5FCRA

Mouse complement factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
230
structure length
230
Chain Sequence
ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor D
publication title Small-molecule factor D inhibitors targeting the alternative complement pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 58
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.46: Complement factor D.
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fcrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fcrA01
1FLEE 3UTUH 1IQJA 1TABE 3A7XA 2XBVA 4AYVB 4DW2U 2CF9H 4YM9A 1AFQC 2IN2A 4FUBA 1P05A 3TPIZ 1T32A 1TPPA 1TNGA 4ISOA 1TRNA 1GJAB 1GJBB 2BDHA 1UTMA 5DGJA 2BVRH 1DXPA 2FPZA 4SGBE 1BRCE 3BG8A 2V0BA 4X2XA 1ZGVA 4BXSA 1VJAU 2Z9GA 1QURH 1C2MA 3BN9A 3M3SA 3F9FA 1HJ8A 4BANB 1RTFB 2CXVA 2NU3E 4H4FA 1EPTB 5DG6A 1GBDA 4GHQA 1OYTH 4FVBA 1QB9A 1CBWC 1O2VA 2VWMA 5E2OA 1GBHA 3VGCC 5JYIA 1GDNA 2BOHB 1OXGA 2XC0A 1GDQA 4R0IA 1H9IE 1C5WB 2CF8H 2PHBA 2ZHDA 3D65E 3M5LA 1INCA 1BTYA 4YOJA 4U2WA 1TNHA 4CRBA 3TH2H 4NA8A 4ZKSU 1LVMA 4ABAA 4MPWA 3V0XA 4ASHA 1O3FA 1UK3A 4RKJB 1HNEE 1QA0A 1ZJDA 2O8LA 1K1NA 3HGNA 2BQ6B 1AI8H 1ACBE 1NU7B 1J14A 2FOGA 1GI6A 2VIQA 1K2I1 4JZFH 1P04A 1LO6A 1WQVH 2JH5D 3E3TA 3FP6E 1EPTC 3ELAH 1RD3B 1FMGA 1BUIA 1C5NH 2GTBA 1OWDA 3ZVFA 1UTPA 3GCNA 4K1EA 2ZHEH 5DP8A 4CR5A 3VB4A 1GJ5H 1PPHE 1Y3UA 1GBCA 1QTFA 4CBNA 1DY8A 2QAAA 3SQHE 3A8DA 2XXLA 1JRSA 1BCUH 2ZU2A 3MHWU 4H6SB 3UOUA 1W13U 1C2LA 5EOKA 1C9PA 1F0RA 2QC2A 1O2GH 3SUEA 2BD2A 2BTCE 2Y82A 4OS4A 3PLBA 1GI9B 1GMCG 1HAVB 3S9AA 1YPJH 4GPGA 2G81E 1UTOA 2BM2A 1NFXA 3V12A 3RU4D 1EPTA 1KXFA 1ZPBA 3QO6A 4Y6DA 1UTLM 4UFFH 3U98H 4DOQA 2Q6FA 4WMEA 2P93A 1GI4A 2AS9A 1JWTA 1JRTA 1ANCA 4ZXXH 4LXBH 1C2GA 1DM4B 2A32A 2PW8H 5FCRA 2BX4A 1NRNH 1ETSH 2AGGX 2XWBI 1NESE 1OWHA 1N8OB 1QB6A 4D7FA 1C1UH 2ZDNA 1B7XB 3QN7A 1TRMA 2G51A 5DPAA 4WJG2 3GDVA 4AG1A 3URDA 2BD5A 3SJ8A 2FESH 1JOUB 1O3IA 3H5CB 3RXIA 1QFKH 2BHGA 1HRTH 4Z0KA 2VIDA 1K1JA 2F9PA 1A2CH 3M5MA 1VCQA 2Y5FA 2TBSA 2Y6TA 2R3UA 1TALA 2ZFTA 4DJZB 3BF6H 2PSYA 3EGKH 4F4OC 2ZFQH 5ESTE 4WXIA 3NPSA 3VEQB 3P92A 1NRSH 3ZYEA 4AGJA 3TH4H 1DLKB 5F6MA 1OOKB 1KTSB 4WY3A 3HK3B 1EJAA 1HJAB 3MH6A 2UUJB 3TVJB 1J9CH 4D9RA 2TGDA 3T2NA 2ZGHA 2ZPSA 1O2TA 4OS7A 4DVAU 1BTWA 2ZWLH 3U1IB 1A0JA 2OC0A 2QXJA 1N8OC 3BTEE 1S6FA 4IBLH 1EXFA 1P9SA 1VGCB 3I78A 1ELCA 1NPMA 3SU2A 2A4GA 2OC7A 3PMBB 1IQIA 1O2LA 2ZKSA 1DE7H 3RXBA 1AIXH 1H1BA 1L4ZA 5DP4A 4OGXA 4X1NU 2BY5X 3BSQA 3TNSA 2ZDAH 4JK6A 4ZHLU 5HGGA 2BVXH 1IAUA 4KTCA 2WV5A 1HAVA 4Y71A 3M3VA 4AN7A 1QGFA 3PTBA 4JCNA 1BIOA 1NT1A 1WTHD 2AFQB 4FUIA 1O3OA 3SW2B 3FFGA 2J38A 2ZHFH 6CHAB 2C8ZB 1CGIE 5GDSH 3F68H 2AH4X 1C5VA 3MH5A 2VIWA 1DDJA 3GICB 3M61U 1V2TT 1MCVA 1KLJH 1XX9A 2FDAA 4X2YA 3GCTF 1QQ4A 2TGPZ 1PPGE 1ELFA 1IQHA 3T5FH 4Z6AH 2FODA 3M5OA 1VGCC 1FDPA 1O2JA 4ZHAA 2AERH 2PWXA 2JKHA 4IN1A 2BD7A 4ZH8A 1DUAA 4ABFA 1O2PA 3T25A 2ZGBH 1BTPA 2PFEA 1XUGA 1ETRH 1N1LA 3BTWE 2BZAA 1YPMH 2PUQH 4KTSA 1G2MA 1EP5A 5DP7A 1P10A 1WBGB 1DXWA 3EA8A 3S69A 4TWYA 2ODQA 1D3QB 3TGIE 1SR5C 2VWOA 6CHAC 3SUFA 2ZO3H 4BTIB 5LPFA 1O3KA 1KSNA 1OWIA 1YYY1 4O9VA 5ESBA 2EI6A 2A2XH 3UFAA 3IWMA 2OBOA 2I6QA 1C5RA 3A7ZA 1VZQH 1SPJA 3B9FH 2CMYA 5L6NH 4I7YH 1TX7A 3VB7A 3FZZA 1P2MA 2F9VA 7GCHF 2A7CA 1YPKH 4BAQB 1EB1H 2THFB 1QQUA 3KN2A 1V2KT 2FMJA 1K1OA 2WPMS 3MO9A 1W11U 4XOJA 3MNSA 1GJCB 3L33A 3ZZ7A 4UFEH 1CU1A 2FXRA 3Q00A 1C5TA 1CGJE 1C5LH 2SNVA 1QBNA 3L6PA 1AB9B 4MPUA 2FTMA 1DWEH 3NK8A 1K9OE 4UDWH 3T62A 1OYQA 1C1SA 1SC8U 1TPAE 1TWXB 2GDDA 7KMEH 1UHBB 1Z71A 4FUHA 2VVCA 5CE1A 4HZHA 4Y79A 1O5CB 1YC0A 3GY2A 3LGWA 1OX1A 3BTGE 1SGRE 1XUHA 3SO3A 1A5GH 1RGQA 3BTQE 1V2PT 3K65B 1O3MA 5GJ4B 3A7TA 2W7SA 1O3BA 1W8BH 1FIWA 5FX5A 4NCYA 2VWNA 3EDXB 4H6TA 5HMAA 4JZIA 4NA9H 1YCPK 3KEEA 4TYDA 2ZFRH 4BOHA 1ANDA 3UQOA 1YBWA 2C93B 1TX8A 3F9GA 3LPRA 1V2ST 4ABGA 3A89A 3RXSA 2FX4A 4IC6A 3PROA 2A0QB 2ZF0H 3S9BA 1FY5A 1AB9C 1MAXA 1EAIA 1P2IA 1IQMA 3RMNH 1GG6B 1V3XA 1GJ4H 3GDUA 3PMJA 4X8UH 1LTOA 1KY9A 3SBKA 1YLCA 1AE5A 3AAUA 1FAKH 2R0LA 2Z3CA 1O5BB 3OTJE 2PTNA 2UWPA 1HJ9A 2HALA 4X1QU 1S81A 4H42U 4DY7B 2LNCA 3PMHB 3NWUA 1LHGH 2ZFPH 1V2JT 1O5AB 2HGTH 3GY5A 4IS5A 5LGOA 1O2OA 3V13A 1GL0E 5I46H 1EX3A 3RXTA 3R3GB 1HAOH 4XDEA 4FU8A 4ISNA 3BEUA 3UQVA 1DWDH 1A7SA 1DLEA 1EAUA 1P03A 1S5SA 2P16A 1JIMA 4XE4A 4AFSA 1O2XA 2A45B 1Q3XA 1V2QT 2Z3DA 1EZSC 3MU0A 1FY4A 2H6MA 1E37B 1SLUB 4GLYA 1E34B 1SI5H 1N6XA 1FY8E 3P8FA 1GG6C 5T6GA 3A7YA 3T29A 1GBTA 2J95A 5ETXA 1ESBA 2OINA 1W12U 2WPHS 3KQBA 1UJ1A 1FNIA 1W7GH 2HNTC 2Y5GA 3MU1A 1SQTA 3P8OA 3VB6A 2O8UA 3UR6A 3ZVDA 1XUKA 2PTCE 1SVPA 2V3OH 1MUEB 1WOFA 1S85A 2AGEX 5LPRA 2P8OB 3MFJA 3MO6A 2BQ7B 5DP6A 3ZV8A 2ZIQH 5A0CA 3V7TA 3BV9B 3ATWA 3RXRA 1GI3A 1HAIH 3A8BA 3SQEE 8GCHG 4DGJA 3NZIA 3K2UA 2QXIA 1O3HA 2Z94A 1ID5H 3NXPA 1HAHH 1UO6A 5BPEA 2A7JA 4E7NA 1C2JA 6GCHG 5CHAB 1C4V2 1RJXB 2ZPRA 3A87A 4XBBA 4MTBA 5A8ZA 2XBYA 3RU4E 1P2OA 3E16B 2PKAB 1ZJKA 2FI3E 1UVSH 1GBIA 1EASA 3URCA 1O3LA 4AFZA 1V2MT 1ZHRA 2FOAA 5GXPA 4KKDA 3RXVA 3PLPA 1BITA 1L1JA 1QJ6B 3MTYA 4RSPA 4MNYA 2FOMB 2R2WU 4Y8XA 2ZU5A 1O2UA 3QK1A 2K1QA 3EA7A 2PKSB 3ZZ3A 2XTTB 4WXVA 3RXKA 3Q77A 3PMAB 1UVPA 3RXJA 4MPVA 2QV1A 2A4OA 1HLTH 3BTDE 3S7HB 4KGAA 2F83A 4MNVA 1QBVH 1O30A 1YM0A 3LJJA 5C3NA 1HB0B 2P3TB 1W3CA 4I32A 4CRFA 3EA9A 3M7QA 1G3EA 1H9LB 1T4VH 2YOLA 3ODFA 2ZGJA 2BY8X 5FX6A 1PQ7A 3ATKA 3VXFH 3UOPA 2UUFB 3NKKA 3ZZBA 1SQOA 4NFEA 2RA0A 2ODPA 1O3DA 3QLPH 1X7AC 1GBKA 2GV7A 5CHAC 1UMAH 4O97A 4UE7H 3QTOH 1HCGA 2W3KA 4NZQA 1DANH 1THPB 3LH3A 4IGDA 1ZTJA 3Q3XA 1JMOH 5AF9H 2ZA5A 3FANA 3HKIB 2BDBA 3W95A 1T7CA 3T27A 1SMFE 2SGQE 5JBTA 2D26C 2OQUA 1OWEA 3LIWA 1TBQH 1GVZA 1GPZA 2F9BH 2G8TA 1QA7A 1GBMA 2STAE 2FOHA 1L4DA 2Q6DA 1EAWA 3C27B 1SGEE 2F9OA 4IMZA 2B9LA 2ZNKH 3SHAH 3LH1A 2BY6X 1KXBA 5TJXA 3AW1A 1O2SA 4WWYA 1J17T 1C1VH 1VJ9U 4CH2B 4I8LA 1NC6A 4MDSA 4B2AA 1HAXB 1BMLA 4RN6A 1GMDG 2Z9KA 1F2SE 1TE0A 3S0NA 3QUMP 2VB0A 3SGQE 2VIVA 3IG6B 2AMDA 2DE8A 4I33A 2R0KA 3M37A 1T4UH 2PKAA 2BQWB 4YTAA 3F1SB 1EUFA 1QRWA 3FZDA 1XKAC 1YPHC 4DIHH 4K1TA 2YNBA 5FPYA 2BD8A 1P8VC 1O35A 3E8LA 3MH4A 2OC1A 1ETTH 3PYHA 3RXOA 2BD9A 2Z6BD 2ZQ2A 4OS1A 1BA8B 3V3MA 4X0WU 2VVVA 4CRGA 1TGBA 1RIWB 4K2YA 2H9TH 5B6OA 1S84A 1S83A 3ZZ6A 3B23B 4A1XA 1YKTA 4K8BA 2VNTA 3S9CA 3S7KB 4JYVH 1NFWA 1MKWK 2H9HA 4NWKA 2VIOA 3PM3A 2ANMH 1SGFG 2Z9JA 4NIVA 3QDZB 2AMPA 3E90B 3R0FA 4UEHH 4JZDH 2OLGA 1GBJA 3HK6B 1ESTA 7ESTE 1SL3A 1ESAA 2CN0H 1LPKB 4K60A 3HATH 3MNXA 1DVAH 1F0UA 2HWLB 3HPTB 1MZAA 2FI5E 1MQ6A 1O2ZA 1PYTD 4KTUA 1SGIB 3M35A 3TLOA 2VIPA 3KNXA 1C2FA 2C90B 5AHGH 2VINA 4INKA 3GCHB 1HXEH 3KQCA 4AFUA 5C1XA 4ISHH 1QB1A 2Y80A 4Y7AA 1T8MA 5I25A 2VJ1A 1BHXF 1RIWC 2EI7A 4D76A 1Y5UT 1QY6A 4FUFA 3DD2H 1FONA 2OXSA 1LHDH 4K3JA 1SGQE 1LHEH 2F3CE 2GV6A 2FX6A 2J34A 3RXAA 3K6ZA 4X6PA 4DURA 3ENSB 2C8XB 2W3IA 4Y0ZE 1CHOG 4D7GA 4DT7B 2P95A 3RMLH 3GY3A 2SGPE 2PLXA 1K21H 2QGRA 1P01A 1MBQA 2IPHA 2CGAA 2H2ZA 1TIOA 5HM9A 5E0GA 2ZCKP 1B0FA 3UPEA 5JB8S 1K1LA 2QY0B 1WU1A 3TK6A 1EB2A 2XWAA 1H9HE 1GI2A 2GCHF 3T26A 3QTVH 2TRMA 4CRAA 1HGTH 5EW1H 1Y8TA 1BHXB 4YZUA 1NFYA 5A09A 2ZU4A 5JBCS 3QGJA 2GT7A 1EOJA 2FZZA 2ZDLA 1S0RA 4A92A 2XC4A 2ZGXH 1IQLA 3SUGA 5LPEA 3SGBE 1P57B 1K28D 1TNLA 5GIBA 1NRRH 1SGTA 3ZVAA 5K7RA 1V2UT 2AIPA 4X8VH 5C20A 3EAJA 5GPIB 2HNTE 2ILNA 4A1TA 1WQSA 3MOCA 1BJVA 1FAXA 1V2WT 1Z1IA 2BDAA 1AMHA 1Y5BT 3LKWA 1PYTC 4GHTA 4J2YB 1AKSB 3OSYA 1BMNH 1XVOA 3BIUH 2GMTB 3LGYA 4AORA 1C9TA 4GSOA 1TMUH 5K0HA 1LHCH 1TQ7B 1H8DH 3A7WA 3RP2A 2BZ6H 1TOMH 3ZYDA 1WCZA 5J4QA 4WH6A 1C2EA 3A7VA 3D62A 4LK4A 1HXFH 1O3JA 1MD7A 4FU7A 1DS2E 1IQGA 2OC8A 4ZKOU 1HYLA 5FBEA 1FPCH 4AG2A 1WAYB 3QX5H 1GJ6A 1E35B 1OS8A 1K22H 1HJAC 1O36A 5DP3A 4UD9H 1QNJA 1MBMA 1O2HA 3MH7A 1THRH 1AZ8A 4WVPE 5E8EH 6LPRA 2OP9A 4E06H 8GCHF 2ANWA 1B5GH 1TNKA 4ZROA 2UUYA 1L0ZA 3SNAA 2GMTC 3TK9A 2XC5A 1KDQB 5FXLA 3A80A 5DP9A 2OBQA 1O2YA 1Y5AT 6GCHF 2VU8E 1Y59T 3RC5A 3IITA 2KAIB 5AFZH 1JIRA 1TB6H 4AB9A 3KQDA 3SNCA 2BY9X 3RXPA 1AUTC 1IHTH 1JXPA 3LDXH 4K1SA 3VB5A 4YLQH 1ABJH 1OP8A 3BG4B 8KME2 1ZTKA 3P8NA 4RKOB 1RS0A 5PTPA 3RXMA 1J15A 1YGCH 1O3EA 4U01A 4MLFB 2FOEA 4BNRA 1GBFA 1UTJA 3OYPA 1UK4A 1ARBA 1ZRKA 2JH6D 1O34A 1PQ8A 3KL6A 1K1MA 4AOQA 1EZUC 2WPJS 3OU0A 2H9EH 1DX5M 4BAMB 2WV4A 1O2IA 4FXGH 2GKVE 4NIWA 1MKXH 1T8LA 3MMGA 5T6DA 1GHYH 1EP6A 1O5DH 2BY7X 1AKSA 1GHAF 1GBAA 3GY4A 3U8TH 3MNBA 3DFJA 3P70B 2P3FH 2ZTXA 4UONA 1SQAA 2AMQA 3RLYH 1QJ1B 4R8TB 3F6UH 4THNH 1TAWA 4B76A 1GJ7B 1C1NA 5E0JA 4O3TA 1SOTA 4X1SU 1KIGH 2QXHA 1D9IA 1XUFA 1BTZA 1TGNA 3NCLA 3ITIA 5E2PA 3BG4C 4GAWA 3UUZA 3MWIU 2ZI2H 1AWHB 2FYRA 1Y3YA 1G3BA 3SORA 1Q2WA 1TLDA 1LVOA 2XCNA 2BDCA 2ALVA 1UTNA 1EJNA 4O3UA 1XXDA 5FHTA 5A8XA 1YPHE 1GMHF 1F5RA 2ZFSA 4DIIH 1BTXA 2QF0A 3DA9B 1HPGA 1P02A 5EPNA 1P09A 1ZMLA 2A31A 1KDQA 1ZHMA 1E0FD 1L1NA 2EA3A 3G01A 3SJOA 1EOLA 3SU4A 1O3PB 2OUAA 2C3SA 1GMDF 5L30H 3DHKH 1RFNA 2KAIA 1BRAA 5DJ7A 1O3CA 2OCVB 5JBAS 2ALPA 4HI3A 3BTHE 1G30B 2O8WA 2Z9IA 2PGQB 1AGJA 2BLWA 2QA9E 3CENA 1Y3XA 1FV9A 3RMOH 2FP7B 3SI3H 1ZR0A 1YF4A 2XBXA 1JBUH 4FUCA 1V2LT 4WH8A 3SV8A 1TPOA 3UREA 1B0EA 2PSXA 2R9PA 4J1YA 9ESTA 4GVUA 5AFYH 1SHYA 3OX7U 1H4WA 3RXHA 2FLBH 4YLUA 3SNEA 4VGCB 1DWBH 4JYUH 1A3EH 4PROA 3FP8E 3UWIA 1OPHB 2GCHG 1GI5A 1OWJA 2EI8A 2GVFA 3W94A 3UNSA 3LC5A 1V2NT 4BXWA 4X1RU 5JB9S 1YLDA 1G37A 2VGCB 3P17H 3SJKA 2ZDVH 5ABWA 1AVGH 3GCOA 2J4IA 4CRCA 3A8CA 3UWJH 1TNIA 2ULLA 1IQNA 3O8DA 1VITH 3U8RH 1NY22 3M36A 1GVKB 5IDKA 1LHFH 4A6LA 4DCDA 1MTSA 1PQ5A 2GZ9A 3FP7E 1MH0A 5F03A 2WUBA 2A2QH 1GVLA 5SGAE 2OQ5A 1GHVH 4OS5A 3RXUA 2BLQA 3PTNA 1SLXB 1F0SA 4CHAB 2G4TA 1BMMH 2AGIX 1A0LA 1TA6A 1GJ8B 1GJ9B 2P59A 4Y76A 4Y8YA 1UHBA 8ESTE 1C5SA 1TONA 2HRVA 2FS8A 1N6YA 4F49A 3UNQA 1SHHB 1C5ZB 4VGCC 1V6DA 1XXFA 4CBOA 4IMQA 5C67A 4ISIH 1YPLH 3SN8A 1GL1A 2RA3A 1XUJA 5A2MH 2SGEE 2ZPQA 1HAPH 1P06A 3RUOA 2A5KA 1O2WA 1UVOA 1SLVB 5EW2H 1GHWH 2VGCC 4UFGH 1SGNE 1CHOF 4ZXYH 1J16A 3MO3A 2G55A 2SFAA 5HXFA 3L3TA 2ZU3A 1LDTT 1A0HB 1MD8A 3BIVH 1TGCA 4WMDA 4B2CA 1OWKA 3A88A 1WSSH 1UCYE 4IN2A 4BAHB 5JBBS 1KXCA 3O8CA 3T28A 2QN5T 2ANYA 1P3EA 3SV7A 3TJVA 4INLA 4XFQA 3VB3A 4JMYA 2EEKA 1GGDB 2PV9B 2ZC9H 5A0AE 2GP9B 4Y0YE 1J8AA 1Y3VA 5F8XA 1BOQA 3UR9A 4X6NA 3JZ1B 1E38B 1P9UA 4NA7A 2WINI 2A1DB 1GWAA 1TX6A 4UFDH 1ELVA 2HVXA 2B8OH 5DP5A 2G5NA 2BDGA 4JZ1A 1ELEE 1OP0A 1ZSLA 4IC5A 3K9XB 3TJNA 1C5QA 3SU5A 4Y8ZA 1ZPCA 4D8NA 5LH8A 1O2KA 2BX3A 4ABEA 3DT0H 1GI8B 4Q80A 3AAVA 3TK5A 3LJOA 1ANBA 2P8OC 1K1PA 3QZRA 3SU1A 2FO9A 1BTHH 1DFPA 4YESB 4FUJA 1GHBG 1ZZZA 1XKBC 2EC9H 1AFQB 1NRPH 3SV6A 1CT0E 2TGTA 1PPZA 4AYYB 3PO1B 1GHZA 3E1XB 1UCYK 3RM2H 3Q3YA 4WF8A 1UVTH 2F9UA 2STBE 1GHAG 2ZTZA 3KIDU 5EG4A 3RXGA 4ZMAH 1GGDC 4B2BA 2A5IA 6ESTA 4X6OA 1ARCA 1IQEA 2FLRH 4GCHG 1SGFA 3U9AH 1C1WH 5HYOA 3UY9A 5DK1A 3ZVGA 1C2IA 2YNAA 1FN6A 2BLOA 1C5YB 3ZVEA 1OP2A 1GCTB 2D2DA 1A4WH 5DO4H 4YO9A 1GDUA 1TPSA 1GI0A 2BXTH 1UTQA 4X6MA 1FJSA 1KLIH 4BTUB 2FOBA 5C5NA 4ZAEA 1EAXA 5FPTA 1CGHA 1DICA 1K1IA 1FI8A 1CT4E 1E36B 3EQ0H 3I29A 2CJIA 1THSH 4FUEA 2ZHQH 4MNXA 2D1JA 2PKSC 1MTVA 1D6RA 4X8SH 2O8TA 1HAYB 1GMHG 3O8RA 2HLCA 3TGJE 3PO1C 1U6QA 2PR3A 3ATIA 4B1TA 2GDEH 4Q2KA 3E0PB 1Z8JB 2Y5HA 4HGCA 3PWCA 1LQDB 5CMXH 1MU8B 1O5EH 3HGPA 1P0SH 3NUMA 4Q7ZA 1BJUA 1GI7B 1P2NA 1C1RA 3E6PH 5J4SA 2V35A 1GCTC 2VH6A 4A5TS 3H7TA 1BBRE 1MQ5A 1ZYOA 1LVBA 1IQKA 4XBDA 3LGIA 1QRZA 1SFIA 2PGBB 1Z8GA 3CS7A 1NRQH 1WUNH 3BTME 1EQ9A 1DPOA 3AW0A 3A8AA 5EXNA 1SSXA 2SGAA 2G52A 2XBWA 3MNCA 1RRKA 4XBCA 4Y7BA 1G32B 1RTKA 4ZKNU 1O2QA 4ABDA 1SLWB 5EXMA 1CSOE 1NN6A 1ORFA 2BLVA 1UVUH 1GBBA 1D6WA 2BD3A 1CVWH 1YP9A 1O0DH 2Z3EA 1MU6B 2UUKB 1ZHPA 3GYMA 3MYWA 1ZMNA 3ZVBA 2JETB 4TPYA 1F5KU 1IOEA 1QRXA 1QR3E 1ELTA 5FCKA 3TNTA 1NS3A 3BTFE 2SNWA 4CH8B 1ZTLA 3ZV9A 4AB8A 3ZZDA 3ZZ5A 2BXUH 2ANKH 1DWCH 1EATA 1Z6EA 2WPLS 1TA2A 1BBRK 3P6ZB 4Q7YA 1WTGH 2AYWA 4Q7XA 3RXDA 5C1UA 1HUTH 2NU2E 3RC6A 1YPEH 3K6YA 3TGKE 4Y10E 2LPRA 4I31A 2WPIS 3ZVCA 1WYKA 1AVXA 3U8OH 3A84A 3BTKE 2GX4A 4ISLA 1A3BH 1TRYA 2RCEA 1EZQA 1VR1H 3TU7H 4CREA 4NIYA 4M7GA 1ZSJA 2IOTA 3CS0A 1TBRH 2FOFA 1S6HA 5C1YA 2JETC 1O5FH 4LOYH 3ZZCA 1UTKA 1HFDA 1CA0B 1C1TA 2UWOA 1C2DA 1P12E 4OS6A 1QJ7B 3A85A 2W26A 4NWLA 1HBTH 3U69H 2HOBA 1PPFE 1BDAA 4I8JA 1NROH 1BB0B 2B5TB 3DUXH 5EQSA 4B73A 3U1JB 1VITF 1A46H 1FIZA 3A81A 5A8YA 2Y81A 1M9UA 3SU6A 3RDZA 1BQYA 1MZDA 1ZGIA 3GCHC 1QL8A 1ZRBA 3A82A 2GCTB 1KXEA 1CE5A 3MU5A 4I8KA 1C5MD 1A1RA 4SGAE 4FU9A 2QCYA 1DT2A 4O03A 4A7IB 3GISB 4GUXA 4ABJA 4CRDA 1A5HA 3RXCA 2WPKS 3QWCH 1T8OA 2XNIA 1SGPE 3RLWH 1CA0C 1P2QA 1EJMA 3VPKA 2VH0A 1YCPH 5H4IB 1SG8B 4OS2A 1RXPA 1GBEA 1MCTA 2ODYB 1HAGE 2J94A 2M5TA 4TY6A 1AUJA 1ELDE 4NIXA 4AZ2B 1C4Y2 2ZECA 2ZGCA 1Z7KA 3H7OA 5EXLA 5FAHA 1QCPA 4MVNA 1LQEA 3SGAE 1FUJA 3TIUA 3RXQA 3LOXA 4Y11E 5DKMA 1OSSA 1TQ0B 4FUDA 1DSUA 2CV3A 4AFQA 2F9NA 2Y7XA 1LKBA 3PWBA 1S0QA 3Q76A 5FBIA 2SGFE 1Q31A 2OTVA 3UIRA 1HV7A 2GCTC 1PFXC 5EPYA 1XVMA 5L2YH 1FXYA 4NSVA 1XMNB 3STIA 2A7HA 2Y7ZA 3F9HA 4B74A 1V2RT 2QIQA 1L1GA 3SOSA 4ABBA 1AQ7A 2B0FA 4JYTA 1P3CA 1BZXE 1ZPZA 4XSKU 5C5OA 4B71A 1MTNB 1O2NA 4LZ1H 1SBWA 2NWNA 1FY1A 1QL9A 8LPRA 3WY8A 1DSTA 2J92A 5FPSA 1O3GA 1MAYA 4NZLA 1HIAB 1UK2A 2FYQA 2OD3B 3SI4H 3OY5U 3KCGH 1OKXA 4WMFA 1C1OA 2O9QA 1QIXB 1AWFH 1C4U2 3RMMH 1O38A 2Q6GA 3LU9B 4K69A 3M5NA 4KP0A 1EKBB 1QBOA 1DITH 1O2MA 1TYNA 4ZUHA 4I8HA 1V2OT 2O8MA 5GCHF 2H5CA 3TJOA 1NU9A 1SGDE 3KHVA 4YOGA 4ZHMU 1GHBF 4BAKB 2TIOA 4AX9H 2IJOB 1ZOMA 1SFQB 3OY6U 3EYDA 1HAZB 3RU4T 2FM2A 3PB1E 1MTNC 2BDIA 4E7RG 1PPCE 2BMGB 2W5EA 3TH3H 1FN8A 5JDUB 4GCHF 4LZ4B 1AHTH 2C8YB 1LPGB 2XCFA 1YPGH 5EU8A 3M3TA 3M7UA 3QZQA 1Y3WA 1C5UA 5G4BA 1Z1JA 1AO5A 3RXEA 1PPBH 2HPQH 1C5XB 1Z6JH 3MI4A 5A0BA 4JZEH 1S82A 1QHRB 1W7XH 3SZNA 4X8TH 2NU4E 1C2KA 3PLKA 1D4PB 1F0TA 4FVDA 3SJIA 2I6SA 2H5DA 5AVDA 3EE0B 3LT3A 5BRRE 3C1KA 2SGDE 2ZDMA 3P95A 1FZZA 5F8ZA 4ABHA 2QYIA 2TPIZ 1G36A 1WV7H 2G4UA 3SJ9A 5T3HA 3F9EA 1PQAA 1O3NA 2FS9A 2GT8A 5E0HA 4CR9A 1AU8A 3ZZ4A 4HTCH 2H1UA 1TNJA 1O32A 4YT7H 1C5PA 1F5LA 2BB4A 1G9IE 2GZ8A 3ATMA 3RM0H 2XYAA 3SUDA 4JK5A 3A83A 3Q3KA 4X2WA 1D3TB 2D8WA 3BEFB 2ZFFH 1T31A 2WYJA 1HIAA 5F8TA 2Z7FE 1XUIA 3N7OA 1UCYH 2ZHWH 2C8WB 2BYAX 4MQAA 3DFLA 2Q1JA 4K5ZA 4TWWA 3AVZA 2NU0E 1ELBA 4NGAH 1QL7A 1IQFA 1O5GH 1ABIH 2ZTYA 3D23A 2GD4B 2WYGA 2ZCHP 9LPRA 1Z8RA 1BMAA 1KTTB 5EODA 2HNTF 1ZMJA 3GY8A 1AFEH 5C2ZA 3GOVB 3FAOA 1O33A 2ZP0H 1AE8H 4D9QA 1DY9A 1L2EA 2P3UB 1T8NA 2ZEBA 3GY7A 2R2MB 4MG3A 2ZCLP 1VITG 2BVSH 1W14U 2A4QA 5TCAA 3LGVA 3AASA 1SGCA 4B75A 3TJUA 1FQ3A 1O3AA 3SV2H 3KF2A 2ESTE 1GCDA 1C1MA 2FWWA 3QGNB 1GJDB 3RXLA 1ZSKA 4DG4A 4YT6H 2F91A 3RXFA 3ZZAA 2FTLE 1NM6A 2AEIH 2TGAA 3KGPA 1LPZB 5T6FA 1KYNA 2DE9A 1GBLA 1ELAA 4U30A 2ZDKA 5GWZA 1AD8H 1DUEA 1SB1H 3SU0A 1ANEA 1O2RA 1NFUA 7LPRA 1TGTA 1TGSZ 1ZLRA 1O39A 1CHGA 3O8BA 2C4FH 1G2LA 2Z9LA 1XM1A 1NZQH 2AIQA 1FPHH 1NTPA 2G00A 3SU3A 1BTUA 4ESTE 3KQEA 2RDLA 3D49H 4KELA 4TY7A 2WUCA 1KLTA 2VVUA 1SOZA 2XW9A 1W2KH 1GMCF 2W7UA 2GZ7A 1IHSH 3ESTA 3SNDA 3SV9A 3STJA 5L2ZH 1VCWA 1LMWB 3ATLA 1TFXA 3LONA 1C1QA 1GHXH 3ZZ9A 4INHA 3BTTE 1HDTH 4MPXA 3VFEA 4TPIZ 3SNBA 1MKWH 1AN1E 2XRCA 5HM2A 1DOJA 4ABIA 4CHAC 4IW4E 3E0NB 1MKXK 1P2JA 1FY3A 4HFPB 5EQQA 1RTLA 5EQRA 1AY6H 3ZZ8A 4NSYA 4A1VA 4U32A 2A4RA 3VXEH 1W10U 5EGMA 3P8GA 1D3DB 1D3PB 1MMJN 1TBZH 3RC4A 3I77A 4NG9H 4K8YA 3ODDA 2PUXB 4QT8C 1ELGA 3E91A 2QF3A 5JPMH 1MTUA 2ZZUH 2CHAB 3TITA 2FIRH 1BBRH 1YCPM 1SGYE 3GCTG 3LGTA 1TOCB 1G3CA 1H8IH 4ZKRU 1NO9H 2ASUB 3LC3A 4X2VA 1CT2E 2V6NA 1LCYA 2FEQH 4BAOB 2B7DH 1V2VT 1C2HA 1MTWA 3JZ2B 2R3YA 2BD4A 4X1PU 2UWLA 1O31A 3BEIB 1GI1A 4FUGA 1EZXC 1LVYA 1PJPA 3HKJB 5GCHG 4MNWA 1C1PA 1CA8B 3UNRA 1AZZA 1F92A 3GY6A 4BTTB 1LKAA 2VWLA 1KXAA 4OGYA 2FOCA 3FVFB 1BT7A 2ZU1A 1Z8IB 2G5VA 2V3HH 3LGUA 1AVWA 2FI4E 1CQQA 1P11E 1TMBH 2BOKA 3CP7A 3GYLB 1W0YH 5IYTA 1CO7E 4E05H 2A5AA 4YOIA 2J9NA 1KXDA 2BDYA 2ZQ1A 2JH0D 1P2KA 1A61H 2QXGA 4NFFA 2CHAC 3MU8A 1VCPA 2GGVB 2NU1E 1C5OH 3GDSA 1W0ZU 2J2UA 2ZG0H 3A86A 3PV4A 2DUCA 1CBWB 5TCCA 3B8JA 3VGCB 2RG3A 1F7ZA 4AGKA 7GCHG 1BRBE 2HPPH 1PPEE 3SHCH 1A5IA 1BRUP 1TMTH 1G3DA 3M7TA 4I8GA 2P94A 3MU4A 1O37A
chains in the Genus database with same CATH superfamily
1FLEE 3UTUH 1IQJA 1TABE 3A7XA 2XBVA 4AYVB 5F53A 4DW2U 2CF9H 4YM9A 1AFQC 2IN2A 2F4LA 1P05A 4FUBA 1T32A 1TPPA 1TNGA 3TPIZ 4ISOA 1TRNA 1GJAB 3F2GA 5C94A 1GJBB 2BDHA 1UTMA 5DGJA 2BVRH 1DXPA 2FPZA 4SGBE 1BRCE 3BG8A 2V0BA 4X2XA 1ZGVA 2F43B 4RI0A 4BXSA 1VJAU 2Z9GA 2KFWA 1QURH 1C2MA 3PV5A 3BN9A 3M3SA 3F9FA 1HJ8A 4BANB 1RTFB 2CXVA 2NU3E 4H4FA 1EPTB 5DG6A 1GBDA 4GHQA 1OYTH 4FVBA 1QB9A 1CBWC 1O2VA 2VWMA 5E2OA 1GBHA 3VGCC 5JYIA 1GDNA 2BOHB 1OXGA 2XC0A 1GDQA 4R0IA 1H9IE 1C5WB 2CF8H 2PHBA 2ZHDA 3D65E 3M5LA 1INCA 1BTYA 4YOJA 4U2WA 1TNHA 4CRBA 3TH2H 4NA8A 4ZKSU 1LVMA 4ABAA 4MPWA 3V0XA 4ASHA 1O3FA 1UK3A 4RKJB 1HNEE 1QA0A 1ZJDA 3PRBA 2J97A 2O8LA 1K1NA 3HGNA 2BQ6B 1AI8H 1ACBE 1NU7B 1J14A 2FOGA 1GI6A 2VIQA 1K2I1 4JZFH 1P04A 1LO6A 1WQVH 2JH5D 3E3TA 3FP6E 1EPTC 3ELAH 1RD3B 1FMGA 1BUIA 1C5NH 2GTBA 1OWDA 3ZVFA 1UTPA 3GCNA 4K1EA 2ZHEH 5DP8A 4CR5A 3VB4A 1GJ5H 1PPHE 1Y3UA 1GBCA 1QTFA 4CBNA 1DY8A 2QAAA 3SQHE 3GS9A 3A8DA 2XXLA 1JRSA 1BCUH 2ZU2A 4ACBA 3MHWU 4H6SB 3UOUA 1W13U 1C2LA 5EOKA 1C9PA 1F0RA 2QC2A 1KMHB 1O2GH 3SUEA 2BD2A 2BTCE 2Y82A 4OS4A 3PLBA 1GI9B 1GMCG 1HAVB 3S9AA 1YPJH 3SYJA 4GPGA 2G81E 1UTOA 2BM2A 1NFXA 3V12A 3RU4D 4TSFD 1EPTA 1KXFA 1ZPBA 3QO6A 4Y6DA 1UTLM 4UFFH 3U98H 4DOQA 2Q6FA 4WMEA 2P93A 1GI4A 2AS9A 1JWTA 1JRTA 1ANCA 4ZXXH 4LXBH 1C2GA 1DM4B 2A32A 2PW8H 5FCRA 2BX4A 1NRNH 1ETSH 2AGGX 2XWBI 1NESE 1OWHA 1N8OB 1QB6A 4D7FA 1C1UH 2ZDNA 1B7XB 3QN7A 1TRMA 2G51A 5DPAA 4WJG2 3GDVA 4AG1A 3URDA 2BD5A 3SJ8A 2FESH 1JOUB 1O3IA 2YMSC 3H5CB 3RXIA 1QFKH 2BHGA 1HRTH 4Z0KA 2VIDA 1K1JA 2F9PA 1A2CH 3M5MA 1VCQA 2Y5FA 2TBSA 2Y6TA 2R3UA 1TALA 2ZFTA 4DJZB 3BF6H 5CDFE 2PSYA 3EGKH 4F4OC 2ZFQH 5ESTE 4WXIA 3NPSA 3VEQB 3P92A 1NRSH 3ZYEA 4AGJA 3TH4H 1DLKB 1NBME 5F6MA 1OOKB 1KTSB 3F3BA 4WY3A 2W6JD 1EJAA 1HJAB 3HK3B 3MH6A 2UUJB 3TVJB 1J9CH 4D9RA 2TGDA 3T2NA 2ZGHA 2ZPSA 1O2TA 4OS7A 4DVAU 1BTWA 2ZWLH 3U1IB 1A0JA 2OC0A 2QXJA 1N8OC 3BTEE 1S6FA 4IBLH 5CHBA 1EXFA 1P9SA 1VGCB 3I78A 1ELCA 1NPMA 3SU2A 2A4GA 2OC7A 3PMBB 1IQIA 1O2LA 2ZKSA 1DE7H 3RXBA 1AIXH 1H1BA 1L4ZA 5DP4A 4OGXA 4X1NU 2BY5X 3BSQA 3TNSA 2ZDAH 4JK6A 4ZHLU 5HGGA 2BVXH 2L74A 1IAUA 4KTCA 2WV5A 1HAVA 4Y71A 3M3VA 4AN7A 1QGFA 3PTBA 4JCNA 1BIOA 1NT1A 1WTHD 2AFQB 4FUIA 1E1QD 1O3OA 3SW2B 3FFGA 2J38A 2ZHFH 6CHAB 2C8ZB 2WPDD 1CGIE 5GDSH 3F68H 2AH4X 1C5VA 3MH5A 2VIWA 1DDJA 3GICB 3M61U 1V2TT 1MCVA 1KLJH 4HG6A 1XX9A 4RT1A 2FDAA 4X2YA 3GCTF 1QQ4A 2TGPZ 1PPGE 1ELFA 1IQHA 3T5FH 4Z6AH 2FODA 3M5OA 1VGCC 1FDPA 4ZHAA 2AERH 2PWXA 2JKHA 4IN1A 2BD7A 4ZH8A 1DUAA 4ABFA 1O2PA 3T25A 2ZGBH 1BTPA 2PFEA 1XUGA 1ETRH 1N1LA 3BTWE 2BZAA 1YPMH 2PUQH 4KTSA 1G2MA 1EP5A 5DP7A 1P10A 1WBGB 1DXWA 3EA8A 3FO8D 3S69A 4TWYA 2ODQA 1D3QB 3TGIE 1SR5C 2VWOA 6CHAC 3SUFA 2ZO3H 4BTIB 5LPFA 5KEDA 1O3KA 1KSNA 1OWIA 1YYY1 4O9VA 5ESBA 2EI6A 2A2XH 3UFAA 3IWMA 2OBOA 2I6QA 1C5RA 3A7ZA 1VZQH 1SPJA 3B9FH 2CMYA 5L6NH 4I7YH 2KCAA 1TX7A 3VB7A 3FZZA 1P2MA 2IPQX 2F9VA 7GCHF 3KYGA 2A7CA 2KR7A 1YPKH 4BAQB 1EB1H 2THFB 1QQUA 3KN2A 1V2KT 2FMJA 1K1OA 2WPMS 3UAIC 3MO9A 1W11U 4XOJA 3MNSA 1GJCB 2AHME 3L33A 3ZZ7A 4UFEH 1CU1A 2FXRA 3Q00A 1C5TA 1CGJE 1C5LH 2SNVA 1QBNA 3L6PA 1AB9B 4MPUA 5B6LA 2FTMA 1DWEH 3NK8A 1K9OE 1UW7A 1SQRA 4UDWH 3T62A 1OYQA 1C1SA 1SC8U 1TPAE 1TWXB 2GDDA 7KMEH 1UHBB 1Z71A 4FUHA 2VVCA 5CE1A 4HZHA 4Y79A 1O5CB 3N99A 1YC0A 3GY2A 3LGWA 1OX1A 3BTGE 1SGRE 1XUHA 3SO3A 2J98B 1A5GH 1RGQA 3BTQE 1V2PT 3K65B 1O3MA 5GJ4B 3A7TA 2W7SA 1O3BA 1W8BH 1FIWA 5FX5A 2P94A 4NCYA 2VWNA 3EDXB 4H6TA 5HMAA 4JZIA 3WWFA 4FOUC 4NA9H 1YCPK 3KEEA 4TYDA 2ZFRH 3OTPA 4BOHA 1ANDA 3UQOA 3W1EA 1YBWA 2C93B 1TX8A 3F9GA 3UB0A 3LPRA 1V2ST 4ABGA 3A89A 3RXSA 2FX4A 4IC6A 3PROA 2A0QB 2ZF0H 3S9BA 1FY5A 1AB9C 1MAXA 1EAIA 1P2IA 1IQMA 3RMNH 1GG6B 1V3XA 1GJ4H 3GDUA 3PMJA 4X8UH 1LTOA 1KY9A 2HLDD 3SBKA 1YLCA 1AE5A 3AAUA 1FAKH 1BMFD 2R0LA 2Z3CA 1O5BB 3OTJE 2PTNA 2UWPA 1HJ9A 2HALA 4X1QU 1S81A 4H42U 4DY7B 2LNCA 3PMHB 3NWUA 1LHGH 2ZFPH 1V2JT 1O5AB 2HGTH 3GY5A 4IS5A 5LGOA 1O2OA 3V13A 1GL0E 5I46H 1EX3A 3RXTA 3R3GB 1HAOH 2V3MA 4XDEA 4FU8A 4ISNA 3BEUA 3UQVA 1DWDH 1A7SA 1DLEA 1EAUA 1P03A 1S5SA 3H09A 2P16A 1JIMA 4XE4A 4AFSA 1O2XA 2A45B 1Q3XA 1V2QT 2Z3DA 1EZSC 3MU0A 1FY4A 3EE7A 2H6MA 1E37B 1SLUB 4GLYA 1E34B 1SI5H 1N6XA 1FY8E 3P8FA 1GG6C 5T6GA 3A7YA 3T29A 1GBTA 2J95A 5ETXA 5EIYA 1ESBA 2OINA 2RDEA 1W12U 2WPHS 2J98A 3KQBA 1UJ1A 1FNIA 1W7GH 4P00A 4AC9A 2HNTC 2Y5GA 3MU1A 1SQTA 3P8OA 3VB6A 2O8UA 3UR6A 3ZVDA 1XUKA 2PTCE 1SVPA 2V3OH 1MUEB 1WOFA 1H8ED 1S85A 2AGEX 5LPRA 2P8OB 3MFJA 3MO6A 2BQ7B 5DP6A 3ZV8A 2ZIQH 5A0CA 3V7TA 3BV9B 3ATWA 3RXRA 1GI3A 1HAIH 3A8BA 3SQEE 8GCHG 4DGJA 3NZIA 3K2UA 1COWD 2QXIA 1O3HA 2Z94A 1ID5H 3NXPA 1HAHH 1UO6A 5DN6D 5BPEA 2A7JA 4E7NA 1C2JA 6GCHG 5CHAB 1C4V2 1RJXB 2ZPRA 3A87A 4XBBA 4F48B 4MTBA 5A8ZA 1W0KD 2XBYA 3RU4E 1P2OA 3E16B 2PKAB 1ZJKA 2FI3E 1UVSH 1GBIA 1EASA 3URCA 1O3LA 4AFZA 1V2MT 1ZHRA 2FOAA 5GXPA 4KKDA 3RXVA 5IK2D 3PLPA 1BITA 1L1JA 1QJ6B 3MTYA 4RSPA 4MNYA 5FL7D 2FOMB 2R2WU 4Y8XA 2ZU5A 1O2UA 3QK1A 2K1QA 3EA7A 2PKSB 3ZZ3A 2XTTB 4WXVA 3RXKA 2QF4A 3Q77A 3PMAB 1UVPA 3RXJA 4MPVA 2QV1A 2A4OA 1HLTH 5HIYA 3BTDE 3S7HB 4KGAA 5HKKD 2F83A 4MNVA 1QBVH 1O30A 1YM0A 3LJJA 5C3NA 1HB0B 2P3TB 1W3CA 4I32A 4CRFA 3EA9A 3M7QA 1G3EA 1H9LB 1T4VH 1YWUA 2YOLA 3ODFA 2ZGJA 2BY8X 5FX6A 1PQ7A 3ATKA 3VXFH 3UOPA 2UUFB 3NKKA 3ZZBA 1SQOA 4NFEA 2RA0A 2ODPA 1O3DA 3QLPH 1X7AC 1GBKA 2GV7A 5CHAC 1UMAH 4O97A 4UE7H 3QTOH 1HCGA 2W3KA 4NZQA 1DANH 1THPB 3LH3A 4IGDA 1ZTJA 3Q3XA 1JMOH 5AF9H 2ZA5A 3FANA 3HKIB 2BDBA 3W95A 1T7CA 3T27A 1SMFE 2SGQE 5JBTA 2D26C 2OQUA 1OWEA 3LIWA 1TBQH 1GVZA 1GPZA 2F9BH 2G8TA 1QA7A 1GBMA 2STAE 2HVYB 2FOHA 1L4DA 2Q6DA 1EAWA 3C27B 1SGEE 2F9OA 4IMZA 2B9LA 3WWBA 2ZNKH 3SHAH 3LH1A 2BY6X 2KCPA 1KXBA 5TJXA 3AW1A 1O2SA 4WWYA 1J17T 1C1VH 1VJ9U 4CH2B 4I8LA 1NC6A 4MDSA 4B2AA 1HAXB 1BMLA 3F2FA 4RN6A 1GMDG 2Z9KA 1F2SE 1TE0A 3S0NA 3QUMP 2VB0A 3SGQE 2VIVA 3IG6B 2AMDA 2DE8A 4I33A 2R0KA 3M37A 1T4UH 2PKAA 2BQWB 4YTAA 3F1SB 1EUFA 1QRWA 3FZDA 1XKAC 1YPHC 4DIHH 4K1TA 2YNBA 5FPYA 2BD8A 1P8VC 1O35A 3DSOA 3E8LA 3MH4A 1ETTH 2OC1A 3PYHA 3RXOA 2BD9A 2Z6BD 2ZQ2A 1EFRD 4OS1A 1BA8B 2VBCA 4X0WU 2VVVA 3V3MA 4CRGA 1TGBA 5HIZA 1RIWB 4K2YA 2H9TH 5B6OA 1S84A 1S83A 3ZZ6A 3B23B 4A1XA 1YKTA 4K8BA 2VNTA 3S9CA 3S7KB 4JYVH 1NFWA 1MKWK 2H9HA 4NWKA 2VIOA 3PM3A 2ANMH 1SGFG 2Z9JA 3PRDA 4NIVA 3QDZB 2AMPA 3E90B 3R0FA 4UEHH 4JZDH 2OLGA 1GBJA 3HK6B 1ESTA 7ESTE 1SL3A 1ESAA 2CN0H 1LPKB 4K60A 3HATH 3MNXA 1DVAH 1F0UA 2HWLB 3HPTB 1MZAA 2FI5E 1MQ6A 1O2ZA 1PYTD 4KTUA 1SGIB 3M35A 3TLOA 2VIPA 3KNXA 1C2FA 2C90B 5AHGH 2VINA 2OK5A 4ASUD 4INKA 3GCHB 1HXEH 3KQCA 4AFUA 5C1XA 4ISHH 1QB1A 2Y80A 4Y7AA 1T8MA 5I25A 2VJ1A 1BHXF 1RIWC 2EI7A 4D76A 1Y5UT 1QY6A 4FUFA 3DD2H 1FONA 2OXSA 1LHDH 4K3JA 1SGQE 1LHEH 2F3CE 2GV6A 2FX6A 2J34A 3RXAA 3K6ZA 4X6PA 4DURA 3ENSB 2C8XB 2W3IA 4Y0ZE 1CHOG 4D7GA 4DT7B 2P95A 2QE7D 3RMLH 3GY3A 2SGPE 2PLXA 1K21H 2QGRA 1P01A 1MBQA 2IPHA 2CGAA 2H2ZA 1TIOA 5HM9A 5E0GA 2ZCKP 1B0FA 3UPEA 5JB8S 3AK5A 1K1LA 2QY0B 1WU1A 3TK6A 1EB2A 2XWAA 1H9HE 1GI2A 2GCHF 2IJD1 3T26A 3QTVH 2TRMA 4CRAA 1HGTH 5EW1H 1Y8TA 1BHXB 4YZUA 1NFYA 5A09A 2ZU4A 5JBCS 3QGJA 2GT7A 1EOJA 2FZZA 2ZDLA 1S0RA 4A92A 2XC4A 3OE7D 2ZGXH 1IQLA 3SUGA 5LPEA 3SGBE 1P57B 1K28D 1TNLA 5GIBA 1NRRH 1SGTA 3ZVAA 5K7RA 1V2UT 2AIPA 5DSFA 4X8VH 5C20A 3EAJA 5GPIB 3MQKC 2HNTE 2ILNA 3CNRA 4A1TA 1WQSA 3MOCA 1BJVA 1FAXA 1V2WT 1Z1IA 2BDAA 1AMHA 1Y5BT 3LKWA 1PYTC 4GHTA 4J2YB 1AKSB 3OSYA 1BMNH 1XVOA 3BIUH 2GMTB 3LGYA 4AORA 1C9TA 4GSOA 1TMUH 5K0HA 1LHCH 1TQ7B 1H8DH 3A7WA 3RP2A 1E79D 2BZ6H 1TOMH 3ZYDA 1WCZA 5J4QA 4WH6A 1C2EA 3A7VA 3D62A 4LK4A 5GNDA 1HXFH 1O3JA 1VKYA 1MD7A 4FU7A 1DS2E 1IQGA 5C0TA 2OC8A 4ZKOU 1HYLA 5FBEA 1FPCH 1OHHD 1WAYB 3QX5H 4AG2A 1GJ6A 1E35B 4OM9A 1OS8A 1K22H 1HJAC 1O36A 5DP3A 4UD9H 1QNJA 1MBMA 1O2HA 3MH7A 1THRH 1AZ8A 4WVPE 5E8EH 6LPRA 2OP9A 4E06H 8GCHF 2ANWA 1B5GH 1TNKA 4ZROA 2UUYA 1L0ZA 3SNAA 2GMTC 3TK9A 2XC5A 1KDQB 5FXLA 3A80A 2J5UA 5DP9A 2OBQA 1O2YA 1Y5AT 2XOKD 6GCHF 2VU8E 1Y59T 4Z1MD 3RC5A 3IITA 2KAIB 5AFZH 1JIRA 1TB6H 4AB9A 3KQDA 3SNCA 2BY9X 3RXPA 1AUTC 1IHTH 1JXPA 3LDXH 4K1SA 3VB5A 4YLQH 1ABJH 1OP8A 3F2HA 3BG4B 8KME2 1ZTKA 3P8NA 4RKOB 2M2AA 1RS0A 5PTPA 3RXMA 1J15A 1YGCH 1O3EA 4U01A 4MLFB 2FOEA 4BNRA 1GBFA 1UTJA 3OYPA 1UK4A 1ARBA 1ZRKA 2JH6D 2EQNA 1O34A 1PQ8A 3KL6A 1K1MA 4AOQA 1EZUC 2WPJS 3OU0A 2H9EH 1DX5M 2LELA 4BAMB 1YLNA 2WV4A 1O2IA 4FXGH 2GKVE 4NIWA 1MKXH 1T8LA 3MMGA 5T1VA 5T6DA 1GHYH 1EP6A 1O5DH 2BY7X 1AKSA 1GHAF 1GBAA 3GY4A 3U8TH 3MNBA 3DFJA 3P70B 2P3FH 2ZTXA 4UONA 1SQAA 2AMQA 3RLYH 1QJ1B 4R8TB 3F6UH 4THNH 1TAWA 4B76A 1GJ7B 1C1NA 5E0JA 4O3TA 1SOTA 5C17A 4M9FA 4X1SU 1H8HD 1KIGH 2QXHA 1D9IA 1XUFA 1BTZA 1TGNA 5C0UA 3NCLA 3ITIA 5E2PA 3BG4C 4GAWA 3UUZA 3MWIU 2ZI2H 4F55A 1AWHB 2FYRA 1Y3YA 1G3BA 3SORA 1Q2WA 1TLDA 1LVOA 2XCNA 2BDCA 2ALVA 1UTNA 1EJNA 4O3UA 1XXDA 5FHTA 5A8XA 1YPHE 1GMHF 3F0OA 1F5RA 2ZFSA 4DIIH 1BTXA 2QF0A 3DA9B 1HPGA 1P02A 5EPNA 1P09A 1ZMLA 2A31A 1KDQA 1ZHMA 1E0FD 1L1NA 2EA3A 3G01A 3SJOA 1EOLA 3SU4A 1O3PB 2OUAA 2C3SA 1GMDF 5L30H 3DHKH 1RFNA 2KAIA 1BRAA 5DJ7A 1O3CA 2OCVB 5JBAS 2ALPA 4HI3A 3BTHE 1G30B 2O8WA 2Z9IA 4P02A 2PGQB 1AGJA 2BLWA 2QA9E 3CENA 1Y3XA 1FV9A 3RMOH 2FP7B 3SI3H 1ZR0A 1YF4A 4ACAA 2XBXA 1JBUH 4FUCA 4YXWD 1V2LT 4WH8A 5EJZA 3SV8A 1TPOA 3UREA 1B0EA 2PSXA 2R9PA 4J1YA 9ESTA 4GVUA 5AFYH 1SHYA 3OX7U 1H4WA 3RXHA 2FLBH 4YLUA 3SNEA 4VGCB 1DWBH 4JYUH 1A3EH 4PROA 3FP8E 3UWIA 1OPHB 2GCHG 1GI5A 1OWJA 2EI8A 2GVFA 3W94A 2KX4A 3UNSA 3LC5A 1V2NT 4BXWA 2JJ1D 4X1RU 5JB9S 1YLDA 1G37A 2VGCB 3P17H 3SJKA 2ZDVH 5ABWA 1AVGH 3GCOA 2J4IA 4CRCA 3A8CA 3OEHD 3UWJH 1TNIA 2ULLA 1IQNA 3O8DA 1VITH 3U8RH 1NY22 3M36A 1GVKB 5IDKA 1LHFH 4A6LA 4DCDA 1MTSA 1PQ5A 2GZ9A 3FP7E 1MH0A 5F03A 2JJ2D 2WUBA 2A2QH 1GVLA 5SGAE 4Q4LA 2OQ5A 1GHVH 4OS5A 3KQ5A 3RXUA 2BLQA 3PTNA 1SLXB 1F0SA 2XNDD 4CHAB 2G4TA 1BMMH 2AGIX 1A0LA 1TA6A 1GJ8B 1GJ9B 2LP6A 2P59A 4Y76A 4Y8YA 1UHBA 8ESTE 1C5SA 1TONA 2HRVA 1YY3A 2FS8A 1N6YA 4F49A 3UNQA 1SHHB 1C5ZB 4VGCC 1V6DA 1XXFA 4CBOA 4IMQA 5C67A 4ISIH 1YPLH 3SN8A 1GL1A 2RA3A 1XUJA 2KM0A 5A2MH 2SGEE 2ZPQA 1HAPH 1P06A 3RUOA 2A5KA 1O2WA 1UVOA 1SLVB 5EW2H 1GHWH 2VGCC 4UFGH 1SGNE 1CHOF 4ZXYH 1J16A 3MO3A 2G55A 2SFAA 5HXFA 3L3TA 2ZU3A 1LDTT 1A0HB 1MD8A 3BIVH 1TGCA 4WMDA 4B2CA 4XRNA 1OWKA 3A88A 1WSSH 1UCYE 4IN2A 4BAHB 5JBBS 1KXCA 3O8CA 3T28A 2QN5T 2ANYA 1P3EA 3SV7A 3TJVA 4INLA 4XFQA 3VB3A 4JMYA 2EEKA 1GGDB 2PV9B 2ZC9H 5KECA 5A0AE 2GP9B 4Y0YE 1J8AA 1Y3VA 5F8XA 1BOQA 3UR9A 4X6NA 3JZ1B 1E38B 1P9UA 4NA7A 2WINI 2A1DB 1GWAA 2WHXA 1TX6A 4UFDH 1ELVA 2HVXA 2B8OH 5DP5A 2G5NA 2BDGA 4JZ1A 5KGOA 1ELEE 1OP0A 1ZSLA 4IC5A 3K9XB 3TJNA 1C5QA 3SU5A 4Y8ZA 1ZPCA 4D8NA 5LH8A 1O2KA 2BX3A 4ABEA 3DT0H 1GI8B 4Q80A 3AAVA 3TK5A 3LJOA 1ANBA 2P8OC 1K1PA 3QZRA 3SU1A 2FO9A 1BTHH 1DFPA 4YESB 4FUJA 1GHBG 1ZZZA 1XKBC 2EC9H 1AFQB 2K8IA 1NRPH 3SV6A 1CT0E 2TGTA 1PPZA 4AYYB 3PO1B 1GHZA 3E1XB 1UCYK 3RM2H 3Q3YA 4WF8A 1UVTH 2F9UA 2STBE 1GHAG 2ZTZA 3KIDU 5EG4A 3RXGA 4ZMAH 1GGDC 4B2BA 2A5IA 6ESTA 4X6OA 1ARCA 1IQEA 2FLRH 4GCHG 1SGFA 3U9AH 1C1WH 5HYOA 3UY9A 5DK1A 4TT3D 3ZVGA 1C2IA 2JIZD 2YNAA 1FN6A 2BLOA 1C5YB 3ZVEA 1OP2A 1GCTB 2D2DA 1A4WH 5DO4H 4YO9A 1GDUA 1TPSA 1GI0A 2BXTH 1UTQA 4X6MA 1FJSA 1KLIH 4BTUB 2FOBA 5C5NA 4ZAEA 1EAXA 5FPTA 1CGHA 1DICA 1K1IA 4ZCNA 1FI8A 2L6OA 1CT4E 1E36B 3EQ0H 3I29A 2CJIA 1THSH 4FUEA 2ZHQH 4MNXA 2KZ4A 2D1JA 2PKSC 1MTVA 1D6RA 4X8SH 2O8TA 1WXRA 1HAYB 1GMHG 3O8RA 2HLCA 3TGJE 3PO1C 1U6QA 2PR3A 3ATIA 4B1TA 2GDEH 4Q2KA 3E0PB 1Z8JB 2Y5HA 4HGCA 3PWCA 1LQDB 5CMXH 1MU8B 1O5EH 3HGPA 1P0SH 3NUMA 4Q7ZA 1BJUA 1GI7B 1P2NA 1C1RA 3E6PH 5J4SA 2V35A 1GCTC 2VH6A 4A5TS 3H7TA 1BBRE 1MQ5A 1ZYOA 1LVBA 1IQKA 4XBDA 3LGIA 1QRZA 2V7QD 2WV9A 1SFIA 2PGBB 3OAAD 1Z8GA 3CS7A 1NRQH 1WUNH 3U28C 3BTME 1EQ9A 1DPOA 3AW0A 3A8AA 5EXNA 1SSXA 2SGAA 2G52A 2XBWA 3MNCA 1RRKA 4XBCA 4Y7BA 1G32B 1RTKA 4ZKNU 1O2QA 4ABDA 1SLWB 5EXMA 1CSOE 1NN6A 1QZ8A 1ORFA 2BLVA 1UVUH 1GBBA 1D6WA 2BD3A 1CVWH 1YP9A 1O0DH 2Z3EA 1MU6B 2UUKB 1ZHPA 3GYMA 3MYWA 1ZMNA 3ZVBA 2JETB 4TPYA 1F5KU 1IOEA 1QRXA 2YMSD 1QR3E 1ELTA 2WZQA 5FCKA 3TNTA 1NS3A 3BTFE 2SNWA 4CH8B 2CK3D 1ZTLA 3ZV9A 4AB8A 3ZZDA 3ZZ5A 2BXUH 2ANKH 1DWCH 1EATA 1Z6EA 2WPLS 1TA2A 1BBRK 3P6ZB 4Q7YA 4B6FA 1WTGH 2AYWA 4Q7XA 3RXDA 5C1UA 1HUTH 2NU2E 3RC6A 1YPEH 3K6YA 3TGKE 4Y10E 2LPRA 4I31A 2WPIS 3ZVCA 1WYKA 1AVXA 2YMSB 3U8OH 3A84A 3BTKE 2GX4A 4ISLA 1A3BH 1TRYA 2RCEA 1EZQA 1VR1H 3TU7H 4CREA 4NIYA 4B6EA 4M7GA 1ZSJA 2IOTA 3CS0A 1TBRH 2FOFA 1S6HA 5C1YA 2JETC 1O5FH 4LOYH 3ZZCA 1UTKA 1HFDA 1CA0B 1C1TA 2UWOA 1C2DA 1P12E 4OS6A 1QJ7B 3A85A 2W26A 4NWLA 1HBTH 3U69H 2HOBA 1PPFE 1BDAA 4I8JA 1NROH 1BB0B 2B5TB 3DUXH 5EQSA 4B73A 3U1JB 1VITF 1A46H 1FIZA 3A81A 5A8YA 2Y81A 1M9UA 3FKSD 3RDZA 3SU6A 1BQYA 1MZDA 1ZGIA 3GCHC 1QL8A 1ZRBA 3A82A 2GCTB 1KXEA 1CE5A 3MU5A 4I8KA 1C5MD 1A1RA 4SGAE 4FU9A 2QCYA 1DT2A 4O03A 4A7IB 3GISB 4GUXA 4ABJA 4CRDA 1A5HA 3RXCA 2WPKS 3QWCH 1T8OA 2XNIA 1SGPE 3RLWH 1CA0C 1P2QA 1EJMA 3VPKA 2VH0A 1YCPH 5H4IB 1SG8B 4OS2A 1RXPA 1GBEA 1MCTA 2ODYB 1HAGE 2J94A 2M5TA 4TY6A 1AUJA 1ELDE 4NIXA 4AZ2B 1C4Y2 2ZECA 2ZGCA 1Z7KA 3H7OA 5EXLA 5FAHA 1QCPA 4MVNA 1LQEA 3SGAE 1FUJA 3TIUA 3RXQA 3LOXA 4Y11E 5DKMA 1OSSA 1TQ0B 3OFND 4FUDA 1DSUA 2CV3A 4AFQA 2F9NA 2Y7XA 1LKBA 3PWBA 1S0QA 3Q76A 5FBIA 2SGFE 1Q31A 2OTVA 3F0PA 3UIRA 1HV7A 2GCTC 1PFXC 5EPYA 1XVMA 5L2YH 1FXYA 4NSVA 1XMNB 3STIA 2A7HA 2Y7ZA 3F9HA 4B74A 1V2RT 3DCLA 2QIQA 1L1GA 3SOSA 4ABBA 1AQ7A 2B0FA 4JYTA 1P3CA 1BZXE 3FN8A 1ZPZA 2GJGA 1E1RD 4XSKU 5C5OA 4B71A 1MTNB 1O2NA 4LZ1H 1SBWA 2NWNA 1FY1A 1QL9A 8LPRA 3WY8A 1DSTA 2J92A 5FPSA 4Q63A 1O3GA 1MAYA 4NZLA 3KYFA 1HIAB 1UK2A 2FYQA 2OD3B 3SI4H 3OY5U 3KCGH 1OKXA 4WMFA 1C1OA 2O9QA 1QIXB 1AWFH 1C4U2 3RMMH 1O38A 2Q6GA 3LU9B 4K69A 3M5NA 4KP0A 1EKBB 1QBOA 1DITH 1O2MA 1TYNA 4ZUHA 4I8HA 2K0QA 1V2OT 2O8MA 5GCHF 2H5CA 3TJOA 1NU9A 1SGDE 3KHVA 5EJLA 4YOGA 4ZHMU 1GHBF 4BAKB 2TIOA 4AX9H 2IJOB 1ZOMA 1SFQB 3OY6U 3EYDA 1HAZB 3RU4T 2FM2A 3PB1E 1MTNC 2BDIA 4E7RG 1PPCE 2BMGB 2W5EA 3TH3H 1FN8A 5JDUB 4GCHF 4LZ4B 1AHTH 2C8YB 1LPGB 2XCFA 1YPGH 5EU8A 3M3TA 3M7UA 3QZQA 1Y3WA 1C5UA 2JDID 5G4BA 1Z1JA 1AO5A 3RXEA 3N7EA 1PPBH 2HPQH 1C5XB 1Z6JH 3MI4A 5A0BA 4JZEH 1S82A 1QHRB 1W7XH 3SZNA 2PP6A 4X8TH 2NU4E 1C2KA 3PLKA 1D4PB 1F0TA 4FVDA 3SJIA 2I6SA 2H5DA 5AVDA 3EE0B 3LT3A 5BRRE 3PV2A 3C1KA 2SGDE 2ZDMA 3NRLA 1FZZA 3P95A 5F8ZA 4ABHA 2QYIA 3WW7A 2TPIZ 1G36A 1WV7H 2G4UA 3SJ9A 5EJ1A 5T3HA 3F9EA 1PQAA 1O3NA 2FS9A 2GT8A 5E0HA 4CR9A 1AU8A 3N7DA 4HTCH 3ZZ4A 2H1UA 1TNJA 1O32A 4YT7H 1C5PA 1F5LA 2BB4A 1G9IE 2GZ8A 3ATMA 2KCOA 3RM0H 2XYAA 3SUDA 4JK5A 3A83A 3Q3KA 4X2WA 1D3TB 2D8WA 3BEFB 2ZFFH 1T31A 2WYJA 1HIAA 5F8TA 2Z7FE 1XUIA 3N7OA 1UCYH 2ZHWH 2C8WB 2BYAX 4MQAA 3DFLA 2Q1JA 3OEED 1SKYE 4K5ZA 4TWWA 3AVZA 2NU0E 1ELBA 4NGAH 1QL7A 1IQFA 1O5GH 1ABIH 2ZTYA 3D23A 1NBMD 2GD4B 2WYGA 2ZCHP 1W0JD 9LPRA 1Z8RA 1BMAA 1KTTB 5EODA 2HNTF 1ZMJA 3GY8A 1AFEH 5C2ZA 3GOVB 3FAOA 1O33A 2ZP0H 1AE8H 4D9QA 1DY9A 1L2EA 1T8NA 2P3UB 2ZEBA 3GY7A 2R2MB 4MG3A 2ZCLP 1VITG 2BVSH 1W14U 2A4QA 5TCAA 3LGVA 3AASA 4XD7D 1SGCA 1MABB 4B75A 3TJUA 1FQ3A 2EY4C 1O3AA 4I86A 3SV2H 3KF2A 2ESTE 1GCDA 1C1MA 2FWWA 3QGNB 3DSGA 1GJDB 3RXLA 1ZSKA 4DG4A 4RT0A 4YT6H 2F91A 3RXFA 3ZZAA 2FTLE 1NM6A 2AEIH 2TGAA 3KGPA 1LPZB 5T6FA 2WSSD 1KYNA 2DE9A 3FOAA 1GBLA 1ELAA 4U30A 2ZDKA 5GWZA 1AD8H 1DUEA 1SB1H 3SU0A 1ANEA 1O2RA 1NFUA 7LPRA 1TGTA 1TGSZ 1ZLRA 1O39A 1CHGA 3O8BA 2C4FH 1G2LA 2Z9LA 1XM1A 1NZQH 2AIQA 1FPHH 3ZIAD 3SZEA 1NTPA 2G00A 3SU3A 1FX0B 1BTUA 4ESTE 3KQEA 2RDLA 3D49H 4KELA 4TY7A 2WUCA 1KLTA 2VVUA 1SOZA 2XW9A 1W2KH 1GMCF 2W7UA 2GZ7A 1IHSH 3ESTA 3SNDA 3SV9A 3STJA 5L2ZH 1VCWA 1LMWB 3ATLA 1TFXA 3LONA 1C1QA 1GHXH 1K0HA 3ZZ9A 4INHA 3BTTE 1HDTH 4MPXA 3VFEA 4TPIZ 3SNBA 1MKWH 1AN1E 2XRCA 5HM2A 1DOJA 4ABIA 4CHAC 4IW4E 3E0NB 1MKXK 1P2JA 1FY3A 4HFPB 5EQQA 1RTLA 2W6ID 5EQRA 1AY6H 3ZZ8A 4NSYA 4A1VA 4U32A 2A4RA 2KCYA 3VXEH 1W10U 5EGMA 3P8GA 1D3DB 1D3PB 1MMJN 1TBZH 3RC4A 3I77A 4NG9H 4K8YA 3ODDA 2PUXB 4QT8C 1ELGA 3E91A 2QF3A 5JPMH 1MTUA 2ZZUH 2CHAB 3TITA 2FIRH 1BBRH 1YCPM 1SGYE 3GCTG 3VG8A 3LGTA 1TOCB 1G3CA 1H8IH 4ZKRU 1NO9H 2ASUB 3LC3A 4X2VA 1CT2E 2V6NA 1LCYA 2FEQH 4BAOB 4FETA 2B7DH 1V2VT 1C2HA 1MTWA 3JZ2B 2R3YA 2BD4A 4X1PU 2UWLA 1O31A 3BEIB 1GI1A 4FUGA 1EZXC 1LVYA 1PJPA 3HKJB 5GCHG 4MNWA 1C1PA 1CA8B 3UNRA 1AZZA 1F92A 3GY6A 2RFKC 4BTTB 1LKAA 2VWLA 1WDIA 1KXAA 4OGYA 1S6LA 2FOCA 3FVFB 1BT7A 2ZU1A 1Z8IB 2QF5A 2G5VA 2V3HH 3LGUA 1AVWA 2FI4E 1CQQA 1P11E 1TMBH 2BOKA 3CP7A 3GYLB 1W0YH 5IYTA 1CO7E 4E05H 2A5AA 4YOIA 2J9NA 1KXDA 2BDYA 2ZQ1A 2JH0D 1P2KA 1A61H 2QXGA 4NFFA 2CHAC 3MU8A 1VCPA 2GGVB 2NU1E 1C5OH 3GDSA 1W0ZU 2J2UA 2ZG0H 3A86A 3PV4A 2DUCA 1CBWB 4DT4A 5TCCA 3B8JA 3VGCB 2RG3A 1F7ZA 4AGKA 7GCHG 1BRBE 2HPPH 1PPEE 3SHCH 1A5IA 1BRUP 1TMTH 1G3DA 3M7TA 4I8GA 1O2JA 3MU4A 1O37A 3DSPA
chains in the Genus database with same CATH topology
1FLEE 3UTUH 1IQJA 1TABE 3A7XA 2XBVA 4AYVB 4DW2U 2CF9H 4YM9A 1AFQC 2IN2A 4FUBA 1P05A 3TPIZ 1T32A 1TPPA 1TNGA 4ISOA 1TRNA 1GJAB 1GJBB 2BDHA 1UTMA 5DGJA 2BVRH 1DXPA 2FPZA 4SGBE 1BRCE 3BG8A 2V0BA 4X2XA 1ZGVA 4BXSA 1VJAU 2Z9GA 1QURH 1C2MA 3BN9A 3M3SA 3F9FA 1HJ8A 4BANB 1RTFB 2CXVA 2NU3E 4H4FA 1EPTB 5DG6A 1GBDA 4GHQA 1OYTH 4FVBA 1QB9A 1CBWC 1O2VA 2VWMA 5E2OA 1GBHA 3VGCC 5JYIA 1GDNA 2BOHB 1OXGA 2XC0A 1GDQA 4R0IA 1H9IE 1C5WB 2CF8H 2PHBA 2ZHDA 3D65E 3M5LA 1INCA 1BTYA 4YOJA 4U2WA 1TNHA 4CRBA 3TH2H 4NA8A 4ZKSU 1LVMA 4ABAA 4MPWA 3V0XA 4ASHA 1O3FA 1UK3A 4RKJB 1HNEE 1QA0A 1ZJDA 2O8LA 1K1NA 3HGNA 2BQ6B 1AI8H 1ACBE 1NU7B 1J14A 2FOGA 1GI6A 2VIQA 1K2I1 4JZFH 1P04A 1LO6A 1WQVH 2JH5D 3E3TA 3FP6E 1EPTC 3ELAH 1RD3B 1FMGA 1BUIA 1C5NH 2GTBA 1OWDA 3ZVFA 1UTPA 3GCNA 4K1EA 2ZHEH 5DP8A 4CR5A 3VB4A 1GJ5H 1PPHE 1Y3UA 1GBCA 1QTFA 4CBNA 1DY8A 2QAAA 3SQHE 3A8DA 2XXLA 1JRSA 1BCUH 2ZU2A 3MHWU 4H6SB 3UOUA 1W13U 1C2LA 5EOKA 1C9PA 1F0RA 2QC2A 1O2GH 3SUEA 2BD2A 2BTCE 2Y82A 4OS4A 3PLBA 1GI9B 1GMCG 1HAVB 3S9AA 1YPJH 4GPGA 2G81E 1UTOA 2BM2A 1NFXA 3V12A 3RU4D 1EPTA 1KXFA 1ZPBA 3QO6A 4Y6DA 1UTLM 4UFFH 3U98H 4DOQA 2Q6FA 4WMEA 2P93A 1GI4A 2AS9A 1JWTA 1JRTA 1ANCA 4ZXXH 4LXBH 1C2GA 1DM4B 2A32A 2PW8H 5FCRA 2BX4A 1NRNH 1ETSH 2AGGX 2XWBI 1NESE 1OWHA 1N8OB 1QB6A 4D7FA 1C1UH 2ZDNA 1B7XB 3QN7A 1TRMA 2G51A 5DPAA 4WJG2 3GDVA 4AG1A 3URDA 2BD5A 3SJ8A 2FESH 1JOUB 1O3IA 3H5CB 3RXIA 1QFKH 2BHGA 1HRTH 4Z0KA 2VIDA 1K1JA 2F9PA 1A2CH 3M5MA 1VCQA 2Y5FA 2TBSA 2Y6TA 2R3UA 1TALA 2ZFTA 4DJZB 3BF6H 2PSYA 3EGKH 4F4OC 2ZFQH 5ESTE 4WXIA 3NPSA 3VEQB 3P92A 1NRSH 3ZYEA 4AGJA 3TH4H 1DLKB 5F6MA 1OOKB 1KTSB 4WY3A 3HK3B 1EJAA 1HJAB 3MH6A 2UUJB 3TVJB 1J9CH 4D9RA 2TGDA 3T2NA 2ZGHA 2ZPSA 1O2TA 4OS7A 4DVAU 1BTWA 2ZWLH 3U1IB 1A0JA 2OC0A 2QXJA 1N8OC 3BTEE 1S6FA 4IBLH 1EXFA 1P9SA 1VGCB 3I78A 1ELCA 1NPMA 3SU2A 2A4GA 2OC7A 3PMBB 1IQIA 1O2LA 2ZKSA 1DE7H 3RXBA 1AIXH 1H1BA 1L4ZA 5DP4A 4OGXA 4X1NU 2BY5X 3BSQA 3TNSA 2ZDAH 4JK6A 4ZHLU 5HGGA 2BVXH 1IAUA 4KTCA 2WV5A 1HAVA 4Y71A 3M3VA 4AN7A 1QGFA 3PTBA 4JCNA 1BIOA 1NT1A 1WTHD 2AFQB 4FUIA 1O3OA 3SW2B 3FFGA 2J38A 2ZHFH 6CHAB 2C8ZB 1CGIE 5GDSH 3F68H 2AH4X 1C5VA 3MH5A 2VIWA 1DDJA 3GICB 3M61U 1V2TT 1MCVA 1KLJH 1XX9A 2FDAA 4X2YA 3GCTF 1QQ4A 2TGPZ 1PPGE 1ELFA 1IQHA 3T5FH 4Z6AH 2FODA 3M5OA 1VGCC 1FDPA 1O2JA 4ZHAA 2AERH 2PWXA 2JKHA 4IN1A 2BD7A 4ZH8A 1DUAA 4ABFA 1O2PA 3T25A 2ZGBH 1BTPA 2PFEA 1XUGA 1ETRH 1N1LA 3BTWE 2BZAA 1YPMH 2PUQH 4KTSA 1G2MA 1EP5A 5DP7A 1P10A 1WBGB 1DXWA 3EA8A 3S69A 4TWYA 2ODQA 1D3QB 3TGIE 1SR5C 2VWOA 6CHAC 3SUFA 2ZO3H 4BTIB 5LPFA 1O3KA 1KSNA 1OWIA 1YYY1 4O9VA 5ESBA 2EI6A 2A2XH 3UFAA 3IWMA 2OBOA 2I6QA 1C5RA 3A7ZA 1VZQH 1SPJA 3B9FH 2CMYA 5L6NH 4I7YH 1TX7A 3VB7A 3FZZA 1P2MA 2F9VA 7GCHF 2A7CA 1YPKH 4BAQB 1EB1H 2THFB 1QQUA 3KN2A 1V2KT 2FMJA 1K1OA 2WPMS 3MO9A 1W11U 4XOJA 3MNSA 1GJCB 3L33A 3ZZ7A 4UFEH 1CU1A 2FXRA 3Q00A 1C5TA 1CGJE 1C5LH 2SNVA 1QBNA 3L6PA 1AB9B 4MPUA 2FTMA 1DWEH 3NK8A 1K9OE 4UDWH 3T62A 1OYQA 1C1SA 1SC8U 1TPAE 1TWXB 2GDDA 7KMEH 1UHBB 1Z71A 4FUHA 2VVCA 5CE1A 4HZHA 4Y79A 1O5CB 1YC0A 3GY2A 3LGWA 1OX1A 3BTGE 1SGRE 1XUHA 3SO3A 1A5GH 1RGQA 3BTQE 1V2PT 3K65B 1O3MA 5GJ4B 3A7TA 2W7SA 1O3BA 1W8BH 1FIWA 5FX5A 4NCYA 2VWNA 3EDXB 4H6TA 5HMAA 4JZIA 4NA9H 1YCPK 3KEEA 4TYDA 2ZFRH 4BOHA 1ANDA 3UQOA 1YBWA 2C93B 1TX8A 3F9GA 3LPRA 1V2ST 4ABGA 3A89A 3RXSA 2FX4A 4IC6A 3PROA 2A0QB 2ZF0H 3S9BA 1FY5A 1AB9C 1MAXA 1EAIA 1P2IA 1IQMA 3RMNH 1GG6B 1V3XA 1GJ4H 3GDUA 3PMJA 4X8UH 1LTOA 1KY9A 3SBKA 1YLCA 1AE5A 3AAUA 1FAKH 2R0LA 2Z3CA 1O5BB 3OTJE 2PTNA 2UWPA 1HJ9A 2HALA 4X1QU 1S81A 4H42U 4DY7B 2LNCA 3PMHB 3NWUA 1LHGH 2ZFPH 1V2JT 1O5AB 2HGTH 3GY5A 4IS5A 5LGOA 1O2OA 3V13A 1GL0E 5I46H 1EX3A 3RXTA 3R3GB 1HAOH 4XDEA 4FU8A 4ISNA 3BEUA 3UQVA 1DWDH 1A7SA 1DLEA 1EAUA 1P03A 1S5SA 2P16A 1JIMA 4XE4A 4AFSA 1O2XA 2A45B 1Q3XA 1V2QT 2Z3DA 1EZSC 3MU0A 1FY4A 2H6MA 1E37B 1SLUB 4GLYA 1E34B 1SI5H 1N6XA 1FY8E 3P8FA 1GG6C 5T6GA 3A7YA 3T29A 1GBTA 2J95A 5ETXA 1ESBA 2OINA 1W12U 2WPHS 3KQBA 1UJ1A 1FNIA 1W7GH 2HNTC 2Y5GA 3MU1A 1SQTA 3P8OA 3VB6A 2O8UA 3UR6A 3ZVDA 1XUKA 2PTCE 1SVPA 2V3OH 1MUEB 1WOFA 1S85A 2AGEX 5LPRA 2P8OB 3MFJA 3MO6A 2BQ7B 5DP6A 3ZV8A 2ZIQH 5A0CA 3V7TA 3BV9B 3ATWA 3RXRA 1GI3A 1HAIH 3A8BA 3SQEE 8GCHG 4DGJA 3NZIA 3K2UA 2QXIA 1O3HA 2Z94A 1ID5H 3NXPA 1HAHH 1UO6A 5BPEA 2A7JA 4E7NA 1C2JA 6GCHG 5CHAB 1C4V2 1RJXB 2ZPRA 3A87A 4XBBA 4MTBA 5A8ZA 2XBYA 3RU4E 1P2OA 3E16B 2PKAB 1ZJKA 2FI3E 1UVSH 1GBIA 1EASA 3URCA 1O3LA 4AFZA 1V2MT 1ZHRA 2FOAA 5GXPA 4KKDA 3RXVA 3PLPA 1BITA 1L1JA 1QJ6B 3MTYA 4RSPA 4MNYA 2FOMB 2R2WU 4Y8XA 2ZU5A 1O2UA 3QK1A 2K1QA 3EA7A 2PKSB 3ZZ3A 2XTTB 4WXVA 3RXKA 3Q77A 3PMAB 1UVPA 3RXJA 4MPVA 2QV1A 2A4OA 1HLTH 3BTDE 3S7HB 4KGAA 2F83A 4MNVA 1QBVH 1O30A 1YM0A 3LJJA 5C3NA 1HB0B 2P3TB 1W3CA 4I32A 4CRFA 3EA9A 3M7QA 1G3EA 1H9LB 1T4VH 2YOLA 3ODFA 2ZGJA 2BY8X 5FX6A 1PQ7A 3ATKA 3VXFH 3UOPA 2UUFB 3NKKA 3ZZBA 1SQOA 4NFEA 2RA0A 2ODPA 1O3DA 3QLPH 1X7AC 1GBKA 2GV7A 5CHAC 1UMAH 4O97A 4UE7H 3QTOH 1HCGA 2W3KA 4NZQA 1DANH 1THPB 3LH3A 4IGDA 1ZTJA 3Q3XA 1JMOH 5AF9H 2ZA5A 3FANA 3HKIB 2BDBA 3W95A 1T7CA 3T27A 1SMFE 2SGQE 5JBTA 2D26C 2OQUA 1OWEA 3LIWA 1TBQH 1GVZA 1GPZA 2F9BH 2G8TA 1QA7A 1GBMA 2STAE 2FOHA 1L4DA 2Q6DA 1EAWA 3C27B 1SGEE 2F9OA 4IMZA 2B9LA 2ZNKH 3SHAH 3LH1A 2BY6X 1KXBA 5TJXA 3AW1A 1O2SA 4WWYA 1J17T 1C1VH 1VJ9U 4CH2B 4I8LA 1NC6A 4MDSA 4B2AA 1HAXB 1BMLA 4RN6A 1GMDG 2Z9KA 1F2SE 1TE0A 3S0NA 3QUMP 2VB0A 3SGQE 2VIVA 3IG6B 2AMDA 2DE8A 4I33A 2R0KA 3M37A 1T4UH 2PKAA 2BQWB 4YTAA 3F1SB 1EUFA 1QRWA 3FZDA 1XKAC 1YPHC 4DIHH 4K1TA 2YNBA 5FPYA 2BD8A 1P8VC 1O35A 3E8LA 3MH4A 2OC1A 1ETTH 3PYHA 3RXOA 2BD9A 2Z6BD 2ZQ2A 4OS1A 1BA8B 3V3MA 4X0WU 2VVVA 4CRGA 1TGBA 1RIWB 4K2YA 2H9TH 5B6OA 1S84A 1S83A 3ZZ6A 3B23B 4A1XA 1YKTA 4K8BA 2VNTA 3S9CA 3S7KB 4JYVH 1NFWA 1MKWK 2H9HA 4NWKA 2VIOA 3PM3A 2ANMH 1SGFG 2Z9JA 4NIVA 3QDZB 2AMPA 3E90B 3R0FA 4UEHH 4JZDH 2OLGA 1GBJA 3HK6B 1ESTA 7ESTE 1SL3A 1ESAA 2CN0H 1LPKB 4K60A 3HATH 3MNXA 1DVAH 1F0UA 2HWLB 3HPTB 1MZAA 2FI5E 1MQ6A 1O2ZA 1PYTD 4KTUA 1SGIB 3M35A 3TLOA 2VIPA 3KNXA 1C2FA 2C90B 5AHGH 2VINA 4INKA 3GCHB 1HXEH 3KQCA 4AFUA 5C1XA 4ISHH 1QB1A 2Y80A 4Y7AA 1T8MA 5I25A 2VJ1A 1BHXF 1RIWC 2EI7A 4D76A 1Y5UT 1QY6A 4FUFA 3DD2H 1FONA 2OXSA 1LHDH 4K3JA 1SGQE 1LHEH 2F3CE 2GV6A 2FX6A 2J34A 3RXAA 3K6ZA 4X6PA 4DURA 3ENSB 2C8XB 2W3IA 4Y0ZE 1CHOG 4D7GA 4DT7B 2P95A 3RMLH 3GY3A 2SGPE 2PLXA 1K21H 2QGRA 1P01A 1MBQA 2IPHA 2CGAA 2H2ZA 1TIOA 5HM9A 5E0GA 2ZCKP 1B0FA 3UPEA 5JB8S 1K1LA 2QY0B 1WU1A 3TK6A 1EB2A 2XWAA 1H9HE 1GI2A 2GCHF 3T26A 3QTVH 2TRMA 4CRAA 1HGTH 5EW1H 1Y8TA 1BHXB 4YZUA 1NFYA 5A09A 2ZU4A 5JBCS 3QGJA 2GT7A 1EOJA 2FZZA 2ZDLA 1S0RA 4A92A 2XC4A 2ZGXH 1IQLA 3SUGA 5LPEA 3SGBE 1P57B 1K28D 1TNLA 5GIBA 1NRRH 1SGTA 3ZVAA 5K7RA 1V2UT 2AIPA 4X8VH 5C20A 3EAJA 5GPIB 2HNTE 2ILNA 4A1TA 1WQSA 3MOCA 1BJVA 1FAXA 1V2WT 1Z1IA 2BDAA 1AMHA 1Y5BT 3LKWA 1PYTC 4GHTA 4J2YB 1AKSB 3OSYA 1BMNH 1XVOA 3BIUH 2GMTB 3LGYA 4AORA 1C9TA 4GSOA 1TMUH 5K0HA 1LHCH 1TQ7B 1H8DH 3A7WA 3RP2A 2BZ6H 1TOMH 3ZYDA 1WCZA 5J4QA 4WH6A 1C2EA 3A7VA 3D62A 4LK4A 1HXFH 1O3JA 1MD7A 4FU7A 1DS2E 1IQGA 2OC8A 4ZKOU 1HYLA 5FBEA 1FPCH 4AG2A 1WAYB 3QX5H 1GJ6A 1E35B 1OS8A 1K22H 1HJAC 1O36A 5DP3A 4UD9H 1QNJA 1MBMA 1O2HA 3MH7A 1THRH 1AZ8A 4WVPE 5E8EH 6LPRA 2OP9A 4E06H 8GCHF 2ANWA 1B5GH 1TNKA 4ZROA 2UUYA 1L0ZA 3SNAA 2GMTC 3TK9A 2XC5A 1KDQB 5FXLA 3A80A 5DP9A 2OBQA 1O2YA 1Y5AT 6GCHF 2VU8E 1Y59T 3RC5A 3IITA 2KAIB 5AFZH 1JIRA 1TB6H 4AB9A 3KQDA 3SNCA 2BY9X 3RXPA 1AUTC 1IHTH 1JXPA 3LDXH 4K1SA 3VB5A 4YLQH 1ABJH 1OP8A 3BG4B 8KME2 1ZTKA 3P8NA 4RKOB 1RS0A 5PTPA 3RXMA 1J15A 1YGCH 1O3EA 4U01A 4MLFB 2FOEA 4BNRA 1GBFA 1UTJA 3OYPA 1UK4A 1ARBA 1ZRKA 2JH6D 1O34A 1PQ8A 3KL6A 1K1MA 4AOQA 1EZUC 2WPJS 3OU0A 2H9EH 1DX5M 4BAMB 2WV4A 1O2IA 4FXGH 2GKVE 4NIWA 1MKXH 1T8LA 3MMGA 5T6DA 1GHYH 1EP6A 1O5DH 2BY7X 1AKSA 1GHAF 1GBAA 3GY4A 3U8TH 3MNBA 3DFJA 3P70B 2P3FH 2ZTXA 4UONA 1SQAA 2AMQA 3RLYH 1QJ1B 4R8TB 3F6UH 4THNH 1TAWA