5FBHA

Crystal structure of the extracellular domain of human calcium sensing receptor with bound gd3+
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
517
structure length
470
Chain Sequence
PDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDIIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDEGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of human calcium-sensing receptor by magnesium ions and an unexpected tryptophan derivative co-agonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Extracellular calcium-sensing receptor
total genus 146
structure length 470
sequence length 517
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA01
4YWHA 4RK7A 4S05A 4RK4A 3IDOA 3I42A 3EULA 1DRJA 2FVYA 2JVKA 4KQCA 1EHCA 4RWEA 5IC5A 1KMIY 1Z2EA 3N8IA 4RK1A 1FFGA 3DZDA 4OLBA 2PLNA 3FFWA 2FQXA 4MRMB 3F73A 5GOTA 3KJXA 4YGXB 5IX8A 4RY9A 3LUGA 3SNKA 3EAFA 3IPCA 3F7NA 3OLYA 1W9HA 1SXGA 3QELB 1JF8A 3LUDA 3CFYA 4WXMA 3N0WA 5TQ2A 1D4ZA 1SD5A 5FBKA 3KHTA 1PNRA 3LUKA 5JNWA 3IP7A 3O21A 4D6XA 4N76A 2OENG 1OXBB 3JPYA 1NXTA 3LTEA 3HDVA 4OTZA 1C0EA 2A9OA 3O1HB 3L6UA 4W5NA 4G97A 1HEYA 2QVGA 1Z13A 4MS1B 3H5VA 4G0OA 4KV7A 1NXPA 4DADA 5KQPA 1FSPA 4TLLB 2IDMA 4EYKA 2F8TA 4P98A 3T8YA 4LRQA 1I3CA 3E3MA 3Q41A 5TPWB 5DCLA 3QEMA 1P2FA 5TQ2B 2PUDA 2WB4A 1QQAA 4Z4IA 4OLAA 3LFTA 1CHNA 4LDZA 3O75A 3H5IA 4Z4EA 1ZH2A 4TLMB 4JB0A 5KC8A 5EWJA 5KI6A 1MB3A 3EODA 4O1HA 4MR9A 1NXOA 1JBEA 1YIOA 1XHEA 1ZESA 2L2QA 1RPJA 1QP7A 5C5EA 4KK4A 1EWTA 2KYRA 3EDCA 4UHKA 5GQSA 4YR7A 3LMKA 2P4UA 3NHZA 1P6UA 2WRZA 3HVRA 2FEWB 4RKQA 3I09A 1NTRA 1PNTA 2CHEA 4EYQA 2MYUA 3A0UA 1M2EA 4IILA 1RZRA 2WMYA 3MF4A 1LK0A 3BBLA 1E6MA 3H5OA 3GA5A 5TE9A 4D74A 1JYFA 4P1ZA 3NNSA 1F4VA 4Z9BA 3N0RA 2PUCA 1DP4A 2PUEA 2JK1A 1ABFA 3CTPA 1AB6A 3H1GA 3MQ4A 4JP1A 4MAAA 4RXTA 3H75A 4RY0A 1QMPA 1E6KA 2H3HA 2FMHA 2XDYA 1Z18A 4IRXA 5EWMA 3HS3A 1ZITA 4ZYLA 2LPMA 4JB2A 5JNUA 4MQEB 4G0XA 3M6MD 2GBPA 4FE7A 3CU5A 2L17A 1Z2DA 2HQRA 5DGCA 2IPLA 1NATA 2JBAA 3Q9SA 4MR7A 3T38A 3LUAA 3I5AA 4MQFB 3C3MA 3NHMA 4WT7A 2I6FA 1RXEA 5FWYA 1MB0A 5JNVA 2VYCA 3BILA 4KRFA 1EFAA 3KYIB 4KNYA 1Z12A 5JNSA 3HUTA 2E4VA 3JVDA 4KVFA 3IPAA 2JBAB 4MR7B 4RSMA 2MYPA 7ABPA 5DLEA 4QYWA 5DTEA 1D5WA 3RQIA 2HPHA 3GV0A 1JYEA 4XARA 4EVSA 4FB4A 3M9WA 5IEJA 3VNBA 3RVJA 5BR1A 3KCNA 5TPZD 4G0MA 2HSGA 3HZHA 4IGAA 2WY2D 1RZRD 5C5CA 3HK2A 3UK0A 2M1ZA 3RVKA 2N9UA 2F8SA 3SQNA 5EWMB 4DN6A 1VRVA 4MPTA 2JVIA 1E2BA 4WUTA 5CHYA 3HM9A 2QXYA 1TVMA 2IOYA 2RGYA 5D2CA 4RKRA 1ABEA 1GCGA 2PUGA 3QEMB 4N03A 4W5OA 3D02A 3OLWA 5FWYB 4D6YA 2WJAA 1YVUA 3SM9A 1NXWA 2AYXA 3I45A 1SXIA 3BRSA 3TX6A 2QU7A 3OQOA 4MYRA 2AYZA 3EJWA 1BA2A 4YO7A 4MS4B 4Z9AA 4FE4A 3A0RB 3N6VA 1BDIA 2YHBA 1DCFA 5JS1A 2L18A 3HCWA 4RS3A 1LJLA 4ETNA 1B00A 4Z4FA 3QLVA 3QEKA 5BQ3A 3O2JA 3CZCA 4HNQA 3H6HA 1Z25A 3JPWA 4ETIA 1KRWA 2P9HA 2CD7A 1ZGGA 1NXVA 3URMA 3O74A 4KK3A 5PNTA 4EYGA 5CNJA 1H9CA 3RVLA 1TJYA 4Q7EA 2FN8A 3RVMA 2B1JA 5ED4A 2E4UA 2FN9A 2IPAB 3CG4A 2H0AA 2HQOA 3G85A 1DBQA 4G86A 3HUUA 1FFWA 4JOQA 1CYEA 3ROFA 1CEYA 4LE0A 4G0YA 4S04A 3Q7TA 1USGA 4Z0NA 1VKRA 1Z16A 2IPMA 1DRKA 1R8JA 5IUKC 1EWVA 3GT7A 3O2QB 2MYTA 4IF4A 1F51E 2FEPA 3L49A 3KG2A 4LE2A 3JY6A 1UDRA 2FMKA 2A9RA 3DBIA 2ZWMA 1TM2A 4L85A 1S8NA 4EVQA 3KTOA 4XAQA 1QNLA 3OMWA 4MS3A 4LDAA 3IP5A 3O1IC 1Y1LA 1OXKB 1NY5A 3P9YA 1MVOA 3CHYA 2FMFA 4XFKA 3KS9A 2A9PA 1DCMA 1U2QA 4MRMA 2PUAA 1DJMA 2HJ9A 5HSGA 1C4WA 1QO0D 3LUHA 1FFSA 3DLHA 3ILHA 3CKMA 4PYRA 5T3YA 4F11A 4E7OA 5KQGA 3CG0A 1LBHA 3HDGA 1A0OA 3HEBA 1DBPA 3Q7SA 2GI4A 2PAFA 1YK0A 2MSKA 4CBVA 5FWXB 1AB5A 4E7PA 4PICA 1RNLA 2R4QA 1SRRA 3RVQA 4Z99A 1KRXA 3N75A 4XLTA 3OQMA 4O5AA 2RJOA 5I4CA 1L5ZA 1YS6A 2QVCA 2FSPA 4O1IA 4YV7A 3A10A 1JH9A 4Z4GA 3HO1A 3OLXA 4NCBA 2FLWA 2FTKE 4YRZA 1ZDMA 3BREA 1T34A 1XWWA 1EAYA 2FLKA 3LOPA 4HNRA 3ILYA 1Z17A 2E4ZA 1U04A 2J48A 2MSWA 3LUFA 3IP9A 5HQJA 3CS3A 3N0XA 4F3TA 5B3JC 3N53A 1K66A 3D8UA 4Z4CA 3OO0A 3TD9A 1BDHA 3MIZA 4RXUA 5TPWA 3HV2A 4W5QA 3QELA 3DGFC 4Y9TA 3LUCA 5B3JA 5BRJA 4LX8A 3DGEC 1BDJA 2IPNA 3Q15C 1ZN2A 4EY3A 2M98A 2R48A 2DRIA 4MQEA 1VPWA 5CNKA 1P6QA 8ABPA 1APBA 1QKKA 1JLKA 1QO0A 3Q7RA 3OLZA 2WWVD 1U8TA 4PE5B 3RVRA 4GPAA 1ZAYA 3QLVC 4G0ZA 5CNIA 4YP9A 1GUDA 4TMYA 1W25A 3RH0A 2FQYA 1RXIA 4OBBA 4MR9B 6CHYA 5HKOA 5IUNC 2VUIB 3SG0A 4N41A 4KQ9A 3B2NA 2PL9A 3QK7A 3C6QA 1D2AA 3H6GA 1M5TA 2WJWA 3C97A 3GWGA 4N0QA 3K9CA 4L4UA 4H60A 4QICA 4ML3A 4MS1A 3IP6A 3H1EA 3MA0A 4RXMA 1U2PA 1PUXA 3FDFA 4RK5A 5EWLA 1DG9A 2IKSA 5TQJA 4MS3B 1DZ3A 5ABPA 2MSLA 2NZUG 2QV0A 3CZ5A 4RZSA 4H3KB 1USKA 4YCSA 1MAVA 4WXEA 6ABPA 2X7XA 1QQBA 3RVNA 4QPJC 4EVRA 3OLVA 5JNTA 2GKGA 3JVIA 3MM4A 1GLGA 2ZAYA 3K4HA 5E3JA 1U0SY 1VLZA 2E4WA 4RK6A 1USIA 3CNBA 3SY8A 2PL1A 3HXMA 2PMCA 3EQ2A 4HNSA 4WWHA 4MLCA 3CRNA 4KFCA 1NXSA 1URPA 2JB9A 3LUJA 4NICA 2GX6A 2NT3A 4JASB 4KREA 3QX8A 4UHJA 5TQ0A 3RVOA 1YTUA 3KLOA 4PEVA 2ID7A 3QLUA 5IEBA 2QR3A 1JL3A 1ZHHA 3OO1A 1ZGZA 2LIVA 3MMNA 3W9SA 3FFTA 2VUHB 3OQNA 1ZH4A 4YS6A 2TMYA 1Z26A 4F12A 4KZKA 3UKJA 1BVHA 1LBIA 3NNNA 3NNDA 4RU1A 3T6KA 1PEYA 4F8JA 1JFTA 2LP4Y 4TN5A 4WZZA 2FMIA 2YHAA 5KQMA 2PKXA 3KSMA 4YLEA 4N47A 3S99A 4OATA 4PZ0A 1GCAA 2QW1A 4RY8A 1XHFA 1IIBA 3GRCA 1D1PA 2V0NA 1JDPA 2IYNA 3FMVA 3KKEA 3R0JA 4HYEA 2CWDA 4H3HB 4EUKA 3QX9A 1EWKA 5CNMA 3O1JC 5JNRA 3DLBA 1M5UA 3UUGA 4ETMA 2FW0A 1YS7A 3H1FA 3H5WA 2CHFA 4MR8A 4MLDA 3A3KA 1JHZA 3EGCA 2PUFA 3RVSA 2HQBA 1M2FA 2B4AA 5KC9A 4W5RA 2VK2A 2Q5CA 3G1WA 3T95A 1J56A 4XXHA 2A9QA 1TLFA 4Q6BA 4KMRA 4OG2A 4GNRA 4QYMA 3JTEA 2QSJA 3CLKA 5JS2A 2R25B 4Q6WA 5KWSA 1KGSA 2RDMA 1DC8A 1QP0A 4N0PA 3F6PA 1K68A 1YMVA 4JAVC 3M9XA 3H5TA 5EWJB 3LKVA 1JFVA 1A04A 1JWLA 5TPZA 5TQ0B 4F06A 4ZPJA 3C3WA 5DKFA 1NXXA 1ZY2A 2GWRA 2MYNA 2FXIA 3HJFA 4IMIB 1JDNA 4RV5A 4RK0A 1DBWA 4NQRA 5IBQA 3C3KA 3GBPA 1YK1A 1E6LA 1JFSA 3FFXA 4MQFA 2RJNA 4B09A 4EGSA 3VNAA 2JRLA 3ROTA 9ABPA 3GL9A 5IUJC 1L5YA 4LZLA 3NBMA 1Z15A 1QPZA 3OM1A 4G0PA 1D1QA 2QZJA 2LBPA 1ISRA 1PEAA 3EQZA 4G0QA 5FBHA 1MIHA 2PJUA 4ZJPA 3GBVA 2JCGA 3KYJB 1WETA 3GYBA 4RDCA 3H5LA 1ZVVA 2NZVG 4NV3A 4KPYA 2ID9A 4MGEA 4NCAA 2R47A 1PHRA 2PUBA 1JX6A 2JVJA 3E61A 5IULC 2FQWA 2O20A 4M88A 4ZMSA 2NUBA 1YMUA 2PE5A 5FWXA 1GUBA 3HSYA 2L19A 5T7BA 4JA2A 4Z4HA 4EYOA 1A2OA 2BGGA 3FGZA 2LUOA 3TO5A 4MR8B 5BRAA 3O2SB 4W5TA 3OMXA 3MYYA 1QP4A 1LJUA 2E4XA 1SXHA 1TMYA 2E4YA 3LKBA 2FKAA 4IMJB 3SAJA 5EWLB 3BRQA 4XASA 3KLNA 3TMYA 3OM0A 3QLUC 1ISSA 2OQRA 5HM6A 3QLTA 1DC7A 3JS5A 2W42A 2FEKA 3F6CA 4ZMRA 4MS4A 2NT4A 1P8AA 5KQLA 4LE1A 1FQWA 3TB6A 4DQDA 5F64A 1DCKA 1BAPA 3RVPA
chains in the Genus database with same CATH superfamily
3DDHA 4FKZA 5E8RA 3EVEA 1BX3A 2C4UA 3F2VA 5DGDA 4AUMA 5CDHA 1H1LA 3OCUA 4WKOA 5K45A 3PTAA 1UXHA 4TMXA 5DX1A 4ZCSA 4PVDA 1JDZA 2I2AA 4KX5A 3V8BA 3RJ5A 5TJ9A 1M2OA 5K0CA 3PKJA 4L4XA 1D2NA 3JD1A 4JA0A 1KMIY 3AHIA 5HMMA 5G02A 2GH1A 4X45A 2HYIC 4WNIA 3JWGA 2ZBPA 4I9FA 2K7FA 3ER8A 5IHPA 1BFUA 3QVTA 3L8FA 3SNKA 2X86A 3LP6A 5DOVA 4BVEA 4QO7A 4ZQBA 4EF5A 4ND6A 2J5RA 3HUEA 2HR1A 2OZEA 2BN4A 3UCEA 4G36A 1JF8A 4LBZA 2I3BA 1AE1A 2QT1A 3KUUA 5H59A 3FB4A 4FFBB 5INTA 1HNWB 1Q15A 3ESDA 3OJ0A 4TL9A 2DETA 3Q11A 3OZTA 1TM7E 2OK8A 4JXKA 5C3MA 1RYMA 1DADA 4K05A 1L5HB 2QX9A 2VBCA 3NEAA 4KFTA 3DV0A 4NOMA 4M1KA 4V3CA 4EITA 1M0TA 2GD0A 3HDVA 2GT1A 2Y1DA 4YI5A 1W0JD 2A9OA 3OA2A 1M0SA 1NW7A 1T5IA 2QKYA 1SCJA 3K1AA 4QFDA 5KCMA 3QMWA 4RIFA 3C6BA 2XX3A 3PDUA 4C05A 3GC6A 3V46A 4I81A 5DEOA 3AVWA 1YH3A 2CHVA 2WJZB 3L8YA 5CM8B 1MJFA 1BDMA 1QHGA 1ULUA 3F6SA 1Y1SA 1H2ZA 2DCUA 2D54A 5A4AA 2QDXA 1G60A 1TPYA 1U0JA 3PQEA 4IOMA 2GBLC 2BRUA 3ULKA 4LCJA 1I6MA 4EYSA 4X8LA 2CEKA 2BSQA 2B1QA 2ZJOA 3IVXA 4UUMA 1TM1E 3B60A 3FUUA 1ND5A 1YS2X 4QDOA 1GRRA 4LYDA 2MINA 4DY6A 4JP8A 4GOOD 1NXOA 5LDGA 4AY5A 3E7XA 2AOWA 3L7KA 3QMVA 1EJ6A 3EXIB 1NZDA 1VMIA 1NP6A 1HFJA 3BL6A 2HBYA 2KYRA 2QTMA 5K8UA 1GCOA 4MVJH 2CMGA 4K7JA 1AQJA 3T3OA 1LBTA 2JAHA 1U1IA 2F3SA 2JGEA 3LLMA 3R74A 4MVJE 4S1WA 4AICA 1PJZA 3EVTA 1CUFA 2B8WA 3QF4A 3TGWA 3TOSA 3BFXA 2AIRA 4CKYA 2RHDA 4PNHA 4TLDA 4YCLA 1G63A 3BEDA 3GFGA 1E6MA 1TJ4A 3A70A 4UTXA 4F04A 4DYVA 3CXUA 3ELDA 2JS7A 4K87A 1OOEA 5EJ4A 1DAKA 4CIXA 4NCIA 4MW0A 3E0XA 2PYDA 2V3WA 2VT7A 2NU8A 4C01A 1QMPA 1IHPA 4Q1AA 3HBNA 2XNKA 2JIBA 3I01M 1IXRC 2HT1A 1PW5A 3FOBA 4R0NA 1DWOA 3TBFA 3CCBA 4Q39A 1QE0A 4KQMA 4DA9A 4HR7A 1IOWA 2XT9A 4GYJA 1ENYA 1H0SA 1XZLA 5DBIA 1QOPB 2QRZA 3M89A 4BNZA 5HNKA 1M1NB 2ZSAA 1U31A 4MUFA 4A2WA 5D1NA 1GKKA 3GDWA 3K1YA 2PKWA 5FHQA 3P0FA 1OA1A 4JQSA 3UENA 4B7CA 1RAHA 4W82A 5HFJA 3HBFA 3NHYA 3NTOA 1BVUA 3KOZA 3EFBA 4R98A 1IPFA 1CUIA 2E4VA 4ZAYA 3L7BA 5HCIA 5CB4F 3A1DA 2JBAB 4PRYA 4DIFA 3VX4A 5JDIC 5CLHA 1E96A 3I6QA 5A9RA 1JQ3A 3DP7A 1OI2A 1PTKA 3UJ6A 1ZNQO 1W88B 4MULA 2NLOA 3RIEA 3WXBA 4HWTA 4IGAA 1M76A 2GZMA 4Q9HA 3BPSA 3NU1A 4JQOA 4O2AF 2IHYA 2C82A 1U7ZA 4DQLA 4K0KB 3C8DA 3GZ4A 3L84A 4OP2A 2AJ8A 3U3MA 1R15A 1KVUA 1OWNA 3B9RA 1LF5A 2GAJA 2C7QA 1JBQA 1TRHA 1MO6A 3M1AA 3VH3A 1E8MA 2PH3A 5E4FA 4CM7A 3ZLJA 1PR1A 4PTZA 1LQTA 3NOQA 3ZHTA 1V25A 2BEUA 3DBLA 3GX1A 3HMQA 4MI3A 4BVJA 5A2GA 2XF8A 2BEVB 1NMEA 1OR8A 1SZDA 4X7RA 4N9QA 2QRLA 2WVGA 2WJAA 3FHTA 3SM9A 2BMWA 4B2YA 1RQ2A 4P5DA 4OXNA 4BKUA 3D6FA 1G5IA 3KTAA 4FYIA 1LQUA 2BCEA 5TB5A 3GNSA 4BOYA 1S96A 4B35A 4YAOA 3IIIA 1S2DA 3QU2A 2V1UA 1ULSA 2BBWA 1ZOIA 2I76A 4KHZA 1WLYA 4HH4A 2PT6A 3WB2A 4RJJA 1ZQ1A 3SS9X 5I7HA 4PSCA 3THSA 1GNRA 1NV8A 1CJBA 1G16A 2QL6A 1AQIA 2Y0DA 3D81A 4AZ3A 4Z4FA 2R2AA 3FOCA 3R3YA 1KJYA 4IIDA 4YWJA 2MTBA 5BSVA 1A2KC 2JD2A 4M2LA 2ZJ8A 3BTOA 4XDYA 4OXRA 5JI2E 4DT1B 1ORWA 1Y4AE 2WF6A 5FBRB 4MJLA 3VA7A 5FUBA 1FNDA 1CS0A 1FEZA 4AL4A 1VPEA 1PWZA 1II0A 2WC1A 1U3FA 5FPKA 3VKHA 2ZRAA 3RVLA 3J7AC 5F5LA 4RKEA 2HMUA 3UA4A 1AY0A 1Z5VA 2OWEA 1LFDB 3CH4B 1MHPA 3IESA 4XFJA 3VXKA 1JP7A 4K9QA 3B36A 4OQEA 3UK2A 3AYXB 2W71A 4G86A 4OQFA 5BUSA 3PR3A 1W29A 2F1RA 3N2YA 1R5OA 4PHFA 4G0YA 4RZHA 1QK5A 2VZLA 4BO1A 3RSOA 1Z16A 2IPMA 4O2AA 3W4KA 3GLUA 4TWRA 1IN4A 4IYRA 3BMQB 4IF4A 4CV0A 1BDBA 5COBA 1RJEA 5AO9A 3AF6A 4JVSB 1NBMD 2YXEA 5DLYA 2BMVA 3DBIA 5KBYA 1M2GA 1DT3A 1P0IA 2BMAA 3ANSA 1EE9A 3H0EA 4MKGA 4IO0A 4XAQA 5ALQA 5KYUB 4AN1A 5KSZA 1C0IA 5AR1A 1OSNA 1JLRA 2Z08A 3ZDQA 4YCJA 4AG6A 5H3HA 5B3AA 4UFOA 3V1KA 3EXHA 3HCAA 1ID1A 2WM9B 3HSSA 3K20A 4QNNA 5KNBH 3HA7A 4E7OA 1E0AA 1ZJ4A 3GI1A 1KKUA 3HMKA 2VWPA 5HKKA 2D2XA 4XD2A 3I2FA 4AUKA 4PICA 4E7PA 1GAWA 3E9DA 3OUTA 3QVOA 2Y8EA 4D3ZA 5KJCA 1W47A 1SVOA 1N1GA 4W9NC 2ISCA 2XCTB 3VKFA 4EFMA 1DXQA 2HU5A 4B81A 4P31A 4CM1A 4WDQA 4IUCS 4DIDA 1XVUA 4KXNA 3PK0A 1HYHA 1K7YA 2QLMA 3RRZA 4LOAA 3LFUA 4B7ZA 4C3UA 3TCNA 2YCLA 5JTUA 2HRRA 2I3AA 1Z56C 4BUZA 4M4SA 4EFLA 5LQRA 3ILYA 1L4EA 3KWFA 4GC5A 3TCKA 4C4TA 3WWPA 2Q46A 1WP9A 3KJNA 4L8YA 2WF7A 5CA0F 2VDOB 1E1QD 4FZVA 1GT6A 2Z9BA 1KFEB 1GCIA 4F9GA 1ZMTA 3LT0A 2NO9A 2YXDA 3MIZA 4RXUA 5A1JA 4YUAA 2XGOA 3HB1A 1Q7CA 4KJZA 4YPVA 1OWMA 2A58A 1CW2B 2JFXA 3B6EA 1JQAA 3V7UA 2IHJA 4ZDJA 1KQGA 1LJ8A 2CXTA 3TLJA 4RY2A 2FJ0A 2M98A 1ZGAA 3HRHA 4JYBA 3WMGA 1FA9A 5JTTA 4J0QA 5CNKA 8ABPA 2NUPA 4A8PA 4DNQA 4WCFC 3KQQA 4F6CA 4BAGA 3A9VA 1JRLA 5EJGA 2YS6A 3KETA 2IH5A 3K6JA 3ZUPA 4GEKA 3B1XA 2XYQA 4FDAA 4F7DA 5CNIA 5CG1A 3RH0A 4OBBA 3O7MA 5C7YA 1U2DA 1UKVY 1ZXXA 1E1CB 1YR7A 3CF4G 4HQFA 2GJSA 3RG8A 3TW4A 5ADWA 3NJRA 3UPTA 3C6QA 1NBMA 1ZSNA 3D6AA 3DE5X 4UHBA 3W79A 5FAKA 3FCUB 1EK2A 4PPFA 2ZYVX 1WAMA 3I9JA 2Q8NA 3D4IA 3NH9A 4EK9A 4MS1A 4RZXA 4DQXA 4AFNA 4MCAA 4TTSA 4NH0A 4C87A 2BGLA 4PC6A 2HK8A 1C9DB 4DSOA 4ZP1A 4FQ5A 4X6UA 4LXTA 2NMVA 5L3QB 2PNFA 1UWVA 4EKNB 2NN3C 1BA3A 2QV0A 4DXHA 2OV2A 4YCSA 1PZEA 3IURA 3QMMA 1L7MA 3L3BA 5KDOA 3A9WA 3DEAA 4RFSB 5KYYB 1OKKD 1L8OA 4TS4A 2QTTA 3H4IA 2D59A 4UDNA 1R0WA 3QE3A 4DBLE 4CT4B 1R74A 2P9QA 1IM8A 3NVKI 3EWNA 1U0SY 1G8SA 4R2WA 2NTVA 2HA5A 2R87A 3KU4A 3LWDA 3DTVA 1E63A 4E5KA 1JVBA 3K92A 1C3OB 1NPTO 1N34B 4CI9A 1K8RA 2JANA 2Y9MB 1ZUIA 1NJSA 3BTUA 1G38A 1SXJD 4U8GA 1BSVA 1VE9A 3EF3A 3JZFA 3RUHA 2GCGA 1YS1X 3PSHA 4KAXA 1YTUA 5A3VA 4F5WA 5JEDA 5K3BA 5DGTA 1CY8A 1GTJ1 3I12A 1C30A 2JLVA 1W4BA 1QHHA 3KL4A 1Z45A 2W5UA 1WKBA 3K0FA 1EP1B 1EJ0A 3R7LA 2HNBA 3KZKA 1KBOA 3AVUA 1BX0A 3DTNA 2IXFA 1ETUA 2GEBA 3S7ZA 1EWQA 1G42A 2LP4Y 2PD4A 3I34X 1N5IA 1TVEA 2VHJA 1IZYA 1M66A 2GRUA 5LUBA 3NAQA 1MGOA 3T1VA 3TVTA 4HK4A 1C8VB 1XRQA 1GTSA 4B3TB 3S5UA 2AA3A 4F9EA 4B17A 2NAPA 1E4EB 1L8AA 1ZMBA 1MORA 2WV9A 4F6RB 3GRCA 5GTDA 3G7NA 4PLPA 1GNSA 5F7XA 3ZYCA 4BB9A 3R0JA 2XQIA 2CWDA 1KEZA 2H4HA 3HLKA 1Z2PX 3O1JC 5C1PA 1Y5MA 1M5UA 1IJFA 4G8DA 3VU9B 5G3ZA 4K9MA 3OTWA 4Y6RA 1NE2A 2EBHX 1D8TA 3AB3A 4NV0A 2C83A 1JIKA 1OPRA 1XZJA 1JIVA 2VP5A 2Z3VA 4NE7A 5EXPA 5BW6B 4KTVE 3CZQA 2WSSD 1EFUA 1A5BB 2QMZA 3VNUA 1KF0A 1U9YA 3JTEA 1RYBA 3UXEA 2JK0A 5JS2A 1FVFA 3IUYA 1DAHA 4PG5A 3S1LA 4BAUA 2DBRA 4N6OA 4M8IA 4C0LA 4LJSA 1UDXA 2XUKA 4JFAA 2XGJA 4NV1A 3LQ2A 1E1RA 3R77A 4IL5A 2CXUA 1EINA 4JEMA 4NZPA 4WK6A 3K9GA 5AXBA 4R1SA 4WLEA 3OEHA 5BYKA 2H7XA 3V48A 2P91A 3C3WA 2CD9A 2X41A 4NEHB 2Y4NA 4RNCA 3WG9A 3FVQA 2BFBA 4BO4A 3FYDA 3U17A 5BWNA 1QC5B 2WAOA 3KALA 5AH0A 3O8OB 4Q9LA 3WGIA 1S3FA 1NSYA 5FUWA 3OJOA 5HX7A 3E3LA 4HPWA 2HSWA 4OKIA 1O97C 5CK4A 4I9HA 1FFXB 1MX3A 1W34A 3O5AA 2BM8A 1SK8A 4BZPA 4RKYA 2ZS7A 3KCQA 4V1CI 3TSAA 4BS9A 3U4IA 1LU9A 1SVSA 2VT2A 2XKBA 1JJ7A 3ISTA 1F2DA 1MRNA 4ZT4A 3A7DA 3RK4A 3WADA 4H35A 1L7PA 3C98A 3NWJA 3D6VA 3FNHA 4BE4A 4OXXA 5D3KA 3OZIA 4OJMX 2FP3A 1LVUA 3DM9B 4HEA1 3LNTA 4EY6A 3ZQ4A 5IPFA 4JA2A 1ADJA 2I80A 1I01A 1YBFA 1MV5A 2QQEA 3FGZA 2O2EA 1VCOA 3OMXA 1FDWA 4KI7A 4C0SA 4D6PA 4R1PA 2FPIB 1BQ4A 2D5LA 2E4YA 2VAVA 4CTMA 4V0OA 3L1VA 3OCXA 4DC1A 4JLKA 3C3DA 3IEXA 3T9BA 3M5CA 1TW3A 3QLUC 3O2NA 3ZK9A 4BEBA 1EIZA 3PICA 4HDSB 5AVRA 2I7TA 2FZEA 2QJWA 3CLSC 2Y0CA 3W0LB 4ENWA 2WINI 1BCSA 2AJTA 3FMIA 3OM8A 3TB4A 2UUCB 5EKDA 5E4YA 3LLCA 4MVJA 4P83A 3COSA 1PR3A 5SY6A 5T5QA 1WCYA 3VDMA 1P8AA 3G5MA 3S40A 1UBTS 1XQYA 2QRVB 3ROKA 4I50B 1LW6E 1P80A 3LE8A 3OVMA 5LBUA 1LRKA 4RK7A 1UINA 4UASA 3U7IA 1VGRA 1WP4A 3L1IA 4QOFA 3GDOA 4HXGA 4KLZA 4UU7A 3RYCB 3QTTA 1M2NA 1RJ9A 1HQCA 4DTIA 1U94A 2JVKA 2ZJ3A 2WMDA 3G3EA 1DL5A 3ZV5A 1KH2A 3OZAA 1NRWA 1ZIYA 3FFWA 4NY1A 3R8CA 2NIPA 1TL7C 4AZSA 2NU7B 5JU6A 1QM5A 1T9ZA 4RY9A 4NYMQ 1WDLA 3NFRA 4J0HA 2PX6A 1TZJA 4TLAA 1FJGB 1R6VA 4XJXA 3NGXA 9GPBA 2RH5A 3IAHA 2F8MA 1XROA 4HO1X 4NX2A 1DBVO 2A94A 4CLHA 1ZH6A 5ECYA 4H3SA 3NETA 4IO1A 2QN9A 3Q6NA 3KT8A 5IJAA 2JIOA 3IOBA 3OX4A 2VPWA 3BAFA 5EI5A 5JNWA 1GPNA 4D6XA 5ISMA 5TIIA 1E2KA 2HMTA 4GGOA 5JZOA 3RF7A 1XWFA 1P1HA 5DK6A 2J7PD 3U1VA 3GT4A 2QLBA 3KAKA 1ZUNB 4OTZA 4IP0A 1T0JB 2AE2A 3EBPA 4YDQA 3LHKA 1QZTA 2ZJ1A 4H27A 3H5VA 2YN2A 2WSMA 1NXPA 5EJFA 3MWGA 3THRA 5A3JA 1E1DA 3FH0A 1T9GR 3KPJA 3PI7A 4I9NA 2ZXFA 4YJFA 5EMJA 2EZTA 4AUNA 4JKOA 3QBJA 3RANA 3B52X 4HFJA 1K1EA 4M1WA 4BFUA 3MJDA 2HHAA 3BSFA 1USVA 5AJUA 2YZGA 3I4FA 3ASYA 3V9AA 3PQFA 4P80A 1OYOA 2ZYIA 4R2IA 4TRJA 3ZU2A 3MS7A 1GG5A 2O2GA 4TSFA 3MWKA 1ZM4A 5JT1A 1FNBA 1ZH2A 5AKKA 1AQLA 3PUVA 1DJOA 1P5FA 2X58A 2YV2A 2V98A 3PD1A 2EKPA 2OO7A 2I8LA 2CYCA 1YIOA 2JNWA 3ROPA 5HP4A 4CEIB 1DKLA 3SHFA 4QPDA 5BXYA 5CLJA 1RW4A 4WBNB 4KK4A 2M32A 1N6OA 5ANRB 3V8MA 2YYSA 2NG1A 2P4UA 2QRGA 3B6KA 3CSUA 3I8XA 5D3QA 3ZBUA 4YV2A 4CETA 1W75A 4F5YA 1NVVR 2E55A 1UAYA 1T8YA 1Q77A 3OF3A 4K9DA 5I9LA 3EFOA 5TV2A 1AXRA 4RVNA 3GA5A 1IL0A 2ODQA 4TMVA 2BKVA 4NCKA 4ZA2A 4CCSA 1KZGB 4PR0A 3VR2D 1RCUA 3H2IA 3VR6H 1XRJA 2PO5A 3FDZB 4BGUA 1FUUA 2UU9B 1KGDA 2Q6KA 3SD7A 5AK6A 3AVXA 4DCJA 4XGQA 4EA8A 2ZT8A 3AWDA 3LBHA 3O73A 3Q0IA 1GUYA 3TE7A 1LWNA 1M8GA 4INJA 4RGVA 4IZ6A 4MXDA 5CJ2A 3T3EA 5J47A 3K7EA 1HE2A 2OHJA 1VLQA 1AGPA 2IEBA 3KKZA 1L5MA 1U8UA 1G8HA 1TCAA 1NATA 3GRYA 4QJ5A 4UREA 1R4NA 3D7LA 4AO6A 5EHZA 4IGIA 1EX9A 3B85A 3JD0A 4NPHA 4Q03A 1BFDA 1OAKA 2Y66A 1ISHA 4JD5A 4TN1A 2Q27A 1TEXA 5JNSA 3H04A 1JU4A 2C77A 1THGA 3IB6A 3AYZB 2QRMA 4W9NA 3E2PA 1F2UB 3A32A 3WR5A 2KSQA 2EV9A 2F9FA 3EK2A 4K6FA 4M76B 4R05A 1G55A 5DX0A 4UNQA 2GEVA 3AQIA 5EP1A 3RQIA 3LPNA 3RWBA 3VAAA 3WWYA 3ZWBA 3EWIA 4DLWA 1S2NA 2BFFB 2ZJ4A 1B0UA 3Q2OA 4TV9A 5KQRA 4TM7A 1NLZA 3CR7A 2PGLA 2GILA 3VGJA 4PONA 1JHVA 3MGCA 4ZO9A 1VMDA 4OXKA 1P1JA 2BEWB 2IZ6A 3VJLA 3LX5A 2ADFA 4MIKA 4RLQA 4V3BA 4DT1A 3CX6A 4X8OA 1U5AA 2I78A 2NNWB 5JAQA 1Z4OA 3QXHA 1YKSA 1RWOA 4QEKA 3C3PA 4NH4A 3INNA 5CEJA 4MGHA 4J75A 4ZT5A 3RFCA 3RKUA 1RDFA 1GAJA 5ICEA 3U60B 1TAGA 4MKIA 4CE6A 1F0NA 1Q1NA 2C7RA 1VL2A 1G2OA 5CVEA 2JKZA 2AMFA 2G6TA 2HCRA 3HB4X 5KOJA 3WLSA 5AW8A 5E0KB 4R69A 4AQDA 4AMGA 4YCNA 2CE2X 3DBVO 1NNUA 3A0RB 4LSGA 4ZVLA 3TD6A 4UEJA 3GJ4A 1D4OA 4UC0A 3AGPA 4ZANA 2QMOA 4IHJB 4DSNA 2C9ZA 4U9HS 3Q8LA 2GBLA 2WM3A 4PTYA 4ILKA 3OECA 1WX1A 3ZJ5A 1GLVA 1Z35A 3ZCVA 5J2TF 5AW7A 2ZBUA 1WMAA 2A33A 4YLYA 2J67A 2H63A 4KXQA 2V7GA 3TSCA 3KKPA 5KNCD 5LKRA 3U61B 2VOJA 5E9WA 4ALLA 1VB5A 3V97A 2KB0A 1BE1A 4G5OA 2YJ3A 5TT0A 3WGVA 3RU3A 2P2CA 3EZFA 3I8OA 3K8OE 4FCCA 1NVXQ 1SIUA 4HGQA 1ADCA 1Q74A 4AYTA 5IXJA 3URMA 3MG9A 4DG9A 5PNTA 3WL7A 2XMPA 4Q7EA 1B2RA 1RAAA 1GPYA 2CFRA 2HN9A 2RHJA 2CDNA 3ITNA 3PCRB 4OHFA 5LKAA 3ZD6A 4TV8A 1K5PA 2BZ1A 4RPCA 2VHXA 1DBQA 4XWWA 4OYYA 3IDQA 2FVXA 3AP3A 3NHRA 3LC0A 2DLNA 3ZDXB 4EF4A 1CEYA 4I50F 2H0RA 2XB4A 2GDJA 5JE8A 4QTTB 4BTLA 4DR4B 1AHNA 1YZFA 3F5FA 4FGUA 4FOTA 3A6DA 1BXRA 3DS8A 4BU0A 1MC8A 1HKHA 1QCYA 4P0TA 4NP6A 2D00A 3U4DA 1GZ3A 4B4DA 2Q99A 4EI2A 3EZ6A 4LE2A 5DOZA 3NX4A 2RHOA 1WXEA 3DLPX 3OPYI 2HZBA 2XJ4A 3UAWA 4DLRA 3N8HA 3OZWA 2OYCA 3JARB 3R7SA 4RW0A 4MJ3A 3ZOKA 1ZNYA 3O1IC 4LHZA 1KHHA 3GFVA 1L4UA 2V7PA 2H5JA 4ECEA 3EWAA 4OX9Y 2C2GA 4IH9A 4F71A 3C39A 3BT7A 3V3KA 2QL9A 2WP8J 4H31A 5F4ZA 2JARA 4BN4A 3WRWA 3DLHA 3PQ6A 4RSGA 5ULLA 1W2HA 2GZ1A 5LDDC 4HX2A 4GWKA 3ON5A 3EGOA 5A9TA 5LQMA 3GD5A 1JEEA 1FDVA 2DZDA 2WD8A 2H2AA 3L0OA 4GVXA 2PAFA 5HXAA 1YK0A 2GF9A 2BWJA 3EVBA 3PGLA 4YLGA 3K9WA 4ZCLA 2CK3A 2JGRA 2UYGA 5CVTA 2J09A 4IAOA 1MDBA 2FZLA 2XRYA 4JLNA 2JH3A 2FSPA 2XCIA 3A10A 4JP2A 1L5FA 1AKYA 1P72A 3RRYA 4MYCA 1RYDA 2VRBA 1JPJA 1ZNZA 1VSBA 2E85A 3Q12A 3PT9A 4RA9A 1KKMA 3IEPA 1FXUA 1XWWA 4LI3X 1GCUA 5IZ4A 4PANA 5J58A 1S1CA 3BHJA 1ZIOA 1E79A 1QIEA 4QL3A 1ZQ9A 1U8YA 1DFHA 1MT0A 4CQLB 2NSJA 4Q66C 4L9RA 4P4NA 2YINC 4DCTA 5BRJA 3FBTA 3Q6MA 5F3WB 1AQYA 2EFDB 4PHCA 3L46A 4L4SA 1E1RD 3VTAA 1N7JA 3I37X 2TECE 2HJVA 3KB8A 4KG7A 5AICA 5FBLB 2O2HA 2QYOA 2SHKA 3OTGA 1I3OA 4UUOA 4LVOA 3WZLA 1T9AA 1V8ZA 5B4VA 5CFOA 3ZY2A 4TKMA 3B13B 1E1LA 4WBSA 5BO5A 1AURA 1NF9A 2HX1A 5F9HA 4O2LA 1XX6A 5EP3A 1G8MA 1U8TA 3L18A 1R0CA 2AG6A 1MENA 2VAMA 4H7KA 2NU6A 4DA7A 3RVRA 3IE1A 4FXPA 5K8TA 4A5SA 5C8XA 3LYUA 1OGJA 2GJAA 3KR9A 4OHXA 2QX8A 3QX3A 5JANA 4IHQA 3FZGA 1EQUA 2AN1A 2D4HA 2PN1A 3IR7A 4XE5A 4IIBA 2W6CX 1J70A 2YWXA 3JQAB 3I04M 1Y9EA 3WRVA 4X54A 1QHNA 1DC4A 4D4MA 1E5DA 2ORED 1UR5A 3LHDA 4M9ZA 2R8XA 3MRTA 4AJ2A 1XLWA 3ZE7A 4RDIA 1KI6B 3SZLA 4Q01A 4P58A 2Y05A 3T7KA 1REQB 2HV8A 1Z8NA 3LU1A 4J3FA 2IKSA 4NVRA 4F60A 1KO8A 4RHEA 3WJ1A 5AI0A 1U7XA 4YDHB 2ZM6B 2I4LA 3I64A 3OJFA 2B4TO 3UMCA 3HXKA 5H3LA 3ZLVA 4ZHQB 1L5QA 3W5AA 3EGDA 1KORA 3NM5A 1P5HA 3EVGA 3Q7QA 1IY8A 1EYZA 3MAGA 3PQ2A 4TOIA 1WOMA 2O52A 4UEOA 3PQDA 2P6MA 1RJ9B 1VFPA 4QQFA 1C50A 3UAGA 3HFGA 4RK6A 1I33A 5H70A 3WA6A 4AKSA 3CNBA 3L7AA 2PL1A 3N7AA 5KPJA 4BJ6A 2W98A 1NIJA 3A7EA 3VSDA 4CLDA 3GJQA 5CBKA 1U02A 2UYOA 5HA5A 1NZFA 1UBRS 1UJ6A 2F3TA 2CL5A 4PAGA 4C14A 5L4SA 1GO2A 1YCFA 1UPFA 2JA1A 1YJAA 1U2GC 2B7BA 1QG6A 2P1ZA 4UUAA 3T5CA 1TPZA 2J08A 4PVCA 4Y1GA 4NCJA 5JZMA 2VVTA 4A73A 4G1FA 5EKTA 1JSCA 4R54A 1DAEA 4YQEA 2VNAA 3V42A 3EQ9A 1POWA 2DWOA 2ZPAA 1Z82A 1L7RA 4IXNA 3TLKA 4CQNA 1JJBA 3ZIAA 3EWSA 1G1AA 4PRKA 2ZBFA 5ETJA 1X2BA 2VPYA 3AFOA 4L75A 1Q1EA 4WZZA 1XDBA 2VATA 1GGVA 1ZVMA 4WINA 1H3FA 3L79A 1UK7A 4QQNA 2XB8A 1B3RA 2UDPA 3L0IB 1K86A 2X76A 1IHXA 2IXEA 3WMEA 2QI9C 3AEKA 2PZ8A 1TT5A 4QHYA 2YNMA 4G5FA 1W5TA 4KR2A 4ZD6A 2V0NA 2YFYA 5AVOA 3N9IA 3TLGA 4QUAA 3MNFA 3SGLA 5REQB 3WMWA 1EUCA 1OFUA 3I9FA 3B5IA 3I0MA 4H16A 4RVDA 1YAHA 5U1PA 2IXGA 1K6JA 1MZVA 2NTJA 4FGSA 1PTJA 4JJAA 4Y9UA 3TWOA 4I1PA 5K8CA 5HQTA 3E3NA 1PK7A 4K0RA 1OWPA 4RH0A 2DQZA 2NU9A 1H6CA 1M7HA 2YXLA 2CV1A 5FPPA 4RELA 4TGLA 1PJRA 5JFGA 2BFNA 4ILEA 4PO8A 2B37A 1EFVB 4OB7A 4DIBA 2BZ0A 4H7HA 2ZXUA 4QYMA 3AM5A 3WLEA 2BF4A 4X62B 1N0HA 3HLYA 4CODB 1BS1A 4XA8A 1RYYA 3GELA 1VDMA 4AIRA 3ST7A 1RXWA 3MBIA 5IDVA 3TRKA 4YRFA 4F6LA 1GL7A 3NHWA 2QX7A 3JRNA 3IHKA 1LNSA 3K5PA 3F4KA 1DX9A 1K68A 3VVLA 2IEGA 1IHUA 5DI3A 3SIWA 4E4TA 3DAHA 1SWVA 3T9EA 3C4JA 4EGFA 4EHJA 1REQA 3QOFA 1L7BA 1UDCA 3RC9A 4EI9A 4C88A 4JKIA 3FLBA 5ITZB 4KR3A 2HYDA 3O8LA 3GFPA 3P19A 2QVZX 4PS0A 3BRWD 1WZ2A 2R11A 4XR9A 2FEAA 2GFHA 3BH6A 3D0OA 1NVGA 3OZRA 3Q9UA 1X9HA 4KYVA 3T3DA 3BEOA 3E4DA 4EB6B 3WK9A 1ILEA 3BWEA 3WYNA 1NX6A 1LK7A 1T5TA 3W78A 1OH7A 1EFCA 2UYQA 3M7IA 3GL9A 2PGAA 4L3OA 4TWZA 4PAOA 1K97A 2O06A 1K9SA 1W0JA 3VU1A 5B4TA 4IOJA 4WXHA 3LQ4A 4ZOBA 3NTVA 2D1TA 4L02A 3HNPA 5CEEA 1G7SA 4UBNA 4IQ4A 4U9IS 4GO1A 5HUJA 1N3YA 1J39A 3JWIA 5NLLA 4MSUA 2GK4A 5CA1F 3PNSA 4GPTA 1WNTA 2OV4A 3FG9A 1WEKA 4ZMSA 3RRBA 1XAJA 4UTZA 2MCFA 4OFXA 5FWXA 1FFXA 3L01A 2Q62A 1NT2A 2ZYSA 4G84A 4WAUA 5DBEX 1GPKA 3SBDA 3V5NA 4QAJA 4ZAWA 1UQRA 4I1SA 4QT0A 3D64A 1KZ6A 1W46A 4CMIB 4PCAA 1FW6A 3NATA 3ROGA 2VRCD 3DD1A 1ESNA 1XKTA 1JFLA 2QR2A 3P52A 5AJHA 5EXEA 1U2TA 4EL0A 5LZ7A 3G9XA 3A6FA 1W1WA 2A57A 5AVXA 3AR5A 5AXAA 2J9YB 2QSUA 2Y1KA 1Y0BA 4PIVA 1FTQA 1YBAA 5AI5A 2G7MC 2BHLA 1S3SA 3ITEA 4DABA 3MTJA 1ZI9A 4HYYA 2Z2KA 3RYCA 1XQ1A 3P4UA 5AKHA 3HI6A 1RQLA 4HH3C 1T9DA 4LYEA 4RVCA 3TB6A 2HHJA 4NYJQ 4HVTA 1B7GO 1ODIA 1W1IA 2DC1A 4NAHA 5IAKA 2QUBA 4N0MA 3QFSA 4BNHA 2CFCA 1F9AA 4UZSA 1TTTA 2CLLB 1KMHB 1R9NA 4P7JA 5BN4A 1Z4NA 4LG1A 2GK3A 4R8VA 1HDZA 1IEQA 1IB0A 4AS3A 1IQPA 1ZK2A 3VR0A 1BJRE 1T5HX 3LVFO 1Z2AA 2IZ1A 4RWEA 2Q5OA 3TSZA 1F8UA 4U2DA 3ZWMA 1FFGA 1T10A 1XI2A 1VZ2A 1YCDA 3UWKA 4GZ6A 3IILA 2PEYA 2ZATA 1DWUA 1Y9DA 4RZIA 4DWWA 2P6NA 2YVLA 1W9HA 1DUIA 2NM0A 1GN9A 4CNQA 1VYVA 3ZWOA 3K9BA 4NMLA 4WXMA 3I92A 3S2SA 4CTJA 3FWNA 1RJFA 1KZ1A 1N2ZA 3PXCX 5JAIA 1Z5WA 1T2CA 3PNBA 2YWDA 4ENPA 3RS2A 2F3RA 2VC2B 5C8ZA 5I8PA 5DHFA 1NHGA 1NXTA 1QZZA 3LRTA 2PD3A 2Y0PA 5FBWB 5FNZA 1BX1A 5A05A 4KR6A 4H7DA 1K5DA 4L6IA 5EVJA 5C8YF 1UUFA 1HNNA 4BASA 2VDVE 4B5KA 3NV9A 1K08A 3H1AA 3U4HA 5EPEA 1UBEA 3BZUA 5FOSA 3CCFA 4GLOA 3LUBA 1IVSA 3GUCA 3TQQA 5GONB 2VWHA 3BGVA 2W70A 3VC2A 3QHQA 2NUAB 1YO6A 3FVVA 5K3DA 5KNLA 3Q41A 2JFNA 4TXLA 4GIBA 1JAIA 4ANFA 5TQ2B 4TL6A 1A95A 1QVAA 4B46A 4V0QA 1X7HA 2BMDA 3O75A 4GI5A 3H5IA 4FDMA 3RABA 2E37A 2QRNA 2R84A 1E1KA 4XTRA 3PXUA 2I29A 2VP9A 3VO2A 1BN7A 4BZWA 5C7OO 1AA6A 3PUZA 3LXMA 5EJ5A 4YAUA 2NXCA 1LPPA 1K9VF 1K7FB 3KXIA 1QP7A 3C1OA 2AR0A 5IK2A 4IJVA 3U19A 3EDCA 4RIGA 2P2YA 4JELA 4B3DA 5A03A 1TYCA 4FN5A 3BB3A 3HKCA 1GPJA 2Y67A 3TDMA 4O3MA 1NTRA 2QMHA 2QQFA 1KTVA 4A15A 1ZEJA 4RF3A 1I6KA 1RPNA 2KW5A 4RD1A 2A0FA 5EZ5A 4EY8A 1KMMA 3T94A 3EGEA 1UANA 2VNHA 4PPNA 3RIHA 2AVDA 1OWLA 1V16A 1P3Y1 4F4JA 3UG7A 5BV2P 4X65B 1NKVA 4B6OA 3MQ4A 1Y1RA 4AMVA 1H8EA 1KFKB 2W6JA 1CIJA 4GI3A 1JDBB 2XDYA 3LO8A 4MARA 3HJAA 4ZGWA 4QDKA 2XW6A 2H1SA 4JB2A 4MMYB 2JGMA 4MQEB 1H2FA 1Y6ZA 4E15A 5ER9A 2UZ1B 5FJIA 5A4KA 1YZVA 1Q11A 4B3BA 4EG4A 5H02A 4B3XA 1QR6A 3FPAA 3QPAA 4DLTA 4AWAA 4TXMA 3PX2A 3OJEA 1J9EA 1QZUA 2I2CA 5DYYA 1JXOA 4F2HA 1EKXA 2Y71A 3T1QA 1M67A 3S2GA 1XZQA 3V7NA 1ODFA 1Z39A 1W8DA 3TSWA 4EHNA 3KYIB 1WE2A 4W9MC 3V2HA 3PF9A 1TI7A 3BE6A 3FHLA 1EAMA 3RUFA 1OTHA 2C9BA 4LSZA 2AZ4A 3CX3A 5F7OA 1R8YA 2ZE5A 3USES 1YC2A 3FZEA 3I1FA 4AT1A 4B76A 3B1JA 2PX3A 1L1RA 5GWXA 1RWNA 3RVJA 1YB2A 2H48A 3CUTA 1PR9A 2OFXA 3KCNA 3FOFC 1TAUA 3ZE1B 1E60A 3B6ZA 3TK1A 4BO5A 1XHLA 3G2PA 4RPKA 5IZCC 3J80A 2M1ZA 4G23A 5SYMA 5J23A 1QH9A 2HREA 3JD4A 2F1HA 2XUZA 1GU1A 2I22A 4ODIA 4W9RA 1C9KA 1WA5A 3VPFA 5L51A 4B3RB 4QGAA 2VJYA 4NATA 4EELA 3BTVA 3AWIA 2Q9BA 1FLNA 5CVUA 5JSHA 3ETCA 2RG7A 4G65A 1Q6ZA 5FWYB 5JBIA 4HVLA 1D5CA 3TW6A 3ZV7A 1XAGA 2X40A 1WW2A 3TX6A 1BO6A 4W99A 1GPAA 4DV5B 1WBBA 1NLYA 5CTAA 1OFGA 4MVYA 2G08A 2LKDA 1EG2A 2HADA 3SKVA 1WMDA 1JIJA 1FFCA 1IEWA 2HF9A 4WKCA 1LZLA 3WLRA 2L18A 4XQEA 2EGUA 3WJ7A 1QO7A 4ESVA 1G98A 4HWOA 4DG5A 1LJLA 3W3ZB 1NVBA 4LPSA 1B00A 1RP7A 4DMHA 5CLFA 1JR3E 3ORYA 4Q3OA 3O2JA 1VLMA 1JW9B 1WUIS 2XMSA 4MV9A 3LHSA 3T1TA 4OMCA 4V38A 4F4HA 1WQ1R 1NHWA 5T6MA 4MRAA 1J2EA 1KRWA 4D41A 3DEJA 4JQCA 2H4YA 4JL6A 3MMSA 4TT3D 4ZT2A 5J5VA 5BNTA 1H9CA 1U6IA 5FUVA 2EKZA 3C41J 1DKMA 1T35A 3TLEA 1D0VA 2E4UA 3QY0A 4Q3KA 2FN9A 3KWMA 2GYYA 3BMXA 2I7DA 5BOVA 1TUEA 4ETWA 2P11A 2ROQA 3PRJA 5SY9A 5T64A 4CQJA 5KJ6A 3V8NA 1W36B 3DHNA 3ROFA 2CKDA 3E8XA 3W7AA 4AZ0B 2NZYA 4CIBA 4D43A 1FRNA 1I2AA 2FWIA 1G8FA 1TK3A 2FSVC 2C2WA 1T9KA 1ZM3A 2CUNA 2H0QA 2XOEA 4KQGA 2ZRLA 2G36A 4RTJA 2KWIA 4YK7A 4PGGA 1UFOA 5JPIA 3ZEAA 2A9RA 1E2HA 1T2DA 1JVNA 1S8NA 2FWAA 2Q1YA 3KEMA 4LXYA 4NMHA 1P1CA 4ND4A 4OM8A 1DKRA 1PGQA 1YU6A 3O38A 3G89A 3EIHA 4LDAA 5DBFA 3W1VA 5BN3A 5H9WA 1XD8A 4OHOA 1T4CB 2I7XA 3SJUA 2F4NA 1U1GA 2I4RA 2RJ3A 3CRW1 1RADA 3ROZA 1H4VB 4DOMA 3CW8X 4M1EA 3CKMA 3OEED 2FDRA 4GVPA 3RWOA 1YA8A 1XVIA 2ZUCA 2YFHA 1B1AA 5ESDA 1CU1A 1TLLA 2RGGA 4FFRA 4OQXA 4X5OA 2ZAMA 1NOKA 3HI4A 3REQB 4CPDA 1FS4A 1UM8A 4ISBA 5DM4A 3WO1A 2EJVA 4B82A 5G41A 3T4PA 3JVVA 1C4KA 1YZHA 4A8JC 2C4VA 4JK3A 2Q6VA 2LCQA 1QH1B 4LMRA 4JSYA 4YT4A 2W2QA 2WEKA 1L5ZA 2QVCA 5FI0B 2VYQA 4RH3A 4BL5A 1JH9A 1TKAA 2BKLA 4Y1RA 2WICA 2ZBRA 5KYUA 1N5MA 1GDTA 1XRSB 1VJGA 1NBWB 1QLHA 3TSYA 3AF0A 4RPIA 4XW2A 1IY9A 3R76A 2GPNA 2ZTMA 4JGIA 1HMYA 2YC2C 1WHTA 1B42A 3HV0A 5G53C 4CLRB 4YMTA 3V2IA 3DTYA 3U1TA 2HKIA 1W8IA 2VO1A 1UXOA 4J49A 3SQWA 1AO3A 4IFEA 3N53A 5F23A 2PU7A 3VVCA 3SBOA 1GRCA 3DHYA 3GW8A 3ZCQA 1HV8A 4D98A 2E18A 2O8NA 3EVNA 2PSSA 1RLUA 2IXBA 3E1SA 5FB3A 4JP3A 1C9YA 1JQJC 1A8IA 5HF8A 1UDBA 2HCFA 1ZWKA 3MXOA 1OBOA 4Z9YA 2HSJA 2W2OA 1WKVA 3VOTA 4D8WA 1V3VA 1PV2A 3PEFA 5FLEX 1QYXA 1QIFA 1GEEA 2XD9A 3IAFA 2Q49A 4X3CA 3TFWA 4ZOQI 4B6QA 2Z43A 4XM1A 1ZL2A 1N32B 4S0ZA 1VE1A 3PPIA 4CZ2A 4BUCA 3PJRA 2G07A 2QE7A 3DDCA 3PDJA 1W44A 3L9WA 3QEOA 2PT5A 2PSHA 4XVUA 3OJLA 5EJEA 5FWNA 1X1CA 2WG1A 4OBEA 4ZI5A 2PPLA 4JLVA 2NWQA 2VRWA 4QIHA 5KTTA 4N41A 1PK8A 1Y5NA 3AUSA 4AJKA 5EERA 1LPNA 2LTAA 1ZIXA 2B30A 3OFJA 1VE7A 3AP2A 1NAIA 3H18A 4H60A 1JA0A 3E82A 4RTSA 4V1CA 1JS1X 4P86A 4HGYA 2I8CA 2ZRPA 2F43B 1N2EA 1ZCFA 3N07A 2VR1A 1B41A 1F0YA 1BEEA 2RHCA 2H2FA 2G3YA 1QJCA 4HFNA 3TBHA 3N5KA 1XF1A 4H77A 4MS3B 1WD5A 3GAMA 3QE2A 5FQOA 1IQUA 4G1CA 4WOKA 3SFVA 3ZU5A 4YCMA 5ABPA 4IS3A 1XD2B 4X3OA 3WDKA 2EYUA 1FW8A 1SQFA 3A4LA 2CLSA 3IBCA 4FHFA 4OAQA 3IP1A 5T41A 1JNYA 4DR5B 4J07A 1GTZA 2ZJ6A 2HF7A 1AN0A 1NQUA 4CL0A 1QXSA 4QBIA 4UE2A 1ZKMA 1WHSA 2B7LA 5L53A 2J3HA 4UBOA 3DE2X 1PE0A 2W58A 2AJBA 4KMMA 5GMOA 3BCRA 3IVMA 3VPBA 4H6XA 2IS4A 2PLAA 2CLOB 3EDQA 5CITA 3P0RA 3UK6A 5GM2A 2OV1A 5LQUA 1YVEI 2ZJAA 2I9KA 2BDUA 3ZZMA 4ASUA 1N36B 1VM6A 1YHZA 2QR3A 4PG4A 4EJSC 3O91A 3QVUA 1YRBA 1XQ6A 2FFJA 4IXDA 3BXPA 3FKQA 3REGA 2ZI5A 1V8BA 5IJ0B 4BX2A 3P94A 1XALA 2Z4RA 1AO0A 4D97A 4QEZA 2QQGA 4NDAA 3QUTA 1V9CA 4KZKA 4QRIA 4QD3A 2FV8A 1Y8RB 1Q0HA 3T6KA 1WXXA 4D9HA 3S28A 5HQ3B 1ZH8A 3SJBA 1FPMA 4ABTA 2A9FA 3NG1A 5LL6P 5T67A 3HB0A 1FIUA 2PJRA 2NU9B 5AKLA 4B3MB 3FCEA 3VZRA 1Z68A 5IRCD 2R1TA 2LRHA 1BHJA 4DJFC 1ML4A 1MXFA 2CLEB 4GKAA 4BNTA 4C6TB 5CD1A 2L69A 3ACCA 2QI9F 4CM6A 4DB4A 1U3GA 2GNOA 2B5VA 2FPWA 1NT4A 4P32A 1J2YA 1EVEA 2K2QB 1ZUNA 3B8HA 3VR3D 1QRUA 2G9RA 3IKMB 3NTXA 3QX9A 3X1KA 4TTAA 2B3TA 5CNMA 4OXYA 2IITA 3U62A 1BNCA 4DM4A 1Y37A 821PA 1G1MA 4CKZA 4JBGA 4D0RA 1M7GA 4GYWA 5JZSA 3A4YA 2CVFA 1M54A 2FX2A 3ECCA 3FE2A 5KHOC 3BKWA 1E89A 4WADA 3RLFA 3V4VB 1JQDA 2AOUA 1YVRA 2VT3A 3WK8A 2F4VB 2RH8A 1OD6A 3EZNA 5DHQA 1IN1A 1UP4A 2OHXA 2QT0A 4WLUA 2O8BA 4D82A 1QG4A 3A04A 1QP0A 1N92A 1O5TA 3GJTA 3HH8A 4KVAA 4CDRA 2QTVB 2E6KA 3Q1LA 5KVQA 1UOOA 3H5TA 2MINB 1XZKA 3LKVA 4ZDWA 5DHAA 2QLFA 4FIDA 1TCBA 5FDFA 1VCIA 2WIDA 1TO1E 4O63O 4HB2A 5HJ7A 3RJ9A 2O1WA 1GQSA 3D4LA 1U8CB 3KDSE 3NWOA 3QJYA 3K16A 3OHMA 1E61A 1TOAA 3D6NB 3PITA 4V0SA 4WZ6A 5JPDA 3WJ2A 5JCOA 4YECA 2IY7A 1ONNA 5AXCA 4YO8A 3CNOA 3K0FB 4GS5A 4O4LF 3UV6A 2PVPA 3OZSA 1PR2A 1N4DA 3OFND 3PC8C 4RZQA 2HT6A 3KXPA 2HDWA 1MA0A 5EG5A 4EKIA 3GLFA 1ZA2A 4G0PA 3WX0A 2J9ZB 1YUNA 3PD0A 3QG5A 5ERGB 1IZ0A 4Q1VA 1Q7GA 3KAJA 2II6A 1WPGA 4JEUA 5HMLA 3N5CA 4ITUA 1TAHA 4KGXA 5C8YA 3INYA 4O0MA 4OL9A 4PZDA 4H2DA 4NE9A 3MWLA 3E23A 3CUSA 2FSVA 4IDOA 3H9JA 2Q2QA 2AK2A 2NUBA 3EOZA 3Q3EA 4ZZ0A 4FPXA 2ZTSA 3CVYA 4U7TB 1QWOA 3GUVA 4UTRA 2JFHA 3PB3A 9LDTA 3KDAA 2Y27A 4MYHA 3QU5A 4LJKA 4AF7A 3LX8A 3ACDA 3SJ7A 4BCBA 1NNSA 2EBFX 3JQ9C 3P96A 1L8XA 3UTCA 4B6FA 4AI6A 3OSZA 2E4XA 2GCEA 3KD3A 3STYA 2BFDA 1SQ6A 4UMFA 1NQXA 4LJ8A 5CYPA 3BRQA 5EWLB 3F97A 4Y18A 2ZFUA 5C8DA 1CF4A 5F33A 3T34A 4BC0A 3RAEC 4R8KA 1SXJC 4N12A 4CR8A 1D4AA 3NHSA 1NE7A 3EVZA 5LZ5A 2VDWB 2PXXA 2WZDA 1TQHA 4TKVB 4QREA 5AUPB 4BC1A 1P17A 4C2TA 4JI1B 1EA5A 2HJGA 4DQDA 2BBTA 2C1ZA 3UUEA 2QTLA 1LI5A 4QSMA 5TJHA 4M1QA 2AOUB 1TIBA 1ZVJA 4FXOA 5EUBA 3G5AA 1V45E 3KFXA 4JVLA 2BFBB 4PC3A 4S2EA 2AW3A 4LK2A 2FVYA 3SEQA 5ALLA 3I5MA 2A3NA 1C4OA 1EHCA 2O07A 3LHIA 4M8KA 3X1MA 3ZK8A 6LDHA 1K4MA 4KFUA 5J4KA 1X7ZB 4IUDS 4EZBA 5LU8A 2OAQ1 1Z4PX 3B3AA 2YVUA 3EXHB 1MEEA 3A9RA 3DAOA 4BZQA 3K4PA 5LOVA 3HN7A 2LWIA 2Q3EA 3HNOA 4E32A 4OXQA 1U4SA 4XPIB 1QGED 1XO1A 3OCZA 2G7ZA 1PDVA 3RC2A 4CMCA 1MNAA 1JHRA 2WFZA 2Q4TA 1DJLA 4NJMA 2J87A 4QSHA 4YYEA 1CUUA 1NUQA 2E89A 4HN4B 5ELMA 4Q9IA 3AV3A 2ODEA 1U0GA 1PJBA 1U2EA 4KSBA 3DDUA 4JLSA 1KDYA 4AJ1A 1OXBB 2H3EA 3JPYA 4TXHA 1CLEA 3MJVA 1AS2A 4FI3F 4JNCA 3R8XA 5M7EA 1Q22A 2NV0A 3D5EA 1IUPA 3EAGA 2LIPA 2Y93A 3EXEA 3PLRA 1CR0A 3HJNA 4C2BA 2JFBA 4TLEA 5FX2A 4RFSA 5FXMA 2X0FA 5KYYA 1ZX1A 4C0QC 1XK6A 2HO5A 3BH7A 4L4ZA 3U4CA 2CVHA 4E51A 1SCUA 4LWPA 4YMHA 1VE6A 5JXIA 4IFIA 4NPAA 4NFHA 3V8QA 1JEQA 3AGQA 3P2KA 4U6NA 1GA4A 2YFQA 1UFVA 4EHIA 4FFVA 3C87A 1T29A 3L1KA 3MT7A 4BQFA 3JR7A 4LI0A 4EI8A 1XTTA 3C7TA 1UMDB 4C3OB 1RXVA 1MO4A 3ZCRA 1OCEA 3D3NA 2R8OA 1JG7A 1RYHA 3AEYA 5EE3A 3WP0A 3F7MA 4Z54A 3NALA 1GNVA 2YQ4A 3LLVA 3N58A 4QZVA 4TLMB 1R0KA 3QX7A 4LWQA 5ITWA 2D2EA 4N4AA 4F56A 1QHHB 3HVJA 3L7NA 4UXHA 3VMMA 1HZJA 3OC6A 2EW2A 4RF4A 2ZROA 2VP2A 4PZZA 1ZD5A 1UFRA 2JCSA 2GR9A 1XA4A 4IJ5A 2CVOA 2Q2NA 2WHPB 5FUQA 4WHMA 4XLZA 5I8WA 2IW1A 1U4OA 1C3JA 3A6HA 1JSXA 1L4YA 4OUDB 3VHRA 4CCWA 3WHLA 2Z83A 3ZIAD 3GPIA 3FOEC 2RG1A 1C3OA 2YWFA 4WLFA 1I10A 4RLSA 3CT6A 1ZK4A 1SUIA 5FPSA 4CF5A 3AEQB 3KEQA 2NTYC 3H5OA 3PC7A 1OFIA 1SC6A 3UWSA 3LGSA 5C7IO 4PYIA 5FCDA 2IIBA 4DA4A 1FX0B 2V0CA 1Y82A 4MWBA 4KPFC 1E2IA 1P39A 2YV5A 3NHBA 4MP6A 5M5BA 1M6NA 2AI2A 2ZB7A 4DKJA 4RY0A 2I91A 4GUDA 5ESWA 5HZKA 2NO1A 1J8FA 1KXJA 4TXNA 2H3HA 3RM3A 4EECA 1Z8FA 1NMSA 2JFOA 3WKAA 5DNYB 1QRTA 4H7IA 3DXYA 4L2IA 1MD9A 1LUAA 1TUGA 4FZ5A 5JLJA 2JLWA 3JVEA 1CUXA 4HDAA 4PX5A 2PVSA 3DOOA 3AKYA 5C46F 3RG2A 2FWJA 4MLPA 5C4MA 3VI4B 2QUAA 1HDYA 4WT7A 2P2ZA 2EJWA 5BRNA 1RABA 3NC4A 5GJBA 4J43A 4KXUA 4AYWA 5BSTA 2GFQA 1ACJA 1B8PA 2IHVA 3BVPA 4NYJR 3IFSA 2R6AA 5EIWA 1NUTA 3I9KA 1L4NA 4UNIA 3B3QA 3JATA 5LD2C 1EX6A 2V8OA 4GMXA 2QLTA 3P2MA 2RKWA 5FWDA 4BMCA 2YR0A 3H19A 3LWNA 3DAYA 1NF2A 2Y2VA 3OQ6A 2CXOA 2VNKA 2XDAA 2OR3A 4N3BA 1L1FA 5BNZA 1GQFA 4NU5A 1CR1A 4EW6A 2J9RA 4L22A 1DQPA 3BXGA 1U7PA 4DEYA 2WFLA 2VPQA 3DE3X 3K4QA 4MP3A 4RL4A 1ODJA 4E4RA 3O84A 2YKGA 4FMDF 2XCRB 2PKEA 1VRVA 4MPTA 4BNKA 4RD6A 1UK6A 3JYNA 1SG9A 3DHEA 1JXQA 3O83A 4DCMA 2TRSB 2VTVA 4CM3A 3DNPA 4NMMA 3JRWA 5DNEA 1DC3A 1SBCA 1V2HE 1FUIA 5AW9A 5U4XA 1QVWA 3H3FA 3OLWA 3B1KA 1XDSA 3CB2A 1Q84A 1YVUA 2YWJA 4ZAGA 3SR3A 3T5AA 1P2TA 4K5QA 4QU5A 4B4KA 3OQOA 2ASVA 1C7FA 3JV7A 4UDOA 3S29A 8GPBA 3W8EA 1CZHA 2QIOA 5CURA 4YMWA 1IONA 3CA8A 3EGVA 3I9V6 3L0CA 3MELA 3QUAA 4XGKA 5LBTA 3FMGA 3G8CA 3KKNA 1ZWLA 4YJ2B 1XL0A 3JWJA 1W4ZA 4J7XA 3VJKA 1ZHFA 1EGHA 1O7JA 1EUZA 5JAZA 1O4WA 5A62A 1B8VA 3IR5A 1O0CA 2XCUA 1IU9A 1FSSA 1XFDA 2WJHA 4I8IA 4CWAA 1HTWA 2P9FA 4NU0A 3OF2A 5FTLA 5ELXA 4Y1FA 1NA5A 3EZ2A 3JPWA 1Z25A 2BT4A 3T1NA 4UXJA 3ZOZA 3RUPA 1JDJA 1A8SA 1I0LA 3H8SA 3Q7IA 4GQIA 1H93A 2BD0A 5C35A 1IXYA 2I6SA 3FVRA 4RQUA 4L78A 2B7CA 4TRRA 4F1KA 1ML3A 1JAHA 2C2MA 5EL0A 3X2EA 4C4PA 3QFCA 1LSSA 1CYEA 4P35A 1DHTA 1S2OA 1BMFD 3HDTA 4DUGA 1KOGA 1E2NA 1XDWA 2V6FA 3K9NA 4YIHA 1UODA 1OA0A 1VKRA 2QTRA 1RD4A 2X5NA 4BUJA 5DHTA 3JQ9A 4N3AA 4UTPA 2QZPA 1XP5A 4OJTA 1Q0TA 3I73A 5BXQC 1K6EA 1Y33E 3JQBC 3P2JA 4LN1A 2G1UA 3D0RA 4KXLA 4E5UA 1VIYA 5J3JA 1Q6YA 5HIMA 4YRNA 3GHYA 2IDZA 3S1SA 1FP7A 1VE3A 1FP1D 3MOSA 4HT3B 1PQPA 3L1UA 1NY5A 5DW3A 1U1DA 1P1FA 1CVRA 4HRVA 1FDUA 2WFLB 1JPNA 3ADOA 2PUAA 1U2QA 1XMVA 2I9PA 1JTEA 1SUWA 3JX9A 4Y6OA 3LC1O 4BKMA 2I2WA 4RE6A 1U28C 2QM0A 1ZK1A 2VCHA 1VKHA 4XVRA 4F38A 3RUCA 2FGJA 4ZZIA 1HOXA 5LU9A 2PY6A 6ADHA 4A2QA 1A0OA 4UAUA 1RM5A 2FQQA 4WLVA 5JSUA 1CK4A 1AHHA 1DO0A 1D2EA 2R4QA 5K0FA 2GTHA 3DMNA 3EDYA 2DR2A 5TEVA 1MRSA 4F84A 2C7OA 3AHDA 1TEHA 5KTSA 4CXMA 2FUG1 1K75A 4PIMA 3AM3A 4O2BF 4LQDA 2ZEJA 4O5OA 3F8SA 4MYUA 1H6DA 4KO8A 1KQNA 3L93A 4YPFA 5IVIA 1CC1S 2PMFA 1DJQA 1RWVA 4WJKB 1P9NA 4DE5A 1E6UA 2XVAA 4I5GA 2B36A 4BFVA 4WOPA 2IYQA 4X44A 1J8YF 1KI7A 2IU4A 2X1LA 3O47A 2RGXA 4M1SA 4QGBA 5CG2A 2ANCA 1E69A 2ZVQX 3C45A 4UM9D 5FUXA 4ENUA 4DIEA 2G72A 2NXEA 3CLVA 3ZI7A 3SYMA 3IBGA 5IDXA 5K99A 3QNUA 1OLUB 2W2KA 3WV5A 3OUZA 5B3JA 1DAOA 3EQ7A 4DUPA 4DDMA 5B1IA 2Z6UA 2BMEA 3AEXA 4Y2QA 1PCXA 5GOZA 3WB0A 4ZFNA 5HWSA 1ZM2A 5K9ZA 3TCXB 2CT8A 1NQVA 5E1OA 4EH1A 1QKKA 2PUWA 2ET6A 1IRIA 4E13A 2YJ6A 2DTXA 2VAWA 4YJHB 2Q7OE 1QLJA 3HCBA 3OLZA 2WMOB 4Y2HA 2KI5A 2IXAA 3AFMA 3GPDG 3OPVA 4M38A 4L0CA 4PE5B 1C0KA 3C3EA 2DWQA 2JEOA 4CT5A 3NW9A 4IDCA 1ICIA 1UPAA 1E5TA 2V55B 3GGOA 1RI4A 3EC7A 3IELA 4QOSA 4DY4A 3R0IA 3LECA 1EZZA 3GFOA 3ZWCA 1EDEA 2ZI9A 3KZ1E 1IZZA 2X14A 2YASA 5EIOA 3LOQA 1AS0A 3IQZA 2CLFB 4EW1A 3CW9A 4JR1A 2YBDA 3C97A 4BEVA 4M36A 5GONF 4ML3A 3P9ZA 2H65A 4ZVTA 4WK4B 1U1CA 3MGBA 3T4XA 1EA7A 3P0EA 5KQMA 1PG0A 4HEQA 3PC8A 4FCVA 4PG8A 4P6VF 3DH0A 5ALJA 3ZHXA 4QC2A 2Z04A 5JI3E 4BPRA 3U4QA 4REMA 2HDOA 3AERB 4B3CA 2GA8A 3RVBA 1T6BY 3C2QA 5HBRA 2Q41A 5DYNA 3DKRA 4F72A 3DUFA 2CXPA 2A5GA 3CQ9A 1V37A 3RVNA 4EVRA 1HL7A 3N70A 1M83A 2IF0A 2GUWA 1V41E 2WAXA 5ITSA 1CQPA 1XZMA 1BEZA 3HGQA 1QGAA 2I65A 4R01A 3H9BA 1NM5A 2XB2A 1CUHA 4MROA 3W5UA 1XCJA 1TC2A 4JIMA 2DH6A 3BN3A 3VNRA 1O03A 1QVRA 4MV3A 4C5CA 2WKQA 3MMZA 5FJJA 4EWLA 4BXOA 4MLCA 1P19A 4BNIA 1NXSA 1EQAA 1OHHD 1SB9A 2BGUA 3DFMA 4ZQEA 4NJEB 4YFVA 1A4XA 2YJGA 3VAYA 1E3EA 2ID7A 2ZAIA 3SXUA 3C6ZA 3VHXB 4MQUA 3ILVA 1CUAA 2H5LA 4BLSA 1CRZA 1DUVG 4LZJA 1KWGA 4K3VA 4AK9A 4Q82A 1TFRA 1J97A 4NNJA 3O95A 3DQPA 3DDNA 4PGMA 3CUKA 4BYMA 4P53A 3RYIA 2GEFA 3K70C 2JLAA 3FCYA 4XSHA 3C8HA 4I3GA 1F9EA 4KAJA 3WY9A 4BX0A 5KU7A 2EJCA 3ASUA 1WDTA 2JH8A 2J6HA 5FFNA 3ACBA 1O96B 1KS2A 2OD9A 4INZA 1JU9A 4L2IB 4BTEA 4M9QA 4CKEB 4WY2A 3IEMA 3GEHA 2HC9A 4M8SA 4X66B 4BNNA 3PC3A 3PXXA 4KFRA 2O8CB 3AI7A 3X2FA 2UKDA 3HY3A 4H9GA 2UUPA 2CXSA 3DMPA 3FMVA 4HYEA 3WOHA 4IJMA 4DLKA 1RHKA 1Q2XA 1JR3A 1DUSA 1QV9A 3B78A 4H7FA 4X94A 3SZOA 5K3FB 2XMGA 3PTLA 2IU6A 4ZU1X 3PLNA 3NLLA 3ZWQA 2YXBA 1BJKA 3WK6A 5AW1A 3GDHA 1GKYA 4G1BA 2H6EA 3RRMA 5LLDA 2V5AA 3G1WA 3T95A 1B6RA 1J56A 3H13A 1RSZA 2O8DB 1Z0JA 1YRQA 3GGSA 1PZGA 1IOLA 4Y0NA 2PL3A 1VXOA 1G6HA 1W36D 4HB4A 3VUFA 3CLKA 4DM7A 4C07A 4ND2A 2ZBEA 2Q4DA 4NZNA 2I1QA 4Z51A 2XZOA 5E3IA 1LKZA 4MICA 2BHSA 1DCTA 5EC8A 3A3OA 1X1AA 3PG5A 3WYCA 1TZ2A 2VYFA 3WBFA 3NYIA 3U39A 1X7YB 4BBPA 3ZJUA 4CEIA 5B6PA 2IELA 3I6BA 3MD9A 3DOCA 2GYWA 2GWRA 2PS9A 3GRVA 3PZRA 3BGDA 3ESXA 5AVWA 2AKYA 4YREA 2WT8A 1CV2A 4J76A 5FEUA 5MN4A 3SZMA 2CB9A 1YK1A 3U3KA 1WDMA 4MQFA 3AR3A 4D3DA 1JR4A 3KVOA 2VK4A 4P54A 1WCIA 4PZ9A 1IY0A 5ALGA 3AJDA 1KIFA 1IVNA 1NG1A 1LGYA 4JR0A 3QBVA 3VHLB 2LGJA 2LBPA 3H8WA 4EW2A 4ZXPA 2ZCJA 3HXTA 5K6TA 1MIHA 3TQSA 2NZ8A 3KTAB 3DZKA 4COKA 4LVCA 4R2HA 4RWZA 4RDCA 4KNVA 2C31A 3A4VA 3LDHA 1KDZA 4D4GA 5IANA 2VAXA 4TM8A 4QOHA 5B57C 4KPYA 2BFWA 2IUFA 3SOZA 3BCUA 5LQAA 1KYTA 3QP9A 2I87A 1CIPA 1A8PA 2EL9A 2G9VA 5ALOA 2PE5A 5BQ5A 3F8WA 2AI3A 5CT9A 1VRCA 4GMDA 4GRAA 5CFRA 3GOHA 5AM1A 1J1UA 2LUOA 5IM5A 3R5KA 4L76A 4NKRA 4MVJD 4FOPA 5JASA 5AKIA 1EUQA 1FE8A 4PFQA 4RCZA 3CEAA 2YMPA 4I1OA 2VP3A 3PI6A 4YT5A 5HDQA 2P2LA 3L4EA 1DG3A 1Y8RA 4RMGA 4KW7A 1Z7EA 4TYNA 1U5CA 3JAKA 3H2ZA 2K4MA 5C8YB 3HKBB 1FJXA 4MW1A 4MZDA 1QVVA 2BUBA 3F5MA 1ULTA 3V80A 5J4YA 1HFKA 1KP3A 2CHGA 2F43A 1PFYA 2XUPA 4N1AA 1N9ZA 3CY6A 3ND5A 3ZH2A 3TJZA 3R5FA 2V7UA 3KSUA 1RMYA 5A04A 3N86A 2EX1A 3RFFA 2AG1A 5IFKA 3G2QA 3H2YA 4FGWA 2UZ4A 3ZGXA 3UKOA 1ORIA 2OCXA 3LRPA 3OTHA 1GKLA 2QZ4A 5DXAA 5C5IA 3E1GA 4QGHA 2SBTA 2Q3MA 4EHFA 1CJSA 5B36A 4QUEA 5AHKA 2XVZA 3EULA 3ZTTA 3ET4A 1Z5UA 2YJNA 1WHSB 1N7GA 3C6XA 3FBGA 3PVCA 4JEHA 4XVHA 2FF5A 5CJJA 1QX4A 1NKTA 2O2ZA 4IX1A 1B8NA 4IIJA 1RQGA 1TQ8A 4P7KA 1UBNA 1XXHA 4B83A 4JGBA 4LZZA 4A8JA 3ZV4A 3OLCX 1MN6A 1IOZA 1I1HA 2DFDA 2JIPA 2Q9UA 5IX8A 2VSYA 4LDPA 5J4VA 3R0QA 1FNCA 2ZI3A 5A06A 1D1TA 3GMDA 5DGXA 4YQZA 1UBCA 4D0SA 4GX1A 3K96A 2EFCB 1MTOA 1EEHA 2FUNB 3TQRA 1XZHA 1E99A 4C04A 1TVKB 1O0BA 4RYLA 1E2JA 1YJQA 2ZBGA 3UO8B 4AY3A 1NKSA 3WYGA 2OCIA 4YRBA 5HW0A 3EXEB 5AI9A 4NE2A 3C5CA 1IN7A 3FIUA 3BGSA 1XCLA 2AEJA 1TXGA 3KFLA 1HQYE 3KHTA 1JIXA 2Y1EA 5KYWA 2IW3A 2XRFA 3IT3A 5TS3A 4DUYB 2PZFA 3AHJA 3DNFA 1ZN9A 3H8JA 4C78A 4OA5A 5FFMA 2L82A 3R24A 1OASA 2ZVJA 3PNKA 2I2FA 3LTEA 2VCEA 3H9EO 4QU8A 4QUHA 2XIQA 3R5JA 5SY4A 3F3KA 3ZG6A 2DT5A 1DIRA 3QVXA 3RS3A 1N0UA 3EGWA 4DJTA 2O0JA 4FYKA 2D2VA 4P92A 2IWHA 3ZNNA 3M70A 5KQPA 4MVXA 5FBQB 3QVJA 3FJYA 1LSOA 1W2WB 3DT8A 1CRLA 4OHYA 3R6GA 1P9WA 1UWKA 3UT6A 3SE7A 2VQDA 1I4LD 4NESA 4LC9A 2Q4EA 1XTPA 2ZU0C 3DE6X 3HFJA 4IGFA 4MVJF 3DF9A 5GVSA 1RLMA 2FOXA 3RADC 3AKZA 1NU6A 3SC4A 4BVKA 4CTKA 2PUDA 4M37A 4XEUA 4F0JA 3HXQA 1R6AA 1W4LA 3LFTA 4PYKA 5TQVA 1IDN1 1D3AA 3G0IA 1T9CA 4E46A 3OJWA 3VPXA 1Q3HA 3EXAA 4MR9A 2X2FA 4LRUA 3HY4A 5CX1A 5CJPA 1DOZA 3N59A 4MB0A 4QWWA 4CQMD 5LMZA 1CEXA 2XT0A 5FULA 5MF6A 1R10A 3NKVA 4MO2A 4BX9A 1SKQA 2GM4A 4M1YA 1P6UA 3A6PC 1B8OA 2F00A 2QUKA 3G2LA 4JLDA 4ZU6X 5K0BA 3HK2A 2ISQA 5DNUA 5FFFA 2BCGY 1HUQA 1ZRNA 3GH3A 3GJ0A 4RX1A 2FUKA 4UTOA 1V3TA 3A0UA 5JO9A 3RSLA 3B7PA 3UOGA 2JLSA 1AKUA 2OO3A 2L42A 3C7DB 3ELUA 4YUZA 4L8GA 4WXRA 1DJPA 4CLEA 4YYZA 1I1NA 3EEBA 4P1ZA 1X1BA 2HA4A 4CM4B 1ELOA 1I2CA 1I6LA 2CJYA 2I6GA 5A1TA 1C9NA 5JOQA 1AB6A 2PUCA 4G85A 3DOFA 4HEJA 3Q8XB 4Z7QB 2GKSA 4C89A 3IL2A 5BQXA 1SXJA 2BP7B 2IP1A 4RVFA 1Z18A 3VNBA 1ECBA 5CYFA 3V8RA 2OKGA 3WOVA 2PQ2A 2PBRA 2PUHA 3KEGA 2CXNA 1A4RA 4ZVRA 3T52A 1DOHA 4JCOA 4RPHA 5TLSA 4Q12A 1T15A 1WNFA 2H1IA 3N05A 2XDWA 3AT1A 4Y9SA 4M89A 4PTLA 1MBZA 1OLSB 1FXWA 4GI7A 3MYRA 3HEMA 5DIFA 3UXYA 3CVWA 1MB0A 1ETHA 4HUQB 4KNYA 2BFPA 2DFVA 2FPOA 2R5NA 4RBNA 2A84A 2YOFA 4KVFA 1CTQA 1N8NA 3A9CA 3LQQA 2AV6A 2QENA 4LQ4A 3NUQA 1OXSC 3FOAA 4RHCA 2F9MA 4X1KB 1W94A 2G71A 4FZJA 2EDAA 3M9WA 4AJHA 4P82A 3NBZC 3QU9A 4G63A 1L5LA 3DZJA 1UBSB 1PQUA 3RSFA 3Q3CA 2BTOA 4CM8A 4YJDA 5KHLB 4GXNA 2JFYA 5JJLA 1KY2A 1FFYA 2DBZA 4KPEC 2J4DA 2REOA 2ZIAA 1E2PA 3DT6A 3KFVA 2VS1A 3VKGA 1W4RA 3GZTB 4H1HA 5TS2A 4URVR 3QY9A 4EUHA 5GV8A 1Q20A 2R3SA 4YC7A 4YRRA 1ISPA 5L9AA 2R751 3NHLA 3QVMA 1TVMA 1NR7A 4UBKA 1QG0A 1XTKA 2FR8A 2WJGA 4MCHA 7REQB 1RHRA 5FTJA 4JLOA 3REOA 1EI9A 2VXCA 1EDBA 2NQ8A 1G19A 4FYMA 1KR5A 1M3SA 2CLIB 4BGEA 9LDBA 1G4HA 5I3ZA 4J2HA 4BP3A 1YR2A 4OPMA 4S1NA 3THYA 2OQVA 2VJOA 2O4CA 4BFXA 3EG5A 4L08A 3FYUA 2XMZA 2X0EA 5IAGA 2CY0A 4F85A 2QXUA 1UQTA 2CNKA 3BK2A 2PS0A 4HI0E 2YHBA 1FS5A 3S0JA 1DCFA 1OJLA 2CB0A 2ODNA 3PZBA 3BS4A 3UJ9A 2FPUA 5MDHA 2HA0A 2XJ9A 3GCZA 5JS1A 2NX2A 1GY8A 3MIIA 1YZGA 3B51X 3FD8A 4JBIA 1T5SA 1SCIA 4LVUA 3IE2A 4YCAA 1P3JA 3IOEA 2G04A 5KYGA 4AKEA 2V54A 1RBQA 3CZCA 3BXEA 2DT8A 2ZIEA 4TL7A 1UMBA 4V02A 3I8SA 3LG2A 5G1OA 2VF4X 2PXAA 2TYSB 1FFEA 2YZMA 4I1IA 2DPXA 3NVMB 4KVGA 3WHPA 3GLIA 2V65A 2LD4A 4LHVA 1P74A 5CLLA 1L9KA 5LQKA 2ABWA 3M5PA 4N65A 3T61A 3LFHA 5JJKA 2QUHA 4O4HB 4N7BA 1K4YA 4DLBA 1QIKA 3N3BC 3X2SA 1K0FA 1R2QA 1RC0A 3CG4A 3MQFA 3HADA 5BN1A 5LLTA 2XCOA 7MHTA 4WK2B 3HUUA 4R0MA 4FYYA 1THTA 1EM8B 4NG4A 3U0VA 2XYPA 4K8RB 2O2JA 4QOEA 2N75A 4AWBA 1DRKA 1E79D 1R8JA 2IP4A 4Z9XA 4B8YA 1IZ8A 5BVHA 2MYTA 1FU4A 2FEPA 3CGGA 3L49A 1EP9A 1N0WA 3MVEA 4JVOA 5BN4B 5JQGA 4ACAA 2HLDD 3VUEA 4Z6KA 1ND6A 2QRUA 2WU3A 2FMKA 4DTCA 1NVVQ 3B6JA 4DLVA 1U0LA 4E2XA 2XF2A 5KWJA 2HMVA 4ZCPA 3RFXA 1BHO1 5EMMA 3T3MB 3L6CA 5H83A 1IWOA 2Y2UA 2QN8A 3AIKA 4NHOA 5E7MA 4DLZA 3M5DA 1E7SA 1B26A 4DR1B 3DVSX 3KOMA 2JC3A 1L5VA 3VR5H 2F6RA 1GL3A 1KZ9A 1UADA 1QORA 4E2ZA 3SC2B 2DPHA 5JW6A 5ALHA 3IO3A 4OK3A 1J0AA 4HN9A 3RHTA 4CMIA 5KQGA 2QPLA 1U81A 4IV8A 3U5TA 5EUQB 4KODA 1P2UA 2NSDA 5A4MS 5J2TA 3BMNB 4KH1A 5DISB 3FDXA 1D8AA 3OX3A 5DT2A 4JN6B 4Q1FA 5E95A 3RVQA 2AJCA 3ZQKA 1SKUA 1G41A 1E5LA 3CH6A 3H84A 2N47A 2H9YA 4UZEA 1DEOA 2QR5A 3I9NA 4CM9A 4A1FA 2CJPA 4G4GA 3SYTA 3A58B 5DH9A 5IYZA 3NTRA 4YRZA 1BJTA 1YZKA 3AF2A 1MT3A 1FYEA 3INGA 4KEAA 4R9RA 2ZAGA 1THZA 1CQJA 1TRKA 4BECA 3V4LA 1DKNA 3DO8A 2Z09A 2IIPA 3N74A 1Y42X 3K2IA 1PF7E 2BPOA 1DIOB 2YJZA 4WA7A 2QY9A 4I50A 4S2UA 4G1VA 2ID8A 4HS9A 1VL5A 3EUWA 1IEVA 2HA2A 3HACA 4BQPA