 4XWKA 4GGOA 2Q7XA 2PV7A 1QH8A 1T9CA 1NVTA 2Q1XA 4PRKA 3JZFA 4BWGA 3HXTA 1PT5A 3NANA 5A9SB 3CO0S 3NDJA 2ZWVA 3I9KA 3I76A 3DVAB 1J2EA 1GQQA 3MJCA 3BMNA 5K0NA 1TCVA 4LUCA 1HE2A 5P21A 3CE9A 2WKWA 7AT1A 5I5EA 3BWDD 3SQXA 4N0EA 3DDSA 5IDYA 1GTRA 1LV8A 4RDHA 3HY6A 5AVRA 2IYQA 1SU6A 1ZLXA 3JQBC 4P31A 1C3LA 1O6BA 3O83A 2Q4RA 3PQ7A 1T2VA 2G72A 4Q18A 5AUQA 5FD8A 3S2EA 3DMRA 1BE0A 4YMUA 5IT9A 3K70C 3BS4A 1SU4A 5K1ZA 4O5AA 3CZ4A 4H17A 3U3KA 1E92A 1OFTA 5FTJA 5ISMA 4U6NA 3CNEA 4REQA 4BV9A 1ZD4A 2JCSA 3ESBA 4F72A 3WAKA 5KTSA 2G0TA 2R6GA 4FXOA 4Q66C 5LVAA 2X0EA 4HGZA 1ZG3A 2IYAA 1NUPA 3LS2A 3RC7A 3COWA 4BFLA 1K5GA 5EQJB 3TEMA 1F38A 4FFVA 3S1SA 2AKYA 3PL5A 1O9HA 2WHPA 4GOXA 4QRHA 3ROZA 4F12A 2BGUA 2O7RA 1ZH6A 4DA4A 5BMVF 3TKYA 2I1VB 4QWMA 5DN6A 2C5SA 4EUNA 2PUBA 2XUIA 1HQKA 1FFCA 2IIPA 2X41A 2BEWA 1LVGA 2W70A 1MB9A 3HWSA 4RQAA 4N8DA 3MMZA 4HAIA 1A4UA 2RI6A 3UC5A 1LS1A 1ZN9A 1JHQA 3L3BA 4HPJB 4RPGA 4ALKA 2H1IA 3UUGA 3L84A 5BQXA 4FNOA 5JNWA 1TYAE 2HCBA 1C3XA 1SBQA 2CDNA 2VIIA 4NV0A 5GGXA 1N0VC 1I3OA 4XJSA 4RVCA 5J43A 3GGDA 1PD0A 5CYFA 1XCPA 4DJJA 1EMDA 3AVPA 3W5UA 3PR1A 2XTZA 4LQ4A 3U3ZA 3GDFA 4ZV9A 5A1TA 1WPRA 3IE2A 3LHIA 4HQLA 2AFHA 5JARA 4H0FA 3D8TA 5K5EA 3LBHA 4DZRA 3OFSA 2P1ZA 5C8YB 5I7HA 2HC9A 2JIZD 2PN1A 1E0DA 3R20A 1QOPB 4BGVA 2OPBA 3H2KA 3TG8A 2RGUA 2C98A 3OH8A 4J1QA 3NTVA 4NIMA 2OFPA 4ZQEA 4PHGA 1OFVA 4TWZA 4MH0R 1BKYA 3NHKA 4FX5A 5FUWA 3AYXB 1OX6A 1V43A 2YOFA 1MH1A 5LU8A 3I2KA 4AICA 4ZGWA 2ADMA 2FRXA 1YJBA 2IZ5A 5IF3A 2A58A 2AMLA 5B2EA 3L6RA 3O1IC 4YP7A 4YREA 4QUIA 1LNQA 4CM7A 1JIVA 3GNLA 1TW3A 2AWOA 1MUUA 2DHRA 2ZOSA 1H4VB 3FPEA 3OQIB 2DWPA 1ZXXA 1DQZA 4KJZA 2PZKA 1FRVA 4MMYB 3QP9A 3X1DA 1JLRA 2FVXA 3VHQA 1YOVA 4RM2A 3PQ5A 5KBYA 4TYWA 3VTFA 5DXJA 2AUTA 3DBRA 1T0UA 4D79A 4KSBA 1Z2NX 3TKAA 2IH2A 4ZVKA 4KQMA 3GELA 1Q0RA 3V2UA 4E51A 4G8DA 4EA7A 4JU8A 2GXQA 4AJHA 3GCGA 5D5PA 3FVVA 3FRJA 1K06A 5ILOA 1REQB 1KI2A 1U28A 4HWGA 5AI0A 4KWIA 4E5SA 3H9QA 1UWKA 3JY6A 5DISB 3RCBA 4ESEA 3RO7A 3F6RA 1UAAA 3A3KA 3DWGA 3H5VA 2NU9A 2PH3A 4TLLB 5TV2A 5ALLA 2HV8A 4MJ7A 2ICAA 3AUUA 1L4KA 4FR5A 1MN6A 3K1YA 1H9CA 1KVSA 4B17A 2RK4A 3FR7A 3MGBA 4K9OA 3X1YA 5BORA 3MUOA 1TUEA 2B8WA 4JIMA 2ZB8A 5NULA 1E1RD 2F1OA 1I4WA 2Y27A 3NKVA 4IJUA 4YBRA 4BMDA 2AW3A 4P3NA 2JAPA 5TLSA 2CXSA 3FPBA 3SYTA 5CFMA 5DNDA 1U0TA 3NR2A 1SFRA 5JDIC 5J4VA 2L17A 5LSAA 2Y1LA 1U8YA 2QMHA 4WJLA 5CDHA 2V98A 4K9SA 4MS3A 1TNDA 1QK4A 4FWBA 1V3TA 4ZCPA 1T3ZA 3TI9A 4V1CA 2VT3A 1R4AA 2G9VA 4GGMX 4R9NA 3RIGA 4O4JF 4B8WA 3A6LA 5JISA 1PSWA 3W06A 1YBVA 2SCUB 3JAWA 2RBKA 1WVGA 1KEEA 2JW5A 5H7XA 1UFQA 4DAOA 4B31A 3BJIC 1BNCA 2CNNA 3E82A 3PDWA 2NZWA 4IG9A 4Q16A 5KSPA 3RYCA 4HX5A 2G6TA 4CMJA 4YACA 1E1NA 2OCBA 4WZ6A 4XE5A 3F7MA 4JSYA 4XTCS 3LUKA 5IXYA 2PNJA 1M83A 3PD0A 1KMCA 1C7QA 1E5QA 3L77A 4P4SB 1IN4A 1CVIA 3PENA 2ZUTA 3JWEA 1CNMA 5ES4B 3LA8A 4F6RB 2WUDA 4UZFA 2HIGA 4MQ4A 3JCZA 1VKOA 2BEVB 5KNDA 1BROA 2ID4A 1BW9A 4JYPA 4KO4S 3SR4A 3GQVA 3HDHA 1ZJ4A 4XYGA 4CM9D 1YKSA 1KJWA 1NP3A 1X6VA 4MS1B 2DQYA 4YJGB 2AMVA 4W8HA 2ZVDA 2YZ2A 4W5TA 4RD1A 3LBAA 3K9LA 5KKNB 1CF4A 1Q1AA 4Z99A 3O3OB 1ZCBA 5JS1A 4FINA 2BR3A 2I76A 2QX6A 1W0KA 1Z6PA 2RC6A 2YRFA 2AZMA 3EISA 3PHHA 2J3IA 4BEVA 1DXQA 1R18A 1UMBA 2AFRA 2RB4A 4LWQA 1IM8A 2GQ0A 3NH6A 5KDLA 2Y67A 1YRHA 3JQAA 4ZQGA 4TOIA 4BO9A 1LTHR 2COKA 1QVRA 2I78A 4QUGA 4Q9IA 5AVYA 1SK8A 2GJ4A 1C7EA 3JSAA 1YCHA 3QJYA 3VMFA 2MSCB 1KYIA 1BN6A 4EUHA 2PEZA 2NUTA 1E7WA 3FFWA 3ICOA 2JJ1D 3LPAA 3HFSA 1C7JA 2C7RA 3MBKA 1N6PA 3CNBA 3UB2A 2BUAA 2V9ZA 4IAOA 4XQ9A 5CGZA 5EIFA 1K08A 1WP4A 4ZOLF 2N1MA 1KHTA 1USGA 2CD7A 3GRUA 4JUCA 1BX3A 4RF5A 2GWRA 3MLBA 3A10A 4RXTA 4WW0A 4CT0A 1RXUA 1N0IA 4D3FA 5CEEA 5IDXA 1T1RA 4QJBA 1JG4A 2DUUA 5H02A 5LC1A 1TPZA 3D6TB 1JIQA 3S7ZA 3SKXA 3AT1A 4C7VA 5CA1B 3K5HA 3DS8A 2YY7A 3QA3E 5K0JA 3IO5A 3S40A 3RIMA 1TYCA 3HVIA 2H1OA 1FRZA 4HUTA 2HXSA 5C0OE 3VPGA 3ZGXA 1Y7PA 2QF7A 1XA0A 3QPDA 2GCOA 1RRCA 3OCXA 1IIRA 1LLUA 1WW8A 5C52B 5I8WA 2ZJ1A 2JIZA 3OA2A 4U9IS 3TW6A 4HH1A 4BQQA 3VU1A 3T34A 5JAOA 1OZAA 4KHPB 1A7JA 4UE3S 5DSZA 5J2TA 3JU3A 3RC9A 2J3LA 1E2IA 2EDCA 1G8AA 3D2CA 1QIDA 3PC7A 3QBVA 3M3PA 1UJ6A 3OIWA 3ETHA 4GS5A 2IXDA 4JL5A 4L5BA 3T3EA 4C0SA 1XFDA 2EFDB 2GEJA 3P20A 1TEXA 1EQUA 3CE6A 1P17A 3WNCA 5EFZA 2H17A 1GN8A 3KX2A 1F2DA 5A5FA 2C7OA 5A9TA 2C2HA 3WICA 4A6EA 4K2HA 5DHSA 2DY1A 4NWIA 4C2AA 4XSGA 1FZTA 3TS1A 2FQ1A 4GI5A 2F1HA 4HNHA 4ZAFA 4BBAA 3L07A 1SA0B 5C5DA 4X66B 2ZZNA 1RS0A 2BCJQ 5EJIA 2HEGA 4E30A 4F5ZA 4LY0A 4NYIQ 1UBOS 2HLDA 4PLZA 4O1HA 3RRFA 4DRYA 5KVSA 3GJYA 2MTBA 2OFOA 4AY5A 2ZJZA 2ZRGA 3L4BA 1A97A 3O03A 5T8KA 2UYGA 4UBJA 3RGWS 4NQZA 1Z8NA 1DQPA 5F64A 1SD1A 3K0EA 1ZYUA 3AX6A 2XB4A 5MN5A 1ZFNA 3FMFA 3MBOA 1OMOA 2GNPA 2QR5A 3OOWA 4DVGA 1Q1EA 1UP4A 1N0UA 2W2MA 1AGXA 2HDWA 3QXCA 3WIUA 4DDWA 5BW5A 2P9GA 2XF2A 5IJ9A 5J23A 1BMTA 4PZEA 1FTWA 1UEJA 2X58A 5D7NA 5DTIA 1RJ9A 3LOQA 1P91A 1VHLA 3JWIA 1WMAA 4C0WA 3FBWA 5J1SB 3AM4A 1FJXA 1A9YA 2QRPA 3QE9Y 3IUSA 1NI5A 4QQNA 1NN5A 5COAA 1HEIA 3OD1A 4MRPA 1E8NA 3WL6A 3QPCA 4DBLC 2YXBA 1AKTA 1KZ7B 1VPDA 2PGIA 3A9TA 1IMJA 2PG3A 3ZHTA 4HEQA 2NMVA 4O5OA 5EINA 2QW0X 1RW4A 3L8MA 3T94A 4DG9A 5JYEA 2FMUA 4EB6A 4JP1A 2VH1A 4A27A 2ZM6B 2BIFA 2P2ZA 3IILA 1ZWKA 3LYAA 3TZLA 2OC9A 4AULA 5J4KA 3FOCA 3D8BA 4DPKA 5CLLA 3O7WA 2PLAA 4URWR 3KQQA 2H5EA 2CSUA 4FYIA 1Z5UA 2PEYA 4TZKA 3HACA 1CZUA 1W8DA 3QVUA 1I7LA 4GBMA 2R4QA 5GJCA 3ESZA 3V1MA 5HRCA 5KINB 1G7SA 4DABA 2ZRNA 3IRVA 5FAXA 1L8OA 3LHFA 3CLRC 3SK0A 3ZHBA 1AKQA 4PQGA 3FTNA 1KZYC 1W36B 3KKZA 3U19A 3RQSA 1WW3A 2P2CA 1U7ZA 2J4CA 4IMRA 4OLJA 1Z36A 1QRAA 2F8TA 2XBUA 5BRNA 1S2GA 2AQIA 4X62B 3LVBA 3PWZA 5AHXA 5TQ2A 4AWAA 2HXYA 4DLAA 1IY0A 2PKQP 3KKPA 1HNZB 4R7TA 3RUCA 1DAFA 5FV7A 2WKSA 1TJ4A 2Q9BA 1IZ8A 1X3LA 2JLVA 4XYEA 3WV5A 2PZGA 2N9UA 3NONA 5A6SB 4K03A 3Q6MA 4QTXA 4M0CA 3UFBA 4RMNA 1GARA 2W4QA 3B8HA 4ZGGA 3S3TA 2WU3A 2I6XA 5IVPA 4I1YA 4MW4A 2VYCA 3I9JA 2RH5A 2XLCA 4FZRA 1SXIA 2HWWA 1XAIA 3CMCO 3OJXA 2TRSB 1KAEA 1VPEA 4PSCA 4AKTA 3GPDG 2FH5B 4AUNA 3TQCA 3GT3A 1L5SA 1JPNA 4G0PA 1JHOA 2YIVX 4D02A 4HB4A 3KVYA 3I0MA 1OI3A 2FDXA 2IOHA 3FUVA 3FYUB 1DUIA 1MIOA 2HHLA 3D6JA 3AIOA 2C5EA 2OQVA 5I48A 1E1QD 5MGNA 2ID9A 4BXOB 1GILA 5IYZF 3IO3A 4DNXA 1U5BA 4Z9XA 4Q01A 3UJDA 4CT5A 2WNIA 3DZGA 4KQHA 2WQZA 2CLOB 4P3YA 4NXNB 2MYPA 2O5CA 3BB3A 1P1KA 3UGTA 3G0GA 2CJWA 2I2BA 3BXOA 4F3RA 3MB8A 4J9VA 1L7AA 3DT6A 3GD7A 3CVJA 2FPKA 3PRYA 4QYWA 2AXNA 4ZYVA 1RHMA 4OREX 3JASB 3ZDYB 2J0SA 4X71A 1OTYA 4PFJA 4OSOA 2DT5A 4N12A 4RNDB 1YASA 5IHPA 1XZMA 1KBQA 3V8PA 4N41A 3TCKA 2MSLA 1JIXA 2OCXA 4KYTA 4C1BA 5C51B 2I4IA 1QG6A 1ECBA 2JK0A 3DBLA 4N5NA 5EZ6B 2H8KA 5I9LA 3TTYA 3FCSB 1HQYE 1XIVA 3M9LA 2E82A 1ML3A 2VK2A 1FXSA 3R2JA 5HILA 4ERNA 1P4JA 1J4AA 1E69A 1H2ZA 3AU9A 3KPJA 2I80A 3MAAC 1I5EA 2HBRA 1R4ZA 2I6TA 1EFRA 5FIUA 5KSZA 4Z4IA 4WKPA 3SYLA 3CZ9A 4HDMB 2VDKB 4W1RA 1N6HA 3OETA 2J0VA 1U1EA 3NHRA 3IJRA 1VKZA 5U4XA 4DV7B 2ZAOA 3NM6B 1O03A 4L5JA 4HNQA 1JTEA 2F3RA 3KU1A 3L0YA 3L1JA 5DYTA 1T3GA 1U1CA 5DGIA 3TFWA 3DR5A 3K4QA 4A1OA 1K7YA 1J7KA 2VUSA 2XTJA 4MITA 4QA9A 1TYEB 3CJQA 5FX2A 4F6RA 4NBKA 1IK6A 3SR3A 3W2GA 1MC4A 4FVTA 2P4HX 1ID8A 1WCWA 2L0XA 1R12A 4CKXA 4PZLA 1KO7A 1TYZA 4GX1A 1HTBA 1DC8A 4I5EA 2IS1A 1OC2A 4NENB 1B8PA 4JJFA 1WU7A 2QMOA 3ETNA 3ETJA 3IBSA 4DPLA 4AT1A 5C8YA 1P9RA 2WYUA 3GLHE 3QG1A 2OUKA 4KQXA 4FDUA 4KZKA 4NNJA 4TXHA 5TEWA 3LUHA 3QX8A 4RK7A 5K0CA 1UMBB 4G24A 2PGOA 2QYSA 1KVUA 1E9EA 1Q0QA 6Q21A 1H3FA 3TIXB 4DIDA 2VT2A 4HV4A 3OZ7A 4N6OA 3LT1A 2QJRA 3OJOA 1BAPA 3VPDA 2Z09A 3VV2A 1WDKA 4W5HA 3HABA 3FAKA 4BFWA 1QP8A 3IP8A 3AL3A 3BCSA 3HFGA 5FTNA 1W36D 2RAPA 3G9QA 2FGJA 4PBRA 4PQEA 1RP7A 2NU7B 3O8OB 2CVOA 4GL4A 5CVTA 3PF9A 2Z1DA 4NBNA 3V9AA 3QFRA 1KPGA 1GZHB 5EXSA 3QPWA 2G09A 1DSSG 4H3HB 2GXUA 4E6EA 5HS6A 2HA5A 3HXKA 1WXQA 5GAJA 3FOZA 4R98A 1WXWA 3SVZA 3QELB 3D0OA 1U3TA 1W36C 1CR1A 3NRJA 4BX8A 2OBMA 3IDZA 2QNRA 5TT1A 2DFVA 4AMVA 3QWIA 4XWYA 3AB8A 2PQ6A 2ZRHA 4MICA 3H42B 5FFNA 2G1KA 3R3WA 1EP9A 3A14A 5K8IA 1DNPA 2WPNA 3Q5EA 1LX7A 1E2NA 2FG5A 4H3SA 4I2VA 4I4IA 1ZINA 4IMPA 4O2BA 5TR9A 3GO4A 3W8FA 2FQWA 1XI2A 2J3DA 4QFMA 3PRHA 2IYXA 1DT5A 1AQYA 2C9OA 2AVDA 2BUBA 1ECGA 5DLEA 4I4TF 1F5SA 2PPVA 3A6EA 1NHWA 4LKRA 2PIAA 4OXNA 1DXYA 4PRLA 5G0VA 2DERA 1HI9A 2PXHA 1EBBA 1QVAA 3PYLA 4IGAA 3RYHA 2XCTB 4U7TB 1KIMA 3WTCA 4Q6BA 4EK9A 3MIIA 4KXVA 3K9BA 3O90A 4P38A 1FL9A 4W6ZA 1GTSA 1Y9ZA 3SCZA 3MN1A 2D1YA 4MJLA 3KLPX 3ZS8A 4CEIA 1E1MA 3AWDA 1NKSA 1JG3A 2OP0A 3L1VA 4IGKA 1AK9A 5BXYA 3L1HA 3S5JA 3UXYA 4YROA 2A1TS 4NOMA 1PGOA 2Z9CA 3ECSA 2EX1A 3TLCA 2IDKA 2PUJA 3G8AA 4Q4AA 3EZXA 4OLHA 4R05A 1B14A 1ZK4A 1H9AA 1UJ5A 2JEOA 2QTVB 4EI7A 4CQNA 3WC4A 2DKOA 4I81A 1HZJA 3RADC 5F7OA 1EP2B 1OXBB 4TTPA 4R81A 1WULS 3E3AA 2Q6VA 1V5FA 3D6AA 4FMPA 2EBWA 3MWDB 3RJ5A 1FF9A 1KDOA 3RSQA 2IZZA 4JBYA 5BWLA 1K8ZB 3S29A 1XMIA 2AC4A 4WEQA 3QSYA 1P80A 2QWXA 3LKVA 4WT7A 1MRSA 4R2XA 2WV9A 4RSRA 3ACBA 3R6TA 2B9VA 2J30A 2VHCA 2FXVA 3HS3A 3NWEA 3GP5A 3HADA 1D6NA 3ZU4A 1U31A 2JFPA 4YLEA 4GC9A 2B78A 2O8FB 2AYZA 1S4MA 3C3BA 4N3BA 5I9MA 3ZDFA 1DDGA 4NZYA 3I1FA 3E81A 5FL3A 3OEED 5FPPA 1OE0A 3BREA 5GZ3A 3MWEB 3JSXA 5H3LA 4TTTS 4F2WA 5KVAA 3INGA 3S70A 4XKJA 4AUMA 4RHCA 1GIAA 3NBQA 1G7TA 3U4MA 2WIFA 4YQEA 5BSUA 2FW1A 3ZJYA 1I30A 4LCEA 1QZXA 3UYKA 4B2YA 4C4YA 1X9IA 3F4KA 1GCOA 4G07A 2QTZA 5CJ2A 4E21A 2G5GX 1N6LA 1EFDN 1HLPA 4KVFA 1Q1BA 3IQDB 1E1CA 4BL5A 4HS4A 3GN2A 3I2FA 2FCRA 2R96A 4I4TB 4KW7A 3GEIA 4RA9B 1XMQB 4KWHA 1RQ2A 1ABFA 3R0QA 3S2YA 1SBYA 1NIJA 5KMGA 5F2NA 1XLTC 2Z30A 4YAEA 4POOA 2A5DA 1BDHA 2UU9B 3QBEA 3VZPA 3RVRA 1IAVA 2B21A 3ZK7A 2ZIXA 3G17A 3MT9A 3GZTB 4DJ5X 3IERA 4RF4A 1FVOA 1ULBA 3KQWA 1PG5A 2JI7A 2C7VA 3EPJA 2BCEA 4JI8B 1LSSA 2MSDB 4H0CA 4Q3LA 1IULA 2A9KA 3ZYZA 1B43A 2Q99A 4GMDA 3A2LA 3EQZA 3UJ6A 4F3NA 5AD1A 1E96A 5KWSA 2IYFA 2OBNA 3JD3A 1DE0A 4V2UA 3OJCA 3FHCB 3Q9NA 1S9DA 2GF2A 2IHJA 4HDKB 1ADBA 1EFCA 4IHJA 1A7AA 1IATA 5DNWA 2J3EA 4WFKA 3U56A 1E7MA 4PO1A 4Z4GA 1PG0A 3KTFA 3W8EA 1R4NB 3QVWA 2GDZA 4TS4A 4NG4A 5AKGA 5M7EA 4JR1A 3HCDA 5CT5A 1D2RA 3NTRA 3CU5A 3UXEA 3W2FA 4MV7A 2ZKLA 2FEMA 3EVAA 1XK7A 5HPYB 3WGLA 4HTFB 4KN5A 1I10A 3WNBA 2EWWA 1RR6A 4YRCA 3HKCB 1II9A 1R27A 5JO9A 2DWCA 3ROEA 4QPNA 3ZIUA 1Y3FE 2QXUA 1QDLB 2WHQA 3G0DA 5ALNA 5IUKC 1VE5A 2J87A 4PGFA 1QHEA 1I6WA 1QZUA 4MS3B 1D03A 4AUEA 3T1OA 3U31A 2WFMA 1XZLA 1OPXA 2FQQA 3ZQ6A 1KEKA 1IXKA 1QOZA 2QZSA 1TVKA 4QVGA 2VBGA 4YMVA 1I5RA 4JS0A 4O2AF 5JXWA 1AS0A 1U98A 2C0CA 1GNVA 1GCGA 1HQDA 2DRIA 4Q9JA 1AXRA 2JFUA 2POCA 2WD8A 1KBOA 1ZX1A 1GCAA 3AG5A 3M5PA 1YQEA 3G8YA 4H2DA 1GG2A 3CUWA 1IRXA 1UPFA 2QRVB 3HZOA 1DAOA 1E6LA 3GA0A 2P0AA 4OHCA 4YCNA 1NVFA 3LIIA 2ZU6A 1OLUA 4RQUA 3K9NA 4ARZA 1NPDA 2VDUE 3VV3A 2NUAB 3MELA 4BBPA 4ZJYA 2YWCA 2W83A 5M04A 2Z4TA 5D85A 4LE0A 1KS9A 1NW6A 3CWQA 4HG2A 2WRZA 1F1JA 3QRWA 1SZDA 2H1WA 5EWMA 3SMQA 1HZZC 4F6CA 4YMWA 1P5JA 4LC9A 5KYUB 4YJGA 4BLTA 1BO6A 5JD5A 3DEFA 4ZOEA 4PPGA 2V3VA 4UHDA 3BQNB 3V8EA 2YH2A 3HZRA 4NFLA 2A2ZA 1B2RA 3WLTA 1A5ZA 2HO4A 4UVEA 4WLVA 1DDIA 1TDJA 5ALPA 2Q3JA 1K0UA 2DUWA 1AKYA 1XP8A 5JYCA 3O8CA 2Q1UA 1ZOOA 5JO0A 3CRMA 2ACKA 1X70A 3ND6A 1N5JA 4MQFB 1MNAA 2W90A 5I4KA 4ZKDA 3LLSA 2AG6A 1NG9A 3QWHA 4HH3C 5E7JA 2A5JA 4EHAA 1H2XA 3C1AA 4OOEA 3ZCVA 4DV4B 1J21A 1KC1A 2PMBA 3G9UA 3HCCA 1U5BB 3E9EA 3PQFA 1AS2A 4XZ3A 3SX4A 5DO9A 4AECA 1GG8A 5AQEA 5FAKA 3RKUA 4L85A 1XWIA 3C5VA 3UT5B 2LIVA 4CLEA 2AN1A 1F8GA 2H31A 1Y8RB 4URUR 5DGHA 3KLNA 5F2EA 1WBBA 3JAKB 3EGXA 2CB0A 3VR2A 1B23P 3M1IA 3NGXA 4KXUA 4ZEXA 1V5EA 2C9BA 4JXJA 4S1OA 5AI5A 3HMQA 4EI8A 3SYMA 2FPLA 4BU1A 1VYTA 5DX0A 4F97A 4OYHA 3LHSA 4R7ZA 3MJHA 3RQIA 1TT5A 2GAOA 1GPKA 4XWGA 6ADHA 1Y1SA 2LCIA 3BK2A 4KEAA 3TFOA 2X23A 5GZ6A 2H1HA 4Y9RA 4YVFA 3P19A 1SVNA 2EP5A 3PWTA 1OBHA 4IIJA 3OFKA 4KRFA 2C54A 2GCNA 2VBCA 1AA6A 2DECA 1BRMA 1TZMA 3HJAA 1TUIA 1WIWA 4AMZA 1BZYA 4V0NA 3V8NA 2FOIA 2KJQA 5FL7D 1XEAA 2PGJA 4NDZA 2HEIA 1RABA 5L3ZA 3V5NA 3VJRA 1W48A 1VKHA 4HNRA 4C3UA 2VEDA 3GC6A 1RM0A 4IPTA 5L7TA 4L5CA 3JZIA 1PZFA 3K1ZA 4BLQA 1YRWA 3BORA 1C2YA 4V0QA 5BV8A 4MUNA 4DZZA 1W29A 1QPGA 2BZ1A 2JATA 3L7NA 3N7TA 3RRXA 5EIAA 4YMTA 5L51A 4O63O 3KAJA 2GZ1A 5HBGA 4FFOA 3GAAA 5SYNA 2P9BA 1P5FA 2PQ0A 4ALMA 4UZSA 3W5HA 1EBUA 1KQ3A 1E0AA 3CZAA 3PTZA 1A98A 4OQDA 2C4TA 2HPZA 4RSMA 1AV7A 1MFPA 3WK7A 1WXDA 2VR1A 1UC9A 1W9HA 2I99A 3A6JA 2PYIA 3A8TA 1JYEA 2WU0A 4JLMA 4QGHA 2WSLA 3TOSA 1XPUA 2QRLA 2BGMA 3A0UA 3ZHSA 2Q28A 2LW7A 2W43A 3PQ2A 1MTZA 2XKAA 1A0OA 3IP5A 5EIBC 4LNAA 4PONA 1JU4A 1DX6A 2YW9A 4Y1GA 1TZ2A 3WWCA 5JMTA 1JQKA 3TNFA 3DE1X 5JDCC 5ELLA 2Z1MA 3IUPA 1SEPA 4OU5A 1Y81A 3ADPA 3ZBTA 3NHWA 4EPTA 2A1UA 3IT2A 4UVGA 5IU6A 3GEEA 1LDGA 2QGNA 4N5IX 4CTMA 1N2ZA 4FUTA 3ZI0A 1NXSA 4BLPA 2ZBEA 2IOFA 4N4AA 1YR1A 4FI3C 4ZQFA 4XIYA 1KI8A 5JDIA 3ADKA 3DOHA 2G1AA 2G4VA 3FN4A 3CX3A 3H17A 3MCTA 3NM4A 4JEUA 4XOIA 1T5IA 1EXNA 2H7CA 3GJRA 4DQKA 2PZJA 4UDYX 3DB2A 4LFBB 3PEWA 3OM1A 2VRWA 4XWTA 5DV9A 4ENSA 2QVXX 1VL8A 2PZFA 2XVZA 1Z75A 3TOVA 3DEYX 1JAZA 1JSRA 2VRCA 3CURA 3C97A 3LTEA 3BIWA 5EZYB 6ABPA 4NX2A 2YIMA 5B58T 3D5TA 1RZUA 2VDVE 2EW1A 1R9GA 2DQZA 3UJPA 821PA 1ISFA 4LOIA 1LC0A 5CDFE 1PWXA 4WADA 3ZE9A 5A9RA 1E6MA 1K4YA 3H75A 2OCLA 3LPMA 1KQNA 3W1VA 4GNKA 4NE7A 3LVRE 4UU7A 2DBQA 2PWYA 2J41A 3C5HA 1KZHA 5JIBA 3NT2A 1V16B 2D5CA 4PY2A 3I6IA 4IEEA 1TQ6A 1FX0A 3IAHA 3SYRA 4Z2AA 3N58A 2CV2A 3MAJA 4C4SA 4LV5B 1PFVA 1LLQA 4X84A 4RACA 2UVDA 4MYRA 2OGTA 1Z5PA 2EHDA 1V41E 2VJBA 2Z5FA 3KVRA 2OORC 3NUGA 4S1TA 2QENA 3FA2A 5KTMA 3E9YA 3MWKA 1BHSA 3P9ZA 5FI5A 5JWHA 2QMYA 5DHFA 4CIVA 1ID1A 4PZCA 4CMCA 1WV0A 5A2GA 4L0MA 1FDIA 3KEFA 3GVHA 3HYRA 1LW7A 4WY5A 3CW8X 3LQFA 3MJDA 1YZYA 2HK8A 2WABA 4EHIA 4ZDKA 3PLNA 2Y9MB 1PJ3A 4QC2A 2ZYUX 4MUXA 5B6JA 3MPUA 2FFBA 2GA9A 2FZGA 2YWEA 2Y9PB 1OBCA 2HPHA 2QU7A 3C4JA 4NHEA 1D9ZA 2WOJA 2DMRA 1E4EA 4FQ7A 1Y4UA 4ZVTA 1NF3A 1U9YA 2C1EA 3CZRA 2AJLI 1EDDA 3HV0A 1N5LA 2JGMA 3M83A 4RAOA 4P92A 3ZVNA 1LNSA 4U2BA 5TPWA 4D0GA 5IASA 2AJDA 3KU4A 2JGEA 3M7IA 1N5OX 1UAGA 3RYFA 4I19A 1Z0JA 3VR1A 3HYSA 1G1AA 1STOA 4QATA 2P2LA 2X0DA 2H1FA 1U9ZA 3MTEA 5TXGA 4WKBA 5TVKA 3GRCA 4TMVA 3F73A 3GGGA 1RQPA 1XPJA 4FFSA 4CDMA 4V0ME 2KSQA 4BVEA 3G88A 1SBZA 1HETA 4OYYA 1BJTA 2NP7A 4JODA 2QA5A 1F2TB 4HHEA 4RPHA 5KTKA 2G9NA 2Z6UA 4WLOA 4ERXA 1P3JA 2ZFUA 3C98A 5CM9C 4N0DA 3GGOA 1N5RA 2Q4EA 1W88B 2NV2B 1U6JA 2OLJA 1C3EA 3G6KA 4XX1A 1QHGA 4WZBA 4BDTA 2E7ZA 1J00A 2YQ4A 5FORA 1RXVA 2L42A 1A1SA 5NLLA 1LY1A 1QYIA 4W1PA 3C1OA 5E6RB 3TLYA 1NW9B 4GMFA 4MHOA 4CU2A 4XVCA 1LPBB 4CMHA 1FP1D 1XXHB 5KEIA 1NJFA 5DRTA 4DSZA 1CUVA 2EP7A 3I6ZA 1OWNA 3MZ0A 4TXMA 2HDHA 2FPIA 2XE7A 1DO0A 3ZZUA 3HM2A 4E1BA 1KDRA 1ZNQO 2X8AA 1SIBE 3CPEA 1J5PA 2V8OA 4E5UA 5ITWA 4RMJA 3IQZA 5U4QA 5JADA 4YJ2F 2P9QA 2R5FA 4KUEA 3ZXSA 4F60A 1EM6A 2V0CA 3O8OA 1P44A 2IKSA 2XAAA 3QVLA 5EY5B 4RS4A 2EIXA 1EGQA 4IOMA 1NJ2A 1YQUA 1XMVA 1X7ZA 2O0LA 3O8QA 3FWPA 4PM4A 3WE7A 4EW6A 1NTRA 2DHEA 2W0MA 3P32A 1ZZGA 3GUCA 2AEMA 1ZNZA 1LJUA 4L74A 5MDHA 3FF1A 4EHKA 4RJIA 2YQ5A 4AG3A 3OJEA 2SKEA 4WNYA 5G4KA 3ZWQA 4B7UA 4WESB 3PGJA 1WOMA 2EARA 2G5PA 3COSA 3L18A 1P7WA 1U3WA 3WGVA 3RTAA 1EB9A 1Q3KA 2H2AA 3EWIA 3OM0A 4IIBA 3KOMA 2EZTA 3GVIA 1E20A 1U65A 721PA 1H8HA 3UFXB 2XNSA 3TQTA 5A03A 3NIGB 4HFJA 5HKKD 5I9NA 3EFOA 3SHTA 2D2FA 3HM9A 1O95C 4OMDA 1NULA 3GH3A 2EEZA 3RTDA 4JFRA 1U1DA 4JI5B 4OYLA 3LWDA 4L8GA 4XD2A 1YRBA 4KK4A 1PFYA 1EUDA 3N59A 1UM9A 1FJ2A 3IBYA 4RK0A 2I1LA 3B9BA 3I5AA 3Q3IA 2ZVPX 2ATXA 1DTWB 1W8IA 4M3NA 5BN1A 2Q1TA 1JECA 2N0SA 3DEKA 1F14A 1V1MB 5DRYA 2H29A 2ZYRA 1QQBA 1NVDA 1JR2A 4UNSA 5A3QA 5I7EA 4CM1A 2BH9A 2G70A 3W8DA 4C6TB 3ROMA 2BKXA 1Z7EA 2QL9A 4NJEB 3CNQS 4AURA 1JG6A 1CY4A 1Y6QA 4XFJA 1B2LA 4BVFA 4Z4CA 1BOOA 1E9DA 3PPIA 3E5HA 4RVFA 3WGJA 3CISA 3MCVA 1NYQA 1X8LA 2IYPA 4W5JA 4B6EA 2A94A 1OSNA 5DYIA 1PBTA 2C2KA 1F8UA 2ZBQA 5DW3A 3HKDA 5JZOA 1DJMA 1AV6A 4YEDA 4C21A 2QGFA 2QGZA 4DLZA 1TZJA 3H3JA 1MPTA 3AVXA 1WXEA 4X7RA 2CZGA 2V7QD 2AWNA 3WK9A 1CQJB 1B0PA 4YRPA 3T9EA 1WY7A 4HXFB 5HFNA 2W6OA 3RLIA 1JWAB 4ZMBA 1NDHA 1L5LA 2V7QA 2DUNA 1XCBA 3BXGA 3KFVA 3H1BA 4WK0B 3KR9A 5KTRA 3ENQA 5L4LA 3W7BA 3KHKA 3T9BA 5CB8A 3PE3A 4LVUA 5DNVA 4D46A 2HT1A 2G80A 2MWMA 3VRHA 4DR4B 2P68A 2P8SA 1AQNA 3RG8A 2DFPA 3D3EA 4BEJA 1JQLB 4RMHA 4TSRA 1A1VA 3O4FA 1SUFA 3A04A 3K0AB 3LYUA 4WXYB 5AKHA 4TTIA 1G5IA 4U7DA 2VQEB 4UBIA 1PJ8A 3CONA 1KAQA 2JFQA 3QBTA 2IEGA 3K70D 1ODTC 4N0PA 2CNWD 3DFUA 3RSGA 2VSOA 4O4HF 1Q5PA 5F5NA 5A4DA 4M7RA 4WNAB 2ZYTX 1EWRA 3C85A 1I4OA 1OW3B 1GTVA 3EA0A 1AQJA 4R83A 1TAUA 1J7JA 1DV2A 4EHHA 1HG1A 5LZ2A 1JMVA 4YPVA 1BHJA 5FH9A 3GEPA 3Q3GE 4WWHA 5F33A 4NOKA 4LOLA 3EAFA 3N6XA 4BO1A 2NO4A 1XHEA 1G6OA 1Q91A 3AF0A 1GSAA 1SXJC 4RBNA 1TRKA 4V38A 1LJ8A 4IDPA 3AR6A 2VNAA 2RK6A 5DHPA 5C3UA 4BMPB 3OPQA 1EG2A 4OQ4A 4JY7A 1OA0A 2GPYA 4ZZ2A 3N75A 1Y3DE 5D6OA 2JK1A 5DMHA 1ZIPA 2CLEB 3CVYA 2JS7A 1GZ7A 4RORA 2PSHA 2PQMA 1DOZA 2QG6A 1MQ8B 2UZ1A 4E0BA 2BFCB 3LWNA 1GV1A 2G83A 1QR2A 1CNEA 1Z7GA 3I39X 1ZNYA 5FQNA 3N6RA 1RWKA 1FSFA 2R44A 3EWAA 2X1MA 3L0CA 3S2SA 1KRHA 2WF9A 2XWPA 3BRWA 2BTQB 5JH7B 1FJGB 3OT1B 1TO6A 3A6FA 4QBHA 4AXBA 4PS0A 4HDQB 5E8RA 5IEBA 3CWZA 1GNPA 3RIXA 3BH7A 2C59A 2HRDA 1NE2A 1OR8A 2XYRA 4EQ6A 4AKGA 4IRXA 1X86B 3LK6A 1ZMTA 1U7HA 3BMCA 3RVLA 3B1KA 5BV1A 1TJNA 3WFIA 4KE7A 4K5QA 3WLMA 3W5AA 3KWMA 3ONWA 5DX1A 5LCXA 3OQ6A 3QBJA 4KR7A 4XVHA 5AMXA 3T4XA 4ZIRA 4WD3A 4QL3A 1H2WA 1IXRC 1ZIXA 1NWHA 2F6RA 2FU5C 2K2QB 3K16A 3REQA 1L5MA 1X0VA 2VRCD 4WBNA 4GEGA 2P9HA 5FFMA 2CNKA 2P69A 1E5TA 4TLCA 5IDQA 4TZ0A 1JGTA 3ANSA 2RHCA 1J70A 2GBLC 3OIUA 3ROGA 1FYXA 2IEAA 3M6AA 1ENPA 3KKNA 1JQAA 4B4DA 2E3JA 2ZIZA 3IAM6 5ESDA 1GADO 1VKJA 2FZCA 2XRFA 4Q1EA 1KWGA 3EXIA 2E5FA 1NF8A 2P35A 3A4LA 2ZQZA 3C8MA 3CA8A 3LQQA 3QPAA 1CJKC 4FCCA 5DT2A 1JQ3A 4HWPA 4E4TA 1KMIY 2KBFA 3FG9A 3ICWA 1E2DA 3PC3A 4HEHA 2NO6A 3D0KA 1GA6A 4OJNA 2DPLA 1FCJA 1Q19A 1E60A 5CLJA 5A0TA 1CJTC 2Z1NA 3ANMA 1M34E 3A31A 2PWZA 2PANA 2XIQA 4II2A 4MPDA 1KJ8A 4HUQB 3KAPA 2ZJ7A 5AKZA 2IY9A 3ASYA 1DUSA 1QTNA 5KYUA 4OP2A 1JT2A 1ST3A 4NQRA 3S1AB 1YTLA 3K5IA 3PC6A 4BZQA 3M5CA 3NATA 3ZKWA 3PF8A 1X8XA 3A6PC 1Z83A 4V24A 4LXHA 2AX3A 4I8XA 2XDQA 3IYLW 4DDKA 5CRIA 3TRJA 2O8BA 4BNKA 1FTSA 1OT5A 3RT7A 4C14A 5AUPB 2R68A 3BGOS 5EJEA 5CNJA 3DNMA 2Z83A 3A3OA 4BVAA 4CF4A 3TUZC 4RULA 3N6VA 4PF1A 1L5VA 2MU1A 2YZGA 4KI7A 4ZYLA 2EQBA 2WU4A 1SKBA 3RYFB 3VYTB 3KLBA 3IA2A 3QFTA 4EZIA 3R3JA 3PFBA 2N42A 4JLPA 4OCZA 3SQDA 1Y8ZA 2GXSA 4WSOA 4ZVNA 3ZHOA 4F9EA 3FBTA 4F2GA 5KJ6A 1FDOA 3DTYA 3WWZA 1ZOPA 2X22A 2B5OA 1P5HA 5IXJA 5D6NA 1WDLA 3UHJA 5DWQA 3G1UA 4HD8A 1I01A 4FB4A 1GD1O 4IIHA 2CUKA 1K0FA 1Q0PA 5DTRA 5FYQA 5K6AC 4ZO4A 1M6NA 1KDYA 1R3UA 2EJUA 3MYRA 3V6LA 2P7HA 4F9TA 3WL4A 2EP8A 3D4OA 3OI7A 1CV2A 4O3FA 4OHBA 3U48A 3VNRA 3VX4A 4ENVA 1JVBA 2Q6OA 4N01A 1Z73A 4QTTB 1RSZA 1E6WA 2HADA 1X7HA 5IAOA 2JC3A 5HQTA 1Z15A 2E6UX 1V95A 2PS9A 1NW5A 3HU5A 4YR9A 4Z53A 3IDFA 3ILYA 2CCJA 2X8LA 3O47A 4C88A 1PNQA 2ZQYA 1H8ED 3LW7A 2OWDA 2X1VA 3X0DA 3HCWA 3H2JA 4O0MA 4JVMA 4TGLA 2EAUA 2FKNA 4P93A 2YWBA 2NVOA 1K6XA 1R8XA 4P0TA 4RA6B 1L5WA 1UPBA 5DCYA 4A6PA 4BQRA 4PZYA 3BTVA 1MJGA 4UNIA 2EYUA 4AZ3A 1K8YB 3PQCA 5DNAA 1G60A 3S2ZA 1E9AA 2VTBA 5CITA 2UUBB 5JCOA 4QAJA 3AEKA 4QGAA 3RC3A 1Y4SA 3DBVO 3T54A 3DE3X 2R1VA 1ODFA 1OKKD 2WHXA 4RK6A 1MQSA 1RAIA 3WA6A 4JYMA 2O5EA 1ESMA 3WBFA 3T1YB 2Q50A 4MEAA 4AWBA 1K9SA 1SB9A 3D43A 4ZCQA 3V8QA 5TRTA 4MS1A 1AKVA 3JQ7A 4V39A 3EEQA 2XBLA 5MFPA 1GDDA 1VIVA 2PGLA 3HZHA 2DP4E 1EZZA 1ZIDA 4Q1BA 3CIOA 2BMVA 2I9PA 4DRXB 2PR2A 4ZREA 3KJNA 4H6PA 2F8SA 4WXPA 2X76A 4N65A 2PA3A 4DCCA 5JQGA 4FOSA 1WQ3A 4MQBA 1NI4B 4FU0A 4EATA 1SIUA 1M2OB 4X65B 3I37X 2UVQA 5LP6F 4FN4A 4C6HA 1ZJJA 3ZGYA 2GFIA 1KJIA 3WHIA 2BTOA 2VAMA 4QGGA 1TYBE 3PXDA 2E5LB 4NU6A 4WCDA 2QJTA 3QKTA 1U7WA 3RYIA 5F78A 5IKPA 1QCZA 4W99A 4ECEA 3UVEA 1YL5A 1JDNA 4FMCB 3CZ5A 4OXIA 3SOZA 4JAVC 5LXTA 5LM3A 1EESA 3G5MA 2FJ0A 3ZVLA 3B51X 3FBGA 5A62A 2PMFA 1MEOA 1TLLA 3MTGA 4Z5XA 5CAEA 1PJBA 1TRHA 2HRBA 4HQ0A 4TKMA 5D1NA 2BYTA 5G4KB 2VF7A 1SPBS 3CLKA 1EDBA 5I7SA 1PLJA 3C3DA 3EA5A 5JVDB 1EB8A 3T12A 4AQ7A 3AJ9A 3MQFA 1OBVA 1LF0A 1G6Q1 3DL4A 4DRXA 2I4TA 2MYTA 2P65A 2NG1A 3FB1A 4M7PA 3VOTA 3SF0A 5A02A 5K2OA 1FC0A 4E31A 2ZRDA 5EHZA 2MSWA 3P9IA 3JVVA 3QENA 4QU9A 4ISCA 5FL7A 4J7XA 3GLGE 1FPQA 4G36A 1PNRA 3KYCA 1LW6E 1QVWA 1UJBA 3PTAA 3MTJA 1CTQA 4MWOA 3BRQA 3G2PA 1OZGA 4DSAA 4IZOA 4DEYA 4PICA 2YIDA 3KHSA 3LRPA 3OWOA 3LQ4A 3L0DA 1P4SA 2ZE7A 3QK7A 3T3IA 3ESXA 4ZODA 1PDOA 5DLQC 5J9FA 3R9WA 1SCKA 1ZUD1 4KQ1A 4AJPA 2HGSA 4OQXA 4URHA 2VJCA 1IM2A 2X5XA 3KXKA 5EJFA 5ARDA 5I7OA 2G1UA 3T7DA 3D2BA 3TR0A 1EK1A 4EY8A 1O4VA 3D8UA 4OHZA 1L5HA 5CD1A 3GDGA 3U44A 1I3LA 1P6UA 1YVRA 3NAMA 5IMBA 4KQCA 1X14A 2G9QA 3X1WA 2DFLA 2INGX 1VBMA 2ZJ6A 4RO0A 4E5PA 3RROA 1D7AA 4HZUB 4HY3A 3FVQA 3ETGA 4G1UC 4BX2A 4PIPA 1SC6A 4L02A 3IIEA 3WVNA 1E64A 3LX5A 5KNCD 4DR1B 3RVNA 3PVSA 5K8TA 3HA2A 4KDEA 5TDHA 1T5DX 4FYJA 2R5WA 4ZAZA 3ABSB 2W71A 2XX3A 4CNQA 3I5XA 3NUZA 5AM3A 1TD9A 3TYXA 1R0XA 4RTSA 5KJ1A 3WLLA 2OY0A 2VNSA 4P54A 1HSZA 3QOYA 1G6KA 1N0HA 3HYNA 1QGOA 1CERA 1QYRA 4M0DA 4MA0A 1N5MA 2YRXA 4R2JA 3ZX5A 5EAIA 3NLLA 4D9MA 1XG5A 3LLMA 5AKEA 1ONPA 5I9BA 2WWVD 2VJYA 1UMCA 2QROA 4WA8A 5H3CA 1JLHA 3ZY4A 1H65A 1KI3A 4C7OA 2IL1A 4EHJA 1UQRA 1G19A 1P2DA 1DKPA 3QF7A 2YYAA 2C3YA 2PYZA 4E32A 1MJGM 5K0SA 4A0SA 4JI7B 1HDGO 2JI9A 4FHEA 3Q9LA 1AZLA 1YB1A 3R1IA 4PCUA 4RCZA 3HB4X 1LBTA 4U7GA 4LF4B 4MV6A 4DYVA 1KKLA 1LQTA 1HYBA 4EELA 2GJAA 1M9NA 4HDNA 3C7AA 1G2PA 5AR1A 2N46A 4TS3A 1E3LA 4L22A 1M7GA 1TKAA 3BA6A 3E9QA 1UBRS 3WK8A 1C4KA 2V5VA 2YWDA 1HPLA 4NR0A 1R8SA 1CR6A 4IV0A 5BN4B 3SEZA 4TV8F 1ZPDA 2OGWA 3DKIA 1RLTA 4QNNA 4C01A 4YJ3B 1R0SA 3DKRA 4IDFA 4XB6B 5EMMA 5CUQA 1PVVA 3LDFA 4MKRA 2E4XA 1SVIA 1IOLA 1DKRA 1F8XA 1NMQA 4FCVA 2GKGA 2OV3A 3FRIA 4LWOA 4M76B 3D54D 3G3EA 4LZAA 4Y6SA 4J7UA 4MR9B 3U7QB 1G3MA 3IT1A 3DOJA 2QZPA 2DKNA 3KXLA 1ESCA 1Y1QA 2VOJA 4NZ9A 4TYPA 1N6IA 1MO5A 5FT9A 3UAGA 4HLDA 1Y9JA 3VYRB 3JTEA 4GPTA 2GX6A 2JVIA 1QYXA 1HXHA 1YCDA 3QKRA 3ZDCA 5LP1A 4XRGA 1Y6JA 2GN4A 3IL2A 1YA4A 3DGEC 3I2IA 3VU9B 2DLCX 1YJXA 3FTCA 4WBXC 3JVDA 3T95A 3NVKI 1MQ9A 1NV9A 1GPLA 1G63A 2HUPA 1I2AA 3ZK8A 2AFHE 2AJBA 2MIIA 1UC5B 3NASA 3E9CA 3T1TA 2VT7A 4PVCA 2DFKB 4QVKA 5E4JA 3N5KA 2M1XA 1CDEA 3Q3EA 2VJLA 4G25A 4N54A 4P9NA 5K0LA 1C29B 4EDHA 3EDRA 2XJ4A 4EF4A 1UBCA 4QX6A 4TQUS 3WWYA 4DV5B 1CPYA 1ONOA 3OOHA 4J4HA 4NAVA 5LBUA 3UCXA 2ZPUA 1L5NA 3RU7A 4I50B 4RFSB 2QUJA 2NXJA 4DG5A 2IC5A 3K8OE 2FR8C 2R4UA 3AK4A 1F6DA 3LRTA 2HUNA 3BJEA 3DXYA 3G5TA 2GD0A 5ULLA 2FFQA 3TD2A 4EG3A 2RONA 4PO3X 2BF7A 4C0XA 2X2PA 1CUXA 1XTKA 1A8HA 2HYDA 4K6MA 1OZHA 1BKSB 4QUDA 4XIGS 1P0MA 3IPYA 2MINA 1NNEA 5K4AA 1ZHFA 3CRZA 1G2IA 1WB5A 3DCIA 2W37A 2FJPA 4PHTA 1UXIA 1XEXA 2FPXA 1U0NA 1FP6A 3AERA 2H3EA 4QIHA 3IUMA 2RCYA 1SQFA 4OF4A 1R0KA 4XM0A 3Q4GA 1NBIA 3K73O 4GSYA 4CM3A 1QRSA 1XC7A 3T7SA 3EVCA 4JVLA 1JKXA 1RYEA 1IBKB 2JNWA 1YV9A 3IOEA 3T3DA 2L19A 3AONB 4Z9FA 3Q8LA 4BFCA 4RYLA 2PDAA 4LA4A 4H6WA 4RMIA 5T57A 4EW1A 3B5EA 4P2BA 2OD7A 1Z0KA 4FYVA 3WGNA 1C3JA 3A4IA 3DOCA 4U2KA 4UHKA 5AM5A 3SE0A 4D45A 1P29A 2AN5A 5T4FA 2EF0A 2JGAA 4IYJA 4MYDA 3Q7TA 1IUNA 3AVOA 3KTDA 4LRYA 1Z2DA 2W8BB 3E7XA 5JCJD 2O5RA 4MW6A 4Z0PA 2AXEA 1M34B 4BNTA 3JVIA 4GXQA 1X1SA 4UULA 3WWOA 3OEEA 1PZEA 2PUCA 1TB4A 1QIJA 4JITA 2IDJA 5A3JA 1TQ8A 3WDMA 3VOAA 4N40A 3GFSA 1MFZA 2O1EA 3T52A 1XTSA 4Q37A 1H69A 3KWLA 4BNFA 2WB2A 3WQBA 3AP1A 3KWFA 3NHAA 4XX0A 2Y71A 1NBEA 2D1SA 1KKUA 3FSEA 1LZKA 3VYWA 1B7GO 1E62A 1O77A 4GLLA 2M2IA 2JLBA 3E9NA 2E37A 1D2MA 4HAZA 1BXGA 1U2DC 4G97A 4HLUC 2WJHA 2FG6C 2VHQA 3MHTA 1DAIA 2FZLA 1RBQA 4KVGA 1S8OA 4DDHA 4U0JA 3V4ZA 5DN6D 4DUYB 1WSWA 2XRZA 3DT9A 2FPPA 4KN6A 4NENA 3R4CA 1SUDA 3U13A 2VHEA 3ABOB 4RU1A 3N87A 2V6JA 3I4FA 3SGLA 4FM9A 4M22A 4TKZA 3BHIA 1G16A 4Q19A 1PJZA 3RUEA 2WI8A 1G8SA 4UE2A 5L3RA 2I3BA 5B37A 5AVKA 4YWHA 2O2JA 4XLZA 2B2NA 2AK3A 4WHMA 1MORA 1PQPA 5LZ9A 1DFIA 5E9JA 1WO8A 2BFBA 5HX7A 2JIDA 2ODTX 1JR3D 2R9VA 2FX5A 2Z04A 5BV2P 3AW8A 1ISRA 2IK8A 2GAFA 4M6WB 1L4GA 1SEVA 1P4RA 1E3TA 3MT7A 2CJYA 5LA6A 2WYHA 1N4AA 3W5VA 3FNRA 1UWCA 1G3UA 1P8AA 2NAPA 2DPYA 1J0AA 2JANA 2MYNA 2VAXA 1BXZA 1C4OA 1PUJA 2ZRCA 4E22A 3H5TA 3GRZA 3GWZA 1PIWA 1I9GA 4JB2A 1NT2A 4B3GA 2FUEA 4GKJB 3EGIA 1XD8A 5DBOA 3ROFA 3OEHD 2XNJA 2VPPA 2ATCA 4NE9A 3STWA 3VC1A 4D74A 4D80A 1IXSB 1F4PA 5BVHA 2VRBA 4IVNA 1E3IA 4UEWA 3TRIA 3K4HA 2QRKA 1IDOA 1QF6A 3CZMA 1UUFA 5IJ0B 1KMHB 4BLWA 1J0BA 3EIQA 2O57A 4OL9A 1K66A 1I1NA 1PD1A 3PJDA 2QR3A 1VP9A 2GBLA 2XWQA 3ZIAD 4EX7A 5AIBA 3UMGA 1H3EA 2HRCA 1I2DA 3P4YA 1J1IA 3DWFA 4J6FA 5AKJA 3REQB 2VPIA 1W46A 4L57A 2QW8A 4JA0A 2C4NA 3VR3A 3OX3A 4CIDA 3LG2A 2QP9X 3O4HA 1E2GA 2W22A 2BGNA 4HEA1 4Y2RA 1JXOA 3RVKA 3D0QA 4DKXA 2OHJA 3HNRA 1FLAA 1S0UA 2JH3A 4RABA 1OYVA 1NF9A 3HUTA 3MGKA 3AJAA 4WKNA 3EXEA 5JD6A 5ICSA 1L2TA 1YB6A 3E0QA 4X5OA 5CDSA 4EY3A 4HEA6 1Z5ZA 2B69A 2XYQA 1CQXA 3VR5D 3H7IA 5CDTA 3NUQA 1HNNA 3W3AD 2FHSA 2OM2A 4XIFA 1UFVA 3VR5H 1CQPA 1G8PA 3CS3A 4E5NA 1S2DA 2HRQA 4RCYA 2JAOA 2AGVA 4UOQA 5ALJA 1T9GS 2AKEA 2IYTA 1N6RA 1RU3A 1JA0A 4HSEA 3ROKA 4RIEA 1R5OA 1WMBA 1YMQA 4EVSA 3U7GA 4DLKA 4DL9A 3CH7A 1SVWA 1DX4A 3BGDA 3JQ8A 1N8NA 3LXRA 1GZSA 3OQ1A 1NBMA 5A7FA 1ESEA 5C5EA 3IUYA 3KZMA 3N2LA 2Q9UA 4MOWA 4Z54A 5BSGA 4JQCA 4EPVA 1Z4OA 1KMMA 4MRMB 4M55A 4RGBA 2D13A 2D5IA 3AJRA 3PHJA 3RTBA 1KK1A 3L4JA 2WILA 5F7JA 1K6JA 1OXVA 1YH3A 4IH1A 1VIYA 4M9XA 4U7FA 5DXAA 5BQ5A 2B8NA 1JFTA 3V4PB 3SZLA 1Y7HA 4ZDIA 2QSYA 4MWGA 5DEIA 3UAWA 4JJEA 3HDYA 3H2IA 1FYDA 2WUWE 3S1LA 4CMIA 3M6IA 1WLSA 3KKKA 3L43A 1V0JA 3ODGA 4DTCA 2CEAA 1UODA 3R3HA 2IPNA 2HY7A 1PP4A 2XNKA 5DX8A 2C77A 3TM4A 4YAGA 4ZHQB 3OTOB 1NVXQ 1JFRA 3PXBA 4HWOA 2GEVA 2NOAA 4JA2A 4ZRNA 4QUHA 1C3OB 2D2XA 2WR8A 1WHSB 3N1UA 3V4VB 3HEAA 3R5HA 2HQBA 2MOKA 4OBXA 3FCYA 4NS4A 4A8PA 3VSDA 3GRAA 4IGEA 3SN6A 2BZGA 1A4RA 1NJGA 2R6CA 4KQJA 4WUVA 3ZI4A 3IVCA 5BVGA 2ATIA 3VBEA 3S8EA 1W59A 4A5OA 1Z5GA 3RAGA 1NBHA 3IAS1 2LKCA 3R7WB 1DWQA 1QOQB 1TXGA 2X9VA 1G2OA 1V2GA 1EA5A 5IJWA 4RQTA 4C2BA 1EUDB 4JP3A 4ZOCA 4F1JA 1AJEA 2QTGA 3HJTA 4JX9A 3DF9A 4MI1A 4ZI3A 2W6CX 4BCCA 3NNDA 1ORIA 4LJ8A 4Q4HA 5EPUA 3JATB 1VSTA 3T7IA 4B6PA 3S81A 3KT8A 4MHSA 1T5OA 4RWEA 5DM60 3U4DA 1UBSB 4RH0A 5DM70 1K98A 4BS9A 1FFHA 2AFHB 3BCHA 2QD4A 2QMZA 4JBWA 4WE3A 3QXJA 5AM4A 3TD6A 5K51A 2WINI 1T6NA 2EBUA 2HBZA 1JKJA 1JDUA 2BGIA 2XUKA 2CFOA 4B6GA 1QZZA 2A6PA 3IAAA 5TPZA 1N8SA 1QE0A 4G5FA 3IMEA 4X1YA 3EZGA 1ONBA 3E9MA 1IQRA 1JJ7A 1G2QA 1E9VA 4CM4A 1P5ZB 3HBNA 4LEIA 4OIFA 2DQ4A 4D3DA 4G81A 4IM7A 2WSSD 4H77A 1Z0FA 4LBVA 4KPGA 5L45A 5GONF 1OA1A 3TM5A 1MCZA 3PXCX 3NDBB 1Q6YA 2EWMA 2W6PA 2CHUA 1SVOA 4EY5A 1PJ4A 2H52A 2QUZA 4QOHA 5FBZA 2CNOA 1LBSA 3GZNA 1TQ2A 1DJPA 2M98A 3UBMA 3BJZA 2NQTA 3E18A 3PRJA 4DDVA 3ED1A 4F5YA 1ZI6A 2PS1A 2IE0A 4D42A 5K45A 3HCAA 1FUKA 4P6VF 1YBMA 1A9PA 3UMSA 4D41A 3GWGA 3EODA 1IPEA 1HE1C 1ADJA 3FR8A 3VNSA 3W78A 1N5KA 1RHKA 1OGJA 3DLCA 2AEJA 2G9ZA 1IONA 3GU3A 3KTAA 4PINA 1E6KA 1Z0ZA 1J56A 1ISGA 5C8YF 2EKDA 4JB3A 5FI3A 5K6AA 1XZIA 3EASA 3FTPA 4QSHA 1TA4A 4CKEA 5AHKA 4OK6A 2A14A 2EKQA 1XTRA 4FR2A 2IKQA 1CY1A 4HFNA 4RKFA 1JTFA 3THXB 1T0BA 2JCYA 2Q46A 2XQVA 3PHCA 4OSEA 3VSAA 2IYUA 2FETA 2VHZA 4ON9A 5FOSA 1L5OA 4BGEA 2ZTVA 2O8VA 2WDPA 3N05A 4ETNA 1PUIA 3THYB 4IGIA 4JGBA 4MV4A 1JJAA 5KSYA 1EDZA 1UBUS 5E38A 1G7RA 1Y1LA 3LBIA 7ADHA 1OLUB 4OK3A 1WSBA 2ZSIA 1PS9A 2RBGA 3C87A 5KYTA 4J1TA 1S2OA 5IKXA 2BM1A 1HORA 2X6RA 4G2TA 3S6JA 1W7AA 3TIVA 3I0ZA 1CJUC 5ALUA 3SX2A 1ZUIA 1MJFA 2OR3A 2XECA 1UZMA 4LJ5A 2RHRA 5F52A 4Y6GB 3IQWA 5AVZA 5CURA 1II8B 1VC2A 2R00A 1GKUB 4Y2HA 4FNGA 5JLAA 1ILEA 4M8SA 3W5DA 1Q7TA 1TU0A 3OEYA 4TS1A 9MHTA 1DFHA 1DIHA 5AHOA 4LHYA 3D1VA 4FYKA 3RASA 4DUPA 3GLIB 3L49A 3ROTA 3ADCA 2JLYA 4JDPA 1C30A 1B8UA 2PT5A 1ACJA 3LC1O 4F8YA 1L7MA 1RBMA 1N2XA 2VBFA 3N3AC 5CVVA 1ZR2A 1O95D 3DZDA 3ANXA 1Y48E 1Y89A 2PD3A 4I99A 5TF4A 2XR1A 4DQDA 3T4UA 4KWEA 1FNBA 1T3TA 4MUYA 2OYCA 4R2IA 2X77A 1M54A 3RS9A 4R4JA 4GQBA 4RHXA 4XQGA 4MHTA 1NF2A 1HLFA 4QYIB 2GGSA 3LPDA 1KOGA 4MYCA 1QF7A 3ZV3A 4B0OA 4JI4B 4A36A 5EPEA 1VL2A 1A88A 4ZJPA 2B4TO 5L40A 3S8MA 1IBMB 1U2RA 2P7IA 3K53A 1U3VA 2HFKA 2CFSA 4HAVA 2XMZA 1M76A 4UM8B 4HN9A 2M6LA 3UOWA 3IBGA 2WIAA 2PCLA 1CQIB 3DTVD 4NCHA 4NDNE 4F0JA 3CUKA 3FM9A 3HCRA 1QWOA 4F7WA 4NAUA 3TZBA 3JQFA 2P9YA 4EFNA 1E89A 1MLDA 2BGKA 2HREA 2I22A 2PGNA 3EHDA 1I3CA 1JR4A 1ZONA 4KAJA 1BW9B 3D7SA 4L75A 5CCDA 4BX9A 1NSYA 1WZIA 5BWBA 3DLTA 1QJCA 3E35A 5AJTA 5DBHX 3SC3A 3QVKA 3GLGB 2C84A 1MNQA 1ZL2A 2Z3VA 2II6A 3DSRA 4H3KB 2XTAA 3QX7A 3GLIA 1GKKA 2AN9A 1GUAA 2HK9A 3CC8A 1MIHA 1JLLA 2IX9A 2P4SA 1UT8A 1C30B 2WFLA 2X15A 3VPBA 3H2HA 4KB5A 1LGYA 2H1VA 4LSWA 5JXGA 3O9VA 3KQPA 4RDXA 5BQOA 2WWHA 1IZ9A 5K0ZA 4NU5A 3RFTA 3FTEA 3BF7A 5FTMA 3QVVA 3LXUX 2ZYHA 3JQRA 1NUSA 2IBMA 4OXYA 4ZC8A 3HNOA 4H7JA 1II0A 4TV8A 1DZIA 2K87A 4TZTA 5EGSA 1PJTA 2OAGA 3IC5A 3L8DA 4MWZA 4CCSA 1R6AA 1YQQA 2YYSA 3R24A 4OFXA 4J0FA 1WCXA 2G4CA 2GPJA 4M9QA 5UKDA 1VLLA 2ZVQX 4RDCA 4BNZA 4JP2A 2JCVA 4QELA 3VQTA 1W35A 4R0VA 4BRUA 2BSQA 4NV1A 2IWRA 2SECE 3WIOA 3ZUGA 3KSDO 1ONSA 4QDTA 3S27A 1CUIA 5LB2A 5EZ5A 3DDUA 4NOLA 4HWSA 5KNBD 4QEKA 1W52X 1L8XA 3EIOA 1RYBA 1U0SY 3QTLA 1BS2A 3VZRA 4LI0A 1LV7A 3GEGA 3LY7A 3PNBA 3ZDRA 1T36A 2Y4OA 1RP1A 4GPZA 3VNBA 4DSOA 2NZ8A 4CKYA 2FFRA 2Q5CA 2GM3A 3LQ2A 1JW9B 3WDLA 4C0JA 3CR8A 1FVFA 3TK1A 6CHYA 4L4SA 2ENWA 1SXJD 2BCGY 2ODPA 2Q2WA 1UPAA 4OH1A 4RXUA 5G02A 3UW1A 1YR3A 2FDCA 3OC6A 1JFFB 1SXPA 2YUTA 1YK1A 2WHYA 1AS3A 3CUUA 3H5WA 1KERA 3RNLA 4IRMA 2PZEA 3DE7X 3H4TA 2QX9A 3PPYA 1FFXB 3HGQA 3PFKA 4JYZA 5GJWC 3T5DA 2FFJA 2X3YA 4FQ8A 1T8UA 2YHIB 4EAQA 1WXXA 4ZANA 1UMCB 3D6VA 1BU8A 3Q9SA 2J67A 4QBIA 2XADA 3T9AA 3ZI7A 7REQB 2BW0A 4CDRA 2HI0A 1TTHA 3P2JA 1H66A 1YI8A 2F90A 2J33A 2ETXA 3OHMA 4TMXA 2ADFA 1XL0A 4DYHA 4TN5A 4UTZA 3DPSA 2HA6A 2F3TA 3CKMA 4BTVA 1F60A 2I6SA 2XT0A 3PJFA 5LBTA 1ZD1A 2ZJ3A 3RIYA 1QMPA 4B5KA 1IEVA 1Y42X 1NT4A 2D2VA 2J59A 2JAWA 2XTMA 4FSHA 4IZ6A 1QPBA 3AXSA 5DI3A 3TR5A 3W34A 4IHJF 3ACDA 3U6KA 1VLJA 2VWQA 2Z8ZA 5LMZA 1TKBA 2ZR0A 1SBTA 3NP7A 4DMKA 4DBVO 3O8NA 3FLBA 1QHHA 2H18A 2DBZA 1X1RA 1FMLA 2Z0MA 4LJKA 5H5JA 3ZQUA 1P1CA 2IEIA 5DEOA 1KH3A 1S9HA 4M89A 4YRAA 5AK4A 1YZGA 5E3IA 5REQA 1JMKC 4OQNA 5IBQA 4QLOA 1NBWB 1CYDA 2AFIE 2FP4A 4WVLA 1TUBA 2GJSA 1L8LA 1BIFA 3MJEA 2P6OA 3MTIA 1FNNA 3ODPA 3QX9A 4XM1A 4CMIB 5CCXA 2QKYA 2GBPA 4ND4A 4D4MA 4EI2A 5AVTA 3TOXA 1BA3A 1I5OA 1KDVA 4BVLA 4OLAA 1KJJA 4FEYA 1Z8DA 1YGPA 2Q3FA 3OPNA 5T3UA 1GNRA 3HSKA 1GGMA 2H0AA 5DYGA 1UMKA 3TZEA 4AO8A 2NO9A 2Y6VA 3IVMA 1D04A 2XNHA 2XUOA 4TM8A 4AZSA 1GM5A 4P0PB 5H59A 2JAXA 3O75A 4GM4A 4QT4A 5E6RA 4F92B 1EJ2A 3FWNA 1O5OA 5AHWA 4D9FA 2PFSA 4IZHA 3N07A 4JXXA 4CU5A 1SURA 1L1RA 4AKEA 5DVZA 2FN4A 1R1DA