5FBHA

Crystal structure of the extracellular domain of human calcium sensing receptor with bound gd3+
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
517
structure length
470
Chain Sequence
PDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDIIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDEGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of human calcium-sensing receptor by magnesium ions and an unexpected tryptophan derivative co-agonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Extracellular calcium-sensing receptor
total genus 146
structure length 470
sequence length 517
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA01
3RVMA 4W5QA 2A9PA 2FMKA 1LBIA 4H60A 1H9CA 4JB2A 3KCNA 5FWXB 3N75A 5JNTA 3C97A 4MGEA 4O1HA 1D2AA 3B2NA 2FVYA 2PMCA 2E4UA 2RDMA 4FE4A 4MR9A 5FWYA 1P6QA 1YMVA 1ABEA 5TQ2B 3OLXA 4L4UA 3URMA 1RZRD 1R8JA 2HQBA 2MSWA 1YVUA 5C5CA 3KHTA 3HVRA 3CU5A 1DBWA 4LE1A 3HK2A 2QVGA 1TLFA 3ILHA 3JS5A 4MR7A 2VUIB 1GLGA 3T38A 1U2PA 4Z9BA 3C3KA 3RVSA 3MYYA 3NNDA 2MSLA 4MRMA 3CHYA 2L19A 3CNBA 3MM4A 1GCGA 4MYRA 4WXEA 4N0QA 3E61A 3KJXA 3Q7RA 4RWEA 3OQOA 1BA2A 3C6QA 5E3JA 4EGSA 4ZPJA 3O75A 5I4CA 4FB4A 1YMUA 2FN9A 4N41A 2B4AA 2LBPA 3RVOA 3S99A 1ISSA 3I09A 4KVFA 1W25A 1MVOA 5KQGA 1EHCA 3JTEA 2R48A 3QLVC 4IF4A 3MQ4A 4LE0A 3OMXA 4Y9TA 1APBA 2ZAYA 1SRRA 3LUHA 2HSGA 1U04A 2R47A 4RXUA 2PUGA 3O1IC 4QYWA 4E7PA 4RS3A 5BRAA 4OG2A 3RVLA 3T6KA 3FFWA 4RDCA 4YO7A 4KREA 4Z99A 5JS1A 1QMPA 3QLVA 3H5IA 4YGXB 3GA5A 2NUBA 5JNSA 5KC9A 4PICA 2CD7A 3I5AA 1E2BA 3QK7A 2RJNA 2FLWA 4RXTA 3O1HB 1BDHA 4KMRA 2F8SA 5DLEA 3KTOA 3DLHA 2I6FA 2PE5A 3A3KA 2L17A 3O2QB 1URPA 1ZHHA 3RVJA 5JNWA 5DTEA 5JNUA 4H3KB 2A9QA 1YS6A 4Q6WA 4PYRA 1JYFA 3O74A 8ABPA 1AB6A 3TX6A 2AYZA 5IEJA 3DGEC 1MIHA 4WZZA 4G0ZA 5FWYB 4GPAA 5IX8A 2FQYA 2WJWA 3IP9A 3TD9A 1DCMA 1NXVA 2XDYA 2CHFA 4RK5A 2MSKA 1Z17A 1JH9A 1JHZA 1QP0A 4KK3A 3OLVA 1K68A 3CRNA 2QV0A 3QLTA 3F6PA 4MS1A 3BRQA 3ROFA 2KYRA 4RK6A 5JNRA 4RY9A 2GI4A 2YHAA 1JDNA 2VUHB 2NT3A 4KK4A 3N0WA 4YCSA 3QELA 2PKXA 5IEBA 5EWMA 4CBVA 4Z4EA 2JRLA 1JWLA 2FQWA 3NHZA 4LX8A 4P1ZA 5JNVA 1ZAYA 4ETNA 1Z15A 1TVMA 4EVRA 4MQEA 3FGZA 5TPWA 4LDAA 4MQEB 4KQ9A 2TMYA 4KRFA 2IPLA 1D5WA 2PUAA 4H3HB 3EAFA 1W9HA 1F4VA 2JBAA 3LUAA 4Z9AA 4HNQA 3C3WA 2FN8A 4HNRA 1JL3A 4F3TA 3Q7SA 2WB4A 4G0OA 1PNRA 3BRSA 1A0OA 1USKA 4MAAA 3JVIA 5EWJA 3Q7TA 4RKRA 3KYJB 4EYQA 1NTRA 2WRZA 4NV3A 4Q6BA 3F73A 5C5EA 4W5TA 3CKMA 3UUGA 3IP6A 4PZ0A 4RKQA 2IOYA 4EVSA 5BQ3A 1DCKA 2RGYA 3KG2A 4WT7A 2HJ9A 4EY3A 1Z2EA 2E4YA 4TN5A 1JFTA 4YV7A 2PL9A 1ZITA 1NXWA 3KLNA 1TMYA 4JA2A 2P9HA 2IPNA 1EWKA 4G0QA 2VK2A 4JAVC 4P98A 4RZSA 4N47A 4RY8A 3M9XA 3KSMA 1KGSA 2H3HA 2R4QA 4IILA 4XFKA 2IPMA 4QPJC 2WMYA 3M9WA 3M6MD 1F51E 4DN6A 1U0SY 1USIA 3H6HA 3OQMA 4KFCA 4KZKA 1KRWA 3OM1A 3EDCA 4Z4HA 3C3MA 4ETMA 4TLMB 3W9SA 5DKFA 3CTPA 4ETIA 2JVIA 1AB5A 3HM9A 1QKKA 4EYGA 1NXSA 2MYPA 3LFTA 1NATA 3ILYA 5CHYA 4LDZA 1E6KA 3FMVA 4Z4CA 1KRXA 4MLCA 3NNNA 3D02A 3QX8A 3OO0A 3I45A 3H5LA 2P4UA 2M1ZA 3P9YA 1PHRA 1M2FA 5DCLA 1D1PA 1JFVA 1BVHA 1CYEA 4KQCA 1GUDA 3H5TA 2VYCA 2NZUG 1FFGA 1ISRA 1Z26A 3HV2A 3SM9A 1SXHA 5ABPA 1Z16A 3UKJA 1XWWA 5HKOA 1MB0A 1DBQA 3FFTA 3OLZA 1U8TA 1ZH4A 1JF8A 1PEAA 3N53A 2IPAB 3KYIB 5IC5A 3CZCA 1C0EA 2FLKA 3BBLA 3IPAA 4MRMB 4RV5A 1RZRA 2E4WA 3LMKA 4IGAA 3RVNA 3KKEA 3SY8A 4ZMSA 1QP4A 1SXIA 3H5OA 1QQBA 2HQRA 4MS1B 5CNMA 2AYXA 3LUGA 2FMHA 5TQ2A 3O2JA 4JP1A 1GUBA 3Q9SA 5FWXA 4EYKA 3GWGA 1QP7A 3MF4A 4MQFA 1NXXA 1XHFA 1ABFA 2PUDA 3BREA 5FBHA 5IULC 4YWHA 2FW0A 2A9RA 1E6MA 5EWLA 3A0RB 3QEKA 3I42A 3RVPA 1BDIA 1DBPA 3H6GA 4Z4GA 3DLBA 1QNLA 1FSPA 1MB3A 1USGA 4XARA 5KWSA 4JOQA 1A2OA 5F64A 1DZ3A 5CNKA 1GCAA 4F12A 4D6XA 4N76A 4OATA 2PUCA 4KV7A 4XLTA 3VNAA 4RK4A 3LUFA 2ID9A 3LUCA 1S8NA 1PEYA 3EODA 1EWVA 2CHEA 2X7XA 1VPWA 2CWDA 3H1EA 2LIVA 2MYUA 4FE7A 4XASA 5TQ0A 1TJYA 3IP7A 4RK0A 7ABPA 1ZVVA 2QR3A 1T34A 3EGCA 4NQRA 3IPCA 2JBAB 1A04A 3G85A 3K9CA 5HSGA 1JFSA 4G0XA 1IIBA 2E4XA 4KPYA 3DZDA 5KQLA 4MLDA 1NXTA 2Q5CA 4MS3A 2DRIA 3FFXA 3TB6A 2L18A 2PJUA 2FKAA 4JB0A 3RH0A 5TQ0B 2W42A 2E4VA 3IDOA 1M5TA 4RY0A 4WXMA 4MPTA 5JS2A 2GBPA 3T95A 3EQ2A 2FEWB 1KMIY 5KQMA 1YTUA 4HYEA 3JVDA 2LUOA 3HXMA 1FQWA 1Z13A 2FTKE 5CNIA 3FDFA 3LKVA 3Q15C 4ZYLA 1Z12A 2HQOA 3H1FA 5HM6A 2ID7A 1ZGGA 4YLEA 3EQZA 1DP4A 1YIOA 3EULA 3K4HA 2RJOA 3QLUA 4IRXA 5TE9A 5EWLB 1XHEA 5ED4A 5KC8A 1SXGA 2GWRA 3VNBA 5KQPA 3MIZA 1M5UA 4XAQA 2O20A 4MQFB 5D2CA 4F8JA 4OLBA 4YR7A 2FQXA 2QU7A 3O2SB 4N0PA 2FEPA 4G86A 5CNJA 3L6UA 4TLLB 5EWJB 1YS7A 1P8AA 3BILA 3GYBA 4O5AA 3GBPA 1RPJA 1D4ZA 4MR9B 1NY5A 3MMNA 3OLYA 2NZVG 5GOTA 5DGCA 1EFAA 3EJWA 3UK0A 1JX6A 2JCGA 2N9UA 5TQJA 4NICA 3RVQA 2M98A 3QEMA 3HUUA 2FEKA 1PNTA 2WJAA 1OXKB 1Z18A 1E6LA 1FFWA 4Q7EA 3CFYA 4RSMA 4KNYA 2IYNA 3OQNA 1BDJA 2QZJA 3F7NA 4G0PA 4NCAA 5PNTA 3NNSA 4N03A 4W5OA 3A0UA 2PL1A 3HEBA 3HO1A 1MAVA 3GBVA 3HSYA 2JB9A 3QELB 3GRCA 3CS3A 3H75A 6CHYA 1P6UA 4M88A 1ZGZA 5IBQA 1EWTA 4HNSA 4D74A 9ABPA 4UHKA 4PE5B 4L85A 3CZ5A 4QYMA 1JBEA 2BGGA 4YRZA 4WUTA 3H5WA 4DADA 4ML3A 1JLKA 2GKGA 3RVKA 1LJLA 3KLOA 3LOPA 1NXOA 3O21A 4MR8B 4ZMRA 1QQAA 1VLZA 2ZWMA 5IUKC 2LPMA 3TMYA 1J56A 4ZJPA 1ZN2A 1ZESA 3LTEA 1PUXA 3QLUC 4F06A 1CHNA 2QW1A 4B09A 4D6YA 5IUNC 3E3MA 1B00A 4RU1A 1BAPA 1TM2A 3RQIA 2FMFA 2MYTA 1U2QA 4OLAA 4LE2A 3HUTA 3OLWA 4IMIB 5HQJA 2PUEA 2YHBA 4G97A 3SQNA 1YK1A 4MS4B 3LUDA 4G0MA 1Y1LA 4YS6A 5IUJC 2JK1A 3IP5A 3Q41A 3OO1A 1YK0A 4QICA 3ROTA 2F8TA 2H0AA 1L5ZA 4MS4A 1VKRA 2FMIA 4RK1A 3N8IA 3HDGA 3HS3A 3HJFA 3SNKA 3JPYA 1P2FA 1HEYA 1LBHA 3H5VA 4TMYA 1LJUA 3N0XA 4UHJA 4DQDA 3G1WA 4W5RA 3R0JA 3L49A 4LZLA 3SAJA 1RXIA 5GQSA 1DG9A 2MYNA 2PLNA 1ZDMA 2JVKA 3HDVA 1Z2DA 3F6CA 5B3JA 1I3CA 1ZY2A 2WWVD 4Z4FA 2PUBA 4EUKA 1VRVA 3NBMA 2B1JA 4Z0NA 1WETA 1DC7A 1DRKA 1QO0D 4EVQA 4RK7A 2OENG 5FBKA 6ABPA 4MR8A 1L5YA 4JASB 5TPWB 2QVCA 1UDRA 3O1JC 4O1IA 3HCWA 1RXEA 3JPWA 5B3JC 3JY6A 3LKBA 2GX6A 2E4ZA 4PEVA 4S04A 5TPZD 2PUFA 2FSPA 4OBBA 2J48A 1QPZA 4W5NA 3LUJA 1NXPA 4MR7B 4MS3B 1EAYA 1CEYA 4XXHA 4S05A 3GT7A 4E7OA 1M2EA 4Z4IA 4YP9A 3TO5A 4IMJB 4EYOA 4F11A 5T3YA 2HPHA 2V0NA 2PAFA 3NHMA 1ZH2A 5KI6A 1K66A 1FFSA 3A10A 1DRJA 2IKSA 2L2QA 3LUKA 3N6VA 4WWHA 3GV0A 1C4WA 1DCFA 4LRQA 3D8UA 4RXMA 5BR1A 2JVJA 1SD5A 2OQRA 1QO0A 3H1GA 3HZHA 4OTZA 3N0RA 3CG0A 1DJMA 3QX9A 3T8YA 2R25B 3QEMB 4NCBA 3KS9A 2A9OA 5EWMB 2WY2D 4GNRA 1RNLA 2QSJA 4G0YA 5TPZA 1D1QA 1JYEA 3CG4A 1Z25A 3MA0A 1LK0A 2LP4Y 3RVRA 3DBIA 1JDPA 3CLKA 2FXIA 3OM0A 3SG0A 3GL9A 1DC8A 2NT4A 5T7BA 2QXYA 3OMWA 3DGFC 1OXBB 2IDMA 5BRJA
chains in the Genus database with same CATH superfamily
2PUHA 4L8WB 4DV7B 3SYLA 2EQ5A 1RWOA 4RGQA 4S1TA 3S0JA 4CFSA 5BSVA 1WCV1 2FZGA 3IAEA 1UZUA 1LD3A 2VRBA 3DFKA 4IH4A 5CX4A 2F1HA 4I55B 1P62B 4MUNA 3S4YA 2ZRPA 2ZUBA 3ER8A 4BNNA 5KNLA 5EMNA 3LLSA 4MPRA 1A5ZA 3M5DA 1P9LA 3HVRA 3KOMA 3K3PA 1BYUA 1HMYA 4K7JA 3UEOA 4FYPA 4BCDA 2WFLA 5FA8A 3AL2A 1NBIA 2VP9A 5K5EA 3HDQA 1P4AA 3CW2A 1XD8A 4GL4A 5DX0A 5IKMA 2ZU0C 2D3TA 4MEBA 3NOOA 4AWBA 1P1JA 1B1CA 4LY0A 2EW1A 3LOUA 2ZYDA 2NTVA 4BX2A 3P7MA 4U0KA 4N8DA 3ST7A 3V6MA 4LHXA 1LRKA 4KMOA 1Y8RB 3N2LA 5DT9A 4AKEA 1DJNA 4KQWA 3AWIA 3O82A 2GYVA 3CN9A 1PZFA 1O96B 3FHLA 1QXSA 1DPFA 1HLFA 1RIFA 2Z4SA 3HDJA 2HMAA 3EMKA 3L05A 5BOSB 3QU7A 1N4AA 2RGEA 3URKA 3VR5H 2O2DA 1IY1A 3HNRA 3I09A 1Y4SA 5AKGA 5F3WB 2IS6A 4RIFA 4HDCA 3JTEA 2M6LA 3TNFA 1E1DA 1EFVB 1LC0A 1OV4A 1CUZA 4CKZA 4P0PB 5EIEA 1E5VA 3LY8A 3ZJVA 1U04A 2JI8A 2FF5A 2INGX 4QYWA 4BNVA 4E2YA 1MW8X 1OLXA 1T6NA 3D4OA 3OQBA 1QGAA 3BERA 4AJLA 2UKDA 4S1VA 3KXIA 4QUAA 5IJ0A 1L5VA 1QH1B 1N5DA 2B7LA 1GTL1 1M2VA 1V16A 3A6HA 2RJNA 3I5AA 1JHVA 2FLWA 4UFNA 4O2BB 5FD8A 3S8MA 1UC9A 2GK3A 4XSHA 4C22A 6YASA 1BD3A 2F8SA 4P0TA 1MR3F 3RS7A 1SVIA 1ZG3A 4ID3A 4UNRA 2G06A 2XVYA 1SG0A 2V3VA 3E2MA 4N54A 2RARA 5T4FA 2RHMA 3ZNNA 4MGIR 3GDGA 3OFKA 2WIDA 4JROA 4OP2A 3K2IA 4HX5A 3B5IA 3G59A 3DKIA 2VSNA 3U16A 2ZI6A 4M6WB 2X2EA 4G9GA 3CX4A 5EKUA 2FMXA 3TX6A 1G4HA 5JD3A 3SIRA 2C9BA 1R27A 1FDWA 1MIHA 2KS6A 3B9PA 3PB3A 3VO2A 4AUMA 4JJZA 4MUXA 4B17A 5FWYB 2LD4A 3BRWD 1JVNA 3BVPA 1AZLA 4RQAA 2OM2A 1I33A 4MW4A 1XVUA 5BV2P 4JJGA 1SKUA 1TRHA 3A58B 1CS4C 1QIKA 4CV3A 2Q9CA 2ZRMA 3W2TA 5CFLA 5SV2A 4U8HA 3MQFA 4AWAA 1U6IA 2PX2A 3PEVA 1KDRA 2QT9A 3DV0B 5LLSA 1G8SA 3G2OA 3OTWA 2AZDA 1GCOA 2JIZA 3LPAA 2NO1A 4OMDA 3SF8B 3U13A 3UMRA 4IOJA 3WMFA 1EZ4A 1VB3A 1AKQA 2PD6A 2GBLC 1S2LA 4KK4A 5I9NA 3I30X 4BFYA 2C5GA 1D8TA 3G13A 4UATA 3UVEA 1T4BA 4DDWA 2A86A 1ZIYA 5BN5B 2ZSUA 1KDYA 3O8LA 4ZYUA 3KZKA 3ITKA 2JGFA 1Z15A 2ZS8A 1TVMA 4N9WA 4OQYA 1Z08A 3ZQKA 1V8BA 1VIAA 3CB2A 4MYSA 1Q91A 4MQEB 3G82C 3NHAA 4KQ9A 5ADUS 1G8YA 1RM4A 4XTRA 1UC8A 3WNBA 4O63O 4C6TB 2X0JA 3OWXA 2WV7A 4IIJA 1HDIA 2FFRA 4Q9IA 1W0JD 3QUTA 2Y2VA 3IOBA 4BQQA 1Z07A 1IY0A 2Q9AA 4JLUA 4FGLA 1JQ5A 2PO7A 5DVZA 3E9ZA 5CB4B 4CYMA 3TOVA 3IPRA 4TN1A 3QG5A 1XRRA 2D5CA 2D6FA 2FPLA 4GPTA 1WPGA 1YQEA 2AQ8A 1X9GA 3IQXA 5A4FS 5HOQA 2Q6IA 2QTMA 2WD8A 4AP5A 5JZMA 1ZW1A 3VPCA 1V1MB 4C3OB 4V0NA 4HH4A 1CR1A 4MV7A 1E3SA 4QFCA 4KPUA 4YUAA 1NDQA 2D3WA 2OOSA 4KQHA 3VYSB 1VIVA 3INNA 4HL6A 4CKBA 1OFGA 1SXQA 1I6LA 2DR2A 3MXOA 3CH5A 4WERA 3P2JA 3VPAA 5JSQA 4PCAA 5FBLB 4F1KA 3ZE7A 3QJYA 1K5HA 1YZYA 1T3LA 4NSNA 1MO4A 8OHMA 1NY6A 3KLBA 4P98A 4C0KA 2BHSA 3ZHRA 4L5YA 4MI3A 1NQXA 2ZJYA 1WXQA 4J9UE 4BB6A 1B76A 5FOXA 2PUVA 3A4TA 4QDTA 4KFCA 1BMQA 3KV3O 1ZXLA 2ZJ1A 4HGNA 2AL7A 3QVSA 4LKRA 1JXQA 1P2BA 1TKCA 2OCYC 3V8EA 2ZUDA 1Q0SA 1TPZA 4CM6A 2WSMA 3IVCA 3AEXA 5HXAA 4S1OA 2ZJ7A 2ODWA 3BB4A 3DYVA 3KEQA 3LFTA 1KQGA 2M6SA 1Z5GA 3RJ5A 4AJIA 4M9SA 1H9AA 1UT6A 3PU6A 3OO0A 1ESNA 4OBXA 4CEHB 2V45A 3BQNB 1H2HA 1JB9A 2P4UA 3DFIA 3MELA 2BHNA 3OCYA 3P9YA 4DUGA 1KAHA 4CEIB 4F4HA 5J40A 1TKBA 3LPLA 3UB4A 4A10A 4B3RB 2V6MA 3W8FA 4HDOB 4OMFG 5CA0A 1E5DA 2H3EA 2GMWA 2ZVJA 2IOHA 3QYPA 1G9XA 4KAXA 1DU4A 1T35A 3TTYA 4BC0A 1Z26A 1TK9A 3JAKA 2I2DA 5FFFA 2OV8A 1JDJA 3E1GA 4FCWA 3ZU6A 2XRMA 1E3JA 2N46A 1P0IA 2PZJA 4XB2A 1HLGA 3VR2A 1XWWA 2ZRBA 1AXGA 2E0IA 3FHOA 4RH0A 3TS1A 2VAXA 4BO5A 2Z9DA 1ZH4A 5KX5B 1R0CA 4I6GA 3VR6H 3KYIB 3O8CA 1M6YA 5ALTA 4TL7A 3RBZA 3BH0A 2WJ6A 4IP0A 4F4CA 3W90A 3O92A 2HA5A 4DUGD 2EQAA 3MK31 3AF3A 3H1BA 2ERCA 1T1JA 3SY8A 1I2CA 4MWTA 3RPEA 1NYQA 3U62A 4IXWA 3V8BA 4H7JA 5CNMA 4O2RA 5HKKD 1PHPA 2G5TA 3FSJX 4LMBA 1BN7A 4KX3A 1XJWA 2RGNA 2V1XA 4F3NA 1QIJA 1U6KA 4J1TC 4B6JA 1J2JA 5A1TA 2O2YA 2Q5JA 2OBFA 4X54A 2I3BA 3T34A 3L0YA 4EY7A 4G0WA 4J90A 1VRCA 5J43A 2B0JA 2NU9B 3GUHA 3NI2A 4KP7A 4QPPA 1XZIA 3AX6A 5DXAA 1VMKA 1IHUA 1SA0A 4HN4B 3W6PA 4WBXC 3R7LA 5BOVA 3QEKA 2VL7A 3V1YA 2XGJA 1QGED 2WT4A 4G1UC 4DY6A 1M1YB 2GERA 1QC5A 3P27A 4OKSA 1VMDA 2PNJA 1FSPA 1X1BA 1X15A 1J09A 5IVIA 4BUZA 1SFRA 3FYUB 3OE7D 2XNDD 3P97A 1N6LA 2VHEA 4BX8A 2ZIGA 4TX1A 5K05A 4XLTA 2G5CA 2VAPA 4XVQA 4AZ0A 3I34X 5GVSA 1TW3A 5IBCA 1GP2A 2EG5A 4URVR 4R2IA 4TV9B 4DEXA 3V8PA 3WV5A 4MYDA 1BSVA 4BP8A 5A71A 2NIPA 1EB8A 1W35A 4KAFA 1RYDA 2AUMA 1SBQA 2AB0A 1H4TA 1X80B 4X61A 4TUYA 1RABA 4NE2A 5G4KA 2VHYA 2D74A 2I2BA 3DE1X 2I76A 3NOXA 4B32A 2OESA 4FS8A 1OT3A 3VH3A 1E62A 4H0CA 2EGUA 3TSAA 1L7VC 1TTPB 5LKAA 1HE2A 1WCXA 1KBQA 2OCXA 2W42A 2E6UX 2WPDA 1KYTA 4IWXA 3TQRA 4Y6OA 5H8WA 3DDWA 1KFKB 3SC3A 1HMPA 4QEKA 2FEWB 2IEIA 3ZDCA 4EHDA 3SWWA 3OQIB 2WYVA 1PVDA 4QKQA 3VPBA 4HDSB 3IILA 3DZCA 4ZZ2A 5BWBA 2RHDA 4IEIA 1GD1O 1QF9A 4MW0A 3BGSA 2QX8A 4GZ5A 4Q3EA 3R7AA 1YIOA 1ODSA 2ZDQA 1JDUA 2XYPA 3HG7A 3DBVO 4UVEA 4DVGA 1L5SA 3H87A 3SYMA 1J2YA 1GEEA 1N1DA 1JTFA 2C2ZA 1J39A 3QBVA 2Q3FA 1MQAA 2BKAA 3TH5A 1EFHA 2A0KA 3L18A 2O20A 4C88A 1TADA 3B7PA 4Y2RA 2JIZD 4ARVA 1OYVA 4H7PA 1U9ZA 5JXIA 3KHSA 4G86A 4U7TB 1WXIA 3PNBA 2BL4A 1W4AA 2W6JA 2NZJA 1YE3A 2UUBB 1SQGA 4M3NA 3Q3IA 5EWJB 4YJHA 4MYCA 1CR0A 1DL5A 1U0BB 3E7PA 1Z4MA 2HLDD 3UJBA 1I10A 3KWFA 4OAQA 4BAUA 4HH0A 5J1TB 3CNQS 2RHRA 1P91A 1IWOA 2X5JO 3EJWA 4QBKA 5CM2Z 1JX6A 2HLPA 2JCGA 3NT5A 4XIIA 4NICA 5TQJA 4R7ZA 3UK0A 4BCCA 5I9LA 3HVUA 1V3VA 3RYTC 4LBWA 4LJAA 4OXNA 2R79A 2V7UA 1TMGE 4RSMA 1Q0ZA 1LCIA 4KNYA 4C78A 2BJWA 3D2LA 1FJ2A 3G6KA 4DJTA 1XYGA 4YT2A 2AOWA 4Q19A 4RM2A 3U60B 1K3UB 3F3YA 3KEMA 3ZNPA 4BP1A 3KEGA 3R4VA 3MHTA 1ONBA 1NF2A 1NIJA 2WSBA 3PE4A 3VTAA 2IUSA 2XE4A 5CXUA 3W4IA 1MX9A 1PX0A 2PRYA 3MBIA 4DMLA 1GNSA 4G23A 2ZRKA 4FKMA 5DV9A 2A35A 4PO3X 4F8YA 2WUGA 1G5IA 4X7BA 3CUVA 2HU7A 4D74A 4F45A 1EVJA 3S2ZA 3WP0A 2NO6A 1QG0A 3WG9A 1OAOA 3ANXA 3JYLA 4HWKA 3WYCA 3K8OE 2JLUA 4GG1A 5HUHA 3L43A 3IR5A 4BQIA 5LOVF 2GJ4A 3D4LA 3WI7A 1U0HC 2H4WA 3OG9A 2Z2XA 1AQIA 4WOKA 4MO2A 4N3AA 4ZJPA 3EBLA 5LD2B 2FPPB 2YY5A 1ZUHA 3B2QA 3G88A 5TMEA 1PR0A 5KTSA 3K4PA 3K32A 3SF0A 3VJKA 4N65A 1KVTA 2XUIA 3BMNB 2L0XA 3ETGA 4WJZA 3FI0A 4ZHQA 3VNUA 3DBHA 3PWTA 3CLTC 1MU0A 1NLUA 4YEDA 3MINB 1WUKS 1T5HX 2ZANA 3LCRA 3UJAA 5FPQA 2PY6A 4Q4JB 3X2FA 2ZUWA 4J4BA 3WNQA 4E12A 3LT5A 4HDKA 3MWFA 2XITA 4MKZA 3ZCUA 1Y7TA 2OD7A 2IYOA 2AXNA 2DC1A 2JH8A 3LY9A 3VO9A 1YK0A 1L1QA 4IDNA 3QHPA 3L41A 2IEZA 4IEEA 1AXEA 2WP8J 1JEEA 1XNJA 1ZN9A 2AR7A 2JJMA 3GAFA 1PK7A 2R5FA 2XT0A 5REQB 3X2SA 2GHRA 1DTEA 1O9GA 4XE5A 3ZGXA 2I99A 2FPIA 2A7XA 2FE4A 1JBKA 4EZEA 3WNZA 1QFZA 3AKYA 1ZQ1A 3GUUA 1LBHA 3KAJA 1GNPA 3VPFA 3FHTA 1H0HA 1K3TA 4DQDA 3M3HA 3VXKA 3T7KA 1V6AA 4ZKEA 3TM5A 3KSAC 1ESMA 3P52A 3PGA1 4AUKA 4N82A 2K2QB 1I3CA 2ZRGA 1NQAO 3QXHA 2J0SA 2XZTA 3DZHA 1SWVA 2BLLA 1Z74A 2YOGA 1E9RA 1XSEA 2FZKA 2V6GA 1JNXX 1XLTA 1PRYA 3B53X 4BGIA 3PNVA 1RHJA 1SULA 4Z3DA 3LC1O 1PX2A 1WMEA 4A73A 4POAA 1KY5A 1VI6A 2X1MA 4XB1A 4M8SA 3K1YA 4YYEA 3JY6A 3PC4A 1N1GA 3M4XA 4CIYA 5EOVA 3S2YA 4BLRA 3ABZA 3PDUA 4Q48A 2OD2A 3L93A 4MS3B 4QDZA 1M1ZA 2PKQP 4DMRA 5CYFA 3WC4A 1E96A 4MA0A 4W9RA 2Y1LA 1DXOA 3IAHA 3KZ1E 3F9RA 3T3PB 4GD3Q 3TFQA 5AHXA 3OWHA 4NCXA 5K0TA 2VSYA 3OF3A 1RI3A 5B3KA 1GARA 1NF3A 4XDZA 2V9CA 5I9TA 1DJMA 1KY2A 3ME5A 1A4RA 1GN9A 1GKUB 1P29A 4KL8S 1B8PA 1PYOA 1Z7YA 3VJLA 1M5RA 3FR7A 3KBBA 4HWGA 4MRRA 3A7DA 3U7JA 3ELBA 5JXHA 1Q92A 1W73A 4QXMA 1KSJA 1P72A 2IU0A 4DCPA 4YBRA 2QI9C 3KSRA 3QPDA 2E48A 2X8BA 2FWIA 2PS0A 1ZHOA 3EB9A 2WHXA 1ZL0A 1YB2A 3IJEB 3JATB 1PG0A 5LIRA 4J43A 2JGDB 5FOQA 5CFNA 1G5RA 4F2PA 4EHBA 2X13A 5HDQA 2I1WA 3ND5A 4L4XA 2CKDA 3NVAA 1T3GA 4RF4A 3KQPA 4IS2A 4H60A 2PO5A 4Q1FA 4RCVA 4BNIA 2ZIFA 1CY2A 1T8UA 2HSWA 1AM4D 1QIIA 3FMFA 4PF1A 1SOWA 2XTMA 3A31A 4IJWA 5CMLA 3QH4A 2GNAA 2ADOA 3EWNA 4RHCA 5KVVA 2XUFA 4LJ8A 3CU5A 4XWOA 2O7QA 1NVWQ 1CQJB 1J9EA 3RBAA 3VFDA 4A82A 1T1IA 2QMHA 4WJLA 4JYZA 2VUIB 1CRLA 2AOXA 2NU6A 4G65A 1RYEA 4YRQA 3UK1A 1QGUA 3KQNA 1OH8A 1CP2A 4R2JA 5FR1A 3CLSD 2AD1A 4B2PA 3QBJA 4YLGA 2PS3A 2XTJA 3CX6A 3MM4A 1Y9JA 3T0IA 5HP4A 2FG5A 2YJTD 1U4NA 4RWEA 2PKQO 1TD9A 5E9JA 3L5KA 2OILA 2O19A 1P2DA 2Y9MB 1IE3A 3WQBA 4KHPB 1DIBA 3GJ0A 1ECLA 1QDUA 2EFYA 1E60A 2PXHA 5I3ZA 3H9CA 3KVVA 5C46F 3AZPA 3IB6A 2MOKA 1ISSA 1D07A 1YB1A 2UZIR 1K4MA 3KB8A 1FU8A 3KOYA 3DBOB 3OE4A 3OOJA 4K28A 4KXNA 5JCJA 4ASUA 4UM8B 4LQDA 1JIVA 3DBRB 5H1YA 4PR0A 3MQ4A 4LE0A 3D7LA 2ZAIA 3OMXA 2ZAYA 4WCFC 3ZK7A 1CY4A 5IXSA 1GEGA 3PXEA 3V7YA 2VJKA 3QPBA 2Z8ZA 4DV4B 4OG2A 3T6KA 4KIUA 2HOQA 1SUBA 3KKKA 4R8RA 1KFJB 2EKQA 3NWOA 4JCOA 4JHLA 4U7PB 5DHRA 2YZ7A 2GXAA 1TFUA 3VV2A 2YXNA 2Q46A 3I1FA 5EJMA 4PPYA 3GOHA 4BV2A 3TPFA 5EKTA 3N2KA 4D0NA 1XTSA 5EJ8A 1GILA 3JZAA 3LCJA 1UXJA 4I6EA 5F33A 3TE6A 1N7JA 1TZCA 2C2HA 3A1UA 2YJNA 2MDTA 2I6FA 4BNHA 2B34A 4HO1X 1L4UA 1UEIA 2FH5B 2X0DA 5JCJD 1ZHHA 1NOJA 3I52A 1RAAA 4YCLA 4WNYA 2A9QA 3L9WA 4QJ4A 1T2AA 1GLVA 4Z9YA 3NVKI 1QZXA 1XMVA 1OXSC 1ZWLA 2WR8A 1E5TA 3HGMA 1H85A 4PYRA 5IAAA 3O74A 5HKLA 3DZFA 2IYPA 1C1DA 2QTHA 3UCEA 3S2UA 1PJSA 1R1DA 2GA8A 4WXYB 4RGBA 2B61A 4RA6B 2I1QA 5HKBA 2Q4OA 2R7NA 4KPUB 2WJWA 4MIKA 3RIGA 5AHKA 2ZJZA 1WXWA 3COYA 3OC6A 3PNPA 4G1BA 1KEZA 4I4CA 4JC8A 4RK5A 2C03A 1T1RA 2GPSA 3IYLW 3R7BA 3TDMA 4YV0A 2Y3IA 2C0PA 5F1YA 1IVYA 3CZ9A 5ALHA 4Z7JA 4ZVVA 5KZMB 2NSDA 1H0RA 3RVDA 1F17A 3W2EA 2EP8A 1LLCA 1N6HA 1DQPA 3LQFA 4O02B 2HMVA 2C5BA 4W5JA 4BMPB 2AX4A 1P9WA 2EFJA 2Q62A 3PLNA 4KXVA 2I54A 4CBVA 3LWNA 3AWDA 2W83A 3EQ7A 3LSYA 4KQMA 2D5AA 1C4OA 3CTMA 3O5AA 4QO8A 4Y98A 1JLLB 3RFXA 3L92A 4F2DA 4ENWA 5J58A 1DB3A 1H6CA 3THSA 2WPNA 1ZJ5A 1X7ZB 3GJXC 3QVUA 3LBNA 4KRFA 4KUEA 3HY6A 4POOA 5K0CA 3AW9A 3BICA 3EZ7A 1QQ6A 3I8OA 4ZU3A 3GXBA 2PUAA 2GZHA 1G9TA 5BN5A 2GRJA 5IBRA 1ZGJA 2J9FA 3BSWA 2SECE 1JL3A 4FONA 2FUG1 3JW8A 4JX9A 4R8LA 1Q20A 1ECCA 2I6TA 3LFUA 5CW1A 4B34A 1H1TA 1V7CA 3V3KA 1U99A 2DAPA 2JI6A 1PJQA 5KTRA 1Y9AA 2G7ZA 3IV7A 4JT2A 3LBAA 4RLSA 3FCYA 1XFDA 4C7KA 4D99A 5ARCA 4ZVMA 3CWCA 2XCRB 4QGHA 1REQB 2O1EA 3CT4A 4QGFA 3ZWMA 1Y82A 3LDAA 5C5EA 2FQ1A 5C8YF 4G81A 1O96A 5JAIA 4A9AA 2N1MA 2O2ZA 2W8BB 4KX5A 4R9UC 1I01A 1UPUA 2H29A 3U5ZB 3STXA 5PGMA 1DDIA 2RGYA 2YS6A 3DTVA 3UAYA 1V5WA 4AXBA 1B0ZA 1L8QA 2V59A 3P0FA 5L45A 2HD4A 1Z2EA 5KDLA 4A2CA 4EJMA 4HDKB 4FX5A 2OCGA 3IHKA 2D2FA 3E1SA 3OVMA 3I2GA 3RHSA 2CXUA 4EL0A 4BX9A 4G0QA 3FWNA 2ZR8A 4BBAA 1P3DA 3CR3C 3EVBA 3MILA 1LPNA 3A6KA 2VDUE 3FX2A 4EBFA 2BMEA 2YW9A 3GVXA 4OI1A 4FB5A 4Y8VA 3DFFA 2XMCA 2AC7A 2FLVA 3ADDA 2VZLA 4FYVA 2C2WA 1L7NA 3PF8A 3S6JA 1YSCA 1QSGA 1R3DA 3OPVA 4K3VA 4Z4HA 1CZLA 1RQXA 4P80A 1K7FB 3MYRA 3X1YA 1S3IA 4D4LA 4UASA 2DERA 1AB5A 4MVJM 5DTRA 1VDZA 2CZGA 1YRYE 3GPDG 3V1NA 2R11A 4CZ2A 4EKEA 5F2NA 1RHKA 2JAOA 3AF0A 3GVPA 4G8DA 4HXYA 5I9MA 1QFSA 3QX8A 2NU8B 5JASA 4CWAA 4MJLA 5DB4A 3SJBA 1I3LA 4FFBB 3QE3A 3WICA 4MKGA 1EEHA 3DWFA 1R50A 3MCTA 4LDNA 4PYIA 1JFVA 2CHGA 2XXAA 1DRUA 2J9RA 2XHEA 3AQ4A 4M8NE 5E38A 3LBHA 1K89A 1JG2A 4PQEA 1ZD4A 4QXQA 2SNIE 2FU5C 3DHYA 3JAMA 1UM9B 5DP2A 4BEJA 5GAJA 1VECA 1B8NA 3ELYA 5G4LA 3JYPA 1Z2NX 1J2TA 3Q72A 3ROZA 4EF4A 3I39X 2HA4A 2PKCA 2RIRA 3COPA 2QNRA 1R7RA 3OLZA 1I0ZA 3E9EA 3N53A 1L5HA 1M0EA 4PC2A 3DV0A 3B2EA 4GBJA 1WABA 2BD0A 2XOEA 4U9UA 4BNXA 1EVQA 1A76A 2B7CA 4GM1A 1KVQA 1NF8A 3AG5A 3FLAA 4BVHA 1DTWB 2FKNA 1DEXA 3TSOA 4F4FA 4KKVA 5FAXA 2XCSB 1GT6A 3NKVA 3WVNA 1EFDN 2P5YA 2P7IA 2RKOA 3RVNA 3C1OA 5SZHB 1ZD1A 4KITB 5KJCA 3ZGYA 2HUPA 1SVKA 2EIHA 4EYSA 4ESVA 1O5TA 5AM0A 2XQIA 4ZCMA 3UPUA 4EFNA 1DCTA 1WP9A 1C2TA 3LUGA 4UAJA 4HNTA 5M34A 2PXXA 3UAZA 3LRTA 1R9GA 4MWCA 2GOYA 3HJTA 3MHPA 2JH9A 3FBTA 5D86A 2JJ1A 1IU9A 4HTFA 4MZXA 4WE3A 5FJIA 2DXIA 1AJEA 1YDMA 1ORVA 3K7EA 3R8XA 3A27A 3PX2A 4OHCA 3OZUA 3VYWA 4LYAA 2SCUA 1SHLA 3SHFA 2CB0A 1ATZA 3IULA 2EU8A 5A7HA 4YAUA 3H16A 3I6IA 4WKCA 2JBHA 2DOKA 2NP6A 4OUDB 2H4HA 2ZDHA 2QR5A 5JVDA 3NONA 3WADA 1T8SA 3EAGA 1VCOA 5G1NA 5K01A 4LCJA 2PYIA 4CCYA 1XRPA 4RPIA 2AJLI 3PR2B 2W2XA 1QCZA 5HRAA 2V54A 5JE8A 4L2IB 4FYJA 3WTBA 2H1IA 2LIVA 3ISTA 4X63A 5BMOA 2AKYA 4GLLA 5JSYA 4IDFA 4DQKA 4X1KB 1S8OA 4QYXA 2J0VA 4KLCA 4BN4A 4DLPA 5FLXA 1KJQA 1C3EA 4R71A 1CQZA 3QFFA 5L3SB 3UCFA 2CV2A 5CG2A 1IHXA 2A5LA 3RYFB 2Z6QA 2E4XA 2EG9A 3MJFA 3B1WA 5AM2A 2Q5CA 3IQIX 3KB6A 1PL7A 3UK2A 2YNMA 2DRIA 2BISA 4PIPA 1RM0A 3HL4A 5DSXA 4ZCPA 4BO6A 1YULA 1VGQA 1N2CB 3QWBA 2EZ8A 3QUSA 4EA7A 3I23A 5MN5A 1K0FA 5M3BA 1EA7A 1JR3A 5EHIA 4M0LA 1CF9A 1FTWA 2SICE 4XUGB 4UMFA 1AZWA 4C2UA 4MUAA 1QV6A 2EP5A 2IX3A 1XHLA 1QB7A 5DNWA 4C1NA 5KSPA 2JFXA 1L8XA 4BRUA 5IJZA 4ZI7B 4MVJG 5E9WA 3SBEA 1X1SA 2ORVA 1G8AA 4KYVA 5ED4A 2H5JA 4KDFA 1CS0B 3KJQA 3WRXA 4UMDA 2QT1A 2P9CA 3LRPA 3NV9A 4IIDA 3NT4A 4AROA 2G1PA 3AXSA 2VI5A 3VKFA 1BQ3A 4L9WA 5D2CA 2X0RA 4U7JA 4FI3F 1LFAA 4AURA 1ZFNA 5H9VA 2BF7A 3SQXA 3TNDA 2H17A 2OHHA 3E53A 3EASA 4INOA 1ANKA 1WTAA 4J0GA 4L9RA 4PCVA 3UH0A 1IUPA 3L6UA 5EZYB 4ZDIA 821PA 3GP8A 3CCBA 3WWZA 3ZWCA 1OBVA 2ACKA 1I2MA 1GQFA 3OIDA 2AKAB 3JQFC 2IHBA 2P68A 2P2LA 2X7JA 5GZ1A 2X5XA 1SBIA 2JL1A 3KL2A 1KZHA 3QFHA 2ECFA 2XUKA 5CT8A 2H1LA 3P1JA 1IXYA 2RKBA 1RDFA 5HJ5A 3QEMA 2OFWA 2QE7D 2GLXA 2EV9A 1R6AA 4RMGA 5AVRA 1Z36A 3ROPA 1FFWA 1C1HA 4Q7EA 1DE0A 3MIIA 3C3BA 3VU1A 1LX7A 1WZEA 8AT1A 2FB9A 2Z43A 4AN1A 4DSZA 1IK4A 5TF4A 4EZBA 3CKLA 2JFWA 1ZWKA 2IU3A 3ZDBA 2UYHA 1NRXA 4OHKA 4ALMA 1CUEA 4RQBA 4HV4A 3Q5DA 4P86A 1GHTA 16PKA 2PTGA 1EUZA 4RJLA 4DC0A 3L6CA 2NUTA 1XWIA 3K6SB 1SC6A 5L3QA 2CK3D 1FLAA 4XD7A 2P3LA 3EIUA 3ETEA 3GJ4A 1UOOA 1RHRA 3IH5A 4M0EA 5FKJA 3C3CA 3WYEA 5LP6B 3THWA 1W4BA 1NR1A 1O08A 2XVMA 5FUXA 2J3IA 3HU2A 1SHKA 2Q50A 2ODQA 3HKDA 3C24A 2WHRA 2D4AA 3R6WA 5D1HA 4E4TA 4X62B 1WL8A 2FMTA 1JEAA 4Y1RA 2ZWMA 2EP7A 3OAAA 4P82A 4DR4B 1YBHA 3VDQA 3WGYA 2B4TO 3D64A 1GAJA 3PC6A 3WBBA 1NBMA 3WGZA 5JIBA 3ICEA 1JXOA 5HQTA 2WMDA 2VPYA 5L4SA 4HDRB 1QFXA 2Q1SA 3WLPA 3SVTA 5F78A 3TUZC 3DR3A 1U0JA 4ROSA 1HRKA 2C95A 3OLWA 4LE2A 5DFAA 3G1TA 2OY0A 3DL0A 3KUCA 5FPHA 5TT0A 2IRWA 1UH5A 4AKIA 4GX5A 3KSDO 4G8BA 4BUCA 3WQQA 4G0MA 1Y1LA 5CBPB 4M0KA 2DTDA 4PTLA 1UQUA 5ICGA 2ERXA 4KO8A 1PIWA 4GOOD 4N5DA 1ZO8A 1RAHA 3D59A 3F98A 1A27A 1JHQA 1G7CA 4J6EA 4FIZA 1Z63A 3Q40A 3UB3A 5CDTA 1A8HA 4G09A 5CXQA 3R6LA 2CW5A 4HNAA 2DFPA 1HEYA 2GJAA 3AHJA 2BGMA 1CSEE 1F6DA 1K9SA 3DXFA 4LXQA 5FNZA 3RU7A 2XADA 3G1WA 2Q1YA 1GR0A 1Q16A 1PK8A 2ZYGA 3O26A 2NGRA 4LC0A 5E7QA 4B3BA 1IBLB 1Q1AA 1RXIA 2IP4A 3F9CA 3A4VA 5TF0A 2P2GA 5ADVA 4RH1A 4DA4A 3T0FA 1DAIA 1S7CA 2A0UA 5EJEA 3K8ZA 5KS2A 1NSTA 1EAMA 4EPYA 3THYB 1PR2A 4ZU6X 4OHZA 3SJUA 5BNIA 5DMXA 2CLCX 2OCIA 5BO5A 2FFBA 4KH0A 4QUIA 1SXJC 2R6HA 2O4UX 5EMKA 3NIWA 2C9DA 1SU7A 4TTTS 3Q7PA 2JFQA 2VRCD 5HQ3B 2EFEB 3D8HA 5GONF 3OJ0A 3DMTC 5EE0A 3P26A 3TZQA 2K6GA 1ZJYA 2IHJA 1JI0A 4MVJD 5TR9A 2GBIA 5LL6P 2B99A 3KLMX 2REQA 4CR6A 4PZCA 1CEYA 3M34A 5D01A 4YP9A 5CDYA 1HY3A 4C06A 1Q0LA 1JILA 1TF5A 4XWGA 1A72A 1WMDA 4EZIA 3N3BC 3A10A 3EIWA 1PV2A 3H8SA 3E8MA 1L4EA 3GELA 1THGA 3C5CA 4I50B 1I7NA 5JSKA 3TLAA 3VJMA 4PG6A 3H1GA 1SVUA 5CD9A 3Q1LA 1XI2A 1QCCA 2VF2A 3OCVA 3JTMA 3P20A 1I4WA 1NP6A 1II8B 4FEYA 4KTVE 3T54A 5AUOB 5JROA 2R25B 2NYAA 1Z75A 1YTLA 1KK1A 2OOKA 3N2EA 4W5HA 1X86B 2AMYA 2JIDA 5G0TA 1V26A 3MJSA 1GTVA 1TZ2A 1RNLA 3NGXA 4Y0AA 2VRCA 4BO1A 4BYGA 5DCYA 3ZGNA 1J0DA 4LHSA 3CN7A 4PZYA 5HF5A 2WMNB 4X65B 1CG6A 3PNMA 4MVJA 2CFOA 1SVWA 4FHDA 4QUJA 3RV3A 1T4CA 1UWLA 4L6IA 1VJCA 4YRDA 1B0UA 4PHTA 3U3KA 3EG9B 3F1LA 1OTXA 3FNIA 1DC8A 3HB5X 3KOXA 3PIRA 5CIWA 5DTQA 5ERXA 2AK3A 1HNNA 3IAXA 1XRJA 1WDMA 4CDNA 5AW7A 1HDEA 3P9IA 3RCBA 3DE6X 2W8ZA 1OD6A 4BE9A 1FRNA 4IIFA 4B79A 4URUR 5IJ0B 1F0PA 2RDMA 2BEUA 5GJBA 3CISA 2IV3A 1JZTA 1X0VA 1GFSA 3JWEA 4M8IA 3UPDA 3A32A 3T1VA 1IXKA 3LTNC 5ALJA 2HHHB 1A9OA 2VXOA 4NATA 1SCUB 3GUZA 4KQGA 1TT7A 4LXYA 4QOHA 3G0BA 2EEZA 4HQRA 1QU2A 1SUPA 1KHHA 2J41A 1LC3A 1E0DA 3MYYA 1G20A 3N8HA 4RDIA 4MRMA 1VJTA 4XPIB 4ZAFA 3C7CB 5LYYA 1YNOA 3UGKA 2CXHA 3C3EA 1GA6A 1SK8A 1BOOA 2J7PA 1MRNA 3C45A 3D8NA 1XMJA 4P7JA 3N2KB 4FIDA 4FWTA 2Y1EA 1R15A 4LDJA 3WGTA 4WUVA 1F60A 521PA 4P34A 1TMOA 5F7OA 4OFWA 4X8LA 3DQPA 1MQ8B 3SPXA 2GSWA 3KV1A 1HNXB 1Z62A 2HHCA 2ZK7A 3EMBA 3WLSA 1YMUA 3H83A 4D3DA 1A9TA 1OPRA 3KBOA 4EAAA 1CTQA 3ZHTA 1D2EA 1NOKA 4HAZA 1RWXA 1CHDA 3FZEA 4Z5XA 1YQUA 2E55A 3F5SA 5JAOA 1A8UA 1RJEA 2WFLB 3GD5A 4FVTA 4KOAA 4LA4A 5YASA 3FFWA 4NMHA 5FEMA 4FNOA 4MGHA 4FGUA 3MPOA 5JWOA 3RB8A 3JYHA 2VTKA 4DCMA 2QTLA 1PEDA 3ANMA 1VE7A 4KMSA 3ZY5A 1LZKA 1K6JA 2G07A 4EPWA 1MVNA 2FX2A 1TGVA 1TYCA 5CVUA 2FPSA 2DHDA 5AKJA 2X8WA 3RKRA 4B35A 5THXA 2CLIB 5TSDA 4Z3KA 2MR5A 2OSVA 1RKVA 2YVKA 1DXHA 2J59A 5JNUA 4CXMA 1N6OA 1E2JA 1KO5A 2QTVB 2IHVA 3P9QA 3RR2A 1R9NA 3UMJA 4F85A 3PFBA 4DLZA 3HGQA 3IODA 2G67A 3K92A 4NYMQ 2O3SA 5CVVA 5FYDA 2IX9A 2XYQA 3WZ2A 1N2JA 1VI5A 2BI4A 3UAWA 4XOIA 1TKAA 3DWEX 7MDHA 1JAYA 2R1UA 5BN1A 3MCAA 4PGMA 4DA8A 1GTZA 4HWTA 4Y2GA 4R9NA 1J8DA 5JMPA 1QLHA 3RFVA 2LIPA 3CY6A 3RADC 4OUKX 3RIHA 2EYQA 1JHZA 3TR6A 1WXXA 2QGZA 3H2IA 4G1EB 2GEDA 4KIGA 5DTJA 4BZQA 3BC1A 4LRSB 3NW9A 3TAHA 1XZLA 3F46A 3M1LA 1AO0A 1UPXA 4G5RA 1Y5RA 1NBMD 1CQXA 1U7WA 1OH6A 4IFEA 4GECA 3BXOA 2CD9A 1DQYA 3SKVA 4C3VA 1PS9A 4UHFA 1LB1B 1O77A 3O73A 2I29A 4I3GA 4G5YA 3DOFA 3DW3X 3NP9A 1NVDA 1QVWA 2VZEA 3DAGA 3H5NA 3HJNA 4OQPA 3DTTA 3MTIA 3OTIA 1LFDB 4NYIR 1RBYA 3NFRA 3OZGA 4TXJA 3NHZA 2H65A 4PBSA 1DAOA 4HQOA 5ICSA 3MWYW 4ZVUA 4GAEA 4QWMA 3TRKA 4EVRA 3KAQA 5IKOA 1KJIA 4UVIA 2HO5A 2QAGA 2HWYA 1GRRA 2V74B 4GOJA 1L4KA 3GA7A 2GEUA 3I2FA 1SO8A 5DPMA 1UQTA 3I61A 3ORRA 3AR5A 4FT2A 5IKPA 1ZKMA 3AERA 1SIOA 1EFPA 4INPA 4H7EA 5CPBA 5FNVB 3KQLA 2IHNA 2BKXA 1YQWA 4X5OA 1XTPA 2RK4A 4C0AC 1ODCA 2QUIA 2P1ZA 1DKPA 3AFHA 1TA0A 4PX9A 2VDMB 3T3IA 5GINE 4AS3A 4E2XA 4DGSA 1A0OA 1FDIA 1BE8A 1QIDA 2J3DA 3IHLA 3P96A 2B83A 1F7VA 1UBGA 4J94A 2QYTA 4L8GA 4G8JA 2VOJA 3OJXA 2C4VA 5CLHA 4PTYA 5A5DA 2P75A 4TYWA 2IIVA 4X1YA 1P4RA 4F9EA 3PPVA 1DAKA 2BFMA 4OMUA 2PS9A 3U3OA 1Q0QA 3BM5A 3ZQ6A 5BQ3A 5IC4A 1QIMA 3FLMA 2D1YA 2WOJA 1C5KA 2QP4A 1DUVG 5BSMA 4BU1A 4EY3A 5CDSA 3LG2A 1A82A 2AA3A 3G8BA 4E5DA 3GDFA 5FBQB 1FBNA 4WLUA 2GCPA 2NVUA 1P73A 4NE7A 3GLHB 2G9VA 3FB4A 1T91A 1J0CA 2CV1A 1KGSA 2R4QA 1A77A 4JI5B 5I45A 2DWCA 3TTXA 3M6MD 1ESDA 1F51E 1OZGA 3MMPA 2QWXA 2OMKA 4TMWA 1N2CA 2V7GA 1SOMA 3LBYA 2QG6A 2J9GA 1Y8AA 1J2UA 2V03A 4L7VA 4R2XA 1QDLB 3N2GA 3IC5A 1G63A 2ESRA 2HM7A 4CMAA 1CLUA 1WJGA 4EYGA 2D0OB 3HCPA 4RTLA 1E6KA 1FX1A 5TY0A 1MAAA 1WQ1R 1SBHA 1L2TA 2J5RA 4Q3AA 1JRLA 1VM6A 1FDOA 2X76A 1N2EA 3IRUA 3MGCA 3FUTA 3LQ2A 5JDCC 4DILA 3DL2A 4DF3A 3TF5A 4ENTA 4DB2A 3NPAA 1NA5A 2K5UA 3I53A 3Q0TA 4S3MA 4WL0A 1GUZA 3OHPA 3SZMA 4C7JA 5EMJA 2ODPA 1V4BA 4OUDA 3X44A 1FLVA 2FPXA 1CBUA 3DE3X 5E6UB 4LFCB 5IZ4A 1F2UA 4MV0A 5JHHB 5KJ1A 2HADA 5HKOA 1NAIA 2LWIA 2X1HA 1ZIXA 2FHSA 1PQ4A 3JV7A 4IAOA 2H1CA 2XNHA 3ELDA 1UZLA 4QFMA 4PPQA 4QTZA 4UM9D 4F86A 4XJVA 3ZY4A 4LOKA 3WSTA 1UADA 1ZONA 2P9GA 5BMVF 4OOFA 4IUDS 4BMZA 4ZI5A 4OFZA 2I7DA 1RZRA 1BFUA 3BGIA 1FUUA 4DWJA 1QRSA 4M9UA 1W4CA 2OZLA 1SAYA 1NQVA 5H3LA 1N8TA 1I13A 4DXAA 4BE4A 4QQNA 5KYXA 1KU0A 1WF3A 5KNDD 1NVGA 2P9ZA 3DG9A 1KSGA 3UQZA 1TIKA 1ZEJA 2UXDB 3EC2A 4DDUA 2PGAA 5JDIC 3PTLA 4K9DA 5BRNA 4ANFA 4M46A 4WBNA 3IAUA 4L5JA 1QE3A 1FNCA 2P4SA 2WTMA 3GWGA 3U44A 1E3WB 2R00A 4O2AB 1XHFA 1CFZA 3BREA 4GMXA 1C2YA 1NDUA 2BRUC 4G5GA 2XZPA 1GTJ1 4BTVA 1AUQA 1PLLA 1XGKA 1XKLA 3HWSA 2BFBA 2CLDX 4J0CA 4JJKA 4PAOA 2GS9A 5LJLA 1EM8A 4QAQA 4EJSB 4Z4GA 4JI8B 3HKBB 3EVEA 5JXJA 4TLDA 1A2OA 1XAIA 2I8CA 3TLJA 3FRIA 4QIHA 4C4SA 5KYYB 4F12A 2IBSA 1F0YA 1S2OA 2DPYA 1NG9A 1XTQA 5GJCA 3PI6A 2PUCA 2F3PA 1PU2A 2OAP1 3B51X 4J1NA 1V9LA 4WESB 5JECA 3U39A 3EGWA 3BE4A 5TQVA 2X7XA 4ZJZA 2CWDA 2VHTA 2P2SA 4RHYA 1U0GA 2QTWB 4XQGA 4BMVA 3F0TA 1XRNA 4YREA 1WX1A 4K6CA 2PJZA 2QLBA 2XDWA 4OL9A 2RHOA 5JNLA 1PV4A 1WY5A 2OWDA 4Q9JA 4QM7A 4KKXB 4KSBA 1WW8A 1HBJA 4ZTZB 2YCBA 2J4DA 4PG7A 1EJBA 5K3EA 5C52B 3H9JA 1SVOA 3FFXA 4RV9A 5DGTA 2OXFA 4CNBA 1M8JA 2FKAA 2FUKA 3KKMA 1DO2A 4JB0A 5DGXA 4Z1MD 2H1HA 1PFKA 1SB8A 1QJCA 3INRA 3FCEA 3IOYA 1WZCA 4RVSA 421PA 1KZYC 1Z0DA 2X0NA 2X6RA 1HDXA 4PIMA 4MTLA 3BH7A 2HT1A 2B1QA 3GNLA 4MB6A 4NYJQ 3B6EA 1OFUX 1P5FA 5C8YB 1LF5A 2HLNA 2V9PA 1OKKA 3JVDA 3D6UA 3ZWDA 5C1BA 3C3XA 4BCBA 3UAGA 1VSQA 1P8JA 3ML1A 1Z0UA 3FOAA 2HQOA 4NFYA 1RQ2A 1S5PA 5CW2A 2F4VB 2ID7A 2D1RA 2H8GA 2ZIEA 2ZT7A 3ZVNA 2VJMB 1ZM7A 4TV8F 5CM8B 3D3QA 4IGKA 1JHPA 1YDGA 1E9CA 2W98A 2VBGA 1H23A 4I9HA 1LV8A 1C80A 1CRWG 4MQFB 2WVGA 3PKZA 3GJQA 4ZDJA 5A2GA 5D5PA 2GVZC 1KZ6A 5FBWB 4HYQA 3CPSA 4QBFA 3SJ7A 2FSVC 3AOEA 2R8EA 1YZLA 3IR7A 2F8MA 3ZXXA 4L8VA 4XZ3A 2XKJE 5AJHA 1E61A 1U9YA 4L5IA 5BVHA 5K8IA 1R2QA 1O94C 2Z5GA 1FXSA 4LDQA 4L95C 4LV6A 3TIVA 1E89A 3FMIA 2JG3A 1UKYA 3CCCA 2B5VA 2HF9A 2P9YA 5EYPB 1SCJA 2DPGA 4C6RA 2VA9A 1PLJA 1X9HA 4JUAA 2IW3A 4OK5A 5A7GA 3GGPA 2WJAA 1VPVA 1KH1A 4OQZA 2BZGA 2ABWA 3ZGOA 4EGFA 2FFHA 1LV7A 1HYBA 5K6AC 1JIKA 2C2YA 2SBTA 2QSYA 3DHVA 5LJIA 1QR6A 3VVCA 1C29B 2CNBA 4QUEA 4N03A 1YL6A 4LS3A 4UU1A 4US1R 5FOTA 5C8VA 1E2PA 3TNJA 1SCQA 4J0JA 3T5TA 4NZNA 3Q7EA 3RC9A 5ARBA 2DQSA 2NVBA 5JPCA 4CQNA 1J8QA 2QQFA 5A3VA 1HH4A 3ND8A 3H75A 4MROA 4OAOA 4DUPA 2Y9PB 3ILSA 1ZGZA 4M88A 1EBFA 4TMXA 2CYBA 2OV4A 2DLCX 1RLJA 3C85A 2BR3A 4TLEA 4PE5B 2NACA 2VT3A 3QBTA 2ZROA 4HFNA 5FI3A 3WBKA 4YRZA 1EDOA 4XYBA 1Z5OA 4R31A 4DOMA 1Z6XA 2F48A 2J9ZB 4IHJB 3SMQA 4MPJA 3AUKA 1BS9A 3V4ZA 2Q3LA 2WU3A 3QRWA 3TMYA 1O94D 2Q3BA 4MWBA 4K6FA 1GZ6A 2CFIA 3K05A 4YCJA 1CZHA 3MWDA 3EEQA 4H59A 1G5PA 1QWSA 3U7QB 5F7ZA 2PSHA 3EYAA 3ROQA 4JKIA 1Z38A 1I9CA 1N5OX 3JD2A 4R68A 5ALQA 4DFDA 1ZJ4A 1VIYA 5JHGB 1CUGA 1IQ0A 4RS4A 2P6MA 2NUAA 1NVVR 5LLTA 4FN5A 4KFTA 1P7WA 2HF8A 4YRPA 3OOSA 1CJMA 5DHTA 3ADOA 4IOMA 5BURA 3LVFO 4PTZA 3L6OO 3KOOA 2VYND 4AP9A 2CXPA 2WU8A 4I1SA 2JFNA 3B3QA 4QICA 3BAZA 4QOEA 1PR5A 1DKQA 1IN6A 4MUGA 4RW0A 4YX9A 4C5BA 5DBHX 1HLPA 3H8WA 4RK1A 4DLNA 4DNPA 1MBZA 2BUBA 5H16A 3DUFA 2ZBUA 4CLEA 1OTYA 5B7NA 4CM5A 1S0UA 2OXCA 3IT3A 2NUAB 1IEXA 2JGEA 3OFJA 4WK2B 1CUVA 1ULAA 2D2VA 4ND1A 5AJWA 4MRSA 4E5KA 4EB3A 1LF0A 1IZ7A 4PC3A 1PR6A 2VJDA 1ZZEA 1SM4A 4H35A 3Q87B 3RIYA 5BPFA 3GFVA 1J7KA 4QVKA 3UUEA 4PSCA 1OX4A 2W2TA 3GAZA 3H4MA 2XCIA 1S2MA 3HXOA 1V8PA 1E9EA 4UBIA 1L7EA 3WLJA 3WL6A 1V48A 5IYZA 5CLQA 1SIBE 4MR8A 2G1UA 5LU8A 2GZ1A 4NCHA 4HPWA 1IWPB 2PCJA 2QM0A 4GC9A 3RASA 3WNVA 4BO9A 5A4IS 3HCWA 2Z1NA 4B4DA 3JPWA 4HZGA 2WKWA 4UQPA 5LMZA 5JRDS 1V9CA 1WXGA 3L6BA 2QSZA 4G07A 1SC9A 1SUAA 3SJAA 5C4GB 3LUJA 3AJ8A 3GT0A 3FKJA 5G2OA 4WSOA 5K0SA 1HKUA 2GCEA 2WBLC 1Z6TA 4Z0HO 3MS4A 4U0JA 5K0ZA 2ZIVB 3PQ8A 1XQ9A 3WL3A 1DX4A 4Q1DA 4QL3A 2VHZA 4FTWA 3IHTA 2D7JA 3GH3A 3KR1A 1EXVA 4WHMA 1YBVA 4AVYA 4PC6A 4DWWA 1A8IA 3FYTA 3T5PA 2ID4A 1ZM3A 2KX7A 5H4GA 5AESA 4JI7B 2GN0A 1V6SA 2BR4A 1EJ6A 1AKWA 2OCLA 3EXFA 3HA3A 4YQEA 1PTJC 4K46A 4JI3B 3WQSB 4QXOA 2JARA 4GNRA 4BBJA 5FH9A 1DUIA 2EJUA 1DJPA 4G0YA 3ZCVA 5BWOA 2R0QC 5KQSA 1XQXA 1YZGA 3V2HA 3CG4A 1LLQA 4MO9A 3W5CA 1OHHA 4BJ1A 4DLXA 4M21A 4KGVA 3S8EA 3AI7A 4EARA 4C4RA 1QTQA 2G04A 1VIMA 2A1UA 1LVGA 3I6BA 1E3TA 3REQA 5B4UA 3KQKA 3OMWA 3L1HA 5LDGA 3ZWAA 4G4SP 3COWA 1IXRC 3SS9X 4D80A 1XDGA 3ESRA 3N75A 1E1QA 5LXTF 3SSNA 1NI3A 1ZSNA 1L4GA 2Y0CA 2ZBFA 2PT6A 4ER6A 2R8YA 3AVXA 4XWTA 5AWFC 4O4IF 2QD1A 3RHTA 2PUWA 2FR8C 3P0EA 4DNXA 4DLLA 1QYDA 4DZRA 5KWJA 3PNOA 2DT5A 2ECOA 3MINA 1LY1A 1TJPB 2QJOA 1XEAA 4Z9FA 2WWRA 3BRCA 2VLIA 3JQ7B 1WW3A 4CTMA 3C6ZA 2GJ9A 2EF1A 5AK6A 1E7MA 4LJYA 4FK8A 3CF4G 1NI4B 1X2EA 3IDQA 4O4LA 1NRIA 3BIJA 4JLOA 3HBNA 1JALA 1XAHA 1PSDA 1XK7A 3G7UA 3K8YA 4YUWA 1RXCA 1COWA 3UC9A 2Z09A 1F1JA 4PHHA 5I4CA 1D03A 1T3HA 3I6QA 3TIIA 2BC9A 4GBED 4I4TF 4P0QB 2V1UA 1DXQA 3PXGA 3QLVC 4JLJA 3BMQB 3L01A 3STWA 4UNIA 4K9OA 4F96A 1A1SA 3G0OA 2GCIA 1MOPA 5JI3E 2YV1A 4HQFA 2G3YA 3TXXA 4CT0A 1XDZA 3HXPA 5EP3A 3SR0A 4CM4B 1XA3A 5KYNA 4ZTUB 4KFUA 4UVDA 1YR1A 3O7WA 4M36A 1NGSA 3RI3A 3QFRA 1CWUA 3IVRA 1VL8A 1QF6A 5IANA 4Z86A 4D4IA 4ECAA 2XF2A 1AKTA 2ZS9A 3EPHA 3BSYA 1F1BA 4IINA 4UPDA 4HATA 3W5SA 2FRDC 1MD9A 2JFZA 5HWSA 1JKJB 2AG8A 1FYDA 2FFAA 1FNSA 1OQAA 2H1FA 3O1HB 3FBGA 3PWSA 1QRAA 3L0SA 1HE3A 1IG0A 1KS2A 3KNZA 3DSRA 1C3LA 1DADA 2OORA 5I9BA 2GTIA 4HJXA 3W7BA 4BEBA 1M8GA 4NYMR 4WXPA 3F5DA 4IDDA 2N0SA 1Q50A 2BM1A 2VQSA 4DLWA 3M6WA 4YDRA 4ZT3A 4NE9A 2B98A 1BGXT 1VQ1A 4REMA 1D0IA 4A23A 3O4FA 3JRWA 1JVSA 2OCKA 3O8DA 2F2TA 2GD1O 4Q7LA 4R2MA 3EZXA 1TIBA 4EM6A 4JI1B 5AW2A 5IEJA 4RAOA 5LMNB 1EZZA 4ZQEA 3SR4A 2QQ0A 1YFZA 4I1IA 2GEBA 2CUZA 3IP9A 1E5QA 3M0EA 4ZT4A 1Z34A 3HYTA 5CDUA 3RYCB 1L5FA 4FDVA 3DQQA 3DVAA 1OZFA 1Z17A 1P44A 5AT1A 3W6OA 4BMYA 5I7UA 2LCFA 1EKXA 3MTJA 4TS9A 4FT4A 3VDMA 4AI6A 3IV9A 3KC2A 3R3JA 3ROGA 3BEOA 3TRFA 3VAYA 1RI1A 1CV2A 4MQBA 3TGWA 1ORTA 2KYRA 1J5PA 4RELA 3ZN2A 1EVEA 2VUHB 3U81A 2N3ZA 2UDPA 5JH7B 3KQUA 3BQ9A 1QGOA 2GNPA 1KDOA 3MS7A 4EK9A 5EWMA 2V58A 5CK5A 3ZBUA 1ZR2A 3G5AA 2E5LB 3PD0A 3B36A 5A5GA 1G66A 5JNVA 4WASA 4CF3A 2BHRA 3BTUA 5EQDA 3VTZA 5JAHA 2QIPA 1QK5A 3K70C 5KO2A 1CRZA 1AT1A 4X97A 1EUDA 1AHIA 5L4NA 1GPH1 3NJRA 3FDIA 5HZGA 3E7DA 3CUUA 1C9YA 1LVHA 1SGWA 4QDUA 2FSSA 1F4VA 4ZVPA 4BQRA 4YRAA 2R8RA 3BL6A 1IXZA 3JQ8A 3CUWA 5DNAA 4K87A 5CA0B 4EY4A 5F2OA 2WE8A 3QW2A 5LSAA 4A1FA 3N2IA 3IBSA 3BXZA 2YDYA 1BWQA 1USKA 2WWHA 5KUTA 3Q7TA 2O0JA 4ZK2A 4PGAA 1K88A 1WPXA 2VJPA 4KU4A 1FTYA 4ZOEA 3TCNA 4DIEA 4YQZA 4MW9A 4X20A 2BDTA 3CM0A 3DAHA 5JAPA 2JLWA 3AF1A 2DBRA 5P8WA 5KSYA 1MIOA 1G5HA 2AVDA 3NXSA 5JAMA 3CVOA 5IT0A 4FOTA 3R5FA 4O4JB 4UHHA 2Q3MA 1TLLA 1H8EA 2HJ9A 3DVQX 2X0EA 1IVSA 2IHKA 1NASA 3I04M 4AMUA 4HS9A 3O83A 4JS0A 4E30A 2C3OA 1LQUA 3LZ6A 1RRFA 4TVSA 1EWKA 3SC6A 3DVRX 3H05A 3OQIA 4C4AA 2QJWA 5IRCD 3EJ6A 4XFKA 2CYCA 4ZU1X 1PL0A 2F43A 1P5JA 4QPJC 3HKCA 3SLGA 5IF9A 2W2KB 3D5QA 4AO6A 3BT7A 3ICQB 2YXBA 2PXCA 3FPAA 5EKSA 1RI2A 3S81A 2PKEA 1IUKA 2E2WA 3L0BA 2D1TA 3AZQA 3KJZA 3OLQA 1TA4A 4HRVA 3G0CA 4MV3A 4PR3A 4JV5B 1GXSB 5FNVA 3QXJA 2D06A 5BYJA 1F8FA 1YJBA 2A9KA 3FWYA 4H7HA 4ZHQF 3GQBA 4QEZA 4MLCA 1WVMA 1H8ED 3WO1A 3IBTA 1SVLA 1D9XA 2I4LA 4ZZ1A 1XRQA 2R86A 3B1JA 3UNXA 3TFWA 2F59A 3BXHA 4M8LA 4MDEA 4YMUA 4R01A 3R3HA 3C6KA 1U5CA 4MVCA 1ZU4A 4XCVA 4LYYA 4E2ZA 3U6KA 2OL4A 1Y1SA 4FBMA 4M1ZA 1QOZA 1GUDA 1E1RA 3L6EA 1ZOOA 2XB9A 4KXXA 3R6GA 4JUDX 4LGYA 4F2GA 4RVOA 1A1VA 3QFCA 3T3HA 3DAFA 5JEEA 2XJ9A 4MRNA 1RM5A 4HMQA 4LMRA 5B1SA 3SLRA 4C6TA 5J2TA 4BN0A 4RTPA 1QR2A 3FMGA 4GP7A 5EIBD 1VL0A 4MCIA 3UKJA 2I3ZA 1DBQA 4LZAA 3FGNA 5BWMA 4BVAA 3IT1A 4N3NA 2I87A 4J2OA 1UKZA 1E1QD 2XE6A 1RPTA 5BY2A 4ER7A 2JGAA 3DOJA 4WNCA 1NG1A 3IQZA 2WABA 3LK6A 5TGZA 1Z4KA 3PIDA 3KXLA 4HAIA 5GZ6A 4KO2S 4JI6B 2RAPA 4MRPA 4CVNA 5JV5A 3FN4A 2QBYA 1X7WB 1O3YA 1YQGA 2NVWA 3AF5A 2IBTA 1O95A 4YIKA 3H5OA 1K75A 4EX7A 4TVKA 3SF8A 2XQFA 4DJ5X 3EXIA 1NLZA 3IEKA 4EPRA 3ZHZA 3MWGA 4HX9A 4AYXA 1QVRA 1I0IA 1ZUNB 4RAQA 5K6TA 2QJRA 2RGXA 4YJFA 3A4NA 5FWXA 1TYDE 1JHRA 3QEBZ 4OXRA 4FGWA 5HIJA 3ZCSA 5ERYA 5F1KA 1WY7A 1I2AA 3I76A 4YAJA 4KAAA 4DA9A 1VOTA 4U6SA 3MB5A 3A0RB 4UE6A 3GLIB 1IAVA 5JCOA 2VPXA 2AYYA 2G40A 2IVFA 1LK7A 3IIJA 4FW8A 1VPEA 4HZUB 4JOQA 5I7FA 5K3OA 1UFVA 2CNDA 2M6RA 4JA0A 4JJ8A 1TQ6A 2C7OA 5T4EA 2FOXA 1BDMA 1Q3TA 1UPFA 4RK4A 3PYMA 2O59A 3ENKA 4JVOA 5EERA 3M1AA 1KY3A 1SXJD 3MJDA 1S96A 4TQ9A 1WNFA 1BGVA 1JDVA 3H1EA 2PSJA 3I5UA 4FE7A 1GZSA 4XASA 5DH9A 3PUWA 3WHPA 1PBNA 4C01A 1VCHA 3M5WA 3AU9A 3RTBA 3WWCA 4DIKA 1YAHA 4ZEXA 3C1TA 3RLFA 3NEPX 4QASA 4G0XA 5CT5A 4YQYA 1P4SA 2RCYA 1W30A 1ONNA 1E2GA 3G1UA 5EIOA 4F5ZA 3CEJA 4I66A 1NWHA 3SNKA 3EOZA 4LRYA 1B3RA 1FC0A 4PWYA 3QU5A 1QM5A 2FWNA 4KN5A 4LY9A 4LZNA 1CU1A 2JD2A 2V0CA 3P71T 1XTRA 1H3NA 1XLUA 3H2GA 4LJSA 3MXTA 2IH5A 1Z2AA 5AP9A 2BFWA 5ALDA 3EOBI 3HWWA 3H1FA 2PX8A 2O54A 2WZBA 1GWNA 3I05A 3EQZA 4FJ2A 2DWQA 3ZDFA 5TE9A 5A9SB 5IH3A 1MX3A 2QVBA 5LYJA 1W5FA 4WTOA 2AKEA 1UBEA 3K0FB 1OU0A 1AU9A 1ECFA 4I8XA 2AN4A 1QS0B 3AM4A 3MIZA 1L7XA 4P2BA 1FBTA 2XQJA 2IWHA 3V1LA 3PQ2A 5FTJA 1UKVY 1XBTA 4OLBA 3DZIA 2AEFA 3C4QA 1N3YA 4R2KA 5BVGA 1WXHA 4EW1A 5KAPA 4ZI7F 1STOA 1XYYA 2ZR9A 1V47A 1QCYA 4V0SA 4C4YA 2R68A 3R74A 1KEUA 2BCJQ 2NO5A 4WZBE 1P60A 2AC4A 5CB4A 1EDDA 3GYBA 3VO1A 2DB3A 4S1PA 1KVRA 1UXHA 2LGJA 3PGLA 4PN3A 3OZXA 1MC1A 3MJHA 1Q17A 4C29A 2H51A 1JEQB 2H7XA 1F8XA 1IUNA 1YB6A 2OZEA 1XMIA 2OZPA 3CLHA 3I64A 3PUIA 1W49A 4IDQA 2O14A 1H8HA 1P9NA 2WWTA 4WCFA 4X6YA 3K70D 2OYCA 3HN7A 1DBSA 1YU6A 4XKJA 2W6OA 3KKNA 4WNIA 4HB4A 2FXVA 1LJ8A 2O2SA 1TT5B 1ZUNA 1KIFA 1PQUA 2IYNA 1H22A 1LTHR 3DHNA 1YCHA 3JD0A 4RVHA 1MJHA 1CEQA 2AW5A 4GVPA 3CVYA 5FPKA 2X2OA 2V9ZA 4KZPA 4NEHB 3ZCTA 2PKRA 4UBNA 1K0UA 1KERA 1Z56C 2DUWA 2Q6VA 3HO1A 4MUYA 4ZN6A 3TOXA 2OO3A 3EIXA 2DEUA 2UZ1B 1QHEA 4LF9B 4KIFA 5B3AA 4ZEOA 4GL2A 3CZ4A 3LL7A 4PZUA 1W6RA 2GZ3A 4X1IB 1SHJA 2G0TA 4WNAA 4DMHA 3TZHA 1WMFA 2G63A 1ORWA 3CZ5A 2CMDA 2H2HA 2J67A 3HDYA 4L85A 4O25A 4TTIA 5K8JB 3EGDA 1KP3A 2RI1A 4Q12A 2WIKA 5DSTA 4PLFA 4PGHA 3FZNA 2ON6A 4AF8A 4EW3A 4ZAXA 1NZFA 3I04A 4BV8A 1WZNA 3FPBA 3A1WA 4PG4A 5JD5A 1I7LA 5J2UF 4E70A 2OAEA 1YHYA 4PRKA 5EZYF 4WINA 1NW9B 2PPLA 4BMDA 4CGZA 2XZLA 3FCCA 1CP3A 3T3GA 4IJ5A 3I9MA 4D98A 1UDXA 5JMTA 1NBME 5JI2E 3AFOA 4V2UA 5AO9A 3RBXA 1CHNA 1DIHA 4CM8B 4ZIRA 1W0KA 3BDVA 3A6ZA 1OROA 4BXOA 4GICA 2G6BA 2HPZA 2X15A 3LT0A 4YP7A 4LDPA 3QVXA 4A03A 2PUJA 3LU1A 4LF4B 1U7HA 1LW6E 3T7EA 4CCWA 3UT5A 1CQPA 2F64A 5E6SA 4P7GA 2UXCB 4PG8A 3OA2A 3PX7A 2Z5VA 2XZDA 1IOWA 2DCUA 1TUIA 2IWRA 3SX2A 2CC2A 3RUHA 1S9DA 2XTZA 4F4DA 4Q00A 4NENA 1KJYA 1W88A 3D5TA 4MS4A 4AG3A 3AHFA 4DNFA 2ZWIA 1P75A 4G85A 2C4MA 3GZNA 4KGDA 4KQ6A 3M9LA 1L8AA 1UZAA 4DA7A 3RUDA 5K0JA 4A8JA 2A6PA 4A36A 1AUXA 4I14A 4K86A 4RGVA 5ICFA 3FVTA 4XX1A 5AKIA 5C35A 4CIBA 2NMVA 1N8KA 4MUIA 3PDJA 2C3UA 1NN3A 2AS0A 2P3SA 2QRZA 3W34A 1KO1A 5CX1B 1Z2DA 1PP4A 5EJ6A 4KGZA 4DMGA 3EX7C 3RW9A 1YBMA 4M98A 2IVZA 3I28A 3AOEC 1AKMA 2VSQA 3CWQA 4FZ3A 5D85A 1DRKA 1QO0D 4EVQA 5D5QA 5FQOA 2VDJA 1L5YA 3TQHA 4EG5A 5TPWB 5AW4A 1RHUA 2D2EA 2Y4OA 4PLCA 1EINA 3TZLA 3GFOA 4TOIA 1LBQA 1W5EA 2PR2A 3PX3A 4WKNA 2AMFA 1QYVA 2ZJBA 5I9SA 2C2KA 4LF5B 3JQGB 1TIPA 4W5NA 2HQSA 4JKOA 5DYYA 5T41A 2GCGA 3MBOA 3V2UA 3P9SA 1RADA 3W2GA 2NZXA 4BLSA 5I7EA 3GAAA 3GJ6A 4DQ0A 1OZHA 3W5BA 1DWOA 2ZE7A 3R7WA 5F2KA 2PBLA 3O4JA 2JVJA 3PNQA 4XLLA 4EEKA 1HRDA 1QUFA 4X7PA 5GM2A 2JFGA 1BE6A 3B20A 3WKAA 4C3UA 5FUQA 3E05A 1BQEA 1XJQA 3TKYA 3RRMA 2A9OA 1I1NA 5MN4A 5CX1A 1E7YA 2OG2A 3E3OA 4LRUA 4LXHA 3ZXYA 1AKYA 1WS6A 2QI9F 2VUSA 3BXFA 3K30A 3SJCA 2NNWB 2Y0DA 3ZQ4A 3G6WA 2KLBA 4J2TA 1JYSA 1LPOA 2AN1A 3B52X 1KI6A 3A1VA 2DFDA 5F3RA 2TS1A 4LUCA 4IUYA 5CJ2A 5LBIA 3HXLA 3W05A 1G6HA 2PDAA 2XF8A 2VH5R 3MT9A 1GAWA 1NW4A 4HQNA 3DP9A 1WKCA 3HQ4O 4PW0A 4D8TA 4PYNA 5LWHA 1G2IA 1C81A 3CH4B 4KI0A 1IK6A 2AEJA 2JRCA 3HCDA 3EOAI 4GSLA 4JLPA 3V32A 4C89A 3ODGA 2VEOA 3D8SA 3WB2A 1RZRD 2GFHA 1KI1A 4GGPA 4W6QA 4RFSB 5C80A 4R83A 2BWJA 3CONA 2HI0A 1T0BA 2O48X 4LN1A 5KOYA 4B1FA 4CLRA 2QVGA 2VDVE 4OKIA 1TLFA 2DJ5A 4ZYYA 5I9IA 3CEPB 4K6GA 4EIWA 4PNZA 4ZYVA 2I6SA 3RVSA 1IN4A 1SHTX 5JRJA 2QTCA 2JANA 1MJFA 3FTNA 4IG4A 2IDZA 4R1NA 1XX6A 2B9VA 1TVKB 1M7GA 3H97A 1JKJA 2O1SA 3MBKA 4LJ7A 1ZSVA 3DWGA 1EU1A 1U28A 1VTKA 1M1NA 1T15A 2IBMA 2ZRLA 3BTVA 3OIUA 3RUEA 1I4TD 3SX4A 5E3JA 5IJWA 3CF6R 4RTRA 2CHVA 1BC5A 1SVNA 3NHUA 3SHWA 1FSFA 2P6OA 2QL9A 2QRHA 2CLEB 3JD4A 3RU9A 1EUQA 3BULA 1BE1A 5CBKA 5FPPA 3CYFA 4XIGS 2XYGA 3O3CA 2E89A 2OVBA 3L1IA 3U4IA 4E22A 2BFEB 1S3SA 2VF8A 5LFAA 2PX0A 4P9NA 2W2PA 4MHOA 1Y6RA 3WXMA 1OUMA 3IRVA 1UK8A 2PBFA 4IV8A 3STUA 1SIWA 1GRQA 4JLSA 2EBUA 3Q6NA 4UW9A 4XDGA 5DNCA 1VCMA 4XWKA 2FR8A 2GXUA 1H5NA 4KREA 3H0EA 3IUNA 5KREA 5E7IA 5JVDF 1WRBA 3RRJA 4LJ4A 3IJPA 1PKXA 1YFKA 1Z8FA 4OHFA 5DNEA 3BN3A 1NE7A 3KR2A 4TKVA 1G9SA 4MVJI 1QH8B 4M1EA 2XAUA 2UYCA 4BVGA 3DHWC 4AIIA 4EUSA 2BI8A 3N2NA 4HUTA 4ME6A 3ZGZA 3KEFA 5IDQA 2Q5QA 2HTFA 1XF1A 1G38A 5IKXA 1W36C 1IVNA 3ZH9B 5K0LA 5SY9A 3EXG1 1OYWA 1LPPA 5DX1A 1NDHA 3AUFA 3BHNA 1I3OA 2C1EA 3CX7A 3PKIA 4RSHA 3USES 4C2BA 5IX8A 3WDKA 2A30A 4MCAA 3TLKA 3T3DA 2QRQA 4JT4A 1JUDA 1KZ7B 5IW8A 4GI5A 1U2RA 2VHVA 2YV3A 1ZBDA 3JQAB 1K27A 3CRNA 3HCAA 3OFVA 3R3SA 4PPNA 2XYRA 3L7YA 1L5HB 4MS1A 3VHLB 5JJCA 4AQYB 3WA7A 3IUQA 4BZPA 4EB6A 4RY9A 2YHAA 2NT3A 3B82A 1Q15A 1SG9A 4NF2A 3KR0A 4L3WA 2C7RA 3I4LA 4YMWA 3VR6A 3S27A 1MV5A 4ZRNA 1NKSA 2P6PA 1N5KA 3BYZA 4NZZA 1Z6ZA 3B12A 3PVSA 1JWLA 2VO1A 1S1CA 4LZOA 4LX8A 3M6IA 4P1ZA 5CU7A 1L7RA 2JD1A 5DHAA 5TC4A 3WFJA 3RAJA 4AT1A 1EA5A 4B7XA 3IFSA 2X19A 2F00A 2BFFB 1ODIA 4ZZIA 1KGDA 3FYHA 4RL4A 2FPUA 3ZGVA 2GAOA 2WM2A 3BMOB 1TUBA 3FPKA 1TTHA 4ZYWA 2NSJA 1F8GA 5IAOA 3FNGA 3USZA 2XRZA 1HE1C 2HPAA 1ICIA 2V5VA 1MO5A 3OT1A 4PRZA 3VZBA 1G21B 4CIVA 1E2HA 1UMBA 3REGA 3CRZA 3HB1A 3KYJB 3T4UA 4DLAA 3G5UA 5B7QA 4J7AA 5LZ7A 3RYHB 4U39A 5C37A 5CAEA 3AF4A 4OHXA 1AOXA 1MQSA 5DM4A 3J7TA 1JR4A 4GF5A 1FVFA 3QA9A 4B3XA 1NSFA 2QL6A 3LPCA 1CUSA 1XZCA 3UUGA 1NULA 3LWDA 1ZD8A 4WJKB 4JP5A 2AFHB 1OX4B 5EJ7A 2GHTA 1PFUA 2BMDA 1A4UA 5ARDA 2SKEA 2W2KA 3KOWA 4UUBA 1YR6A 2PL9A 3FYSA 1YKFA 2FDXA 2EKBA 2YQZA 4HWRA 1JHUA 1J5EB 2VK2A 1X14A 3WNCA 3U3ZA 1GRVA 4GIBA 1YZTA 2AFIA 3NR2A 1J1ZA 1TYBE 2FEAA 3WMRA 1XRMA 1ML4A 1R0LA 2CFCA 1HDOA 3K0KA 1U5BA 3HNPA 4BHTA 1ZU5A 2XKBA 4HRYA 1PWYE 4B6RA 1B2LA 2AHRA 1ILEA 2BKEA 1N7GA 4QQFA 4E08A 5CB4F 2OC9A 4CIXA 1HG1A 1YZHA 1ZAKA 3RJ9A 3MS2A 4UQOA 1V95A 2QD2A 4FLFA 3V1KA 3B3FA 3WL5A 1MDFA 3IV6A 3C8HA 3KAKA 2O6HA 2R7MA 4RIGA 4WBSA 5EI5A 1FS5A 1L1RA 2EC5A 4QGBA 1X9IA 2WOOA 4IJMA 3DT8A 4R1UA 4JJAA 1CFJA 4GPEA 1GTRA 2G4LA 1VLQA 1D1PA 2YUTA 2GK7A 1BKYA 2GN6A 2COEA 2RGGA 4TS3A 4BO8A 4CM7A 4UTRA 5KOHB 3ONVA 3GRAA 3V4RA 1R9JA 4ZAYA 1S02A 5EC8A 3PP8A 4ARZA 3ZLJA 4KO1S 4DCJA 3PIIA 4EMSA 1LI7A 3OUTA 4LJ6A 3VI4B 2ADFA 5LZ9A 4RLHA 2E3JA 4MINA 3VISA 1N5IA 1N0UA 1E2IA 2IJGX 3GYGA 2IHYA 2IE0A 3A4IA 3I2YX 3GLIA 2ACWA 1JSZA 1R66A 4L0MA 4IIYA 3CZCA 2CVOA 3FFAA 1C0EA 2ATXA 5DIFA 2JAUA 5AJVB 1ZZGA 1WW2A 4REOA 3HZZA 2E4WA 5K3FB 4A2QA 3KSBC 1E18A 2Q07A 4Q1BA 6PFKA 5L3VA 3ANYB 4YPOA 1C9NA 3T99A 3FBWA 5BV8A 2W11A 1QP4A 5TS3A 2WTEA 2ZRQA 2A57A 1V3QE 2OP1A 3QPAA 4B2YA 3NRCA 1E4EA 1BKDR 3UHAA 3NUZA 4HK4A 1TU3A 5THQA 4NARA 1SR8A 5JISA 1QP7A 1C7QA 3IOEA 2BGTA 5BWCA 1O6CA 4EHNA 2V4ZA 3LXMA 2FUEA 4PHCA 4U6NA 3QY9A 5ECYA 5IULC 1HZJA 3LY7A 5J2UB 1CS0A 1G0OA 1E6MA 3LXRA 3O1LA 4JYPA 4KYUA 3JWJA 4CMJA 1UBRS 2EJBA 1GZVA 1RPNA 1H0KA 4FYXA 3K0CC 3K35A 4NOMA 2CXQA 3R7NA 4C7MA 2HREA 4ZI7A 2P9FA 4J0FA 3HLTA 1I6MA 1SXJE 2P79A 4EFDA 1XAJA 1XZMA 5ITZA 1JAXA 4D6XA 5M2QA 2H2AA 5AK0A 2AEEA 5F12A 4N76A 1R0WA 5EUBA 1TYZA 1V8ZA 4IV0A 1M2OA 4MCHA 1XMQB 1IY8A 4JBHA 1XCMA 1PEYA 2COKA 3ICPA 2HK8A 3L7CA 1CR6A 3B6MA 2H4JA 4K9RA 2YWFA 1XNHA 2IW1A 2IGBA