5FA8A

Sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
156
structure length
156
Chain Sequence
YVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title aKMT Catalyzes Extensive Protein Lysine Methylation in the Hyperthermophilic Archaeon Sulfolobus islandicus but is Dispensable for the Growth of the Organism
pubmed doi rcsb
source organism Sulfolobus islandicus (strain m.14.25 / kamchatka #1)
molecule tags Transferase
molecule keywords Ribosomal protein L11 methyltransferase, putative
total genus 49
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa8A00
3A4TA 3LX6A 3B5IA 2BR5A 3HVHA 4OA5A 3GU3A 5EZSA 3C3YA 2GA9A 2IP2A 3BUSA 3MCZA 1VL5A 4C08A 3HCBA 2IGTA 2VZ9A 5DXJA 1G8SA 4CKCA 3V97A 3FTEA 1PRYA 4RV9A 2V7EA 4YV1A 3OE5A 5ICEA 1NKVA 3B3FA 4MWZA 3HCFA 2PKWA 2VDVE 3K6RA 3R24A 5HIKA 5LQAA 2PBFA 3UA4A 2E5WA 3GXOA 2IH2A 3QOXA 1BC5A 3TPZA 1D2HA 3CJTA 2HWKA 4RX1A 4OA8A 2G1PA 5CUQA 1FPQA 1XTPA 3TQSA 1XDZA 1ZQ9A 1RJGA 3LBYA 3OCJA 3P9NA 3EVGA 2NXCA 2PXCA 3OFJA 1EJ6A 5DRTA 3UFBA 4RTQA 3C6MA 4YUWA 2QE6A 5IKMA 2XYQA 3T0IA 3EVCA 2I6GA 1TPYA 5K01A 4ER0A 1WZNA 4YMHA 1X1AA 3HA3A 5EIWA 1TW3A 2PWYA 3TR6A 3TMAA 4RTMA 3LSTA 3EMBA 3GRUA 4BP3A 2IBTA 4HG2A 3UJ6A 3M6XA 3HM2A 3M6VA 4RVHA 3M33A 5FA8A 5K0NA 5C0OE 1SUIA 3T7RA 4AZWA 2QM3A 5FWDA 3S68A 3TM4A 4E30A 4MIKA 2KW5A 3DOUA 5DXAA 2GLUA 4QDKA 3GRVA 2OYRA 3THSA 4F84A 4ER5A 4RTRA 3PT9A 1XJ5A 2PJDA 3UJ9A 4JXJA 4QVKA 5DX1A 3SSOA 5K0GA 2CKDA 2FHPA 2O57A 2AN3A 1NW6A 3NDIA 1H1DA 1EJ0A 2GS9A 2I7CA 3HVKA 5DTMA 2XYRA 1M0EA 1ORHA 5DX8A 4BLVA 1M6EX 5E1DA 2B3TA 3R9XB 1D2GA 10MHA 2CL5A 1X19A 4KW7A 3Q87B 4HH4A 4RYLA 1O54A 4ER3A 1KR5A 2YTZA 3PVCA 1D2CA 3FUUA 2DULA 2NNWB 4PONA 4V0QA 4ER6A 3PFGA 1RI2A 2O06A 3MTEA 3SVZA 5LQCA 2JH9A 3AJDA 1I1NA 4IWNA 4PYOA 5EEGA 2P1DA 1YFJA 1XVAA 5DX0A 2QYOA 5BXYA 3NVMB 3R0QA 4FSDA 2ESRA 3GDHA 4IV8A 3AXSA 4RVGA 5EKXA 3G5TA 2IH5A 3O4FA 4GEKA 5DM1A 3VC1A 3E23A 3DR5A 1SQGA 3UJ7A 5K0LA 1XDSA 5CVVA 1NE2A 4RWZA 5FQOA 1YFLA 3U81A 3GRZA 1AF7A 5KQSA 9MHTA 3C6KA 4MHTA 2G8NA 5EMMA 5EZQA 4RTLA 4FP9A 4MQ4A 3MERA 2CWWA 4OQEA 5E2BA 5CCXA 3KR1A 1WXWA 1AQJA 2WA1A 2BR3A 3KQSA 5D1NA 2PV0A 4LECA 1NBIA 4BLWA 2ZTHA 2G71A 5DSXA 4BP1A 5FCDA 3NW9A 3NVKI 4EMSA 4RTNA 1SQFA 3LBFA 1M6YA 5CM2Z 2R3SA 2ZSUA 2ADMA 2ZWVA 1R8XA 2PWPA 5EOVA 2JG3A 3JWJA 1NV9A 1HNNA 1QAMA 1WY7A 1KPGA 1QYRA 4XUCA 1UWVA 2P7HA 5EKUA 1JTFA 3DLIA 5DWQA 3B3JA 2IDJA 3ELWA 1G6Q1 4QPPA 3EEYA 3NDJA 1R00A 2PX5A 3BWCA 1IY9A 3UJDA 3HCCA 2H11A 2OB1A 2JHPA 2OZVA 1RI1A 4L7VA 2IDKA 3BWYA 1YZ3A 2AN4A 4E2WA 4H0NA 4BLUA 4RSRA 3UBTA 1HMYA 1NW5A 3KKZA 4FT4A 4U7TB 4M37A 3C0KA 1KPHA 2ONYA 2XYVA 4QVGA 2HV9A 2GPYA 1JQDA 3GIWA 3EGEA 3ME5A 2K4MA 3PS9A 3BKWA 1L3IA 4YV2A 1ZGAA 4PINA 5JUWA 4OX9Y 3SXJA 4E2ZA 1R74A 5E9WA 4R6XA 3DXYA 5K0EA 3GWZA 3KQOA 4FSXA 4WVLA 4YUXA 1QAOA 1P39A 2ZULA 3K0BA 3JWIA 4GQBA 3ERCA 3EVAA 1Z3CA 4KIFA 4QTTB 4AZVA 3FYDA 3IEIA 2AOUB 3B89A 1DL5A 2O0LA 5E8RA 5FA5A 4C07A 2OBFA 4FZVA 4OBWA 2PLWA 2JHAA 3FPJA 3G88A 3PX2A 3T7TA 3UJAA 4PIPA 3TRKA 3BWBA 3P9CA 4XCXA 1JSXA 3P2KA 2FYTA 3LDUA 5CIYA 2NXNA 4DCMA 1ZG3A 3FRIA 2ZFUA 5EIFA 1FP1D 3B7PA 4XUDA 4CXMA 5GIOE 5KYGA 3GRRA 3KQPA 4DZRA 4AZTA 1Y8CA 4EKGA 1L1EA 2OXTA 2OO3A 1MJFA 3X0DA 1BOOA 5LQNA 4HGYA 5K05A 4PCLA 2AOVA 1U2ZA 4X60A 2B9EA 2NP6A 3AXTA 3L8DA 3UA3A 5CVJA 2IFTA 4PNEA 3HA5A 4ISCA 2ZBQA 2UZ4A 2I9KA 2FCAA 5D1HA 2YUIA 5HFJA 2JH8A 4FT2A 3A25A 1EIZA 4CWAA 4EKIA 4FS8A 4O29A 1G38A 2FK7A 5DM2A 2V74B 2EFJA 2YR0A 1SKMA 1X1CA 2BR4A 2AVDA 5E1OA 7MHTA 2UYOA 2NXEA 1ORIA 1F3LA 1V39A 4KVZA 1JR4A 1JG4A 4QDJA 1BKYA 3DMGA 3LHDA 4POOA 2YXLA 4CKBA 2LD4A 1YB2A 2GH1A 5CD1A 3DULA 1JQ3A 3HP7A 3O7WA 5GM2A 2BZGA 3GO4A 4PGHA 3OZRA 1Q0SA 3G5LA 4KDCA 3SGLA 4EK9A 4PYJA 3MHTA 3M4XA 2EX4A 3B3GA 3KHKA 5LQJA 3LCCA 5HIJA 1MHTA 1G55A 5P8WA 4PYIA 4AUKA 3DMHA 3DUWA 3KPYA 3ORHA 1UFKA 2AOWA 3OU2A 5K0JA 4M36A 5K09A 2C7OA 3SR4A 3LCVB 2NP7A 5F2KA 4R6WA 3RODA 1XCJA 3HNRA 2GB4A 2Y1XA 4K6MA 5EHGA 3C3PA 5E8JA 5EEHA 5EG5A 5BW5A 5LSAA 5E9QA 3JWGA 2NYUA 3THRA 3CCFA 1WG8A 4PIMA 5FHQA 2IH4A 2G72A 3GRYA 3Q7EA 2B78A 2WK1A 4PGGA 5GINE 4BY9E 5LQRA 3KPJA 5CVUA 3BGDA 5T6BA 2PSSA 2P8JA 2H00A 3A7DA 2EG5A 4GC5A 5C1IA 5U4XA 2Z6UA 2VDWA 4P58A 1KPIA 3LCUA 3R3HA 2QRVB 1EG2A 5GIPE 1ZKDA 2AOTA 3HVJA 4MTLA 5H02A 3FTDA 1N7JA 1VQ1A 4YUZA 2P7IA 2ZZMA 3MB5A 2DPMA 3P97A 3E8SA 1L9KA 3HCAA 3HEMA 4EQZA 4KIGA 3BZBA 5C9ZA 1VE3A 2ZIGA 3EVFA 3KPUA 2UYCA 1KHHA 3ER9A 4XUEA 2JHCA 4KDRA 3FUXA 2ZBPA 1NW3A 1EAMA 3EVBA 3MQ2A 3BKXA 5FULA 2ZBRA 3I5UA 3LKZA 2C7PA 3MGGA 1I4WA 4FR0A 3OPNA 2AVNA 3TFWA 3A26A 3G89A 3KPVA 5FUBA 3OZSA 1AQIA 3LGAA 1KXZA 4ZTBA 2ZW9A 3KR9A 4NECA 2OY0A 2PXAA 2AN5A 1JG3A 1JG1A 3KQYA 3H2BA 4RTOA 1NBHA 3DTNA 4GUAA 3LKDA 3TLJA 2PX8A 5K0CA 1R18A 1QAQA 4E31A 2PVCA 5EGSA 4E70A 3ELYA 3G7UA 4IKPA 3KR2A 3IV6A 4R8SA 5LQKA 2HTEA 3D2LA 3LECA 2JJQA 3EVZA 5E1BA 3NWEA 3LPMA 5DPMA 3GJYA 3DXXA 3KQTA 3EVEA 4P7JA 4KRGA 3P9IA 1T43A 5K03A 4HTFA 1P1BA 4WXHA 5E9JA 4CTKA 1RI3A 5MHTA 3HCEA 5DTQA 2IIPA 5JR3A 1IXKA 5HILA 1O9GA 1OR8A 2VDUE 1BHJA 1YUBA 2I62A 2YQZA 3CKKA 3EVDA 3CJQA 1KP9A 2ORED 2CMHA 5ERGB 3I58A 2PGXA 4LWPA 5EQJB 3F4KA 4GOMD 4RTPA 4YMGA 2H1RA 3OU6A 2ZZKA 8MHTA 5KVAA 4DCGA 3DP7A 5K0BA 3BXOA 5ICFA 1WS6A 3KQQA 1JSZA 3EEOA 2AOUA 2ERCA 3DLCA 3GNLA 1NV8A 2IPXA 4LWOA 3SM3A 2XVAA 4X1OA 4F86A 2ZIEA 5DM4A 3UJCA 2R6ZA 2ZWAA 1O9HA 3SSNA 2IBSA 1FJXA 2VP3A 4GBED 1INLA 1VP9A 2HNKA 2O05A 3PB3A 4GOLD 3VC2A 4R05A 3HCDA 1WXXA 4HGZA 5HEKA 3RW9A 3BWMA 5B1SA 3LDFA 3P71T 3NMUF 3FPHA 3RIEA 5HIIA 4PYKA 4B17A 3KR0A 4CKEA 3KQMA 5GP1A 3GGDA 4RTKA 1IM8A 3NTVA 3UJBA 4QTUB 4DMGA 3G2QA 3FYCA 3I64A 1JQEA 2AOTB 2HMYB 3SSMA 3FRHA 4PCAA 3FPFA 2FRXA 3BGIA 2YX1A 5CVEA 3ELDA 1ZHFA 4OQDA 1JTEA 3ANXA 5GM1A 5E2AA 2Q41A 4X61A 3P9KA 4M7RA 1YZHA 3EPPA 1VP3A 3FUTA 4P7KA 4P7GA 5EMKA 5M5BA 5DT2A 3KU1A 5CCBA 2EJTA 4DA4A 1Q0TA 2WA2A 3EGIA 4LG1A 4Y2HA 5IH3A 4IV0A 3I53A 3OU7A 2OPBA 3JWHA 1SG9A 5BP7A 5LQUA 2YXDA 4UOEA 5ICCA 2Z6QA 2P40A 3TKAA 4A6EA 4C05A 1SVUA 2AZTA 5GWXA 4QPNA 1RJEA 4YV0A 3ELUA 4HTFB 3CGGA 1PJZA 1RJDA 5DRYA 2QY6A 3MTIA 5FWAA 1NW8A 5DTRA 5LR6A 1TW2A 3EGVA 3G2MA 3T7SA 4ATNA 3KQWA 4Y30A 3BGVA 2GAFA 2PX2A 4DM3A 5F2NA 4AZSA 4YUYA 2XBMA 1XXLA 3E7PA 3IYLW 3PX3A 4DF3A 5EVJA 3M70A 4RTSA 1AV6A 1F38A 5ICGA 3I9FA 1UIRA 3M6WA 3ID6C 5DSTA 3IHTA 4RTJA 3DXZA 5EMLA 2Y1WA 3R6TA 1KIAA 3EMDA 3G2PA 1SUSA 2N47A 2VS1A 4Z2YA 2ZZNA 4M38A 3AY0A 2O07A 2AOXA 3A27A 2BM9A 3PTAA 1XCLA 3OZTA 4OBXA 3GCZA 4HSGA 4U7PB 4V0RA 5E1MA 3CJRA 3FZGA 2B25A 2G70A 1L3CA 5DM0A 1FP2A 5HOQA 5KS2A 5K0FA 3TOSA 1DCTA 5G02A 1I9GA 1L3BA 4ER7A 2OB2A 3DMFA 1DUSA 2OKCA 2P41A 4DKJA 3TM5A 2Z6AA 3O31A 1VIDA 2PX4A 3E05A 3G8AA 3HA7A 3WSTA 4PYNA 2C7RA 2YXEA 2FK8A 2UYHA 1X1DA 3FUVA 5HIMA 3FPGA 4GOND 2P35A 1R6AA 5EPEA 2XVMA 2F8LA 3NWBA 4RVDA 3M6UA 3DH0A 4YUVA 4KWCA 4G56A 5F2OA 2A14A 2PY6A 1G8AA 4A6DA 3MCTA 3P2EA 2P3QA 3FUWA 3AWIA 3P8ZA 1QANA 4QQNA 1JG2A 4E32A 4RVFA 4DQ0A 2FPOA 4C06A 1RJFA 2P3LA 5FHRA 4EVIA 3VSEA 2NXJA 1NT2A 3UJ8A 4GOOD 3P2IA 5T67A 3BT7A 3MAGA 4GF5A 2EJUA 3REOA 4HC4A 1X1BA 4C04A 2P3OA 1YF3A 2CMGA 5EMJA 1VPTA 2ZCJA 5T64A 3FTFA 3ER8A 3PFHA 4R8RA 3OFKA 1VBFA 2QRVA 3A7EA 3LDGA 2PT6A 1P1CA 4HRAA 5K8VA 1P91A 1FBNA 3FTCA 4E2XA 5FADA 2PXXA 5EC8A 3LL7A 2UYQA 1G60A 2BM8A 3QOWA 3OE4A 2ZIFA 3NJRA 4AX8A 4F85A 4PWYA 5KQRA 2BH2A 1RI4A 5GOZA 3CC8A 1VLMA 2AS0A 2B2CA 4PYQA 1KYZA 1N7IA 1N2XA 2AR0A 3FPEA 3SMQA 2HR1A 3PLAE 1NW7A 4PYLA 4X41A 2ZVJA 5FQNA 2YVLA 3UZUA 2ZLBA 3SX0A 3V8VA 4E33A 3CVOA 3CBGA 4GC9A 4P7FA 5DLYA 3VYWA 3G2OA 1EQAA 3KQVA 4PYMA 3G8BA 1XDUA 3KPWA 3UWPA 4CTJA 4C03A 3HVIA 4X63A 4QQKA 2C7QA 5EHIA 4C4AA 1R8YA 1KYWA 1RI5A 2ONZA 3QV2A 4E2YA 1QZZA 3HTXA 5FTWA 5CVDA 3TKYA 5BW4A 2PT9A 5HZMA 4FGZA 1ZGJA 1B42A
chains in the Genus database with same CATH superfamily
2AHRA 3LLUA 4K9LA 3SXUB 4OI4A 3LDHA 2O4UX 1OH7A 3D6JA 1EVLA 3BHIA 4OHVA 4JLDA 3WFIA 5JPCA 3KAKA 4OHYA 1DCMA 1YR1A 2YV2A 1RRGA 1Z36A 5F64A 3ZDRA 1KOFA 2IRWA 4Y6QA 2J3HA 5ICEA 2G6TA 4Z4EA 3G68A 3K6RA 1A1SA 1M34A 4KN6A 4DG5A 5KNBH 3GXOA 4NS1A 2IH2A 4LEIA 3FPLA 2VSYA 3V48A 3RS7A 5DLDA 1RRMA 4EJSC 2VUTA 3MRSA 1GAXA 3J7TA 4O1IA 2C3YA 4B74A 4F93B 5DHRA 2E5LB 2V6IA 2WZBA 1RP7A 2V0GA 3UFBA 1ISSA 1XQWA 4ZYUA 1C9DB 1LPOA 3A1UA 1O97D 2VHTA 2ZOSA 5EIXA 5TGDA 2QTWB 1PWEA 3S29A 3VR3D 4XWYA 2CN1A 2PWBA 4XQ9A 3FD8A 4URHA 5A2QA 3QWAA 5SZHB 3UJ6A 1ICIA 3CM0A 3TNDA 1EXDA 3O94A 1JA1A 1RQ2A 1DC8A 1OFTA 3LQ1A 3PIIA 4IGEA 1PJAA 2QLLA 4WPGA 3NBUA 5DOZA 2G36A 5E6RB 1G7CA 1L5VA 1A88A 1YJAA 3Q6MA 4OHUA 4RDIA 5DXAA 1EPUA 1MBZA 2ZJ4A 1Z5GA 2CLLB 1L7DA 2RHWA 3VKUA 4COOA 3AONB 4DUPA 4IP0A 2X2OA 4ER5A 5IHPA 1JL3A 1MP0A 3EF1A 2RI6A 3F3SA 1P5FA 3KV1A 1DKLA 2EC5A 2RKOA 2VBCA 2HPZA 4X93A 1FVXA 5DEOA 3LWBA 2HGZA 3A6GA 3RJ5A 1VE7A 1RT9A 3PWTA 4J1TC 4JJFA 3VAAA 2Y68A 1X77A 5EHZA 4H7EA 1E1RD 5KEIA 1H1DA 2CVOA 2IZ6A 2GS9A 4JQZA 1AGPA 3WL3A 2LNDA 4BNYA 1MN6A 4IIEA 5AYVA 4G26A 4PQGA 3KZMA 4QFMA 3EY9A 3A9SA 3D2BA 3CNHA 1UJ2A 3GT3A 3L4EA 4GPIB 5HE8A 5K51A 3T7AA 4BKQA 3EFEA 4K05A 1PL7A 1W9HA 4L8VA 4TV9F 4W8HA 5FXMA 4MOWA 4RF2A 3MS7A 3PFGA 4QE3A 4TV8F 3IUSA 1S2MA 4MIOA 3LUDA 1N75A 4PXAA 3ZVLA 4ECAA 2G25A 1BXKA 2D06A 4MV9A 2ZGVA 4Q3KA 2ZAGA 3DO8A 2VQEB 1CJCA 2H51A 3V33A 1W1UA 2ESRA 1G5FA 4CFSA 4LE2A 5CPFA 2V3CC 1J33A 4FIZA 3NHWA 5ERYA 1Z16A 2IH5A 2XGJA 5JOQA 2G0TA 1GOTA 1TPZA 3KAJA 3Q5GA 3TUIC 1G9TA 4YJ3F 5KJ1A 4HXEB 5DHUA 5LOVB 4QULA 3GRZA 3BRWD 5GZ3A 4ZQIA 3NOXA 4A2CA 4B8YA 2XNSA 4KLAA 4QLOA 5L3RA 4ZRDA 4AXXA 1TJ3A 4DR2B 2GEBA 2ZBEA 4PN3A 3AM1A 4G4SO 2GKOA 2EARA 1YR7A 3FOCA 3ICOA 3OZXA 4AXBA 1PT8A 2YQ4A 2ZVPX 1FSFA 1TC1A 3NW9A 5IMBA 3DOHA 4ITRC 3T4PA 1RWKA 5AIAA 5KDOA 1TYCA 3TMKA 2PH7A 4AM8A 1U98A 5L3QA 4MTCA 1Q57A 4PSDA 5EE5B 4R1LA 2O8VA 2A58A 2J45A 4YECA 2IYQA 4TTPA 1XYGA 4J3NA 1YACA 1SM4A 2CLSA 2WYOA 4N3AA 4ZOAA 3OOJA 2I3AA 4FE3A 1Y1SA 1UKEA 2Q6OA 2FQXA 4Z0NA 1HDCA 1YVPA 3U48A 1UC9A 1TK3A 4B6PA 3DHNA 1AT1A 4A92A 1EUYA 4OP2A 5IUNC 2IYOA 3DFIA 3ZWDA 2B1IA 1WCIB 5KSWB 4IOLA 4JYCA 1II0A 5EKTA 4CKXA 3ZZ0A 4F9GA 2IDKA 1GEEA 5FOVA 4ACAA 1FP4A 4FNMA 1C5KA 2FR0A 4V24A 2GBIA 2I2AA 4TN1A 4TVBA 3T5PA 4EGFA 1JHVA 3PWKA 1V48A 2FMXA 1FLAA 3EPJA 1NOIA 2GZHA 3LGSA 4R16A 3AIIA 3OLYA 1Y1KE 2GBFA 1T2AA 1NA5A 3E9MA 3GC6A 1R9JA 2VHWA 1N2GA 2ZRBA 3ILSA 2XZLA 1YZGA 1DJMA 4ZAWA 4O2BA 5BRNA 2WG1A 4FSXA 3PC8A 3QMWA 1M0SA 4M9SA 3IHKA 3JWIA 1F48A 4R8VA 1XE3A 3D4PA 1PSZA 4MJ7A 1R9NA 2FG7C 1P9LA 3IB3A 5AKYA 4CL2A 2P3SA 4XAQA 2DJ5A 3G88A 3T7TA 3UJAA 2QD2A 3H9EO 4PIPA 3B6KA 3UJNA 4UHFA 4HX9A 4UUNA 1YR2A 4MYSA 4JU9A 1UBJS 2JIRA 1KFEB 2P9CA 1TTHA 3KKKA 1MZVA 1MEEA 1SKAA 4AJEA 1U9JA 3GRRA 3O6VA 4YGYA 3ZKAA 1JEJA 2NQ8A 4I3FA 4EKGA 4QLAA 1FRFS 1MJFA 4TYYA 2IK8A 3KB6A 4I2VA 2Y2UA 4TVKA 3TL6A 3DKIA 1WUTA 3WGUA 4BE4A 4PS0A 3GLHE 2PUVA 1VHQA 4X8HA 1C1XA 1RFGE 3C3XA 4ZZ3A 3R5XA 4GXQA 1H3NA 3OQ1A 3OQIA 4P31A 5TS2A 2PO5A 4MH0R 4QUHA 4LMAA 4CQMD 3RK0A 1GL3A 2XDWA 2C8LA 2OD7A 5IDWA 2R00A 2HK6A 4YI5A 2H2FA 2XD9A 4FZJA 2ZR0A 5JROA 3T9EA 4O29A 1JSCA 2CLCX 3R0ZA 5JE8A 5I7SA 1U2RA 2JH3A 3D3WB 4R1UA 3SFTA 3F1KA 1R27A 3NU1A 2XT9A 1UK8A 1V7PC 3PHLA 3AILA 1SUWA 2DTDA 2F3QA 2NXEA 4UEWA 1ZM7A 1ZICA 4FUTA 3NKLA 1KJNA 1EUQA 4NMXB 1FNDA 3QBTA 2ROQA 1ISPA 3ZE6A 3U80A 2X15A 3JVEA 5GM2A 3MCWA 3BIOA 4GI5A 4E15A 5H4GA 3K30A 2IWRA 1FFWA 4ARVA 2YW9A 4EUSA 1JDUA 2ZETA 1OVGA 3DZHA 3OD1A 5CLGA 5EXTA 1DLJA 1N6KA 4IO0A 3CLTD 5AW9A 3LW7A 3ROEA 3Q7IA 1CQIB 3A0RB 3KHKA 2C4HA 4FVTA 4LRUA 4S1NA 1PUXA 5JFTA 3HSKA 4JL5A 3LKBA 5D5QA 5IAAA 2AOWA 1FK8A 3BH7A 1SKQA 3G2HA 1HG1A 4W82A 4KMMA 1E2LA 3L7YA 4LXXA 4W9RA 4B2LA 3IJ5A 3UAOA 3JQ7A 3PGMA 1ZVJA 5A9SB 3I73A 1GPUA 4GECA 5FHQA 2CXOA 5LU9A 1QYIA 4HB3A 2ETXA 1R5JA 2FU5C 2H1HA 5CVUA 1LBIA 4XYGA 1I2ZA 1A8PA 1NM5A 3AL3A 3CMMA 1OUMA 3Q88A 2DU8A 3ACDA 3FUCA 1GZ7A 4KH0A 1OXKB 3KEOA 3LCUA 4RHTA 2Y77A 2P9GA 1M1NB 3F73A 3NAGA 1J5EB 1EVEA 3F6PA 1R50A 2J7KA 5HKOA 2H2HA 2X42A 1XNQB 4BB9A 1D8AA 2HBQA 2D8MA 4WZZA 2H1SA 2DPLA 1LUAA 4JLNA 2ZRAA 2QSJA 2W2LA 4KDRA 4GL4A 4OYHA 4HMOA 4JBLA 2AD1A 4HUJA 4CIBA 3DMTA 4EPTA 4QRDA 1HV8A 1O89A 2IUYA 4QRIA 5JSYA 3VGPA 2FNAA 3KPVA 1QRUA 1E9EA 3PUZA 4MVJA 2FZLA 2H4HA 1WZ2A 5KHLB 4RTJA 4K0RA 4RACA 3DL4A 4X1KB 1QO9A 1OPXA 1PGNA 3NM6B 1P5ZB 3LKDA 4ND1A 5JV5A 1WWKA 2HOQA 3C7KA 4L5IA 4XD7D 4O4LF 4LSGA 4ZREA 3EK2A 4E31A 3MTQA 3AZQA 4OSPA 2WKWA 1QE5A 2L0XA 3GZJA 3WSTA 3RUPA 4R8SA 5FV7A 3RBZA 3EVZA 4MS3B 5DPMA 4PE5B 2WJWA 4JLOA 4KXVA 3M9WA 4D4HA 2B7BA 3EVEA 3W3AH 4F9FA 3RIXA 4RM2A 1T43A 4WOKA 2BH9A 4HTFA 1NRWA 1VM6A 5DTQA 5HA5A 1M6VB 2XWSA 4HI0E 5LJLA 4OGGA 4E03A 2XE4A 2ZIXB 1P6XA 4A27A 5LOVF 3K2BA 4BUJA 3BGWA 5LCXA 1XPUA 3KXIA 2VHVA 3IDQA 5CTJA 1GSHA 1PJSA 1VRCA 4NY1A 3TJZA 1VLHA 2O14A 3DHVA 4NSNA 5AJZA 4OXIA 2ZB4A 4JS0A 4DCGA 5D6NA 1LDGA 1R1DA 4KWTA 2PQ2A 4DLPA 2OGSA 3GOHA 3R3VA 3CCBA 4QUAA 2HW8A 3LJKA 4FFVA 1BE0A 4BV8A 3VJLA 1CYEA 4RKFA 5J5AA 3H11A 1PZFA 2OBNA 3USES 4ZZIA 1YBAA 2FRVA 2BMEA 1RRVA 3AF1A 3WYEA 4FWTA 1E98A 3CUUA 5EWMA 1M2OA 1FFHA 1L2TA 3CPSA 4IXWA 3PIDA 1TVMA 4TL7A 2VT3A 3HCDA 1QIJA 4FU0A 4OM7A 4RESA 4UTXA 1TAQA 2IT1A 4WD3A 3UV3A 4AF8A 4B45A 3KOMA 1BWRA 2NSDA 5A4JA 1U0JA 2ZYVX 1CUGA 1PX2A 3DDHA 5GP1A 1XO1A 3AF6A 4QTUB 2OOKA 3G2QA 3TX6A 1HE8B 4UTNA 4L9WA 4UZSA 1GPH1 5JJ5A 3VU0A 1GFIA 3TUZC 2X1LA 1R9MA 3RTDA 1KR2A 2WJGA 3K09A 3SSMA 3PC7A 2M98A 3ODGA 5ADVA 1NPTO 4Z9AA 3C5WP 4TWBA 4EY3A 2PUBA 1RD4A 4G5YA 1XHLA 3WBBA 5K6AC 4N03A 4KX3A 5JALA 1YZHA 2R4TA 3K1ZA 2DLNA 1QB7A 1JH8A 1PZEA 1FVFA 2J07A 2RI1A 3OQIB 1Q5PA 1TQ4A 5JS7A 1KH1A 4URYR 4LSMA 3HV2A 1HLPA 3MTAA 4PFJA 5CBPA 5JI2E 3I53A 3WMEA 4D6XA 2Z2ZA 1DBSA 2G9UA 3THXA 5ALOA 2XMZA 3LWDA 3JU3A 4FGSA 4MCHA 1H8HD 1I51A 1K3FA 1S8NA 2GILA 2IU6A 3BMXA 1IUNA 1NNLA 2J9YB 4G25A 2HFKA 1PJZA 4HGRA 4MA0A 3UWMA 1CUIA 1Q0HA 2BFAA 2FX5A 2VYNA 3GRPA 2AEMA 1KO1A 4W5NA 1IHXA 4HZGA 1BZYA 1DV2A 2DWPA 2ZJ5A 3C45A 5FPHA 2QN1A 3HKCB 4AZSA 1GL7A 1YU6A 5F2NA 4MKGA 4MV7A 1E5QA 2B9VA 1D9ZA 1R37A 4XPIB 1ZGCA 1PTJA 2QX7A 3F2IA 1RWNA 4N3BA 1TF2A 2VRBA 2ZI5A 3RC3A 4Z4IA 2ZUBA 2FEOA 2MSLA 2V0NA 1I33A 3KKQA 2YINC 3VR6H 4PG8A 1SUSA 1Y9DA 3OFNA 3WKBA 1GGKA 1FLVA 1PO7A 1I6WA 3D4IA 3ICVA 3BAZA 4M38A 4OXNA 3T54A 4BVAA 2O07A 2WWTA 3GCZA 5JJBA 1XU4A 3GGOA 4CV0A 3CJRA 3KJXA 4FEEA 2GF0A 3TAHA 3ONEA 3WNZA 1XZMA 1ZJ5A 3HLYA 3FDFA 4EF4A 4OXYA 4X97A 1PZGA 2QRPA 4BMCA 4YIKA 1BN7A 5KC9A 2IUSA 4OATA 5EPEA 6ADHA 3HDQA 3LI2A 3OWOA 3LQKA 3T1QA 1JMYA 2P6UA 3QGMA 4X1IA 3SQWA 2Z5FA 4H08A 4MLDA 3HADA 1LSSA 3M6UA 1XT6A 3JQFC 3R3YA 2H4YA 1FYVA 1PVDA 2P5UA 3N9IA 1G8AA 2C9DA 3HUTA 4JC0A 3DNFA 2CSXA 3VVMA 2HQOA 2H2IA 3TAUA 1PLJA 4OYRA 4EG0A 2VNIA 4N40A 4E5VA 2YMPA 4AROA 5HKLA 1A7AA 1QYXA 2GZ2A 3CMCO 3HB7A 1PQ4A 1JHMA 3L0IB 3LXXA 2GSWA 2GWRA 3NP9A 4NV1A 4C3UA 3WV5A 1T3ZA 3WLAA 2RHHA 2Z8YA 4M9CA 3LTNC 4GKVA 2OVBA 5ALRA 5HF5A 3IP1A 1CE8B 2OEPA 3K9GA 5U1PA 3CE6A 2O48X 2QLJA 4B2PA 3TIFA 1JT9A 1K86A 3M6FA 4AS3A 1GGEA 4AMYA 3C5VA 2OGUA 2M2IA 3KL2A 2C2GA 3OQ6A 5LN1A 1TTQB 4YB8A 3PFBA 4N65A 1RC1A 1T5BA 1XZLA 3DZCA 4NZOA 4UZFA 1Z7WA 4WLEA 3HHEA 1NQOA 2EL9A 4CHGA 5JFOA 3FKQA 3DBLA 2HR1A 3A4MA 3GRCA 4CKCB 3HPRA 3S1LA 1ZHHA 2PPVA 3RYFA 1A50B 3GROA 2NSHA 2B5VA 2AJBA 1NQTA 3GAZA 2TSYB 4QEKA 2WDPA 2VUIB 4KTTE 4ZOLA 1FW6A 3NI2A 3BERA 2HADA 2ORYA 3B3AA 5G41A 1A8UA 1EXNA 2OGZA 1U3CA 4K9DA 3LYHA 5FTWA 4EZEA 2YHAA 1ECJA 3GK3A 3GJ7A 5BW4A 3WGLA 5BR8B 1ADCA 3DAYA 1ENPA 1H2AS 1EGMB 1S3GA 5FUWA 4V03A 5DGDA 5CLLA 2SCUA 3E18A 3R6LA 3OESA 5H81A 2J5RA 2K2WA 1E9VA 3B6ZA 3HU5A 5IM4A 2GA9A 3EARA 4DPMA 1XXHA 4OHOA 1M1ZA 2R1VB 2ZS9A 3R3SA 4OKNA 3VMMA 4D3DA 4KBYA 2BRUA 4F2WA 3FTEA 1UFOA 1WOMA 1EFPA 3KNZA 4WESA 3MT7A 1FB5A 2EFGA 3FBTA 2CW5A 4JCCA 3UCFA 3K96A 3UANA 5JWOA 3L6EA 1RRFA 1LFDB 2IYUA 2UV8A 5KAPA 1UPCA 3MTGA 3QOXA 2WP0A 4TSRA 1L8LA 4YACA 1KE2A 3TPZA 2H0RA 2FP4A 4RX1A 2W2PA 3M6MD 3MWKA 2ZB7A 3KEQA 2ZE8A 3ZU2A 5C7LO 1AS2A 3FCXA 4DPLA 3LBYA 3VR2D 4DLBA 1HE1C 3A1CA 2QRLA 4IDHA 4KVGA 4J0HA 3AY6A 3RQIA 2B83A 1GL9B 4R9SA 3EMVA 4I8DA 4MR8A 3U60B 4WX2B 1X1QA 3RSFA 3VSBA 3VM6A 4DADA 5BN5A 4MCIA 3OZIA 1A8HA 5K09A 1FYXA 2OORC 4IX1A 3O8OA 1N5MA 1TAHA 2PHZA 4KZKA 3FM9A 1M34E 3DAFA 1OGJA 4OQPA 2JAWA 4HBGA 2Z95A 4S1VA 4YCAA 3ZHZA 1E66A 5C5IA 3JVDA 2O19A 1TU4A 1ZP6A 3GB9A 4UM8B 2VNAA 3SU8A 3GRVA 4JJIA 3GLIB 1ISFA 4KRYA 2JJ1A 3JY6A 4ZI2A 4AWXA 4QDXA 4ONEA 4IHJB 3ANSA 4QVKA 3ZLUA 4J1SA 5EHQA 1QK3A 4LXIA 1I1HA 2C59A 1ONSA 2WF7A 2B0CA 3FN4A 1CDEA 2W2LD 2X6RA 5BSTA 2PD6A 5FWNA 1KFJB 4QTZA 4L78A 4YT5A 5DTMA 2R1ZA 2WU3A 5DBFA 4I8XA 3Q3GE 4JLKA 2O2ZA 3DCIA 2JVJA 4G5OA 5DX8A 3CWZA 3ZE1B 3ZHSA 3V1MA 4GXRA 4A0FA 1D2GA 4B3RB 3ZUPA 5CA0F 4P3NA 4KW7A 4RYLA 1R6UA 5KOHB 4MIEA 1M66A 1GTJ1 1XL1A 4EYQA 4TS3A 1ES9A 1C3XA 3PEWA 3RJ9A 1PYGA 1ZSYA 1QQAA 1B8OA 1WIWA 5A4DA 2VWHA 4B3BA 3LVQE 3QKSA 3PPWA 1CIVA 2PXHA 2CNWD 1QTQA 1J0DA 3Q3IA 5BT8A 3ZWWA 1IUPA 3AVYA 2W98A 3O8OB 3E7WA 3LYUA 3KTOA 1DMSA 1N2HA 1I4DD 5CVVA 1CV2A 1UC8A 3O75A 4A2QA 3DT6A 1R0KA 2EEPA 3JQEA 4D4JA 2MOKA 3VNAA 4DWJA 5IZ4A 1L7MA 2OOSA 5B2EA 1T5LA 3E0QA 4PZCA 4P83A 4BEVA 4IFBA 3L1JA 1N0UA 5JAHA 3I9V6 1NBIA 2WIDA 4D0SA 3NVKI 1NI3A 1E92A 4Q6WA 4WXYB 2CFCA 2PL1A 1PD1A 3HMKA 4JSRA 3GJ3A 2HCFA 2ZYSA 2RDMA 2H63A 1DRKA 2OC4A 2SECE 3AR2A 3FKSA 4BWYA 2P7HA 3JPWA 3W5DA 2G6BA 2EKQA 4ND8B 4NNPA 2PS3A 1ZD5A 1BRTA 3H5VA 1DWUA 2QVXX 1UXHA 2IITA 3B9RA 2R25B 3PD7A 5F76A 5KHOC 3N0XA 4CKWB 5BPFA 1MENA 4K9PA 2G17A 1RWWA 3KYBA 3DXFA 2YHIA 4ZCLA 4RABA 1W7AA 3VOSA 4CJXA 3FCUB 4M0UA 1GQRA 1Q7CA 2BGJA 3V8NA 3D2AA 4BNMA 5I9NA 1C1DB 1DKQA 1QQ6A 3L7JA 4C4SA 2OHJA 4JLWA 5FTMA 3UG6A 3W5IA 1DO8A 4BNDB 4LV8B 3ZE8A 2O52A 2QW8A 4L5AA 4E94A 4EYEA 4WVLA 4W8GA 3KS9A 3O8LA 1JLLB 5B1YA 3SSAA 1H9BA 4NU6A 3VZCA 1E1CB 2CLFB 2O0LA 3FE2A 4DCTA 4DOMA 2DKNA 1XB2A 2ZRJA 3RSLA 5HRUA 4RS4A 2V5UA 1YTLA 4YALA 4ZQEA 2ZROA 1U9IC 3MYRA 4EM6A 3C43A 2POCA 4FHEA 4XWTA 4NPHA 4RZ2A 3W90A 3L7LA 1NG1A 3A2NA 1NVVR 3UAVA 5JCPA 3HN2A 1CPYA 3LG2A 3DDNA 1ISIA 1OIVA 3KXDA 3NV9A 4MGKR 5T3YA 4JA2A 1H2YA 3ZXYA 3JYPA 5I5GA 3SBEA 3G2LA 4HGYA 3EW7A 4EGAA 1UMKA 1CF4A 3KHUA 4LDQA 4FGUA 8GPBA 2F90A 1DTWA 3GCWA 3VSCA 3MJ4A 1K0UA 1NR1A 1TVEA 3WGNA 2XUOA 2A5JA 1WMSA 1CR4A 4ZO9A 1QGYA 2NUPA 1ML4A 2I3BA 2YUIA 3E61A 1D8TA 2E6KA 2TMYA 3ZTYA 3ZEIA 1Z8NA 1Z35A 2XECA 1QZ3A 4O63O 3BDVA 1HZJA 3H0CA 4M0EA 4I50B 2V74B 4Y1EA 5K3BA 4HAIA 5FBWB 3L7MA 3D6UA 1Q1EA 1N9GB 5BNZA 2A84A 2OD9A 2ZRIA 3DMGA 5EJIA 1SFRA 3WA6A 4CKBA 3TI7A 2W2OA 3H7AA 5MF6A 5CD1A 4F21A 1P4AA 4IQFA 5C35A 2XRYA 1CY6A 3COZA 2FPGA 4EK9A 3W2HA 2FSPA 3T94A 2JLUA 1HTTA 2FLKA 2GAOA 5JD5A 2YN0A 1VDMA 1QVVA 1Q1AA 1IEXA 1G8GA 4B8WA 1LBEA 4MW4A 1UPAA 4RJLA 5F5XA 3C1OA 2ODNA 3K15A 3AFHA 1X39A 2ZEJA 4YDRA 3S99A 7ADHA 2JIQA 4DIFA 3OC6A 3LMKA 5FOXA 2C7BA 4N9QA 5LP6A 3S3TA 3K6SA 1I9CA 1T6NA 1V1MA 3EZ9A 4ND6A 1GRQA 2CLIB 5G0VA 5D84A 2FPIA 2XKKA 2H16A 3EQ6A 2EBWA 1WP4A 3BGDA 3LF1A 3NCTA 4DE5A 3THWB 1SBNE 2VNHA 4GC5A 4OG2A 3ZNNA 2WJ3A 5BWMA 4UNPA 5I7VA 2PH1A 3NKVA 4P58A 5G1OA 3ZE7A 4B6QA 1VPEA 5JSZB 2CLHB 2ZANA 3L7NA 2ZAIA 3N2NA 3CZRA 2FKAA 2AXQA 3KAPA 1J8QA 4QJIA 5K99A 3TGWA 4JP8A 2NVOA 4DVJA 3U6BA 2VKQA 2XB4A 4OK3A 2FWRA 1C3OA 3ENWA 4MGIR 4E6EA 4DBVO 3K8OE 4W5OA 1OB5A 5A3RA 1N7HA 2F4VB 3ZHQA 1W85A 2WAOA 4YRRA 5DYWA 2O2EA 5C8YA 3N2ZB 1TT5B 2YWDA 3FNHA 4BKPA 1F9EA 1IM2A 4CM3A 2XQIA 4XKJA 4UDOA 2HSDA 3PGA1 2ZW9A 1TZKA 2BJHA 1QGUB 4UZEA 1DC5A 4LZJA 4RTOA 3H2BA 3IH5A 2C2MA 3FWHA 4MITA 1MB0A 3FSGD 2V65A 1OA0A 2VH1A 4INAA 4CE6A 4G5RA 4TV9B 4C9BA 5JEDA 1QLJA 2BGTA 2X22A 5EZ6B 3G7UA 3DE7X 4GMDA 3QELB 3KR2A 3TSYA 3RCBA 3REQA 3VNSA 2OFOA 5CNKA 3LPMA 2FPLA 3CVYA 4JOCA 1G3IA 4FEGA 3UMCA 1O6FA 3ZCTA 2ZYIA 4EEXA 1P3JA 1VZ2A 3IE2A 3JZAA 1XRNA 3H9UA 5IJZA 2W6QA 1BVUA 1JEYA 3MXTA 1TM2A 3ZXUB 1YUBA 1M2OB 1ZL2A 3DMYA 3FYTA 3G0BA 3IDOA 3JQCA 3VO1A 5JLAA 4EATA 1TKAA 3ZXXA 4HQLA 1QG6A 1NLYA 3CB4A 2VHJA 4D42A 4F3RA 1B2LA 1OGIA 3LO8A 4CNBA 4HLDA 8MHTA 3RUHA 3DE2X 1YOVA 3OJFA 5KVAA 3IOMA 1CUZA 4M99A 4MW9A 3CZ9A 1T3GA 4TLDA 5ICFA 4BDSA 1GPBA 4ESEA 4II3A 3KLPX 1G18A 4H3KB 2YL2A 4MI9A 2R68A 3MS4A 2BLLA 2X5XA 4OGWA 3D1LA 4X1OA 1M74A 3CRQA 4BFTA 2HBYA 3Q3HA 4TYQA 4TT8A 1EX6A 3AR5A 1E4EA 1UDRA 4PX9A 4JLAA 1GJRA 3VTKA 3VU3A 3OKPA 4O2BB 1RKUA 3CKYA 1WU7A 3ISTA 1OC4A 2O05A 2W2VA 1OMOA 1DCKA 3EWNA 3IOEA 4TZTA 2Q1WA 2VP5A 4MS4A 4YR7A 5B57C 1JAYA 2BGIA 1I01A 2VAXA 4LGMA 1U3VA 2NZJA 4IVQA 4AJ2A 2VO1A 3FIUA 1UH5A 3I64A 3HFSA 5AVTA 2BJVA 1R0LA 2DECA 2JBHA 4G07A 4WKPA 4BASA 2A3NA 2DQYA 1OLSA 3WGMA 1PTKA 1RXIA 3AERA 1J9EA 3GD7A 4L3WA 2YWJA 3HC7A 5CLHA 5KNDD 4AJPA 1Y4DE 3A6EA 1GYQA 3ANXA 1EZZA 3RFVA 2ZSEA 3GP8A 3FNRA 1N6HA 1K6JA 2X40A 5DHSA 4XYEA 4P7KA 4IXNA 1O95D 4B35A 3TOCA 5GV8A 4QUJA 2C5EA 1QJ4A 2QRNA 1C1XB 1NXWA 3RAPR 5BN4A 4CM9A 1EDDA 4B3GA 4HH0A 1GFWA 1XZHA 3NQ41 1AB5A 5C4MA 2I55A 2QL5A 3K4PA 3FTPA 1MAUA 1SU4A 3I4FA 3EZFA 3F96A 3C41J 4GR5A 4IZ6A 2GR9A 2A1TS 4J49A 4XVRA 3DKRA 4AKSA 3TGPA 4KNWA 1OKKD 1TA9A 2JFOA 1YKFA 2YMMA 3K9QO 2IHUA 3IKJA 2BEUB 3RG8A 1Z6PA 3SKVA 2AG8A 5C1BA 3EGVA 1IL0A 3IESA 1FEZA 4B3TB 1E59A 2VDQB 4B3IA 2XITA 1Y89A 3HGTA 1LX7A 3UMJA 4E4RA 1DC7A 1GGMA 2QGFA 2WD8A 3BVPA 5EA2A 4A8JA 2WHXA 3E0XA 4OGKA 2J08A 1COWD 2MSNA 3VU9B 5FV4A 1A9XB 1PQWA 1WY5A 2Q3CA 3G9UA 4TV8A 3ID6C 2O3UA 1WV0A 3CX7A 4US0R 3IPRA 3M0EA 4RD0A 4F5WA 2NU6A 2ZVQX 4OFBA 2DF8A 2WWVD 3UB3A 3JR3A 2E55A 3TMYA 4D4MA 4MMYB 4YCJA 1JXOA 2X9QA 2GFIA 4Y0VA 1KZ6A 1XCLA 2IHBA 1H2BA 2J6IA 2VQDA 2QTNA 3MPOA 3K32A 2IYRA 1K3TA 3ZWMA 3T3PB 3GVXA 4I9UA 1MABB 3TOVA 3MMNA 4N0MA 4JELA 4NFLA 1EFTA 3WDSA 4J4BA 1OZ0A 3D59A 1LVHA 1WPQA 2QUKA 1C0IA 4ENTA 1EE9A 2UYHA 4JXKA 2WKRA 1NUPA 3A3PA 3IKLA 4JT9A 3FNGA 4QNRA 1R6AA 2SICE 3LBIA 4CU2A 4Q15A 1N9GA 3ZBTA 4C0BA 2ZUUA 2X23A 4A8PA 4CFZA 3DH0A 4CQMB 3DFFA 2W2NA 1DZIA 3IMKA 1W34A 4IUBS 2VQ3A 3HKBB 3OQVA 4MI3A 1GITA 1NPDA 2P0AA 4G65A 3X1JA 4MYDA 2QPTA 4MQBA 2VTDA 3BBPA 1PNQA 1AKQA 1EUDA 1TM5E 4UU1A 3SQXA 4C43A 4DSUA 4JQCA 3SMVA 2AWNA 1WF3A 4LC0A 1B2RA 2EZ9A 2B82A 3DMRA 5P21A 2JGDA 1EP2B 1QB8A 2HWYA 3AUJB 4LOIA 1S89A 1CE8A 3K20A 4M9UA 3EAFA 4E3WA 4YT2A 3PLRA 4FN4A 4BMSA 5T64A 1T9DA 1YS9A 1XMIA 3IHWA 1IY8A 3X1DA 4WLUA 5BVHA 3LDGA 5MN4A 4F3YA 1VIVA 2P9EA 3SJAA 1K08A 1DHRA 2BP7B 3O2NA 1SOAA 2C96A 1CY2A 1AKUA 1RVDA 4K9MA 2VP9A 3SS9X 4PWYA 5L3VA 3NALA 5A3QA 2XYHA 1ODTC 1V1MB 2FZGA 1SHTX 2YXBA 2ZYTX 1U1CA 2ZVJA 1F4VA 1GA1A 1T1EA 3EFHA 2EKDA 3CBGA 2C42A 2IHVA 4P7FA 5KSPA 3SJBA 4D26A 1ETUA 3EIHA 3E9YA 1TYDE 3E2IA 4XSHA 3RV4A 4DEXA 4EG4A 1VJGA 3IDFA 4MGZR 4ENSA 2B1QA 1ZOIA 3WWOA 5KOIA 3A1SA 2VJOA 3NRBA 2ZB3A 5EHIA 1O1YA 2Z1MA 5B3KA 1D7OA 4L15A 4RQBA 3B7WA 1KSJA 4KR9A 1ZU5A 3GJRA 4FFNA 4GVXA 4IH1A 3UK7A 2Y1CA 1NMYA 2EIXA 3HJCA 4U2BA 2XZDA 4TKVB 3ZJ5A 3LVFO 3AIMA 2OL4A 3IEVA 3FPCA 5BQPA 2YW2A 4C2BA 3BXGA 2EVWX 3SJCA 4CGYA 3STWA 5FOWA 4BLRA 2JLYA 2OAEA 3AETB 2C7RA 3U44A 4CIDA 4CEJB 2Z56A 1N5IA 3O2QB 3KD2A 3UA4A 3ND9A 3PRKE 5DGCA 3RRZA 1UT5A 1OAOC 1JBQA 1YAJA 4UD6A 2YS6A 3OZGA 4ZT4A 5HF8A 4OSEA 3W5VA 2YDXA 1MEOA 1O94C 3CF2A 4K26A 4QT0A 4UU0A 4NYIR 5BMVA 3HO1A 2RCNA 2PXCA 3W8DA 1EJ6A 2C9ZA 5IKMA 3H75A 5EFOA 2B5OA 2CXSA 1TEHA 2I6GA 2WTAA 3T5BA 1TPYA 2NYVA 4N5NA 4BB0A 2UUCB 1UJCA 4UTRA 2I3DA 3KSMA 5DLEA 3C3BA 5HJ7A 4DV2B 2VTKA 1BMFA 1RU3A 1YCGA 3PDCA 4ZTZB 4RVHA 3OBIA 4BRUA 2X0IA 1U28C 1EHCA 2PKXA 1VGQA 2OECA 3OECA 1QS0A 5AXDA 3RLIA 1JE1A 2J41A 2WYIA 4PN7A 1OAKA 3RJZA 1SKUA 2QN6A 2Z43A 1L5HB 2K6GA 2YYSA 1KI9A 2ZR7A 2OYRA 3HYRA 1ANKA 4RCZA 4D9BA 3RJMA 1WETA 1G21B 3H4VA 3PI6A 4Q4HA 1ABEA 4UPEA 5DCWA 1WPGA 1SXIA 5IKEA 3C5HA 1LQ2A 1MFPA 1U1DA 3AX6A 1GZ5A 1JR6A 3DEHA 1OAAA 3R7WB 1GKLA 1ODKA 3DP9A 1II8B 4J1TA 1OI2A 5I9TA 5BWOA 3SX4A 1Z2NX 2C77A 5JASA 3MEQA 2PEYA 4WNAA 4U2GA 2VOJA 3R9XB 4L9AA 1KS9A 1AJEA 2EIHA 1OYWA 3CVWA 4HH4A 2G80A 2VJLA 2COEA 5JNVA 3PVCA 2H31A 2DULA 4V0QA 1V8DA 4TS4A 2XMRA 3GR6A 2I1QA 2YV4A 3BJRA 4KVAA 2XXAA 2YYYA 4HLCA 2C4TA 2WPDD 4A0GA 4BGIA 4OBBA 4ABTA 1E2UA 4MRMB 2W4MA 3HHPA 2O4CA 1YS4A 1V35A 2J3IA 1Z6XA 1I7DA 1QVZA 5A7FA 4Q3LA 4LVOA 2LVBA 3EDOA 4MR9B 4YBZA 2CEAA 4IHAA 2JI8A 2Z6VA 1A4UA 1ST2A 1UBFA 4BO0A 2XNCA 1TEXA 1Z82A 2JJ2D 2RHOA 2VUHB 4R69A 2XV1A 1Z5PA 4KFRA 4DCVA 3GRAA 1IHOA 3MERA 5CCXA 1XVUA 3UGJA 3FLEA 1WXWA 3KR1A 4IIBA 2PUHA 1ZLYA 1AKMA 3MJTA 2BR3A 4TS1A 1T9BA 4Y9TA 2YWBA 3GH1A 1SCKA 3W7VA 2OMKA 4RK0A 2IEGA 4EFLA 2IIBA 4QL3A 1WNFA 4PX5A 2IHJA 4OI0A 1MOPA 1XCMA 1MTOA 4LW8A 4R2IA 1RRCA 3JZIA 3N28A 3RVQA 1NMXA 1NV9A 2OFWA 2R9VA 2XCOA 2ZSBA 3KSZO 2F17A 4XUCA 5CAEB 1R0WA 1JTFA 1RLJA 4U00A 5HSGA 4E4TA 4BVHA 4UXJA 2BHSA 3KJGA 2H5EA 4C0JA 3OZWA 1LZKA 4P3PA 4KPGA 5HF6A 3TQQA 3ZHVA 1R4ZA 2XZTA 3E4DA 1EB9A 2J3KA 2Q45A 1S1CA 2JFHA 3S2IA 3DOJA 1W35A 5TPZD 4M3NA 4IXMA 3DC7A 1EK0A 2JHPA 5DZSA 3U40A 2CMFA 4D4GA 2C04A 5IT5A 1KVQA 2JD1A 1YQXA 2W0SA 4RH0A 5C7OO 3PGVA 3ZI0A 1ID1A 4M37A 1KK2A 4LY3A 3CRRA 3OIUA 4NDZA 5T4EA 5LQMA 3GDOA 4QVGA 4RCYA 1U8XX 4MUEA 4QICA 2FOXA 1UDWA 3BMNB 2BHRA 5B37A 4C0QC 4OX9Y 2EGGA 1IJEA 1KP3A 3PRYA 4RO0A 4U2KA 3DXYA 3B6MA 3KQOA 1H65A 5CJPA 1VG9B 3OVMA 1MJ5A 3R5FA 1R8SA 3QTTA 1BO6A 2GN6A 3PC3A 3UV6A 4KHPB 4JUDX 3QU7A 1TQ6A 3EGOA 4KPUA 2CF6A 5BWCA 1U7UA 2BKEA 3V4LA 1JF8A 2CNDA 1GNVA 1N8NA 2OLJA 2XHEA 1U7TA 3AF5A 2OXRA 2HSWA 3LT1A 4OBWA 4OH7A 2HXSA 4S2EA 4UVDA 2OFFA 2NZXA 4LISA 5C32A 4I2NA 1RHRA 4QHTA 1D2AA 5KDDA 3ZPXA 2WWYA 4M1OA 5LZ4A 4V0KA 1LNQA 5AQEA 3ZYZA 1WSDA 3AVQA 3GAMA 2AYZA 3OZ7A 4RNCA 5GIOE 4HZIA 5BSEA 1NUTA 2XNKA 3GUYA 5DULA 1PGOA 1UWKA 2OXTA 1A7JA 1U90A 2G4LA 3BB4A 3PUXA 4CV1A 4OK6A 1NIPA 3GFSA 1UP6A 3AUYA 3WQSB 4YRNA 1TLLA 5JW6A 1BKSB 1VECA 2OESA 4JGGA 1U0RA 3IOBA 3MLBA 5EESA 1YJCA 1BDBA 1ZJJA 2JCSA 3GLFB 4DLRA 2QZZA 3EIEA 3ZY3A 2HF7A 5IF9A 1IPEA 4D45A 2D1SA 3L84A 3FDZB 5HCIA 4N47A 4YQFA 4XFJA 2YNMD 1LPBB 3CWCA 4J16C 4Z9FA 1LLDA 2ZWMA 4ZO6A 1F3LA 3DOOA 1OYYA 1JR4A 3IAXA 3KRTA 2YXPX 1ZM2A 1NTRA 1KMHA 5KQPA 4P33A 1YB6A 1D9XA 2WV9A 1M8KA 2GBLC 4LOHA 1GZSA 4PGHA 4Q9HA 1ZU4A 4JN6B 1A8IA 3OQHA 4QQ8A 1H4QA 3CUKA 3WHKA 1VA4A 2NW6A 1SEVA 5CNJA 1NP7A 1L5YA 1NI5A 2H57A 3LCCA 3UIEA 5EZYF 1WPXA 4EZBA 4HUQA 4ZVNA 4BIIA 4PNZA 3LCVB 4HAOA 1Z7BA 1UUFA 4LX8A 4MRAA 1NJ6A 4DG8A 1BDJA 1LV7A 5J4LA 2OQRA 4MULA 5JXIA 1KSHA 3WIEA 1QHFA 3NDRA 3DW3X 5CFOA 2AZXA 1KH3A 2HA5A 4XEHA 1BNCA 2AZMA 5LQRA 4GGOA 2XI4A 2ATVA 3HKCA 3TLMA 3W4IA 2GAIA 2H00A 4YDSA 1JA0A 1P7ZA 2Z83A 4JXXA 5L4NA 2FPPA 3H5LA 1ZYUA 3OZBA 4RLHA 2QP9X 3RVSA 2QRVB 3L9XA 1PFVA 1WTCA 421PA 1JG7A 1KFBB 1WMDA 4K6FA 1EX9A 3A3KA 2WTMA 4MTLA 2N46A 5H02A 1CLUA 2C9BA 1L7BA 2Q3FA 4B33A 2SBTA 1L9KA 3GUVA 4QWWA 4BJ1A 4O4HA 1OYVA 1PK8A 2QMYA 2EWWA 3RO7A 1XG5A 4N7MA 5BQFA 3K8YA 1Q91A 1V45E 2VXCA 3GLGE 2PLFA 1IFXA 4A8TA 2EDCA 4J03A 1F4PA 3BJZA 2QL7A 3GLRA 4NBWA 3EODA 4P81A 1O8BA 4PEVA 4KAAA 3CT4A 1U2DA 5J3JA 5KTKA 4XM2A 3CS3A 4QG3A 2PKCA 1KJJA 3LGAA 2PMCA 3QVJA 3KR9A 4NENA 1VE1A 1N5KA 2P62A 4JJ7A 3TE6A 2QG9A 5FA6A 4DQUA 4DA8A 1NBHA 2OXCA 1W36C 1CUWA 3FDZA 2V8OA 2LKCA 1R18A 3I2JA 4UUOA 1FMLA 2XNJA 2MR5A 1BHSA 2ZJ6A 1QAQA 4M9QA 3OIFA 4QPJC 2XA9A 5JD4A 2H1WA 4QM6A 2G5GX 4WASA 2IU4A 4HEHA 4UULA 3WL8A 1I94B 3NBKA 4J2HA 3UKOA 1GUZA 2EYUA 4B47A 2PQ6A 9ATCA 1XZBA 3REGA 3ZGVA 5CXSA 3WBJA 4GYKA 2G1UA 3WO1A 1HEYA 5TDHA 4NZPA 4ZC8A 2Q1YA 3LDAA 2DT8A 3WK4A 4TTAA 3HRIA 4O1HA 2VDUE 5REQB 4DMHA 1KI3A 2SHKA 1N2JA 3BD6A 4PV7A 1E9AA 3DVRX 4HJXA 3FOEC 1I3CA 2BSAA 3EXHC 2ZS7A 4LYFA 2IEYA 5FBQB 2IUTA 3LUJA 2HWWA 3NUGA 1ACJA 2DH5A 3QWBA 1LQUA 3OU6A 4GOMD 3L7CA 5GJCA 3TNYA 4AJIA 1IUOA 3HCNA 3W9YA 1L5GB 3C98A 2HKIA 4YCSA 4RD4A 1KYYA 3IEUA 2J7PD 1GAJA 4V1CA 3B8HA 3AKZA 1GV1A 2JL1A 4XB6B 3HRHA 1QX3A 1HR0B 5E6UB 2QYTA 4HAYA 1KS2A 3JWPA 3P32A 5T4FA 2AYXA 3N8HA 1EP3B 1M2FA 2IYYA 4OEHA 3E1KA 2OSVA 1RPTA 3EXIA 3IAS6 2LZ0A 1WB6A 3H3JA 3Q7RA 4F4DA 3H16A 4XB2A 4CCWA 1INLA 3PB3A 1RKBA 3S0JA 1NYRA 2VAPA 2UYYA 2A0YA 3LXUX 4UUMA 1PWHA 2J9ZB 5FO0A 1Z28A 2JLRA 1OLXA 1PG2A 3P20A 1YCHA 2VF7A 4U6QA 3LC1O 4CODB 4KR3A 2FJ0A 3ZUGA 3PYMA 1NN0A 2D4HA 3D8TA 1CZUA 3HEBA 2WJHA 5DN6A 2ZITA 4REOA 1R7RA 5CB6A 1VBNA 4DQLA 3LK6A 2ZJZA 4KREA 3RASA 4BLUA 4DWOA 4RY9A 3NDPA 1QC5A 2QTAA 3V9PA 1TKRA 2HF9A 3L1UA 4X7RA 4B84A 1PNVA 4FTWA 2WD7A 1E1NA 3FPFA 4L9SA 4ZWNA 4JMPA 4NYIQ 1OC2A 3S6JA 2YWEA 1WB5A 3ELDA 4TL8A 1J0AA 4FGJA 2A57A 3HPQA 5AJYA 5E2AA 4D6PA 4E88A 3QVOA 2IHYA 4BEJA 1PDVA 2X7JA 3MWLA 2GK7A 5AVYA 5IN4A 1HRKA 3OY2A 4HYYA 1QZUA 1SCQA 3FB4A 2ANBA 1L4BA 2J46A 2RC5A 1NLUA 4LDNA 4G8DA 4Y2HA 4CIVA 2E1RA 4LKRA 1OX4B 1PFUA 3STVA 2J0UA 4KXXA 2VJMA 4EKNB 4XLTA 3TYXA 2JIPA 1NZFA 1L5NA 3DBIA 1BCSB 3WNQA 3OPMA 3PUWA 1WHSB 3CGGA 1GRRA 2OLEA 2Q5FA 2ZDGA 5CLQA 5CM8B 3RWOA 4ALMA 4ZKDA 1QPZA 2J31A 2F8MA 5BUCA 4WKOA 2HA2A 4XIGS 1KAGA 1HKUA 1LGYA 4QOJA 5TPWA 4Y30A 3BD7A 1A3CA 3OOWA 3IA2A 1RAEA 3O90A 1UFVA 2I0FA 1XXLA 3WWYA 2WJ6A 4M0FA 3GJQA 3EXG2 2HB6A 2PYIA 1E2QA 1NI4B 3DMDA 1XR3A 3GGPA 1L4EA 5BXYA 2P1ZA 5LL6P 4C22A 1B6RA 5KTSA 5EPUA 3JSXA 3R77A 4LCJA 5AKIA 1Z2CA 2H5LA 2CZCA 2JLQA 2CNLA 4OUDB 1IXSB 1RWXA 1UEJA 2FRDC 4Z0HO 2A88A 3O26A 1CZHA 5E1MA 5FNVA 3PD0A 1KHTA 3IKTA 1AUQA 1UKYA 1PI3A 1ZMXA 1M6VA 2GCEA 2QTZA 2X9VA 3HYSA 4GSLA 1UJBA 4IZHA 4KEAA 1NR5A 4R9VA 3TOSA 3UICA 3UMYA 3RS4A 4XASA 1IZYA 2ALJA 3DHYA 3KVYA 4DC0A 2BFEA 1XNRB 3B1VA 2JBAA 4DBLE 1Y0BA 4LK3A 5FL7A 3CBQA 4EY4A 4F8JA 5I4BA 1QYVA 3ZV7A 3V80A 4ZQHA 3FOFC 1OOEA 3E48A 4O4JF 4QREA 4P4UA 5IK2D 1WXQA 5CFNA 3NNDA 3OA2A 3ZV3A 4HWPA 4KQXA 2H1CA 1RYBA 1U4OA 3C3CA 4RZQA 3HXKA 1E1KA 2OGWA 5EIBC 2V97A 3F6CA 2YV1A 3BRCA 2AB0A 3WB2A 3WLEA 3ZW7A 2GESA 2QTVB 3MELA 3VHXB 1HLFA 3QNWA 2QJRA 4EYKA 5A0TA 1KZ7B 4RVFA 1ZZEA 1FOEB 4OLAA 2Z4SA 3L06A 4IDPA 1PNOA 4K9SA 4MUAA 2PNJA 3K16A 1I2MA 1P3DA 3NUQA 4AMVA 2Z2JA 3C7DB 1M5UA 1NJFA 4MVJP 5BOSA 2EJUA 2FWIA 3OX1A 4RD3A 3HUFA 2GLXA 4XR9A 2BFCA 2ZI6A 1ULTA 1MC8A 5EMJA 3W04A 2AZ4A 2WF5A 4M46A 5C8YF 3ER8A 3OY7A 3TW6A 3OFKA 2D2IA 3OPXA 1AG9A 4RXMA 3ND6A 2PT6A 5FBZA 4IHKA 4M1TA 4PSCA 3NIBA 3AFIA 3AJ8A 2GJ8A 3U4IA 4HPXB 1AN0A 1E64A 4G0VA 3NNNA 4WT7A 5DHFA 5JCOA 1D2NA 3U3MA 3NJRA 3VPGA 5C3MA 3K71B 1H85A 1JVBA 1XEWX 2HA7A 2O0KA 2YCBA 3N86A 4FHDA 1SD2A 4V0LA 4CM4B 4AZ3B 4BGDA 2AR0A 3K70D 3PLAE 4X6YA 4G63A 1J0CA 2YVLA 1NBOA 4RC9A 1JBEA 1WOYA 3AIOA 3SYKA 2X4LA 3N74A 1B8UA 1N0HA 4V0NA 3GJZA 4B85A 5CB0A 5CT5A 2I7DA 4HNTA 3F5FA 1ORTA 4DYHA 1I2DA 3SYLA 3UW3A 2HK8A 1Z0SA 4Q9KA 3H2ZA 5JISA 4C4AA 3PEEA 2H7YA 1QZZA 3QJGA 3FSEA 4AMGA 1QH8A 3LYLA 5T8KA 3LY9A 4MW2A 3VZQA 4KU4A 1P8AA 1ZGJA 1OHHD 2PZMA 2QN8A 4WZAB 4HZUA 2ZJAA 4OQXA 3LQ2A 4HNHA 2RGNA 1VCIA 3SEFA 1YDHA 2PZGA 3BUSA 1VL5A 3DYBA 1O77A 3GLQA 1MV5A 2EWMA 4G8JA 3I92A 2DMRA 2ZXFA 4N6GA 1PL6A 3SXPA 4AO7A 4AU1A 3MZ0A 3QW2A 4HCJA 5DI3B 2DY0A 4FGKA 2BPOA 1UMCA 3R24A 1E1RA 2X4IA 1PKXA 2CNOA 2X76A 3HO8A 1QF7A 3WLOA 1E3WB 3QEOA 1KU6A 4UDNA 5AK3A 1XZFA 3T15A 2JPDA 5CLIA 2IOFA 4B3JA 2MINB 3FHLA 1F2VA 1J1ZA 1UCFA 1UZNA 2E6UX 2O5VA 1U65A 3H6KA 4H6PA 4OF4A 2AX3A 3T7JA 3N2KA 1I5EA 4EB6A 4D4LA 4ZJPA 4YMTA 3UT5A 1Y6ZA 3OCCA 1U5AA 2OMEA 4Q7MB 4F96A 2QE6A 4RH3A 1XA4A 4TTIA 1K9SA 3BDAA 4D8VA 1J2RA 2QXUA 3HA3A 3NHKA 4CZ2A 3HUUA 1F1JA 4GW3A 3ILXA 3QVLA 3OJCA 2XD4A 3GRUA 4JUBA 4UMEA 3GAFA 3M6XA 4GZ3A 4UBJA 4BP3A 4PFSA 5KYWA 4ND5A 4ZQCB 2SNIE 2CNNA 4G0NA 2A4MA 4BO4A 4YR9A 4TX1A 2WJVA 4DGSA 1P4HA 2OBLA 3FOAA 3P0FA 4X3CA 1C0PA 4IJKA 5DOVA 3OETA 4CETA 4KUEA 4F84A 4RQAA 1WPRA 4S12A 2ONJA 5HQTA 3R3JA 3R41A 1SBHA 1QFJA 3IOCA 2BFBA 4AS2A 4LJAA 5DSZA 3FPSA 3ZK8A 1PQUA 1RWPA 2AN3A 2ORVA 2QN7A 2XH8A 3IVRA 4PRLA 2J9XB 3EZ7A 3AHDA 4JEHA 4F2GA 2QDXA 3B13B 4FYKA 1R0ZA 1ZJWA 3ZH2A 2ZTLA 3L1VA 4GBMA 3UAYA 3C4QA 2IX9A 1W0JD 4Y7DA 1YHYA 4TROA 2IUFA 3BSSA 2CL5A 1T0IA 2JS7A 4LX0A 3I45A 2P9TA 1ML3A 1QHNA 2Q7XA 1LSOA 1SB9A 3BCRA 3KKOA 4JVLA 4QU0A 1H2XA 1SOMA 2GCGA 3C7CB 3G23A 4RFLA 3ZK9A 1GUFA 4RQTA 5TQ0B 5LQCA 1DKRA 3SKXA 2W6PA 1FXWF 1MXFA 4FE4A 4A23A 5EEGA 2OHGA 1CERA 5AI9A 4DDTA 1XAHA 3CLVA 1Q0UA 4C7VA 3AR6A 4QRHA 4EZIA 5FWYB 1K88A 4HV4A 2RGEA 4W5QA 2VJCA 3AF3A 4LFCB 4PG7A 3OI7A 5K0LA 1XDSA 1GR1A 2CC2A 3K4QA 4XTRA 4Z9BA 2VT6A 3AF4A 9MHTA 4Q34A 5K3OA 2W2TA 4LQCA 3AUAA 4IOJA 3D5EA 1Q0QA 2DLDA 3ICWA 4OQEA 4QYMA 4JKOA 4DLLA 1GZDA 4ZV7A 3VZPA 4GGMX 1ID8A 4XDHA 3Q98A 5D1NA 1JDZA 3W2IA 2AFHA 3KJEA 5KSZA 1RAGA 1TM1E 3E9EA 1PX0A 1UMDB 4KIJA 3JYOA 5LP6C 3GPLA 1JR3D 4JB3A 3QIAA 3PC2A 4DR1B 1XMVA 4OYYA 3UHOA 3K6JA 3PNPA 1WNTA 1CQZA 2Z8ZA 4BMNA 3KB1A 1KQGA 2QU8A 1BFUA 5EKUA 2XOEA 1QYRA 2VI5A 3RRXA 3H18A 4BAZA 2NO0A 5BN3B 5C8ZA 3TTUA 4MA4A 1E5VA 5TQVA 1N5JA 3BM5A 3E82A 5E0KB 1PG0A 5AM5A 3EXHA 2P4UA 1HMPA 2R6CA 1QUFA 4BX8A 5JDCA 4BVFA 1MAHA 3DE3X 4BNZA 2GM3A 3HCCA 3ZKWA 2N1BA 2VYFA 2ZUCA 3TRDA 5IANA 4RGVA 2FPMA 3ZGZA 2ZJ1A 3BWYA 1X0VA 3TXYA 4BXOA 4LZZA 1EWVA 3AWDA 4Q03A 1AO0A 1FSZA 1PUIA 3AB7A 3BMQB 3HWX1 3JQBC 4RSRA 2QT1A 4CI0B 2FW1A 4AG5A 2CL6X 2DERA 1JTVA 1Z26A 3HKDB 1G8YA 1N57A 3DZDA 2FFJA 1O95C 1XKQA 2BEJA 2WUWE 2XTZA 2GHIA 3KCNA 4HWSA 1L3IA 4HDMA 4C5AA 4DYVA 5K3EA 3QLVC 3ACCA 2JFNA 3GLTA 4HLUC 1VE9A 5C3UA 2D2FA 2YN4A 3NHLA 4D9NA 1BEEA 1CX9B 2QAJA 4ZI5A 3DD1A 4HXGA 5CD9A 1LEHA 2DRIA 3IERA 4IIJB 4KIFA 5LDDC 2M1ZA 3EB9A 2QBYB 3GNQA 1LBHA 1MF7A 2OBFA 3N59A 5TMEA 1FMTA 1T25A 1S7GA 4DMMA 1CIJA 4MPJA 2AUNA 1MOZA 4OJYA 4ZPXA 1ZIPA 1O2DA 4J3JA 4BZQA 3F67A 5BPHA 3TUJC 4UCXA 5JO9A 4FMPA 4LIPD 1YL6A 3LY8A 2YWGA 3DEYX 1GV0A 1G7RA 2D2XA 3AFNA 3WGYA 1MIOA 1ZH2A 1V8ZA 1BJTA 2QE7A 1ZEJA 3ICPA 3TBKA 3A2LA 2QAIA 2B4TO 2CCJA 1AURA 1DBVO 2Q0SA 3FR7A 3QPUA 4IS3A 5DM60 2IXBA 1H5NA 2WFLB 2RG7A 2P9ZA 5D1HA 4B8ZA 1U2QA 1XCGB 2NV6A 2VH5R 3GEPA 1OI3A 1NVVQ 1Q12A 2PQMA 2VBGA 4X8OA 4L2IB 1KIFA 1C7IA 1LLUA 1GUDA 4YS6A 4GU5A 1ORIA 2CXUA 4RGYA 3JQAA 3T5DA 1X8JA 2OBXA 3GMSA 3QG5A 4M8SA 2BZSA 4MUGA 1T4GA 3DULA 4D4IA 4B82A 4G9EA 5AOBA 4ALLA 4JV5B 2JBAB 2D2EA 4WLNA 2MYUA 1NQXA 2HTFA 1IPHA 3IQFA 5AUQA 3O4IA 5FL7D 3AKDA 2RBGA 2IYEA 1YVRA 4QGHA 4YX9A 4Z3OA 5HOEA 5IVHA 1O87A 4CR7A 2GAJA 4R68A 3AHCA 5HFAA 4AYTA 5IEJA 5KOJB 5F9HA 3SHOA 3USZA 1TFRA 1Y1PA 1N4AA 1MG0A 4HL6A 3B9PA 2XNDD 3LX4A 4XD7A 2JI7A 2QNIA 3EDMA 3G02A 2VQ6A 3N2YA 3CURA 1GVHA 1XCJA 1N3LA 1KTIA 2O8FA 3C3PA 1RPNA 2VPQA 4QXAA 1WZEA 2GZAA 2ONKA 2G04A 1CHDA 1VFPA 3ENQA 1DPFA 1G3RA 1WG8A 3B20A 3KWLA 3M1YA 2Q9UA 3GRYA 3MMXA 3QYPA 3H86A 2HO4A 1C7ZA 4LYDA 4NABA 5DLQC 4HN2A 4ZIRA 1TAGA 2CJPA 4YRBA 1VA5A 6CHYA 3SC6A 2YKGA 3ABIA 4MCJA 4LYYA 5SZIA 4CLOB 1UDAA 4J9VA 1KEZA 4PTZA 4KXLA 2JEZA 2Y1FA 2BM1A 2WE8A 2FQWA 4BAGA 4JLVA 5GIPE 3MGBA 3CFYA 5C1PA 3IRUA 3KX2A 3TD6A 2GHTA 1UBTS 3E9CA 3ZDFA 1TT7A 2HPVA 3C8DA 3GQVA 3FSRA 5B64A 5FOQA 1M8FA 4X1YB 1XJCA 4MVJH 3LUHA 1DADA 4IDEA 2FPGB 3I2IA 4LTNA 1EEXB 4FDLA 3UWKA 3PGJA 1H4TA 4GPBA 1W36D 1DQSA 4JROA 1T8YA 2V6GA 4PLHA 2V4ZA 1Y8QB 4DBZA 4I1IA 3Q3VA 3KYCB 1E3TA 2W6IA 3Q5DA 3SYTA 4F9EA 1SU8A 2CYCA 4EB8A 2J59A 2PX8A 2TMGA 2A86A 2XDYA 4Q12A 4TMFA 5HKKA 4Q7EA 4R54A 2IHKA 4J07A 4WFKA 2XQGA 1YDFA 1JAZA 2H4ZA 2XCQA 3EGXB 2GARA 4TLBA 5B7QA 2C1XA 3D2LA 4OH1A 1QPBA 1HH4A 3NHUA 3C5CA 2V9PA 5D86A 3MGCA 3UXEA 4MWTA 4FBMA 3HXQA 1G59A 3KVRA 2ASVA 4ZYTA 4D8UA 3O1HB 1Y80A 5JR3A 3ZI7A 1D1PA 1SHUX 2D5BA 2YQZA 4O0LA 2PL3A 1ZWKA 3CLSC 2Q2NA 3PFNA 4MLPA 1O8CA 3UFXA 2ADOA 3AF0A 5KNBD 5JZBA 4LWPA 1GTRA 2ZYWX 3W6UA 1OV4A 1YR6A 1CUAA 1U1IA 2HD4A 2ZZKA 1P1RA 3FCSB 4LMBA 5EKSA 4GWKA 2NO6A 5DI9A 4GL2A 3HI4A 3KQQA 3G2NA 1TUEA 3ZWAA 2IEDA 2G77B 1U1GA 2OWEA 1Z73A 3AQ4A 3L8YA 3TIGA 4AUMA 4XI9A 3SM3A 3PXEA 3N6RA 2QLFA 3DJFA 2FF5A 4NV0A 3ZWNA 4F86A 2QF7A 2DPGA 1X38A 3G0IA 4FNOA 3WICA 1UOEA 1DAOA 1F2DA 2F1OA 2I3GA 2ZQYA 3DW1X 3MS2A 3NNSA 1KYTA 4L76A 4UUPA 1ISMA 5A4KA 5JSQA 1MAWA 1MU0A 1YCFA 3CG0A 1T0UA 5EP4A 2XMSA 3RTCA 1YDEA 4F3CA 1QFZA 1EE2A 2F64A 3SZMA 1FUIA 4V3CA 4PLGA 1T0JB 1GN9A 3RIEA 3MUNA 1A9YA 1A82A 2CMDA 1SZJG 1YQTA 5CGZA 5CG2A 1YWGO 1JEQB 1FBTA 4HAWA 4YAOA 3TLBA 2P2SA 1DRJA 2H29A 3WMGA 2PFKA 4G0YA 1X7WB 2XCTB 1NJ5A 4QC2A 1ZMRA 1YONA 3QU5A 1GT91 1FNBA 4JLUA 3PSHA 3FYHA 2C5FA 5J4HA 3HZRA 5CB4F 1CQPA 1BIFA 2ZU0C 5ALSA 4FHGA 4NULA 1QOQB 1GY8A 2CHVA 3BGIA 4TZ6A 1KBZA 1HQKA 2GZ3A 1KDZA 4DAOA 4EB0A 2CV2A 1AKEA 1ZUNB 1ZITA 2VA8A 2NN3C 4JOSA 4FYPA 1M6NA 4B75A 3DR3A 4P7BA 5A71A 1EXVA 5FWXB 1G8MA 4RULA 2AWOA 1TADA 1SG9A 2HV8A 5KOYA 3TVDA 2Y9PB 1H9CA 2P40A 2VZEA 2C2YA 4EA6A 1I4OA 5CNMA 1FF9A 2HWXA 3B6EA 1H6AA 4PC6A 5K0ZA 1RXWA 2YDYA 3FB1A 4FCVA 4CT4B 4YV0A 1X6VA 1HFKA 1WSAA 3G9ZA 2O2SA 4FDMA 1R9GA 1DBWA 1TW2A 4XD2A 4ZEWA 1OV6A 2NU9B 4G97A 5KKCA 2J33A 3ZD7A 4YUYA 2P2YA 3I4CA 3IUEA 4U5QA 2FSHA 3L7KA 1U28A 1F38A 2QAGA 3GD5A 3QKRA 2RK4A 1E69A 5GWXA 1DO2A 1Y48E 4O5OA 2J3LA 2INGX 2V54A 1B43A 4K81B 3NEYA 3QKSB 1XZGA 3QVSA 1LK7A 1SZCA 4H1HA 1FL9A 3F3MA 4L0CA 3SS7X 3EOZA 1JDBB 2AOXA 3A27A 3EH1A 4N18A 1PAUA 4QBFA 1GL6A 3CGWA 2J67A 4W5WA 3UQYS 4G0QA 4AUEA 1EX1A 1BMTA 4NOMA 2VWGA 4N0DA 4NBKA 5E7MA 1W581 3VA7A 5KS2A 3FCAA 1SBCA 1H2HA 4KR0A 3TNFA 3S2GA 1CT9A 3M5DA 3DMFA 3OUZA 4FQ5A 4B6SA 3DV0A 3WLMA 4B71A 1HDEA 1PS0A 1DUIA 2C95A 3B1XA 5EJGA 4PYNA 5FLYA 3RR2A 4YAUA 1G0NA 4KUGA 1VLLA 2P75A 1CQWA 3I42A 3K0KA 2I7XA 3PVSA 3BIJA 3VAZA 4RJJA 3A1NA 3EQ9A 4CNQA 4RVDA 4W63A 4KITB 4G56A 4H27A 3I6MA 2DPHA 3WHLA 3VKHA 1H05A 4FSHA 1QR2A 4YEDA 1JPNA 3MQ4A 4GWGA 2FDCA 1TD1A 2IV3A 3LLSA 3LQRA 3PV0A 3RYIB 1X1TA 4GMXA 4OO3A 5A4AA 1TTPB 2I4LA 3EAGA 4RAOA 3T41A 5BSWA 4C06A 1Y1TA 3OURA 2AKYA 3LA8A 4OL9A 1W8DA 1V3TA 1LLFA 3GEHA 4GOOD 4Q3AA 3UJ8A 5K8CA 3NGMA 3VPFA 4ARIA 3H84A 2N42A 3GIDA 1V43A 1P6QA 3F5QA 2AW5A 1U8UA 3WGZA 2ZDHA 4WWHA 5EIAA 3Q8LA 2PLNA 3U7JA 4LGYA 5D87A 4AUNA 1UF9A 1XROA 3AI2A 4NZ9A 1MX9A 4TYMA 2UYQA 4Y6RA 4BV3A 2X0NA 2FSIA 1QNFA 2BFBB 2PRKA 4ETMA 1XWWA 2QPLA 4R1MA 1S2LA 3KWJA 2AS0A 1JT2A 5CA1F 3AEUB 4PYQA 1CVRA 1DXOA 4DDWA 4LRSB 3U7HB 2O8DA 4KWHA 1LDMA 1JHOA 4Q9NA 2K87A 1VMEA 3QF4B 2A6PA 3VYWA 1YULA 2Q0HA 1G19A 3G2OA 3KKLA 1NATA 2GD6A 2QE7D 1B76A 4J91A 2GUWA 4GICA 4WN9B 3RQSA 4KO2S 1S5PA 4C03A 1KI6B 2QUJA 4QQKA 3HP1A 4NJOA 4HQRA 3GUHA 4KIWA 2X13A 3PXBA 3SPXA 5KWSA 3HTXA 4L28A 5BO5A 1BWSA 1EGVB 4NF2A 3AP2A 4BZPA 1K66A 4URWR 5IW8A 3U31A 3UT5B 3LX6A 1APBA 3G1UA 3VR6D 5JI3E 3GG9A 3HVHA 1QH1A 3CTPA 2Q9AA 3U3XA 3QEMA 4UVIA 2DAPA 3I6YA 1KZHA 3T3IA 3BQ9A 3WI7A 3S8EA 2I2BA 3R74A 4RK1A 2Z4RA 5M29A 2P2GA 1GQSA 4MWZA 3JQGB 2HCBA 3S2UA 3BL8A 3VO8A 1RYYA 1XD2A 3EIWA 4BGUA 4EEZA 2AX4A 4FFBA 3OF5A 3ZE2B 4J90A 1SBIA 3EC7A 4M60A 3WIBA 4LXUA 5LUAA 3HCPA 1CXZA 2Q28A 3M8KA 2JRCA 3FSJX 3DDCA 3CUSA 4H7IA 1XL0A 4ZV4A 1Y7HA 1MORA 1FPQA 1QK5A 2QR2A 3SZGA 4CN8A 2XB8A 1N2BA 1PZXA 1HFEL 4MQEA 3PPVA 4RKYA 4YH1A 5JS1A 1ZXBA 5DRTA 3KO8A 1J8MF 4XRGA 1MFZA 5A6SA 4M6WA 4Y3UA 2WHYA 1IZ9A 2Z2KA 5EMNA 3BXZA 1U1FA 4JI6B 3ZEAA 4H7JA 4G67A 5AK0A 4DABA 1EJBA 3TMAA 1SK8A 5M04A 4RTMA 2X8JB 3EMBA 4D8WA 3U4QB 2XEXA 4DR5B 1SEPA 1L4KA 4US2R 2HLDD 3EY4A 4N0QA 1FMFA 1NURA 3U7QA 3VMFA 2QM3A 5EP2A 3EQZA 2NSLA 5J4YA 4N6NA 2YIDA 1CVIA 2VDLB 4PR0A 1GDHA 4LHSA 2JFPA 1G0OA 4OPMA 1PUJA 3THSA 2HIAA 1MA0A 2HXYA 3BIFA 4IFEA 4L73A 5KYXA 1P2DA 1K5GA 1VYHA 4MEBA 5ALUA 5I8PA 3Q9SA 2DSTA 2ECKA 2HJRA 1GTZA 2FHPA 4GMGA 4KDEA 4MICA 1PEAA 2VXYA 2WB4A 621PA 3LPDA 4Y1RA 4DQDA 4BX9A 3U4CA 3O95A 4PO1A 2ZRHA 3UCEA 1R66A 3VH1A 4D02A 1E0KA 3JQFA 1KL7A 1PFGA 1P7WA 1F2TA 3WK5A 1C2TA 1Q15A 3OO0A 1YDMA 5DWVA 5KX5B 4ER3A 3Q87B 1GU0A 3V8RA 2IXGA 1D2CA 2PGDA 2Y6UA 4AVYA 3B1FA 1NSTA 3KT0A 4WBSA 5CB8A 3T1OA 2AGVA 4OFZA 2XUAA 3HYTA 3SIXA 5K3AA 3SLKA 4YMUA 1PSDA 3RYFB 5AW4A 3CT6A 2VKTA 1X9GA 3ZWXA 2Q3HA 4PBTA 1G64A 3D4LA 5LYJA 2BOVA 1U0NA 2QN3A 2WG0A 1J7JA 2LPMA 3OMWA 5LP1A 3E53A 5K8UA 3SX2A 1IH8A 3DR5A 1P2GA 3TLEA 1LDBA 4LYJA 4U7JA 2P9BA 4Y9UA 4I4NA 4KK3A 2B7CA 3UKJA 3K2IA 4Y2YA 3VYSB 6REQB 3C6KA 4OQZA 5DYYA 4DV0B 3OKAA 5EZQA 4E5KA 3K05A 2QQGA 1JDJA 1GPKA 1QYCA 3HVUA 2XEDA 2YBDA 2VSXA 2AQHA 2OHHA 3KB8A 3OIDA 3E9RA 5ALGA 1PE0A 1Q3TA 2A1UB 1SZDA 1BN6A 2FVYA 2ZSUA 1GA6A 3B2EA 1TVKA 1ZN7A 4HNSA 4WCFB 2QVGA 4W7SA 5T5QA 1PJLA 1KPGA 4ED9A 1OIWA 2DUMA 1OILA 1U4SA 3AHJA 4ZVKA 3VNBA 1DS6A 2XE6A 4B44A 2LIVA 4EHIA 3M83A 3F3KA 2C03A 1Y6GA 2J3EA 2OZLA 4BNGA 3LQQA 2O8CB 1D2RA 1EBBA 3CUYA 4G6ZA 3GG2A 2YZ7A 4CYMA 3BA1A 5KYUB 4B09A 2AN4A 1WQ3A 4FMDB 4HQNA 4E2WA 4K86A 2UAGA 4ZEXA 2FH5B 1OYOA 1E2JA 1MHPA 1TLFA 5FEUA 1KPHA 1VKZA 3K0AB 2YWHA 4FZ3A 1JV2B 5D2CA 5FYDA 5JPIA 3ME5A 4UW9A 2DM6A 1NUAA 4HNRA 1WKCA 4J3FA 2XCSB 4HNAA 3BSFA 3TN7A 2VJMB 2AR9A 8ADHA 4TWAA 2A94A 2WTXA 1OFUA 4JFAA 3CE9A 4RSGA 3C14C 4WIAA 2ZULA 3PBKA 4C4YA 4QBHA 3PX7A 4EJ0A 2MT9A 1YFKA 2W37A 4TTTS 1N2OA 1Z3CA 3EVAA 1ZJ4A 4N82A 4CUKA 3AEQA 2GTHA 1V9LA 5ABPA 2Y0CA 4HHEA 3PJGA 3C3WA 3QPCA 4LBWA 3PQ4A 2JHAA 2C31A 1XA3A 4PWZA 2AC4A 1AN9A 3O38A 4XARA 5JU6A 3V1NA 3GGGA 4QXMA 2ZCVA 1A72A 3QP9A 3C15C 4YONB 2Q8PA 2QYSA 1RHJA 2EAUA 2CJXA 3B12A 1NZDA 1ZKMA 4NMLA 4D44A 1E0AA 2QD1A 2I78A 1M2HA 4S3MA 3RBVA 5EJ8A 1L7QA 4WNYA 1T5IA 3CEMA 3KQPA 4CXMA 3AI1A 2ZRFA 2OG2A 2X0DA 1FJ2A 1QM5A 3ABOB 1ACLA 2OO3A 2BI4A 3X0DA 3O9VA 1S3IA 1XEFA 3NHBA 3LP5A 4UHKA 4PCLA 2FW7A 1MRNA 1TIBA 3C97A 2GCPA 4WN9A 3AXTA 3JRXA 5TVGA 1GSIA 5SYMA 4ZAYA 4ZVUA 2JKVA 3UA3A 4GOXA 4X7MA 3ZJTA 1P4GA 2QTFA 4A4DA 4ACBA 1ODJA 4GX1A 3F2VA 4UHEA 4WXRA 4Z1MD 1Z4KA 1NYQA 3LHFA 1USWA 5JC8A 1DRWA 3OFND 4CWAA 3O73A 1RLOA