5FBHA

Crystal structure of the extracellular domain of human calcium sensing receptor with bound gd3+
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
517
structure length
470
Chain Sequence
PDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDIIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDEGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular calcium-sensing receptor
publication title Structural basis for regulation of human calcium-sensing receptor by magnesium ions and an unexpected tryptophan derivative co-agonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 146
structure length 470
sequence length 517
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fbhA01
3I09A 1YK0A 4E7OA 2P4UA 1PNRA 4Z4EA 4RY9A 1LBHA 3O75A 3JS5A 2DRIA 2QXYA 1MB0A 5TQ0A 3BILA 1NXPA 1DC7A 3KG2A 1A04A 3O21A 4P1ZA 2E4UA 4WXMA 1NXSA 2RDMA 5KQGA 3IP6A 1MAVA 3LUAA 2MSKA 1U2QA 5TE9A 1ISSA 4RSMA 4G97A 4Y9TA 1ABFA 4GPAA 1LJLA 3D02A 1JHZA 2L2QA 3HUUA 1M5TA 4LE2A 8ABPA 3LUHA 1ZGZA 3HS3A 3RVRA 3KCNA 4CBVA 4MYRA 2PL9A 4TLLB 3H1GA 2B1JA 3LMKA 4OTZA 4N03A 5DTEA 3LUCA 1BAPA 1LJUA 5EWJB 4RWEA 1YTUA 4LZLA 3BBLA 2JCGA 5JNRA 3O2JA 1FFSA 3UK0A 4MPTA 1U0SY 1EWTA 2B4AA 3DZDA 4PE5B 3OLWA 1VKRA 5IULC 3DLHA 5TQ2B 5JNUA 1QPZA 4ETNA 1QP7A 4RS3A 5I4CA 3HV2A 2TMYA 3SM9A 3L6UA 4OG2A 1TMYA 1YMVA 3KSMA 3MYYA 2M98A 4F8JA 2PE5A 4G0PA 1E6KA 3T6KA 3B2NA 3K9CA 1CYEA 1SXGA 3JY6A 1IIBA 1USGA 3OM0A 3JVIA 3H1FA 5FWYA 5TPZA 4YR7A 5TPZD 4ZMSA 3LOPA 3GV0A 4MGEA 5HKOA 1D5WA 1F51E 2HJ9A 1DBPA 3BREA 4G0ZA 4Z9AA 1OXBB 3VNAA 3O1JC 3Q7RA 1JYFA 4XARA 1NATA 4XAQA 1TM2A 1YS7A 3LUFA 2E4WA 3H6GA 3A0RB 1PUXA 3O74A 2X7XA 3F7NA 4TLMB 5HM6A 1E2BA 2OENG 4Z0NA 4KVFA 1ABEA 3CS3A 2MYNA 4W5RA 4MS1B 4EVQA 5CNIA 1KRXA 3IPAA 5B3JC 2FN8A 3Q7TA 5JNWA 2ID9A 4TN5A 3EODA 5B3JA 5TPWA 2FEWB 1T34A 3JVDA 2MYUA 1R8JA 3CNBA 1Z12A 2GKGA 2PMCA 1BDHA 3A3KA 3GBVA 3QEMB 3T8YA 3HJFA 3TX6A 2FQWA 3MMNA 1JLKA 2NZVG 4OATA 4MR9B 4YS6A 4WWHA 1NXVA 1Z17A 2WJWA 1KGSA 1U04A 3HZHA 4MS3B 4N47A 4RXUA 4OLBA 2JVJA 4MR8B 5T3YA 3CG4A 3ROTA 3DGFC 5EWMA 5FBHA 2OQRA 3TO5A 2O20A 3GT7A 4JAVC 3JPYA 4KREA 4Q7EA 4MQEB 5D2CA 2FLWA 4LDZA 4JA2A 2GX6A 3GWGA 2YHAA 3HDGA 4E7PA 1YS6A 4YLEA 4KFCA 4KK4A 1Z26A 4LE0A 2JRLA 4RK4A 2NT4A 5IUKC 3TB6A 4KRFA 3H5LA 5CHYA 3H6HA 2WWVD 3N6VA 4G0QA 4N0PA 2CWDA 3QLUA 2FMHA 3OO1A 1DC8A 2LP4Y 1J56A 4IRXA 5KQPA 1U8TA 2RJOA 2NUBA 2R25B 4WT7A 4ZPJA 2PUGA 3KYIB 5CNJA 4ZMRA 3CKMA 3H5VA 1H9CA 3N75A 1W9HA 1XHFA 2L18A 1BDIA 2JBAB 2QVCA 1Z15A 2JVKA 1QQBA 4KPYA 1YIOA 4O1HA 3BRSA 2E4XA 1B00A 3F6PA 4KV7A 4F12A 2FMKA 2IPLA 4KMRA 5DKFA 2HSGA 2H0AA 4QYMA 2R4QA 1RNLA 1Z16A 2MYTA 5IEJA 2F8SA 3O2QB 4EY3A 2PL1A 3ILHA 1DJMA 4W5NA 4DADA 3LTEA 1AB5A 1Z13A 3OMWA 1K68A 3EGCA 4RY8A 1CHNA 1TVMA 3O2SB 3FDFA 3FGZA 1S8NA 4MRMB 4Z4IA 3C3MA 2LPMA 2WJAA 1DBQA 4MR7A 4G86A 4XFKA 4KZKA 4MAAA 2Q5CA 1ZGGA 3CZCA 1GCGA 1NXXA 3QLVC 2FN9A 4WZZA 1C0EA 1RXEA 3GYBA 1NXWA 3RVSA 2ID7A 4P98A 3LUKA 1ZESA 1L5YA 3DLBA 2RJNA 1JBEA 5FWXA 3W9SA 1ZDMA 1ISRA 5FBKA 3VNBA 1EWKA 2VUIB 3KJXA 2WY2D 5KC9A 4MLDA 2PAFA 3N8IA 2PLNA 3HXMA 3RVOA 1LBIA 3S99A 3UUGA 2IDMA 1P6QA 1A0OA 1ZHHA 2VK2A 3ILYA 1EAYA 2HPHA 4LE1A 5ED4A 3OQNA 4YO7A 1QP4A 3IDOA 3K4HA 4OLAA 2WRZA 4FE7A 2MYPA 1PEYA 5CNKA 2IPMA 1D1PA 5BR1A 4NCAA 3EAFA 1DRJA 4N41A 3NHMA 4D6YA 4MQFB 4QPJC 1SRRA 2E4VA 4N76A 4M88A 2FMIA 2FEKA 4W5QA 4NQRA 3M9WA 4UHKA 3LFTA 2J48A 4S05A 1JF8A 3KYJB 5GOTA 1NY5A 4G0OA 3H5TA 3SY8A 4DN6A 3RVJA 1YK1A 3MA0A 3QX9A 3O1HB 2A9OA 2GBPA 1USKA 3RVKA 3C3KA 3TD9A 1JH9A 2PUDA 4ETIA 2V0NA 3H1EA 4Z4HA 4RK5A 4JASB 4ETMA 1KMIY 4G0XA 3Q41A 5EWJA 4PYRA 1KRWA 4LRQA 4NV3A 4D6XA 3P9YA 3SG0A 3D8UA 3OM1A 4Q6BA 5E3JA 4IMJB 4MLCA 3QELB 3G85A 1MVOA 5TQ2A 1UDRA 4HYEA 4RK0A 3NBMA 2A9PA 3NNDA 3BRQA 4IILA 4YGXB 4YV7A 3N0XA 4MS4B 2IOYA 2FTKE 3ROFA 3URMA 4Q6WA 3F73A 3LKVA 3RVLA 5KQLA 5PNTA 2CHFA 3C3WA 3HEBA 4QYWA 1NXOA 3IP7A 4OBBA 4RK1A 3FFXA 3UKJA 4EGSA 1USIA 3JPWA 2HQRA 3QX8A 5IUJC 3HM9A 3GRCA 1QMPA 1C4WA 4O1IA 2PUAA 2NZUG 1MIHA 3NNSA 4RXMA 5TQ0B 3FMVA 1BVHA 4FE4A 3HSYA 3NNNA 2LBPA 4RDCA 4RKRA 1ZAYA 3FFWA 3OLZA 4GNRA 4RXTA 2GI4A 3EJWA 4XXHA 2QSJA 3Q9SA 1K66A 1SXIA 1W25A 3CFYA 4IF4A 4RKQA 4RK7A 4JP1A 4EVSA 1Z18A 2CD7A 3OLYA 4ZJPA 6ABPA 2FEPA 4MS1A 4Z4FA 3N53A 1D1QA 2LUOA 2QU7A 4UHJA 4MR7B 3RH0A 4EYQA 3H5WA 1MB3A 2HQBA 3H5OA 2ZWMA 4EUKA 1NTRA 3DBIA 5JNVA 2IPNA 1JFTA 2VYCA 3EQZA 3E3MA 3RQIA 5BQ3A 4KK3A 4EYGA 3CLKA 2L19A 2F8TA 3QEMA 5EWLA 1PEAA 3OLVA 1DCKA 3L49A 1PNTA 3F6CA 2VUHB 2M1ZA 3EDCA 3MIZA 1RXIA 2E4ZA 2I6FA 3DGEC 1A2OA 1GLGA 4MR9A 5KQMA 1XWWA 4FB4A 1BDJA 4MS3A 6CHYA 4Z4GA 4MR8A 1DZ3A 3QEKA 5JS2A 1QP0A 3H5IA 1NXTA 1YMUA 2FMFA 4QICA 5GQSA 4EYOA 4W5OA 2W42A 5BRJA 4PICA 2PKXA 3CHYA 3SQNA 4XASA 4MQEA 4YCSA 5JNTA 3LUDA 1GCAA 5FWYB 4H3HB 1JL3A 1VPWA 4W5TA 1VLZA 1ZITA 2FXIA 1L5ZA 4L4UA 1F4VA 1M2FA 1RPJA 1ZH4A 3N0RA 5IC5A 3HK2A 4B09A 3QLVA 3CG0A 2AYXA 4RY0A 3TMYA 1FFWA 1QNLA 3O1IC 3RVQA 5ABPA 3RVNA 5IUNC 1ZH2A 2GWRA 3IP9A 3MQ4A 5C5EA 1DCMA 4LX8A 1YVUA 1ZY2A 1URPA 2WB4A 2JBAA 4Z99A 2QV0A 3M9XA 3MF4A 4DQDA 5JNSA 2JVIA 3HVRA 1P8AA 1FFGA 3SAJA 1JX6A 1AB6A 1FQWA 4LDAA 3HO1A 2WMYA 9ABPA 5TPWB 3R0JA 4JOQA 4IGAA 4ZYLA 1DG9A 3I5AA 2QW1A 3KLOA 3SNKA 3GA5A 1TJYA 1DCFA 5DLEA 2FSPA 1M5UA 2HQOA 3GL9A 2FLKA 4MRMA 2E4YA 3GBPA 2PJUA 1ZN2A 1Z2EA 3HDVA 4D74A 2P9HA 1P6UA 3QLTA 4KNYA 5HSGA 3OMXA 3CTPA 1ZVVA 2PUEA 3H75A 4F06A 2AYZA 5KI6A 2R47A 4HNQA 2A9QA 5EWMB 5HQJA 5KWSA 2CHEA 1JDPA 1E6LA 1QO0A 1LK0A 1QO0D 1APBA 4NCBA 2RGYA 5DGCA 4XLTA 1D2AA 1M2EA 2QR3A 1JFSA 1E6MA 4ML3A 4HNRA 2MSWA 4H3KB 1JYEA 4KQ9A 3I42A 4PZ0A 2IYNA 3Q7SA 3LKBA 3C97A 3RVMA 1D4ZA 1FSPA 3A0UA 1BA2A 1Z25A 1U2PA 2PUCA 1SXHA 3NHZA 3G1WA 3LUJA 4JB2A 5F64A 2IKSA 1SD5A 1XHEA 2JK1A 3A10A 4WXEA 4HNSA 1GUDA 4MQFA 1QQAA 4RZSA 1P2FA 3KHTA 4F11A 3OQOA 2BGGA 3E61A 3IPCA 4G0YA 3T95A 2R48A 1PHRA 3OLXA 2QZJA 3CU5A 4KQCA 3T38A 4EYKA 2QVGA 4RV5A 4WUTA 1RZRA 5IBQA 3RVPA 5IX8A 1RZRD 4YWHA 7ABPA 5EWLB 4RK6A 1Z2DA 1QKKA 3LUGA 5CNMA 4NICA 3EULA 5DCLA 5KC8A 1WETA 3CRNA 2IPAB 3HUTA 1GUBA 3MM4A 3OO0A 4N0QA 3IP5A 5T7BA 4TMYA 4G0MA 1DP4A 2FQXA 3M6MD 1TLFA 2L17A 2JB9A 2H3HA 1JDNA 3Q15C 4RU1A 3CZ5A 4H60A 4Z9BA 4EVRA 1Y1LA 1JWLA 1EFAA 2NT3A 4PEVA 1CEYA 2ZAYA 3N0WA 4YRZA 3FFTA 2FQYA 2FW0A 3KKEA 2PUFA 3I45A 4JB0A 5IEBA 1I3CA 3QELA 3QLUC 3OQMA 1HEYA 3EQ2A 2FKAA 1VRVA 3C6QA 3KS9A 4YP9A 2N9UA 2FVYA 2YHBA 4F3TA 2MSLA 3KLNA 4Z4CA 4L85A 5TQJA 5FWXB 5BRAA 4MS4A 2KYRA 3QK7A 1OXKB 1EWVA 5C5CA 2PUBA 3HCWA 4O5AA 1JFVA 4S04A 2LIVA 1DRKA 1EHCA 2A9RA 3KTOA 4IMIB 3JTEA 5JS1A 1DBWA 2XDYA
chains in the Genus database with same CATH superfamily
5K7SA 4QWMA 1I2AA 1SG6A 1KQOA 3CEJA 1N1EA 4ZCLA 1US8A 4X8MA 3PHCA 2M32A 3BCRA 3GUZA 3MFQA 5LQSA 1JTFA 3SXPA 4Z4EA 4IIUA 3DDHA 4GI2A 2HGZA 5LD2C 3H2JA 4F85A 3L8YA 3R7SA 2WHXA 1N4AA 1EHYA 2HWWA 1IY1A 2WD9A 3D64A 4ZVOA 3CZ4A 2YWEA 4LISA 1X1RA 4KOAA 4WGFA 5KNLA 2PGJA 5TE9A 3K0EA 1ISSA 3OZVA 4K28A 1GRQA 1Q77A 2Q4BA 4G97A 3SF0A 2ZRHA 1AN9A 4L5JA 4L0MA 3X2EA 3FAKA 2ZR7A 1QYRA 4RELA 1LJLA 1V3QE 4UVGA 3RS0A 4F4CA 1VLQA 4LXGA 3UGKA 8ABPA 1X8LA 2XYVA 2ZJYA 3H9JA 3OIUA 3H6KA 4R2JA 3UAOA 1Y81A 4OMDA 4TLDA 5CK5A 4TQ9A 1L5HB 3SQDA 3ZXSA 4DWWA 1J97A 1MB4A 1OX4A 4JMPA 3EVGA 3GFTA 4N03A 3UHOA 1N32B 2RB5A 5AKGA 2IU0A 1BAPA 1C0LA 1SVKA 2QHXA 4OYHA 4XDHA 1QH8B 2YJ4A 3JZMA 1B0AA 5FULA 3UWSA 3BBLA 2ZSEA 4JUAA 2RK4A 2UUBB 1JHPA 1A9OA 1FFSA 3KE8A 2J87A 1DAHA 1CR2A 4X7BA 5CAEB 4CKEB 1I10A 2ONYA 2GHRA 1M76A 2PMEA 3S2SA 1UBCA 4D4IA 3PNOA 4YQEA 3UN1A 2C3YA 2V6BA 4BLVA 4E15A 3UPTA 2CHUA 1Z8NA 4HDAA 4D0SA 1UC5B 1XCGB 4EHLA 2PGOA 1T13A 1HE8B 1DEKA 2H5EA 1AUVA 1TE2A 2DKNA 2IW1A 3NHPA 4K86A 5E6RA 2CLLB 1USGA 1VLHA 2FAXA 3CNHA 1JZSA 2WUFA 4EEZA 5K2OA 5K3DA 3SYLA 2XB6A 3MINA 2DMRA 3CVOA 3QBJA 2W0MA 5T4FA 1RDFA 1PJBA 3RU3A 1ZW6A 1DBPA 4L1KA 2D5IA 2YYYA 4DR3B 2B4TO 4JLOA 5KNCH 3GFVA 4WBSA 2AS0A 2JGIA 4GC9A 4XH9B 1W2GA 3I9LA 2YW9A 2C29D 2QUJA 4RA6B 5HGXA 3QSYA 2YY6A 4PSDA 4BE7B 2EOAA 1M8FA 3KKZA 5CTAA 1T6NA 2VJMA 5DI9A 1U7DA 1E2BA 1IN5A 3VR5D 4M1TA 2D8AA 2V4UA 4RV4A 5HQ3A 4XEHA 3BRWA 1N5RA 3QVUA 4F5WA 4KMOA 1EJ2A 3OECA 3WWZA 1E4OA 1ZK4A 5J2UF 1KI3A 5H70A 3JVEA 3DM9B 3GLFE 2X5OA 1TUBB 4D3XA 4TVKA 2B4YA 2PU7A 3F0TA 4EYEA 6LDHA 1JSCA 2EAUA 2JANA 1FTSA 3QE4A 4Q4AB 5AQEA 2IYEA 2GKGA 3PYLA 1GNSA 4LZAA 1I3OA 5F3WB 4FXPA 4QXOA 4JKOA 5EE5B 4FHGA 1PQ4A 2FQWA 1IZ8A 1XQYA 4X00A 4WEQA 4Y2VA 3DOHA 4ZI7F 1NXVA 1PLJA 1LEHA 1KGSA 3SIXA 2CMDA 4E09A 1Y34E 4O0LA 4DV4B 1QIHA 1RAGA 1XEWX 3L93A 3UJAA 1NUQA 1F9EA 2XNKA 2YUTA 3Q2IA 5FEMA 4D3YA 5JDIC 3WS7A 1DGQA 3HNPA 1HMPA 5CG2A 1M8GA 1MJGM 1N2HA 2A86A 3U7GA 4Q9IA 3CVXA 4M0MA 5L53A 1FJXA 3KR9A 1X1CA 3GLFB 3IBCA 2FCRA 2VJYA 1D0SA 1YKGA 3LCJA 1J8VA 4BBZA 1HDIA 1TA4A 4QNRA 2HJSA 3I61A 1J5XA 2CMKA 2HHLA 3E23A 1F2TA 2NT4A 5AM5A 3ZHQA 4BV3A 2KX7A 4HWGA 3LK6A 4N8DA 4G0QA 1ZAKA 3VNUA 3SICE 2EZUA 1CNEA 2I2DA 2P67A 3WQSB 1DC8A 3DEKA 1DO0A 1P3DA 3E7XA 3VMMA 2C98A 1JBQA 3HCNA 4INPA 1H6DA 5FXMA 1EA7A 1QLHA 4ZVPA 3TD6A 1H23A 4BNXA 4EKNB 5BNTA 2YHSA 1EVEA 2PD3A 1S9DA 1XU9A 3DVLA 3NPMA 4ZPJA 4O63O 5IBRA 4DLRA 4ZMRA 3T99A 3JW8A 3FOWA 1ISGA 1DAKA 3RHTA 1PT9A 1SIWA 2JBAB 2CY0A 2Q2VA 2ZFUA 3K5PA 3ZGLA 3LO5A 3U3ZA 4PPFA 1NG1A 3VH2A 3R76A 5K3EA 4O4IA 1LDMA 1Q0LA 1QHFA 2ANCA 4LXYA 2ZPAA 3GELA 4Q05A 2HIMA 4Q12A 3WSTA 3U1BA 2EKPA 5IEJA 1DJMA 1PR3A 2IYFA 4FFVA 1MVNA 2PL1A 2ZTVA 2Q1XA 2CL0X 4MB0A 1PJQA 1FLDA 1K68A 5FUWA 5A4DA 4V1CB 1XPRA 5IJ0A 3ICVA 1MC4A 1ZRSA 3FDFA 3K53A 2QGFA 4FJ2A 4Y8VA 2JI6A 1W44A 5U9CA 3P1JA 2ZG6A 3H7AA 5J47A 1R9NA 2I7XA 2WJAA 2O06A 3LP8A 4C03A 2PZJA 4HATA 3TTVA 3K94A 4ARSA 5H80A 5HJ5A 2YNMD 1QVRA 3H65A 4ZCRA 3VKGA 1VDZA 1ZGGA 3JQFA 1TNDA 4GWKA 3ANTA 1S2NA 4HUQB 5JANA 4YY3B 5JXJA 2OCPA 3AONB 1P1KA 1LDNA 3NFYA 1TM3E 4TVOA 3SBEA 3DLBA 3A2NA 4NPHA 3I83A 4Q1BA 4QDOA 1WVIA 4N39A 4UJ5A 4ZTBA 5BSVA 3VNBA 3N8DA 1ADBA 1EWKA 2B34A 3DB2A 1XRNA 1E7RA 3EY4A 4DLVA 2AZMA 2RMKA 5AJXA 4QT0A 1NVBA 3DE2X 5DTIA 4TSKA 3HXMA 2V6MA 3D0OA 3PFNA 4H1TA 4W99A 3ZE0B 2IDMA 1P6QA 4HFRA 3MLAA 1N0HA 1EAYA 5BQ5A 3CLRD 5ED4A 2QAIA 2C83A 2DAPA 2XKBA 3IDOA 4J7XA 3QBEA 2VLIA 5DNUA 4GW3A 5ULLA 3X44A 3QUSA 5JECA 4YT4A 3FBWA 4UKDA 1F7VA 1B7GO 4EELA 1U1CA 4QGSA 1DRJA 4FDUA 2HUNA 2OZPA 3MMSA 1M2VB 5JWRA 4EAAA 4L8FA 2FEKA 3PNYA 3JYLA 2BDTA 5BR8B 4FZVA 1L0BA 5JCJA 3M9WA 2ZWIA 1AKNA 4KQJA 2W2LA 3WMWA 3KPWA 1J0XO 2FX2A 2PZ8A 1O97C 1SHLA 1UKEA 3UQYS 5LLDA 1GKIA 2EW8A 1GADO 1ZGJA 2L69A 1ULZA 4POOA 1XK6A 4MUJA 1FJGB 1P9OA 4UTRA 5BWNA 3QPCA 1XZLA 4OGKA 2DM6A 2DLDA 1WB6A 1EGAA 2F90A 4RK5A 1P1HA 2KW5A 3FG9A 1HNXB 5JY6A 2V7UA 4INAA 4RMJA 4X7RA 2JARA 4IZHA 5FJIA 2C9OA 1XLWA 3FGPA 1H65A 3PQEA 4G5GA 2A3NA 5EMKA 4AZTA 1DXQA 3OM1A 2QJRA 3KEGA 4PQYA 4RZUA 5KNDH 3O7WA 4BGEA 2Q6LA 3CJRA 3L06A 4RVFA 4C3ZA 1UDRA 3FWHA 3I3SR 4PSAA 3INTA 5JZSA 5KYXB 1HEUA 3EC1A 4WDRA 3IUQA 5B7NA 5J2TF 3AY6A 1IZ0A 1M3SA 1XSEA 2IOYA 1QH9A 2VSNA 4K3VA 3W1WA 1E0AA 3LKVA 3DL4A 4OKSA 4M7PA 4NBKA 4MK4A 2XCTB 3U9SA 2WNSA 3MCTA 1RFGE 1LY1A 4KWCA 4F2WA 3CRZA 1USIA 1S2GA 1F0YA 3OOYA 3E0XA 5COBA 4D44A 3E5NA 3FM9A 4BNTA 2XUDA 3CW2A 2FSVA 4URFA 1YFJA 1CY0A 1Q0ZA 1GNLA 3HZOA 5CEFA 1UFKA 1BVHA 4BPBA 2XI4A 2G1AA 5HKKD 1X39A 2INGX 3HCEA 4JJ6A 4MJLA 4PHCA 1ZG3A 4DCTA 1VSQA 3MWEA 1VMDA 2PU5A 3MTJA 1SG9A 4ALKA 3GNSA 5BN4A 4Q9LA 2I6GA 2NP7A 3WBJA 3Q40A 3DZFA 3WOVA 1HURA 1LBQA 2RFLA 3BZWA 5ADHA 1NJ6A 1UKVY 2B0JA 3NEJA 4GX0A 1IQ0A 3KQVA 3MN1A 1M1NB 4TYYA 3QHAA 4MXDA 1ZVJA 5E8RA 3RIEA 4EYQA 2V7GA 4I1PA 3E27A 2FCAA 4KV9A 3LVBA 1KMNA 3ML1A 3H5OA 3SSOA 3JQBA 5JNVA 2FEMA 1WW8A 1IEVA 4BO4A 3JQGA 1YRLA 5FPYA 3GXOA 5SZJA 3TG2A 1K5DA 4GQBA 2G1JA 3TR5A 4KE9A 4U7TB 4F21A 3ZX4A 5L6LB 4L22A 5FL7A 1RXIA 2CDRA 4G25A 4UNPA 3RYHB 1YDMA 1V8DA 6CHYA 2WEKA 2PKYX 2HMAA 3SX4A 3I5YA 1NM5A 4X1OA 3ZLBA 4ZJZA 1NUSA 1JP7A 2P6OA 4GOLD 4KC0A 4B2IA 4MR8A 3AEUA 3CRVA 5J4VA 2HLNA 1QAOA 1XQXA 4QICA 1NXTA 4GI5A 5AI4A 3L5KA 3E8MA 4RANA 4Q24A 4Y0VA 1Y5LA 5B57C 5JQGB 4PZUA 4C6TB 5SY9A 4POAA 2XCUA 2WAAA 1G19A 4HDMB 4E4TA 1IXZA 3A9UA 1D8TA 1IL0A 2IXAA 3AQIA 3ISJA 2I1QA 1PS0A 1WQ3A 1P2SA 3GZTB 4K9NA 4OJNA 4PYNA 3ZU3A 4DV2B 1VPWA 1RAEA 3MRVA 2OY0A 4TXMA 3EGDA 3WGYA 4DJ5X 4BQRA 4I9UA 2NV0A 1P81A 1PE0A 4FR0A 5IKPA 3K6SA 4FDAA 1I6WA 2AGVA 3DAFA 4MVJM 4FM9A 2H06A 5KVQA 5L6MB 1IXKA 2FUG6 4X93A 2ZYUX 1QNLA 5FH9A 1Q0UA 2EBHX 5EJGA 2WVHA 1OB5A 3F9RA 1W46A 3WBBA 2PGLA 3ZHCA 2I7TA 1T25A 1AUPA 1VSVA 2VTDA 3R7AA 3U80A 3ZK8A 4ZYZA 5JD4A 5CFLA 1URPA 1O89A 3KSZO 4F2HA 1IBRA 1RQLA 2CFOA 3K9LA 5FF9A 2H9IA 3AGPA 1MJ5A 1AMUA 4D41A 3M9XA 3A6DA 2R6JA 4FI3F 4FYPA 3HR4A 4Q3NA 4WK0B 4N0MA 3FKQA 3KEOA 1SUCA 1X8XA 2ZYIA 2PVSA 3GROA 1CT9A 1OR8A 1HLPA 3VDXA 5E38A 2J5BA 2B7CA 4GICA 5JNLA 2X9VA 1RP7A 1WQ1R 1YHNA 1CDOA 2N1BA 3IKVA 4H0CA 4ZRNA 3LXUX 4EUFA 4N9QA 4YUAA 3GBPA 2PJUA 3CLUC 2CB9A 3JAMA 1FLNA 2AK3A 2WB2A 4NONA 4RV9A 5SZKB 1FK8A 3NPAA 1LW6E 1PFGA 3NOVA 4HI0E 3EZ2A 1VHLA 4ZVNA 3JALA 5EXTA 1WCV1 4H08A 1SELA 2DHCA 4OQNA 4XR4A 2CJPA 3A27A 3DOIA 4F56A 1D9XA 1O9GA 1PGQA 2FUNB 3L4BC 3TRIA 3PGKA 2DR2A 1E92A 4XLTA 5EP1A 4UAGA 3IIKA 4ZN6A 1GYRA 1FJ2A 2HLHA 3HVHA 5C7LO 3IUMA 4KSCA 1IN4A 2ZWPA 2JPDA 3KSUA 3JQ8A 1JYEA 3M1IA 3RUIA 3GFFA 2WKRA 3RVMA 5A0FA 1Q6ZA 5ISMA 3RODA 2VAPA 1ZJ5A 1FW8A 1Z5GA 3OEYA 1U8YA 3C8DA 4N49A 1SQGA 2PUCA 4XD2A 3W0LB 5ALZA 2B5OA 2FX5A 4OK5A 5CYGA 4P3KA 1DQSA 2WKQA 1VRWA 3KDAA 4KYIB 4BKPA 4DBLE 4F96A 4J49A 1J24A 2BUAA 2QTHA 5AO9A 3GFPA 3KZMA 3LPMA 2CVQA 3EUFA 3SE7A 4CEJA 2XECA 4PS0A 2WQ6A 4Q1CA 4CETA 1U7HA 3PRKE 1L7AA 3A6HA 3ETJA 5ELLA 1BCSB 3BWDD 2QVGA 3TTYA 4MX8A 3ZBPA 1FUIA 2IYTA 5FBZA 1DQYA 1OAOA 1NPTO 3TQTA 3WKEA 5G2OA 1NJ8A 2JZOA 3LIPA 1T4CB 3Q2OA 3GEMA 1XMSA 3O8BA 1WD5A 2JLXA 1QGED 5KNBA 3CZQA 2ALJA 4G09A 4KHPB 4WOKA 3RSSA 3U6BA 1OBVA 1I7LA 1Y82A 1TXGA 4QRHA 2C03A 3K2QA 2WR8A 1JWLA 4MMZB 3GQBA 3BVPA 4D2IA 3I58A 3NBXX 4BB6A 3ENKA 3OJXA 4EHDA 3EBOA 5I3CA 1MDBA 4FFOA 4JITA 4MQ4A 4OQYA 3RT1A 4WVFA 5ADUS 5EUBA 3ACDA 5CXUA 4Y67A 1YBHA 5KVSA 5LOVA 3D8RA 1CZLA 4Y1EA 3TAUA 2IIVA 3IIMA 4IX9A 1ID1A 1JT2A 3MTAA 5A6SB 2C99A 4PZPA 5C5CA 1QH1A 1R10A 3F9IA 4EATA 4IQ4A 2ATCA 2MWMA 1GZ3A 2CK3A 4EUNA 3LLVA 1VLMA 5B7PA 4S04A 4HZIA 3BMNB 1J8DA 3ZVLA 5ER9A 2XDYA 1TYEB 5CLGA 3OX4A 5F1KA 2IZ0A 1KI8A 5EJIA 1U9YA 1N1MA 3M9LA 2VR1A 4TL7A 5E0OA 1Q1EA 2BCJQ 1L4UA 1P5FA 4G8CA 3DMNA 3G9XA 4UPEA 1A2QA 1IHYA 2PGIA 2YC4C 1CDDA 1NXSA 2RHHA 4AF8A 5I9NA 1RXYA 4U9HS 1V16B 1PQUA 2J4DA 2WWRA 4PG4A 5E6SB 2YVQA 1SOAA 1U4SA 4QJ5A 5I9TA 4A82A 1R6XA 5GVSA 3LS2A 2FSSA 3GZNA 5FR2A 5EUMA 5KYYA 1THTA 2LKCA 3FSGD 2PSFA 2L2QA 3VMFA 5EIXA 1ENOA 3PNSA 3I2YX 3G0DA 3LBFA 4OSOA 4TLLB 5EXPA 3EMKA 2J4FA 3H1GA 3QF4B 4ID3A 1PV2A 2OEPA 5KYUA 4U2GA 1PSDA 4RUKA 3GLIB 1JAXA 4RACA 4EITA 1X77A 3BSYA 3FCCA 3M5CA 3N28A 3DMTC 3QUCA 2JFOA 4Y2GA 5EP3A 1SQ0A 3A3NA 3S1LA 3NKFA 1MO5A 4ASUA 4NCXA 3FJYA 1B73A 1YIAA 1OXSC 3MWFA 1YRQA 4MKXA 2FE4A 4EFMA 1Y4AE 2Z1NA 1SULA 3IDZA 2IHVA 3OOJA 4LRSB 4PONA 1U9CA 3F5DA 4PYMA 3A36A 5DVZA 5LA6A 5I4CA 4OG2A 3R9IA 3QKRA 3VUEA 1LKZA 5AKXA 5KREA 1XF9A 3QM1A 4PQEA 3ISTA 4YNBA 1N9GB 1R7RA 1E6KA 3RSLA 3EWNA 3KQKA 3MYRA 4R40A 3WRWA 2NP6A 2P7HA 3K8OE 4CMAA 3JVIA 5D00A 1E4EA 3HLYA 5LU8A 1E5VA 4DABA 5H8WA 1YE3A 1Z0UA 2NNWB 1EYZA 3OTHA 2H1FA 4OD0A 1A4XA 2MCFA 4OGLA 4JHLA 2YMLA 4OQXA 2JLRA 2GPWA 1O6BA 3ANSA 3RBAA 4BFZA 4CLDA 4EI8A 2WMDA 1L4KA 2YHUA 2AG1A 4GLJA 4ABYA 4BMPB 4UDYX 4KBYA 1TQHA 4X1YB 3AHHA 2YQ4A 4FIDA 3WOHA 2QZZA 4AXBA 5EUCA 2IRWA 4JNKA 5JSFA 2Y6UA 4BFSA 1HDGO 1BKDR 2D5LA 1Q0PA 1G6OA 4EHJA 4FKBA 5D01A 3EGXA 4DKXA 3C3JA 2B8WA 3N76A 4A5OA 2DVMA 1XAJA 1ZN8A 5FNVF 4GWGA 2Q3CA 3L1UA 1LF0A 1UBMS 2EDAA 1VGVA 3LI2A 3U4HA 2VJOA 4PQRA 2EFYA 4QT4A 4LUCA 3T1TA 1Z0JA 3ZJYA 3I53A 3BAFA 2Y92A 1QWOA 4ZTUB 3DFFA 1F7UA 3PCTA 3UCFA 1G59A 4DLTA 1AC5A 1W88B 2BN4A 4JR0A 2E3JA 4LN1A 1SUPA 5IH7A 1FTWA 2YVKA 3OE4A 1W36C 1GSHA 3U7IA 3EIWA 3NWJA 3SXJA 1NZJA 2D0PB 4ZGGA 1JEYA 2R62A 2Y9MB 3DBVO 4X7PA 2HHHB 2O5VA 1A9SA 4RVHA 4QASA 3BGVA 4OLBA 4BZZA 5I45A 5DNYB 5HYVA 4HGYA 1O03A 3W5SA 3D5QA 3KQMA 2AZTA 1YQXA 3LC1O 4KQEA 3AZOA 5DM60 1GN8A 4LQDA 3GT7A 1EFTA 5KNCD 3SHFA 3W2TA 4JLAA 3EFOB 3GEHA 3M1LA 2QMZA 4QNNA 1E7SA 2IEIA 4WDQA 3ZWBA 3JWGA 2YV2A 3GWGA 1FXUA 4OIFA 2BDUA 3TLEA 2JAPA 3VNSA 1NAHA 4NAUA 3W5IA 5CHYA 2R11A 2OAEA 1ZRHA 3PI6A 1XVIA 3Q72A 1JR3D 1SZPA 3RT9A 3WFIA 4ZHQF 4KUHA 4MQUA 2FMHA 4FMDF 2AJTA 4DTCA 1K7SN 3B3GA 5E9JA 5F52A 1NRXA 4UBNA 3GP8A 5ICMA 1VJ5A 2FP3A 3V4VB 3D6NB 5KX5F 2VWGA 1UF9A 1DNPA 4KNVA 1KOFA 3CKMA 2W2NA 2XMQA 1YE8A 4LYGA 1WVMA 3I9V1 3U3MA 3N7TA 3GJZA 3L7DA 3BRSA 3F6PA 2IEYA 3QP9A 3SJAA 2IH4A 1FJHA 4O29A 4YCMA 3PX3A 4XWYA 4BKQA 1YR3A 1NJ5A 2VTBA 1PN3A 1I80A 3N74A 2J6IA 2ZWAA 4X44A 3SKYA 1J9GA 2NAPA 5ITVA 1UMCB 3FPFA 4EY6A 2B6HA 3AR6A 4J4BA 2MIIA 5DBEX 3F96A 4EO9A 4M8KA 4RENA 3TYXA 3BOSA 4UM9B 2I8LA 3O4IA 3SQMA 3GGJA 2E2WA 1T1GA 2QTVA 4Y18A 5LZ5A 3SK0A 4AP6A 4ZIRA 1II8B 2ZIUB 1OYOA 4JN6B 3T06B 3KE9A 1E6UA 5C1OA 6NULA 3MUNA 3OBBA 1ZK1A 1VMAA 1YB1A 4Q4DA 4JLJA 1XGKA 3FDZA 4M55A 5AVOA 3QXHA 1LB1B 3DZ8A 3X1ZA 1NXXA 1KYZA 2KHZA 2XQGA 2QGZA 3MJCA 3KC2A 4HAZA 5T64A 3U44B 4KI0A 5BVHB 3SQWA 4WZAE 4AJLA 1OCEA 1S3GA 1R4NA 4PAQA 1ILWA 5AVXA 4V0ME 3VR2D 5IT9A 1VMIA 1N5MA 2RK6A 3F8WA 3KJXA 2A4MA 2VAWA 2D5CA 3PSAA 3F5SA 5F4ZA 5G53C 4CE6A 4DXAA 5HRCA 1OJ7A 3IQIX 3NTOA 3SS7X 4B33A 4I1YA 4A03A 1LBIA 1NY6A 3B9BA 4CMCA 2FW6A 1GUFA 1KHTA 5ERXA 1ZFNA 2G9UA 4OOFA 4YO7A 4FFPA 3RRNA 1F6DA 2WA2A 5E4YA 4QGHA 4BFXA 3GMSA 4BNUA 1FPQA 2RBEA 5LNK6 3F4BA 5B4TA 1X1DA 1X9HA 4I3FA 3TFWA 1U5AA 4UXIA 5AK4A 3NHMA 1OFHA 1EUCB 4MQFB 5IZCC 5JALA 2V3CC 3STXA 3ABZA 4NQRA 2QLLA 1AZLA 1A5BB 1QPGA 4L9WA 4KE6A 1JF8A 2PH1A 3QU2A 2F4NA 4INJA 2J9YB 4GOOD 5EZYA 2OYRA 3WR5A 1KVRA 3D81A 3HXOA 2CZCA 1UM8A 4GVLA 3W04A 3AV0B 2WT8A 3QJGA 2ZAGA 2A9OA 5AUQA 4BXOB 4EMUA 5DYYA 2ZB8A 3RVKA 1TZKA 1K7EB 2X0JA 3D8NA 4RNCA 4FOPA 2W6PA 3T4UA 1GL7A 4REQB 4TKLA 3GLGE 2P6NA 4AS2A 3OAAA 2W6JA 4HRAA 3QW4B 5IN5A 3VSBA 4DVJA 4IJQA 1G8SA 4PLHA 2O05A 1GKYA 4DIOA 2Z3WA 3M6UA 3GC6A 4F6LA 2O8CA 3WNZA 1NFFA 2O1SA 4D8YA 4D6XA 1NW7A 3B60A 3P9YA 1GLNA 4INZA 1JSRA 4V3BA 3R7BA 1EXVA 4JYAB 3G7SA 1H2YA 4GMFA 4LHXA 3QELB 1B1CA 3KJIA 2Q1WA 1BFDA 5TQ2A 3UOAB 3PB3A 1D3AA 4QO7A 1KJYA 3PNMA 2PS9A 3CEMA 1YV9A 3N0XA 4BOYA 4M1KA 4YV7A 5LM3A 3IP1A 4BQSA 1T1RA 4JLUA 3I9OA 5ICFA 3OQIB 4EW2A 5H9WA 2P6PA 1U5CA 4DARA 4MKZA 5FOSA 1VL2A 2ZRAA 3V8RA 2OCDA 4HYTA 2Y0EA 3MTEA 4NX2A 2FRVA 2WG0A 1U3TA 2C9MA 2RHMA 3A6ZA 1QO9A 3M4JA 3ZNNA 1N2CA 3GLGB 3HM9A 3KQUA 2JLZA 4O1IA 1TADA 3WGKA 4RE6A 3X1KA 2Q0HA 1CJVC 1Q2XA 2BM9A 1PFYA 1SA0A 2P2DA 5TQ0B 2CCKA 4KW7A 2JA1A 1H2WA 3ND7A 2PPLA 4YRIA 1OFGA 2PZAA 1XMQB 3KYDB 1Y1KE 1O4WA 4P54A 1BWQA 1GPAA 2VHYA 2VLBA 3RTDA 5BSHA 4LI3X 2VVTA 4OU4A 5IAJA 3T5MA 2QSJA 4RYLA 1M2OB 4H7FA 5A9RA 1YQQA 3AP2A 4KRYA 4YI3A 1QAMA 2BFDB 2H65A 3EDYA 4PSUA 1P33A 2VF2A 4MJ3A 4PO1A 1CQIA 1AZSC 2Y1CA 5A5FA 4MS1A 4KAFA 3EZFA 3NDRA 1D4FA 1DG1G 3CV3A 3HKDA 1KMCA 4ETWA 4BDTA 4HPWA 3D6UA 3H8WA 3AW9A 4L8WB 5CVEA 3K9HA 1BHO1 4QPDA 4AU1A 1UEIA 4PFQA 1FVOA 4CQLB 2BF4A 2PGXA 3DJYA 1F3LA 2IPNA 4EKDA 3ZHTA 1T6ZA 3BFPA 1MORA 1SCDA 5BQ3A 2JIRA 4NJEB 5I8ZA 2WHQA 1OV6A 1VCNA 3EEOA 1ENYA 1MIOA 2Y1DA 4IIXA 1TB4A 3S44A 4PF1A 2BEVB 2I29A 1DOAA 1E7QA 1OZHA 3WAKA 4ZXFA 4DCJA 1S2LA 2DETA 1F14A 4FB4A 1QQ5A 2V5UA 2UZ0A 4AMVA 1OYWA 1U02A 1YDHA 4O4HF 2KMLA 4A6XA 2B37A 4MINA 2HUPA 3GPLA 2EKQA 4KIWA 1CU1A 3O6VA 3LWDA 4J0EA 4EX7A 4ND8A 3H3XA 4TKUA 1JNXX 3R4VA 1WB5A 3EBLA 1U7PA 1ODLA 1XU4A 4OHUA 5BT8A 1RWVA 3C3XA 4BQEA 4DDWA 3LUDA 3T1VA 3ZDEA 3I4LA 3IBTA 4NESA 3SKXA 1J1UA 1SHZA 4CU5A 1H69A 3DOFA 1YNSA 2Y1XA 1ZJYA 5CB4A 1R18A 1F4VA 1T43A 2XUAA 3N0RA 4RMGA 2QWXA 4OGGA 2XIJA 4ZGWA 4E0BA 1QIGA 3FPHA 4PW0A 2Z08A 5LSAA 2GAAA 2EBWA 1J7JA 3TMYA 5LVAA 3TF5A 1ZIPA 5ABPA 3NHWA 1C1DA 4NFYA 3CXUA 4FMBB 2UZAA 1JG4A 3K1YA 3OA2A 3VJKA 2BP7B 5ESRA 1N2GA 1Z6QA 2APJA 5J2UB 3TINA 2UXCB 2HA3A 2X4GA 3CY6A 3GVHA 4HQ6A 4JBGA 1YVUA 5EIHA 3UT5A 1OILA 3KYCB 1E8NA 1TU3A 5BYJA 3NI2A 1C80A 4LF7B 4A2CA 1DL5A 2GFIA 3CSSA 3WLSA 1HQCA 4FFNA 1YUMA 3KLPX 4ZOEA 1CY4A 1ZISA 3T9CA 5KBYA 2E48A 3CINA 1NU8A 1XYVA 4HH1A 3R8FA 3L6EA 3P2MA 5GMOA 4C07A 3A1EA 5FLKA 4ZI7B 1DZIA 1GRVA 1V1JA 2REQB 4J1SA 4NJOA 4PPYA 4FNOA 4HZUB 4PWZA 5F5LA 1AUQA 5AM2A 4DV6B 1M5UA 2YY7A 4HY3A 4F3KA 1I6LA 1UBEA 3VO2A 4JT8A 4AY3A 1XROA 4DUGA 4PZLA 4ZFNA 4IDAA 3AHJA 3DNPA 3IRUA 4D74A 4X61A 3NB0A 3GRVA 2IOFK 3OMXA 2X1LA 2YJGA 4F86A 3CH7A 3BK2A 5ALMA 3JD0A 3ZZ1A 3K96A 3S2GA 5KNBH 5T5QA 1OZFA 2QP3A 2XHZA 3GN2A 1A7UA 3NDIA 2Z5LA 2GSWA 3OEEA 4FDTA 5DISB 5TMEA 4CDNA 4D5EA 1LS6A 4UHCA 1O2DA 1TM7E 5AMXA 2VP5A 4C78A 3K72B 5C9ZA 4AMZA 3G2IA 4JQYA 4QLAA 4UBJA 4NG5A 3GHYA 2YBDA 3A0UA 2IP1A 3C87A 5AM1A 5AJVB 3EIOA 2OCBA 3EEBA 1U2PA 3NHZA 2I4IA 3AHIA 4W9NC 3S2YA 2YASA 2IKSA 3GEPA 3TRHA 2J0UA 3UKDA 1J00A 5C0OE 3UPUA 3FTFA 5FFFA 4OHFA 1AQUA 3LLUA 4W9NA 4LFAB 4G8JA 4HB3A 3ZZUA 1QQAA 2O8VA 3IMFA 1DXOA 1QTNA 1DJQA 3DQPA 3HQ4O 4FZRA 4B87A 4X1KB 4UOQA 2DUMA 4G0WA 3I92A 1AOXA 3TEMA 3T7JA 3VPCA 1KETA 3IR7A 4I6JA 3O8OB 4ZQFA 5HBGA 3REGA 1RZRA 4YWHA 2VRCA 1IXSB 4JJ8A 3PIRA 2EATA 3FOAA 1HGXA 4GZ5A 4OY3A 4RD6A 2CDCA 1E0KA 2VAVA 3CLTC 4GWLA 4HHEA 1SKAA 5P21A 3FE2A 1PG5A 2Z0MA 4PC3A 1E7WA 3VZDA 3C45A 3ZTYA 5AVTA 4I9GA 4GP6A 4AMYA 4CF7A 3HCRA 1SC3A 2ZSHA 5KSWB 1RWOA 1XJWA 1DRVA 2R1UA 2HCBA 2Z2ZA 3M1YA 4IMRA 3RWBA 3F6BX 5HNKA 4KACA 2ZAYA 1ORTA 3HCAA 3OQBA 4FMCF 4YRZA 3I37X 3RIGA 2FW0A 4MPJA 4JB0A 1KK0A 2X9NA 4X3OA 1KI6B 3L01A 2X86A 4OXYA 4V2IA 1GEGA 5JAHA 2QX9A 4DXHA 1C9YA 4QRIA 3SYKA 2PANA 3E7PA 2CNOA 3A70A 3JQDA 4MTCA 4Y1RB 5TQJA 1NBAA 3D3KA 4NV1A 2EWVA 4PN7A 4M21A 2JCVA 4PYIA 4HNAB 5CCDA 4EO4A 5K8VA 4X8OA 1SGWA 1FFXA 2WLSA 4MYTA 2LGJA 3W90A 3UJHA 5C80A 1FLVA 4K88A 5ALRA 5H3LA 1IWBB 3A9VA 3AXSA 5LIPA 1TT5A 3THWA 2F1OA 2V8OA 3D2BA 5A2QA 5K4GA 3EIQA 3RF7A 1UC9A 3E6AA 4DDTA 1AKMA 1XEXA 2DRIA 3COJA 1IHUA 5FOXA 5JEEA 1IY0A 1X1SA 4JIGA 1DC7A 3DFIA 3KG2A 4UHFA 2A1UB 3BGSA 2YV4A 4WXMA 2IODA 2OCLA 2IUUA 1ZHFA 3IOEA 2Q7XA 1T3TA 3IB3A 3T4PA 3CISA 3DV2A 4F7WA 3EPKA 3B3JA 3RGGA 2VPYA 4RVNA 2VDWA 4LRTB 3WQQA 3H1BA 2GGSA 2MHCA 2O2DA 1HG1A 2COKA 5DHQA 1XRSB 1O6GA 1M6WA 1EX1A 2FWRA 2QJTA 3AERB 5EFZA 4Z1MA 4MUAA 2XTAA 1Y8QA 2O23A 4OTZA 3ZDDA 3V42A 4QSMA 3VVMA 1W94A 3E9RA 4HLDA 1ZR4A 4L5IA 4MEBA 4LSGA 1X7ZB 3BCSA 3NDPA 3LDGA 4P7KA 1Y7TA 3EXAA 2ZITA 1TO6A 1EJ0A 1XTSA 2VZ8A 3AL0C 3O47A 3CJQA 2VXBA 4I8DA 5J2TB 2J9XB 2ORVA 4JSRA 1UFRA 1EFKA 2X5KO 3A2LA 3F67A 1P4JA 4PTYA 2AW3A 4GX2A 4ETNA 1OUMA 3N0TA 3WGUA 4KO4S 1TMGE 1XTKA 5HF8A 1ODIA 3LRXA 3R3WA 3P8ZA 4JBXA 4WN3A 1KR2A 3G02A 3QKSA 5L95A 3SJ7A 1TKAA 2NQ8A 2FKNA 2F9FA 4DA7A 1OWNA 4MCAA 4HN9A 3U7QA 4NH0A 1YONA 2G9ZA 2C3OA 2ZBDA 1TKBA 1FZQA 1GSIA 2TSYB 4EECA 3B1VA 5JPCA 5F9MA 4ADSG 3O1JC 2GBIA 5LMUB 3QE3A 1D2HA 4MYHA 1L6RA 1ORRA 1JYFA 2P4SA 1H6BA 4OXKA 3RARA 3K70C 1QOPB 2E4WA 5CM9C 1QANA 2A0WA 3BH6A 4D99A 1ZI6A 5ALGA 1Q0QA 1ZUNA 2O48X 3L7IA 4EOGA 2MINA 5JSYA 1DO2A 2XJ9A 1YJ5A 3ETEA 4KQMA 1QZZA 4RZIA 4LF4B 4S1OA 4HTFA 2J6CA 3BRWD 4O8CA 5BSMA 3RD5A 3ZUGA 4E2ZA 2H4HA 2O3JA 3DD5A 5AVRA 2XR1A 1E3MA 1NNSA 4IVNA 4B4WA 2CNDA 2GM3A 3HL4A 3ZYZA 3BL8A 3N2YA 1YS2X 3RHSA 3H9EO 1BN7A 2ZI4A 1WNFA 3I2GA 3U3OA 5JAPA 1I3NA 4I0WB 5AW2A 2OZLA 4YAOA 1MO4A 2RJ3A 1L4YA 4R8KA 1YCHA 3AFIA 3QEMB 4DRXA 4CIYA 4CXMA 4M0DA 2WTUA 2QYHA 1V35A 3N2EA 2DX7A 4YDRA 1E1CA 3ID6C 4FGJA 3WLAA 2KQUA 3DTTA 1PZXA 3HLTA 4U3JA 1YZFA 2CDNA 4JP5A 4LJ5A 2Y05A 1JAIA 4O2RA 2QZ4A 1HDZA 1NKSA 3SQLA 3V8NA 1FSZA 2GBFA 3DGFC 3E70C 2IPXA 5JT1A 3IMKA 1DIGA 3TO5A 3A32A 5K3OA 4JGIA 2A4KA 2ZE5A 4X95A 1RAAA 2IXTA 1T3SA 5DBGA 1EBBA 1NX6A 2GJ8A 2GEFA 1JRLA 5THXA 4WL0A 4TYWA 5FLYA 1EUDA 5JATA 4KODA 3UW1A 1W87A 1CG6A 4KFCA 4R69A 1V4BA 4LE0A 4X8LA 4YRFA 1K98A 2F62A 4QFBA 1UP7A 2AX3A 5EN4A 3VA7A 4XDZA 3ZLJA 3UW3A 3CPSA 2PGAA 3AK4A 4IEIA 2QAGB 4K9RA 2VF5X 1LPPA 2NV6A 3OO1A 4L5YA 2G0TA 3L0IB 4ITVA 2JD2A 5I9SA 3A9SA 2B83A 4OQDA 5ALEA 4ZDKA 1PZFA 3ASZA 3WYCA 4IOLA 4CEIA 3AHDA 5KJ1A 2W83A 4XJTA 1GPLA 3TB4A 1NI5A 1F17A 3ZVNA 4JXZA 1FDTA 2IX9A 1TA0A 2ZJ8A 1VPEA 4A6EA 1LDYA 1C1HA 2GCOA 3PKJA 2EFDB 3P2JA 4MPPA 2H3EA 4QGBA 4A8JC 5K0SA 4KPYA 2MR6A 5TIIA 3DVAA 4H2DA 1IH8A 3SYTA 1ZD4A 2CZGA 4PSKA 2V7XA 3M89A 2V7PA 5C53B 3QYJA 5G0WA 1PEKE 4V3CA 2Q9BA 4W5NA 3ZNPA 1TECE 1UXHA 4OQ4A 5EHQA 1U3VA 4O4IF 1OT5A 1TZBA 3IB6A 3NZEA 1AHPA 2QY6A 4MRMB 3AUYA 1NVVR 4Y2HA 3VV3A 3T5PA 4TRRA 1KU6A 3CUEF 4F1JA 1UKYA 3C6MA 2QUZA 4HB2A 2WSSA 5LKAA 1I2BA 5DSZA 5BY2A 4QYXA 3FZEA 4JQOA 4KR9A 2CL6X 2VK1A 3QMMA 1ONBA 2BFMA 2HLDA 2I6SA 4KFSA 5CM8B 3TS1A 2EWMA 3GYBA 1VYVA 2NUTA 1ZYUA 3RVSA 2HJGA 2WIFA 2RGEA 3LF2A 5JAUA 3RIHA 3QFFA 1E9BA 2HMYB 3LA8A 4G07A 1ISRA 3DV9A 1DINA 3VPSA 3OZXA 3M6AA 4EGAA 1B6TA 3P9IA 1TGVA 2WMNB 2GPAA 3S99A 2WG2A 1AQ6A 2WMOB 3B85A 2OK7A 1FA9A 1XZHA 1SQFA 2HBZA 3DR5A 3M4NA 1FTGA 1MQAA 2WHRA 3PCXA 2ZJ2A 1N7GA 4LE1A 4IDBA 4PZZA 1E5LA 4UM5A 3HB0A 4KPUB 2IWRA 1EJBA 1K7XB 2QPTA 4ZZ0A 4HDRA 5BR1A 2BGTA 3E3AA 3H05A 2VQ6A 1QJ4A 2UZ4A 1PWHA 1AH2A 1BEZA 1X7XA 3SJZA 4X62B 1R8YA 3FBGA 4QPJC 4X60A 4AJIA 2IZZA 2BFFA 1VIYA 3HDHA 3U48A 5DM0A 1TQDA 4UHKA 3RWOA 2NU9B 4KUGA 3Q4GA 4BX0A 5EJEA 4S05A 2QBYB 1KKUA 4DQVA 3GRPA 1KEEB 1C3JA 3NGLA 4MUMA 2DUWA 2G67A 2QROA 4QYTA 4BNNA 5L4LA 2GMWA 1ORHA 1YK1A 1GQYA 1KZHA 2YJ5A 5CFNA 1UT8A 1HC7A 1R8XA 4H1WA 3JQCA 4PC2A 4RPKA 1KI4A 4ND5A 4NZYA 4TTAA 2Y1GA 5DULA 4YPFA 4QM6A 1QOQB 4WZBB 1R5NA 4C9BA 1T8SA 5T41A 1GLVA 1MC5A 3AP1A 2JDIA 3L9XA 3NHUA 3Q0IA 4NZZA 4ZCSA 3P26A 3R7DA 5KO2A 5E1DA 3L7BA 3OOEA 3H11A 4BLSA 3RFXA 2FZVA 2O2XA 2WNHA 5G0VA 1D03A 1VG0B 3YASA 3OEHA 4FLEA 3L0CA 2DHRA 3VOSA 2ECFA 1ZD1A 3M6FA 1BMFA 1XD9A 1ZLXA 4KUEA 2DPXA 4JI0B 2QLMA 2TMDA 3BTUA 1KJ8A 1RABA 2BISA 2F43B 4WFIA 1P5RA 4CKBB 2AFIE 1Y6GA 1LU9A 5JFTA 2C00A 4IILA 2X2FA 2C58A 2ZRCA 2I4LA 3OCYA 4JROA 3JAWA 4UUMA 1DS6A 4IXTA 1R00A 2CFRA 1L5KA 3S2UA 3C3WA 1OVMA 2BMWA 4D56A 3UUEA 3SVLA 3FFXA 4OUDB 1MXHA 3NLLA 3DE3X 4P4GA 4QEKA 2G6TA 3HP1A 2A1IA 1C4WA 5SY6A 3Q88A 3MCVA 5ALKA 1H8EA 2YS6A 3I39X 4ALMA 2HRBA 3MT7A 1QF9A 4ZQGA 4ZEMA 5D3ZA 2GO1A 2D2IA 5GIPE 10MHA 2ZGVA 1QE0A 1N2XA 2ZIXB 4CL8A 1J9EA 1XDZA 3C8MA 3MWJA 1GG5A 1ZD9A 3Q9SA 1TA9A 1TM1E 3L7JA 4UAJA 3RHZA 2UKDA 4GS5A 4G37A 2FJUA 1CB0A 4A23A 4B4VA 5HZKA 1GPMA 1LSUA 4MA5A 1HT1E 2AFIB 4IH9A 3FI9A 3IHLA 2RI0A 2EKDA 1HEIA 3ZCPA 2XF2A 2HJWA 3HGQA 3MWDA 3QUTA 5IT4A 2Q2QA 4UUAA 2BMAA 3GN1A 3WG9A 2PLRA 1AO3A 3RH0A 4P81A 1E2FA 1NQTA 5KOYA 1RAIA 3BERA 2ZW9A 1QFMA 4MYUA 1PHPA 3I4CA 1CJUC 2VYCA 1IZ9A 1IJKA 2QI9C 4WJLA 2QIPA 2VHUA 4O4LA 1PEAA 3OCWA 4G85A 5FX2A 5LBIA 4CM1A 3S8YA 3QG1A 3KR0A 4DDMA 1XTBA 1ZD5A 3KFXA 5D1NA 1RWPA 2AIRA 2E4ZA 2VQSA 4MQLA 1Y5RA 4MR9A 4HGPA 1LJ8A 5EIBD 2GDZA 2VJPA 3O82A 2G40A 3W4KA 1ZBDA 5E6UB 5F77A 2WIJA 4H6VA 2YWGA 4Q37A 5E4JA 1W5SA 2JLBA 3RRBA 1J2EA 4IV0A 3DMHA 4EI2A 5IT5A 2ZUTA 4UPVA 4DIUA 3FSRA 3ZHSA 4HAIA 4X66B 4QNMA 4Z0HO 1U65A 3CZ9A 1B0ZA 4MQEA 5G1NA 1IQPA 1MRNA 3IAS1 1H1TA 3E81A 4DV1B 3KSDO 1XTPA 4Q66C 4E03A 2QL5A 3GYGA 4BO8A 1QV7A 4TSRA 2MSCB 3PVZA 3STVA 1KAHA 1Q74A 4RORA 5IBPA 1GT6A 2IQ5A 2P2GA 3O3CA 5JJLA 4OH7A 1I51A 2Z2IA 4QELA 3W6PA 2P79A 1JA9A 5FNVB 1GG8A 1KC3A 2YXEA 4BZQA 5A5GA 3KJEA 4U6NA 2R4TA 2DPYA 4Q4JB 1J1ZA 3KK0A 4IICA 2CCGA 1H3FA 3K9QO 4R68A 1RI3A 4II3A 2PXXA 3E9YA 4LRYA 1OGJA 3DVQX 3MELA 3C3EA 3F3KA 4GM0A 1PV4A 3UF0A 4QPNA 1FW6A 2GN8A 4AG6A 4YVFA 2X1HA 1KI2A 4PBSA 5IJZA 1Z6AA 3RUEA 4QDXA 4WECA 2GLUA 2OCKA 1KJNA 1YI1A 1M0WA 2Z57A 1MF7A 2XVMA 3MIIA 4FR2A 4TN1A 4B7AA 5TPWB 3PQ2A 4GOJA 1CUGA 1GUYA 3D7SA 4OCZA 5K0ZA 3G5MA 4KJXA 4ZYLA 3G9UA 3IJPA 4ZKDA 2P0EA 1JR3E 3OZSA 3ZQ4A 1NE7A 5J5AA 3S2IA 3CF0A 1RI4A 4KX3A 1WZ2A 2HBQA 1QF6A 4TL9A 5DGDA 3Q6IA 2QXUA 2W2OA 4M8SA 2GARA 4Q48A 2QORA 3K0FA 3DBLA 1EQAA 3B2EA 4EKEA 2JAOA 3KZXA 2MDTA 5J5VA 5JAOA 1Q0TA 2P77A 3COSA 3D59A 5KU7A 2JFUA 1GARA 4QA9A 2O8FA 1J39A 1W9MA 3LQ1A 4KDCA 1PFVA 1T5TA 2BSAA 2I65A 4WXHA 5D6NA 4LJ6A 5E9AA 3W9UA 2CHEA 4CHTA 5ALNA 1LK0A 4Q18A 2Q5OA 3DT8A 1P4HA 1I94B 2W8ZA 1BEUB 4IF6A 1KZGB 5P8WA 4B4KA 2AG8A 4ZHQB 4FGUA 4EQ6B 4FMDB 4GOND 3QFCA 1O08A 2NU7A 3SF8A 2BEWA 3FTQA 2IXFA 2PFGA 1D4ZA 4C0WA 1KY2A 3EFEA 3PC4A 4QEZA 3IUBA 1P6XA 2O1EA 1X15A 1KAOA 5DYNA 4J2HA 4OP3A 3LM8A 5KX5B 1T3LA 3CB4A 1A4RA 2AC2A 1WJGA 3OMLA 1LF5A 4KIJA 1DQZA 2PYDA 4JYBA 1SD5A 2HRRA 1YB2A 5TR9A 4C0HA 5ELXA 4KYVA 4NULA 4YYZA 4JELA 5HUHA 1ZJWA 3JXEA 4CCYB 2O2JA 3FNQA 1JXMA 1TD1A 3VO9A 4UBLA 3KHTA 3HWSA 3E61A 2WYWA 4REMA 2NIPA 2F48A 2FMUA 4DT1B 3T38A 5AKZA 4MVYA 5JYCA 3PA6A 1MC1A 4H7HA 3T3GA 4DMRA 3TVTA 4ZYTA 2W6OA 4NICA 1Z6TA 3CPJB 3QIAA 1ZONA 3AFHA 3R7NA 1VI6A 2FEXA 3HUTA 4AWAA 5A7GA 1S01A 2GEVA 3NIBA 3IP5A 4N0QA 4UM7A 4RD1A 4BB5A 3HPRA 1KVSA 1HZJA 1R4MB 4WMLA 4GGOA 1VP3A 4AG5A 4OK3A 2QMOA 3F6YA 3N3BC 4AX4A 5JASA 4EVRA 3ME5A 3ZVMA 5E3HA 1BXZA 2I66A 1F4LA 4GI7A 5K0TA 4Y2SA 5K6TA 4URZR 3TGPA 1M54A 1RLOA 1P2VA 1XZMA 4DCGA 4OFWA 1T8YA 2ZPTX 5HIAA 5CM2Z 2GHTA 3ILXA 2A9KA 3GVPA 4ECEA 3QE9Y 5BYAA 1JVNA 7GPBA 2O7QA 4W9MC 2GZ1A 1Z2AA 4MS4A 2P30A 4B3JA 2GJKA 2X0NA 2WFLB 5LQKA 5AKKA 2CJWA 5LOVF 2IE8A 3NJ4A 4JVLA 3H0CA 1JLLA 5JBNA 2LIVA 3LP6A 2CK3D 3MWLA 4IMIB 4DA8A 2GH1A 2BTOA 3AO0B 5JWHA 1TZCA 1ENZA 5KVCA 3EF3A 4E7OA 1M6VA 4JWKA 2XVAA 1LVGA 4FOSA 4JUIA 2FF5A 4HWTA 1JA1A 2DWQA 3WAJA 1XAIA 1ZKMA 5CLLA 1J0EA 3ELYA 1YS4A 4DWVA 2P9TA 3MERA 3UMFA 1AGNA 3ZHUA 1K6EA 3W7BA 3QKIA 2X3YA 3CCBA 2IYLD 2FN7A 1HLGA 3KXKA 3PFBA 3QPAA 1AQYA 4M0CA 1F1JA 4C29A 1PTKA 2A7QA 3WXMA 4J4HA 5KJEA 2OHIA 2WWWA 5BOSB 2ZZNA 1TPYA 2Z30A 2NUAA 1VLVA 3HZRA 3IAAA 2OCXA 5CT5A 3OTOB 1N2SA 1R88A 2ET6A 5F1PA 4GR4A 1ODKA 1GCIA 4FEAA 4C06A 2K6GA 4O59O 1UMDB 1WHSA 2I99A 1COWA 3D4PA 5HK9A 3NBYC 2FDCA 5ALYA 1SCJA 1CRZA 3GD7A 1ZSNA 4B85A 3UK0A 4WN9B 2R7AA 3IO3A 3LFUA 1XMXA 1ZRNA 2IWHA 4ASUD 2J0VA 1ZL2A 3DUWA 3PGA1 3VYSB 2ZI3A 4WNAA 5JLJA 3WIUA 1AXEA 1ESCA 1GTL1 2Q3JA 1HYQA 2X0EA 4D9JA 4RGQA 3C4VA 3BH7A 5GZ1A 3KCQA 2JW5A 5HTKA 3SQOA 1Y89A 3WDSA 4QTYA 4BZXA 3WJ2A 5KYNA 2REOA 3ESRA 3K9CA 2ASEA 2GAFA 3VUFA 5LA6F 2XVYA 4BRUA 1HQDA 5DF1A 4DUYB 2G06A 4D6PA 2FOXA 1GL6A 1QFZA 4P0QB 3MBOA 2NNLD 3CRW1 3DPSA 1IK4A 4D8WA 5I48A 4QQFA 1T1IA 5CPBA 3ZWNA 1UJNA 1IU9A 5ECDA 4E5SA 2WPDD 1J8MF 1NVVQ 2H31A 3Q7RA 5ALSA 3ZD6A 1NULA 2EZ8A 2ZUVA 4TZ6A 5EOVA 5L40A 2OZVA 1VIMA 4YBZA 3SZGA 1IPFA 3RV4A 1N1DA 5JU6A 1E1RD 2BSXA 2R4UA 2RK3A 2VWQA 1JQ5A 1XNHA 1YQTA 5LB4A 1RQXA 2NSHA 3HN7A 4H18A 1P1BA 1V37A 4W63A 3WHKA 3WYGA 4BQIA 4NU0A 5K8IA 2P91A 3CX7A 5FAKA 2VP2A 1K92A 1YJ8A 1NNI1 4WY5A 1H4QA 3H97A 4IPTA 2FB9A 1BQ4A 1PSWA 4X84A 1KQNA 3TSZA 2QVBA 2Q4OA 3RYFB 4BJ1A 2I80A 5GP1A 1MV8A 2AOXA 3STHA 4Y2PA 4XR9A 2C2YA 2MYUA 1RI2A 1XMJA 2IEZA 2AN4A 2IVZA 4GI1A 1QHHA 1Z0ZA 2C84A 1GAEO 3RS9A 4BMXA 1N5DA 3DPIA 4O4HB 4WJKB 5DTRA 3W79A 2HU8A 3UMMA 2BZGA 1NBWB 1VP9A 4C4YA 2JFBA 1ZIDA 3LQYA 3SGLA 3PLAE 4Z9YA 1CZHA 3HG7A 2QRGA 4F3RA 3CZMA 2XZDA 4QUAA 4XPZA 4FHDA 3SMVA 1XVTA 2XUKA 3CUWA 1GM5A 3VR4D 3AUUA 3AF3A 3T4XA 5EZQA 2P9FA 3CF4A 4WKBA 2KI5A 1YHYA 3WSWA 4AF6A 4KIGA 3MGGA 2B2NA 1EFPB 2I3ZA 3NFRA 4K9SA 4C30A 2O20A 4RCVA 3DZIA 5H0IA 4JZYA 4ZOCA 3X1WA 2W4QA 4JKIA 3GDGA 3TSOA 1NASA 3G2OA 3BJIC 3MPOA 3WGOA 2XCSB 3I8OA 3VPFA 1MZPA 3IA2A 3NHRA 2O2IA 1YS6A 4DSNA 3A1UA 2BFCB 4IXNA 2XY4A 5CDHA 4AZVA 3AETA 1IQUA 5BSUA 4WUVA 3MGBA 1IE3A 5F35A 3UT0A 1F9AA 2FJPA 5CB6A 1WUJS 1J0CA 4DV5B 4Y9DA 4PV7A 5IW8A 2HEIA 4R1TA 2FQ1A 3NC4A 2V5VA 3TL3A 4K6MA 9MHTA 4YROA 4BX3A 2GUWA 3WADA 4D9IA 5ARBA 3EGWA 4Q4HA 5TRTA 3MWKA 5EIOA 3N75A 1VJTA 1TVKB 3LXRA 4RJTA 3NIWA 4F45A 3TIVA 5J9FA 5ERGB 5C8YA 1ZZEA 1QF7A 4JCOA 2JH3A 3LXXA 3H5NA 3I30X 2N1MA 3B9RA 2XNJA 4YIKA 1DX4A 2F8SA 1AKYA 2JFVA 2CB0A 2OHXA 1ND6A 2Q46A 1RAHA 2QR5A 4IVPA 4JSYA 2JLYA 1FFEA 2HNKA 3CIFA 3EGCA 3FROA 3QYAA 1NSYA 4EMBA 2Q2OA 1FRZA 3HB1A 3KWLA 4GF5A 4BO7A 1GU7A 1UPTA 4X6UA 5HEKA 5CCXA 4U02A 2H2WA 1P7CA 4OL0A 4CIAA 2GKSA 4MR7A 2ZSIA 4GZ3A 3LT5A 1Z88A 2BV3A 2ICAA 3IA7A 1XALA 3DV0B 1YRWA 4JX8A 4B83A 4K9KA 3FMFA 3RLFA 3KEFA 4F04A 2H4JA 3MJ4A 1JPJA 4US2R 4IJVA 5EJAA 1FRQA 1UPBA 3DKVA 3GPBA 4WW0A 2H18A 3PFFA 2HSZA 1U6JA 3WY9A 3L1KA 2DHEA 4H27A 1JR2A 4AO6A 2VK4A 2BSQA 1KDVA 4WA7A 3FMPB 5KVVA 1FTYA 5I5GA 3W05A 2XOXA 3ACBA 3QMWA 1MQ8B 2XUOA 3FNFA 3OPQA 3ROEA 3A25A 5CW2A 1V6AA 1K8RA 3VC3A 3OQJA 4BLRA 3I01A 3KB8A 3KAKA 2VK2A 4S1WA 5BUSA 2YMMA 4OLAA 2RARA 3DDWA 3OPYI 5LU9A 2IPMA 1TF5A 2D62A 2AE1A 2ID4A 4XYBA 5COAA 3FH0A 2X40A 1AZWA 2R6GA 3BWBA 4C4AA 1P9LA 4RVDA 2NYVA 2E4VA 4XEUA 1C1XB 2NWQA 3BIWA 2ZI6A 5BV0A 4IOJA 3R9XB 1YOVA 3ADPA 3IEKA 4AVYA 3M4YA 4FC7A 2W0SA 3UPDA 1RI1A 2J3IA 1I3MA 1X8JA 1OSNA 1Y4SA 3FCYA 4R01A 5FOVA 4F3CA 4XWOA 4CMGA 1GNVA 3LV8A 3RVJA 3QX9A 1RC0A 1G41A 3WRXA 2O07A 1EX6A 5EZYF 1QUEA 1LPMA 3SR4A 1KH2A 1JH9A 5H3CA 4FMCB 3DNFA 4N7BA 1P8JA 2YFKA 3DAPA 3FCOA 4W9RA 4YMVA 1KMIY 1OZ0A 2QM7A 1P2TA 2VPPA 4K9PA 3OAAD 4L0DA 3H3JA 3VSDA 2PYIA 4RIFA 2JGMA 5ALOA 4CIXA 3QEBZ 5JXHA 3QVXA 1Z75A 1QK5A 3CUTA 4X90A 2HW8A 3B6IA 1DEAA 1ZMTA 3N7AA 1XRRA 1MAAA 4NBLA 4FOOA 5A2GA 5KCZA 1ZK0A 2AW5A 2DC1A 3C6KA 4LJ8A 4N0EA 2QMEA 1PT6A 4PANA 5GONA 1SO8A 1YVEI 4B7CA 2A9PA 1XJCA 5ITZB 3OD1A 3QG5A 2ZT6A 1Y6FA 2FTKE 3NAQA 1SBYA 4FS8A 5IAGA 2ZIZA 3RVLA 3NS7A 4KN9S 3RRFA 4M9RA 4RLSA 2IFTA 4HOYA 2Y66A 4LHYA 3IEIA 1MDFA 3IP7A 1ACMA 2P3OA 3EXHA 1Y1SA 5BT9A 4ZC8A 3LLCA 4UARA 3RIYA 4A91A 2WTEA 4EPRA 4R0VA 1CZUA 1QMPA 1US8B 1KJWA 3SEAA 4AROA 3NHBA 1NRWA 2I3AA 1WLSA 4IVRA 3LTNC 2WE7A 4DGQA 1WDWB 3ODPA 2RH4A 5DBOA 5HK8A 3VU3A 3HSYA 1W7AA 3RRZA 1ZAYA 5FWDA 1AE1A 3EJWA 4I2VA 5EHNA 1K66A 1SXIA 3E8XA 3KB2A 2IYSA 1Z4OA 2NSYA 4GMGA 4I5GA 1ST2A 3ZGZA 4LAFA 3T3EA 1Z18A 4TWAA 1F0KA 3W5HA 2RAFA 4RTKA 4B3SB 2OM2A 3ZOZA 2DKOA 4Z4FA 5AHRA 3NUZA 4AYWA 2O0MA 4ND4A 2OLKA 1Q1ZA 1DT5A 2QU7A 4FYWA 5KOHA 3HB5X 3VH4A 3EZ7A 4QOHA 5JCOC 4N9WA 2R6R1 2H2HA 1NYLA 3H5WA 1T9KA 1ZGBA 4DCUA 5HE9A 1OX4B 2NX2A 2P1ZA 2P9CA 1CP2A 3U4IA 1LPAB 3BMXA 4EUKA 3DWGA 3K09A 3OUTA 2ZYRA 4YI5A 3KOXA 2CVHA 1F5SA 3DLPX 2D2VA 3OZIA 3WK7A 2L19A 4C04A 5DHFA 2YR0A 4L8VA 1C0KA 4FGWA 4B2YA 4BZWA 2R8EA 3AF5A 4OQQA 3SLKA 1CTQA 1S5PA 2UUOA 2AC4A 4PZDA 2I6FA 4TMTA 1OVGA 2O0LA 3EVCA 4MS3A 3TZQA 1VZ2A 3MSCA 1DC3A 1Q3KA 2WWGA 1PWZA 1JG3A 3H2HA 1H2FA 3EE6A 3R5SA 5DOVA 5CBPA 3D54D 5MN4A 1OWOA 1K89A 5TJ9A 1KJIA 1AS0A 1KDZA 3E35A 3H5IA 4EYOA 1TL7C 3LE8A 2XDQA 2OO5A 3MEQA 1P4RA 1U8UA 5E6RB 1PS9A 5JNTA 3SQNA 3N2IA 3FHJA 2N0SA 1ETHA 1BC5A 4ME6A 4XJXA 5KTRA 4IQ8A 3PK0A 1OPXA 3BD6A 2BT4A 1E2MA 3MINB 4NVRA 3FF4A 4B0OA 1N8TA 2IGBA 1Q3TA 1VLZA 1DAPA 3OY2A 2W6ZA 1QV9A 5ECGC 1RPJA 3DMDA 1X2BA 5IC5A 5BSEA 3WNDA 5LZ9A 2J7KA 4OHXA 4ENVA 3N2ZB 1P7YA 2KSQA 4PTLA 1QUFA 4MPRA 5EESA 5CB4F 1VQ1A 1GR0A 3FYHA 1KP2A 1QHYA 1E2NA 3BWCA 1NKVA 3R5HA 1DAIA 2VJMB 2XCLA 3IP9A 4DRZA 4RH3A 2HK8A 2DJIA 2QRNA 5I8PA 2ONKA 5HQ3B 4XD7D 1B15A 1P5ZB 5F3RA 3ZE7A 5LPNA 2CE7A 2O0KA 2FPOA 2Q6VA 1KEWA 1RRFA 2CNKA 4FCCA 3A1VA 2V4MA 4OQZA 3TRFA 1AKWA 3BK7A 4P3PA 4HMQA 1JX6A 3MFYA 2B82A 3TL6A 3DF9A 4WLVA 1EG2A 1OGYA 3K4PA 4OSPA 5I47A 1N34B 2O19A 1U5BA 2OBYA 5DM2A 2E4AA 4E6PA 3N2NA 3SSNA 3V7NA 3UAVA 2P5SA 2YUIA 2YXLA 1X87A 3K4QA 4FJ1A 2NXEA 2OBNA 1XZ8A 2VHTA 4QYSA 3A1WA 3MK31 2PGNA 5H81A 2VC2B 1NT2A 1DTEA 4QATA 4D9GA 1YRBA 1ZJZA 2DWUA 4DUGD 5HP4A 3I5XA 4WA8A 1YZLA 4J16C 4LYJA 1PRYA 1C8LA 2IU6A 5HSGA 2PX5A 3K8YA 4HDNA 4P35A 4YK7A 4BVHA 2H00A 4F06A 3PJGA 1UPAA 4RQTA 1ZBQA 5JSKA 3MMPA 4OQPA 3ZQUA 4LBZA 5HQJA 1E6LA 2OG2A 3OEED 2I3GA 4FWTA 3UJ7A 3A9TA 3QBTA 1BWRA 4I5DA 1E6MA 1TKCA 4BLUA 1BDMA 1U94A 3KYBA 4Q93A 1FDVA 3B53X 3TBKA 1BRTA 1Z3IX 1JDVA 3BD9A 5AI5A 4ZU6X 2R6DA 1DDGA 1KMHA 4KVGA 1UDCA 2GBLC 3UANA 1N5IA 3PP8A 1NJ1A 2B98A 4MICA 3NRCA 4M0KA 1A2BA 1ISFA 1ULAA 2CBGA 1IYZA 4J0GA 4FEYA 2CVPA 2OGUA 2I54A 1YB5A 3RROA 3SU8A 2IYAA 4IO0A 3THSA 4F11A 5IJWA 4D3SA 2O50A 3RIMA 4CL0A 4E32A 1O9HA 4PN3A 2I7VA 2HCJB 4PRKA 5TEWA 1EVKA 1U1EA 2ZJFA 3L4EA 4O4IB 5E2IA 1JQJC 2FHSA 1BXRA 1NF9A 3KQYA 2XKJE 4RK6A 1Z2DA 2VRCD 3E9MA 4ONEA 5DCLA 3SNHA 3VHLB 4ARUA 1OI2A 1NVWQ 3V80A 1EPUA 1XKLA 4AN1A 6REQA 3DB1A 1QFSA 1BMTA 1YDWA 2HK7A 3M34A 3UXMA 3W4IA 3TPFA 1PDOA 4E12A 5IJ0B 2XCRB 3HV0A 1P3Y1 2I55A 1GPJA 2ONCA 4PNHA 3BHIA 1I9CA 1NMSA 2B8TA 2BD0A 1Z0FA 2CC2A 3TKLA 1ZN9A 3F7OA 3Q15C 4I1OA 2O1WA 4UVDA 4Y6GB 2PT9A 3QTLA 2B9EA 2BKAA 2VJBA 3FZGA 4QDJA 4R1PA 3HGMA 1WB9A 1DUSA 1KFBB 2D1TA 4MZXA 1XA3A 2QLBA 3EYAA 3ZGOA 4D9MA 2CF5A 1XTRA 2DBQA 4F9FA 3QLUC 3BMOA 2WHEA 2ZIFA 2DY1A 5AJTA 2HYIC 5AHOA 3BXXA 2ZKIA 4OYRA 1K1EA 4LY9A 1DBVO 2CMFA 5BRAA 1U63A 1LPSA 4UFPA 5C3MA 3Q9UA 1SKMA 3PUWA 1KVQA 1OKKA 3AHGA 5FI0B 3WMRA 3KAJA 2DPGA 121PA 4JVOA 1YR6A 3V4OA 1JFVA 3AR8A 2FPGA 4MROA 1W59A 2W4MA 4NZMA 1KQFA 4QVIA 3C3DA 4OK6A 1N7JA 3AEZA 1CULC 3AUXA 3UGJA 1GGFA 5HCNA 1PWEA 3G6KA 4XUCA 1ECPA 5B30A 1LBHA 3R7WA 3AKZA 1WXWA 3A8TA 4GXTA 5JJBA 4IBOA 4GP7A 1X19A 4I4TA 4QVGA 3MHTA 3IBFA 2JGJA 1RM3A 2BW0A 2EBUA 3BS4A 4JV5B 1RRKA 1OY1A 1YR9A 3WL4A 5KYVA 4ZK2A 1V5GA 2AJLI 2E4UA 3LSTA 4AJNA 4AN0A 4CM9D 4KZPA 1H94A 4CCWA 5T67A 3RAGA 1A76A 2BHTA 3DE5X 3IXQA 2R1VA 3BXGA 1J21A 2Q99A 4RD3A 2HOQA 2R86A 3MJTA 3WRYC 3OTWA 3DDUA 4C5CA 3F74A 1JIQA 5GZ3A 3L7CA 4A7PA 1O6FA 1J2TA 2VDVE 3KTAA 5AUOB 4DBLC 2XZOA 2F1JA 3WRYA 1EGMB 1B6SA 1OFUA 3IAXA 4DBZA 1SM4A 1UZUA 4KH0A 5I9MA 5HDQA 5ADVA 5I7VA 2RCNA 4N54A 3TMAA 4Z1MD 3LMKA 2E1PA 1PR5A 1FNDA 1VC2A 1VSTA 3WWPA 1P0MA 2ADOA 2ZROA 2PH5A 3IO5A 4X1IA 3IR6A 4A0RA 4BVLA 2GZDA 3THXA 2RHBA 2WZBA 2PSSA 3NTQA 1RYZA 3IEPA 3L40A 5DJ5A 3E2MA 3PEUA 4INOA 3DQZA 3U2QA 2AEJA 4RH1A 1ZUD1 4HAOA 5BORA 2P68A 2G71A 1KE1A 4TT3A 1Y6JA 3RFCA 3KFVA 2QK4A 1V47A 2WP8J 4R7TA 3BXPA 4Y2TA 4F8JA 2WICA 4L7QA 1LZLA 5F51A 3I32A 2JGAA 2WJGA 1RXCA 3BYZA 2JZCA 4K9DA 2J6BA 1DKNA 3MMXA 4RAOA 4IRMA 3VAZA 3FNGA 1B6RA 1XFDA 2C82A 3KSRA 1PAUA 2XCIA 5IDWA 3ZDZB 1R0CA 2P41A 1Y3CE 5CLHA 1U2GC 2CLHB 3T3PB 2VYVA 4GFDA 4F4JA 2PR7A 1DBRA 4L9AA 1L7DA 3KIPA 4TV9A 1Y3BE 4HAUA 1Z4QA 3OC0A 1IZZA 1H42A 3QVOA 4PLPA 3R0ZA 4NEGA 2OQ2A 1TM2A 3UH1A 2YJZA 4LYDA 3TZBA 2ZB3A 4B44A 1Z7BA 2XWQA 1T3ZA 3MWEB 4JY7A 3QEAZ 1GNTA 4G65A 3BDAA 5BN4B 4DRYA 4ER0A 2XXJA 3ERCA 2AN5A 3F7NA 4G67A 1FUUA 3ABRB 2CHQA 2ODPA 2VL7A 1FYXA 3I9V6 1RJGA 3U13A 4ESVA 1LSJA 3MS2A 5CX1A 4AKHA 1Z2OX 1WD7A 2GEDA 4XYEA 2I4RA 1XD8A 3UMGA 1PVDA 3I6ZA 3MNFA 4Q4LA 1G4HA 1JAYA 1JA0A 2AQIA 4RKFA 5F1YA 1H2XA 2VXOA 4MWOA 4WKPA 1R4ZA 1ZICA 3ROQA 4B9EA 4EHAA 4EJSA 2BVNA 1M8KA 2AMJA 2FEWB 5DHTA 3JQGB 4MVWA 2QR2A 2G9NA 1W4CA 1LI7A 1GRNA 3IELA 2BFEA 3VZCA 3M82A 4BNZA 1MLDA 4HPXB 4R1NA 5D8DA 4EHBA 3ULKA 2WZDA 1JLKA 1MRSA 4QJBA 3C4JA 1GZVA 3BJEA 3OSUA 4J91A 3GGSA 5A3VA 2GXAA 5EMHA 1MO3A 3V2GA 2D1YA 4WWHA 2WJWA 1ZXXA 3CF4G 2GBCA 4TZTA 4XB6B 2WVJA 2A94A 5ALUA 4CF6A 2M2IA 1ELOA 1XUOA 4LW8A 2QM3A 3DKPA 3DZKA 3RBZA 3EOBI 3WI7A 4HDKA 1IVYA 4FDMA 4MR8B 3AEUB 4PZ9A 5I3ZA 2MU1A 3O3MB 3IQHX 5TS3A 1OASA 2X14A 3GRYA 2PS3A 5FBHA 3R3ZA 3RC9A 4XW2A 3TR6A 5K0CA 2OQRA 3LUPA 4AY6A 3DVSX 4DE5A 3JPYA 2AHRA 3NEPX 3P9KA 5GINE 2FLWA 4YRCA 2AK2A 4MV7A 1Z6PA 1HT2E 3ZDQA 5LJIA 2EX4A 4AO7A 3D9QX 3S2EA 4IS2A 4Q0MA 5H4GA 5JD5A 3EGDB 5G40A 4C4RA 3EFBA 3ROXA 1EZZA 1H4TA 3K6SB 5LDGA 1CR0A 2Q3LA 1Y48E 1FMTA 2NVOA 3ANNA 2IY7A 4J0JA 4EUSA 1V25A 3ZIUA 1S3FA 4OHBA 5I7SA 2ZI9A 1JHOA 1R0LA 1M5RA 2K2QB 3QFHA 1UBSB 1YCGA 4NBRA 4U7WA 4KOEC 5KQPA 5G1OA 5DFAA 3EEIA 5EJMA 2UVQA 5KB3A 2NO9A 5L51A 1RRGA 3D8TA 1EXWA 1Y9DA 3VYUB 5AVWA 2CVZA 1JFRA 2O2HA 2QVCA 3K15A 3TOXA 1C9KA 2A5FA 4YB8A 5T6BA 1SCAA 4PFKA 1QQBA 4TXHA 3DYBA 1ZVMA 2FMKA 1T10A 3I05A 4Z9FA 3RS4A 1A96A 3RUFA 2IXBA 3OE1A 1CZOA 3ONDA 2R4QA 4R8LA 3A6KA 4S3MA 4PAMA 2VQEB 1NBIA 2GRJA 2WINI 1EB9A 4HEJA 1GTRA 2ZI7A 1YR2A 1LNQA 2GZSA 3NP9A 3S7TA 2JAHA 3TCXB 2FFHA 5JO0A 2AR0A 1RWKA 1KAEA 3ICPA 2C1XA 1T8UA 1E18A 4LBVA 3NEYA 1PW5A 1G20E 2O5EA 3AKEA 1L7OA 2ACKA 2UVDA 1GT91 1HO3A 2BJHA 1XD2A 1YU6A 2AWOA 2VP0A 3QTBA 4M9ZA 2E55A 4MGZR 2D4AA 2JJQA 1CUEA 1T36A 1N2EA 1FDSA 1SUAA 2WSSD 1UZMA 3HUEA 2OSBA 2A14A 2P11A 4GBMA 4OAPA 4YDHB 2K87A 4FKZA 1PJAA 1L4EA 2Q5CA 2Q1UA 1D8AA 1T0JB 3AF4A 1GCGA 3JALB 3K6KA 3KM0A 3HYLA 3QFTA 4BKUA 4BO2A 2BHRA 1C0EA 1YGPA 3L8EA 4LMPA 3FUVA 3STTA 2DFDA 1XRLA 1BROA 4ZICA 1HR0B 4D8VA 4DIMA 1J4AA 4WZ6A 5A71A 3I34X 3FTEA 3JQ8B 1JILA 1VHJA 3P0EA 4I4IA 4UZSA 4KU4A 4LTMA 3I6BA 4IJMA 5LL6P 1Y80A 2C2MA 3PUJA 5KMGA 3OQNA 3ICEA 3WL5A 2J0QA 1BH6A 3HJRA 1NBEA 4FE7A 1WQ4A 3P97A 3F6SA 2ZJ1A 4R51A 5CGQB 5E9WA 2HU7A 2PD4A 4MUBA 3VSAA 1GRCA 3WNQA 4C6HA 1Z4NA 2ZYGA 5CT6A 3ROZA 1A4UA 3RAJA 4CEJB 3NC0C 5NLLA 2C9ZA 1QGDA 3OCXA 4Y0AA 5HS6A 1IB6A 2CUZA 4CT4B 2H1CA 2JHGA 2POCA 4MA4A 1EVZA 3QEJA 4AP5A 4DLXA 1C29B 5CTJA 5HF6A 2Q0SA 1J5EB 4CF4A 4NJMA 2VDKB 4OJQA 3ZC3A 1LNSA 3AVXA 4MGIR 1EFVA 3SY8A 2H0QA 4B43A 3NM5A 1RYMA 2CXSA 3ET4A 2VAMA 3FPKA 4H6WA 1QXSA 4IOKA 3T7IA 1PJ3A 2O9JA 2PMBA 3ABIA 3C3KA 2IIQA 1Q17A 3IQXA 4KDRA 3QVTA 4XQCA 4CMIA 3GJ8A 2X9GA 2ZM6B 2R9VA 4ENRA 1LLCA 2JDID 4ESHA 1OTHA 4KE8A 3OI7A 3Q41A 2HA0A 1IWPB 1DO8A 1YZTA 3GQBB 2UXBB 1KRWA 1CJMA 3MJFA 3KXIA 1T3HA 3V2HA 1Y0BA 2A57A 1J25A 1YAJA 2YW2A 2A0XA 1P2UA 1TVCA 2AFHE 3EGEA 2C5BA 3K20A 4MLPA 4BMSA 3OEHD 4PC7A 4CCAA 4F71A 2VZLA 1U6IA 4AS1A 4K9MA 1BMFD 5LOVB 2IYZA 5EJ7A