5FANA

Crystal structure of pvhct in complex with p-coumaroyl-coa and protocatechuate
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
448
structure length
435
Chain Sequence
GHMKITVRGSEMVYPAAETPRRRLWNSGPDLVVPRFHTPSVYFFRRRDGEGNDLAAADGSFFDGARMRRALAEALVPFYPMAGRLARDEDGRVEIDCNAGGVLFQEADAPDATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVVQVTHFKCGGVAIGVGMQHHVADGFSGLHFINSWADLCRGVPFAVMPYIDRSLLRARDPPTPVYPHVEYQPAPAMLSPPAAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAGVAEGAAVIQAALDRMDEGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title Exploiting the Substrate Promiscuity of Hydroxycinnamoyl-CoA:Shikimate Hydroxycinnamoyl Transferase to Reduce Lignin.
pubmed doi rcsb
source organism Panicum virgatum
molecule tags Transferase
total genus 129
structure length 435
sequence length 448
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5fanA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5fanA01
3U9BA 1E2OA 4JN3A 2E1UA 3L60A 1CLAA 1SCZA 2VSQA 4HVMA 1EAEA 4CLAA 1Q23A 5KJTA 5FANA 1EACA 1C4TA 2II5A 1EAFA 2II4A 1L5AA 4N72A 1QCAA 2RKTA 1PD5A 2IHWA 4G0BA 1XMDA 2BGHA 2E1TA 2JGPA 3FP0A 1EAAA 3FOTA 2II3A 1DPBA 5FALA 1DPDA 5KJUA 1CIAA 2XHGA 2CLAA 2E1VA 5DUAA 5KJWA 1EADA 5KJVA 1EABA 3B2SA 1XMCA 4JN5A 1NOCB 3MAEA 2RKVA 1Q9JA 1XL8A 1XL7A 4G2MA 5DU9A 2ZBAA 2XR7A 4KECA 3CLAA 4G22A 5T3EA 3U9FA 5KJSA 3B30A 1DPCA 4KE4A 2I9DA
chains in the Genus database with same CATH superfamily
3U9BA 1NDBA 2E1UA 3L60A 2VSQA 1EAEA 4CLAA 1C4TA 2DEBA 4N72A 1T7NA 2RKTA 1PD5A 2IHWA 2RCUA 2BGHA 3FP0A 5KJUA 1DPBA 5FALA 5KJWA 4JN5A 1NOCB 3MAEA 1T7QA 5DU9A 4G2MA 2FY5A 2XR7A 4KECA 3CLAA 5KJTA 5T3EA 2H3PA 1CLAA 4HVMA 2II5A 2II4A 1QCAA 1XMDA 3FOTA 2II3A 1DPDA 1CIAA 2H3UA 2E1VA 4EP9A 1NM8A 5KJVA 4EPHA 1Q9JA 2ZBAA 4G22A 2FY3A 4KE4A 4EYWA 1E2OA 4JN3A 1Q6XA 1SCZA 1Q23A 2FYOA 1EAFA 1L5AA 1T1UA 2H3WA 2H4TA 4G0BA 1T7OA 1NDIA 2E1TA 2JGPA 1EAAA 2FW3A 1EADA 1XMCA 2RKVA 3U9FA 5KJSA 3B30A 1DPCA 2I9DA 5FANA 1EACA 1S5OA 2XHGA 2CLAA 5DUAA 1EABA 3B2SA 1XL8A 1XL7A 2FY2A 2FY4A 1NDFA
chains in the Genus database with same CATH topology
3U9BA 1E2OA 4JN3A 2E1UA 3L60A 1CLAA 1SCZA 2VSQA 4HVMA 1EAEA 4CLAA 1Q23A 5KJTA 5FANA 1EACA 1C4TA 2II5A 1EAFA 2II4A 1L5AA 4N72A 1QCAA 2RKTA 1PD5A 2IHWA 4G0BA 1XMDA 2BGHA 2E1TA 2JGPA 3FP0A 1EAAA 3FOTA 2II3A 1DPBA 5FALA 1DPDA 5KJUA 1CIAA 2XHGA 2CLAA 2E1VA 5DUAA 5KJWA 1EADA 5KJVA 1EABA 3B2SA 1XMCA 4JN5A 1NOCB 3MAEA 2RKVA 1Q9JA 1XL8A 1XL7A 4G2MA 5DU9A 2ZBAA 2XR7A 4KECA 3CLAA 4G22A 5T3EA 3U9FA 5KJSA 3B30A 1DPCA 4KE4A 2I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9B A;  1E2O A;  4JN3 A;  2E1U A;  3L60 A;  1CLA A;  1SCZ A;  2VSQ A;  4HVM A;  1EAE A;  4CLA A;  1Q23 A;  5KJT A;  5FAN A;  1EAC A;  1C4T A;  2II5 A;  1EAF A;  2II4 A;  1L5A A;  4N72 A;  1QCA A;  2RKT A;  1PD5 A;  2IHW A;  4G0B A;  1XMD A;  2BGH A;  2E1T A;  2JGP A;  3FP0 A;  1EAA A;  3FOT A;  2II3 A;  1DPB A;  5FAL A;  1DPD A;  5KJU A;  1CIA A;  2XHG A;  2CLA A;  2E1V A;  5DUA A;  5KJW A;  1EAD A;  5KJV A;  1EAB A;  3B2S A;  1XMC A;  4JN5 A;  1NOC B;  3MAE A;  2RKV A;  1Q9J A;  1XL8 A;  1XL7 A;  4G2M A;  5DU9 A;  2ZBA A;  2XR7 A;  4KEC A;  3CLA A;  4G22 A;  5T3E A;  3U9F A;  5KJS A;  3B30 A;  1DPC A;  4KE4 A;  2I9D A; 
#chains in the Genus database with same CATH topology
 3U9B A;  1NDB A;  2E1U A;  3L60 A;  2VSQ A;  1EAE A;  4CLA A;  1C4T A;  2DEB A;  4N72 A;  1T7N A;  2RKT A;  1PD5 A;  2IHW A;  2RCU A;  2BGH A;  3FP0 A;  5KJU A;  1DPB A;  5FAL A;  5KJW A;  4JN5 A;  1NOC B;  3MAE A;  1T7Q A;  5DU9 A;  4G2M A;  2FY5 A;  2XR7 A;  4KEC A;  3CLA A;  5KJT A;  5T3E A;  2H3P A;  1CLA A;  4HVM A;  2II5 A;  2II4 A;  1QCA A;  1XMD A;  3FOT A;  2II3 A;  1DPD A;  1CIA A;  2H3U A;  2E1V A;  4EP9 A;  1NM8 A;  5KJV A;  4EPH A;  1Q9J A;  2ZBA A;  4G22 A;  2FY3 A;  4KE4 A;  4EYW A;  1E2O A;  4JN3 A;  1Q6X A;  1SCZ A;  1Q23 A;  2FYO A;  1EAF A;  1L5A A;  1T1U A;  2H3W A;  2H4T A;  4G0B A;  1T7O A;  1NDI A;  2E1T A;  2JGP A;  1EAA A;  2FW3 A;  1EAD A;  1XMC A;  2RKV A;  3U9F A;  5KJS A;  3B30 A;  1DPC A;  2I9D A;  5FAN A;  1EAC A;  1S5O A;  2XHG A;  2CLA A;  5DUA A;  1EAB A;  3B2S A;  1XL8 A;  1XL7 A;  2FY2 A;  2FY4 A;  1NDF A; 
#chains in the Genus database with same CATH homology
 3U9B A;  1E2O A;  4JN3 A;  2E1U A;  3L60 A;  1CLA A;  1SCZ A;  2VSQ A;  4HVM A;  1EAE A;  4CLA A;  1Q23 A;  5KJT A;  5FAN A;  1EAC A;  1C4T A;  2II5 A;  1EAF A;  2II4 A;  1L5A A;  4N72 A;  1QCA A;  2RKT A;  1PD5 A;  2IHW A;  4G0B A;  1XMD A;  2BGH A;  2E1T A;  2JGP A;  3FP0 A;  1EAA A;  3FOT A;  2II3 A;  1DPB A;  5FAL A;  1DPD A;  5KJU A;  1CIA A;  2XHG A;  2CLA A;  2E1V A;  5DUA A;  5KJW A;  1EAD A;  5KJV A;  1EAB A;  3B2S A;  1XMC A;  4JN5 A;  1NOC B;  3MAE A;  2RKV A;  1Q9J A;  1XL8 A;  1XL7 A;  4G2M A;  5DU9 A;  2ZBA A;  2XR7 A;  4KEC A;  3CLA A;  4G22 A;  5T3E A;  3U9F A;  5KJS A;  3B30 A;  1DPC A;  4KE4 A;  2I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...