5FCRA

Mouse complement factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
230
structure length
230
Chain Sequence
ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule factor D inhibitors targeting the alternative complement pathway.
pubmed doi rcsb
molecule keywords Complement factor D
molecule tags Hydrolase
source organism Mus musculus
total genus 58
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.46: Complement factor D.
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fcrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fcrA01
4I31A 1PQ8A 2H2ZA 5JBTA 1GCDA 4UEHH 4YO9A 3SJIA 5T6GA 1ORFA 3OU0A 5C1YA 4ZKNU 1RS0A 1SQAA 2VWLA 1SLUB 8ESTE 1GMCF 2BDIA 1GDQA 4MPWA 1XUIA 1QIXB 2TIOA 4WY3A 3FP8E 4ZROA 3A81A 1A0LA 3VGCB 1TGBA 4AGKA 1QL9A 1CA0B 1YGCH 3VB4A 2QN5T 1FJSA 2ZU2A 4FUGA 2CN0H 2ZTXA 4MDSA 1EB2A 2ILNA 4BTTB 1E0FD 3NPSA 5BPEA 2HOBA 1C5NH 1O5DH 3C27B 4X1NU 2OC1A 2ALVA 2PHBA 1MQ5A 1C1WH 1MTSA 1UTOA 2G51A 4VGCB 3RXOA 1HAOH 4GCHG 4XBCA 1FI8A 1HCGA 2FOCA 3IG6B 1D3DB 2ZKSA 1RRKA 3ZZ9A 2XC0A 4MQAA 1QA0A 2GD4B 1VJAU 1HAHH 1PFXC 1VGCC 3URCA 1BRUP 2V3HH 5E2OA 2FIRH 1TWXB 3ZZ8A 1IHSH 5F8TA 5F8XA 4NGAH 5PTPA 5HM2A 4KTCA 1FV9A 2BOKA 5HYOA 2AH4X 4BTIB 2F91A 1P57B 1BTZA 3BF6H 4R8TB 3LH3A 1NN6A 1GDNA 1GJ7B 5FPYA 1QL8A 4ABFA 4DVAU 2Z3DA 1GI4A 2RA0A 5EXNA 5JBCS 2FEQH 1G37A 1YPEH 1YKTA 2VIDA 1DPOA 2QXIA 1O2LA 3UPEA 1K1NA 4Y7AA 1BTYA 1CGJE 1Y5UT 5JB8S 5L2ZH 4WVPE 2EI8A 1SC8U 1IQNA 2FODA 1GMDG 1K1IA 1FMGA 2G4UA 4X8TH 3SJOA 1FQ3A 1OWHA 2FWWA 3E1XB 4DJZB 1TYNA 3GCTG 4NA7A 2BQ6B 1LPKB 3RXPA 2XTTB 1S0RA 1O2TA 4AN7A 3TGKE 1ZGIA 5DP6A 1Z71A 5ESBA 1W8BH 2OQUA 2ZFSA 4Q7XA 1EZXC 1A7SA 1T8MA 1MAXA 1XUHA 4GVUA 3QTOH 2KAIA 3OSYA 2BX4A 1J14A 1GPZA 1NRQH 3PTNA 3P95A 5A0CA 2CV3A 2QXGA 1GBEA 3A7VA 3ELAH 3MO3A 1HIAB 5DKMA 1NRSH 3QLPH 3B23B 1KSNA 3HK3B 3LKWA 4IS5A 5IDKA 1NESE 2W3IA 5CMXH 4DT7B 2UUJB 4YM9A 1HUTH 1GWAA 1TE0A 2NU2E 1H4WA 3M5OA 1XUKA 3E0PB 1AFEH 1C4V2 2VNTA 2W26A 3MNCA 4CHAB 2SGEE 1TONA 1TGCA 3RM2H 4YLUA 1KIGH 1LHDH 4GHQA 1WCZA 2B9LA 4MNWA 1MCVA 1E36B 4O97A 1AB9B 1MMJN 2PTCE 1HPGA 4K60A 2P94A 2ZU5A 1O2IA 1HYLA 1IQMA 2ZHDA 1OPHB 1XUJA 5FPTA 2VVUA 2PUXB 5FBIA 1O0DH 1G3DA 1GMCG 2A4GA 2F3CE 4DG4A 3S69A 2XBXA 5TCAA 2Z9JA 1TPSA 3B9FH 3BTKE 1BB0B 4I8GA 1GJ4H 4GHTA 1OWKA 2FI4E 2G5NA 2QY0B 2SGDE 1DFPA 2C3SA 4Q7ZA 4TYDA 1TQ7B 3BTME 5DP9A 3U1JB 1SPJA 1RTKA 1LKAA 3GDVA 4O3TA 4X8UH 1GBLA 1MAYA 3PMBB 2WYJA 3SHCH 2FO9A 3KHVA 3BSQA 1NFWA 2A5AA 5GXPA 1SOZA 1ANBA 1CVWH 1THSH 1DY8A 1ELBA 2ULLA 3PB1E 1WU1A 4JCNA 1ELCA 1FONA 3ZVAA 9LPRA 3OX7U 1SHYA 1HJAC 1TGNA 2H5DA 2F9PA 4THNH 1BTWA 1JMOH 1P04A 1RGQA 2SGPE 4Y8YA 1UCYE 3Q3YA 1G30B 1BZXE 3TJNA 3MNSA 1KXDA 2VVVA 1BQYA 4WMEA 1C1VH 1A2CH 1BMNH 1GBTA 4NWLA 2Z9KA 5GPIB 3BG4C 4F4OC 5AVDA 3SU4A 1CQQA 4GSOA 3Q76A 3SGBE 2P95A 3SV9A 1FAXA 3URDA 3SV7A 1KXAA 1O2KA 4KKDA 1UTJA 1GI1A 4IBLH 2C8YB 1JXPA 1H1BA 1NY22 2LNCA 1GHYH 1O3JA 4BOHA 1P05A 1LPGB 1ESBA 2OD3B 2O8WA 5F8ZA 1TGSZ 5LPRA 4AX9H 5EXMA 1OXGA 5C5NA 1ETTH 2BZAA 2OC7A 3TLOA 4XE4A 2WPKS 2YNBA 3MFJA 3QWCH 1G3EA 4D9QA 1O2OA 2ZWLH 4AFQA 1EZQA 1O2YA 1SGDE 1U6QA 1ESAA 2BD3A 8KME2 1E37B 4IGDA 1ANDA 2ZHWH 1N1LA 4FUJA 2R3YA 5T6DA 2FS8A 1SGPE 2DE8A 4GLYA 4JZEH 2VWOA 1LMWB 1MU6B 4Z0KA 1ZTJA 1TNKA 1EJAA 3ATIA 3MMGA 1SLVB 3E0NB 4AB9A 3BN9A 1HJ8A 2ZEBA 1SGFG 1A5IA 2UUKB 1ELTA 1O3MA 1HAPH 2A1DB 2G52A 2QA9E 1GGDB 2G81E 4JZDH 1DS2E 3EAJA 4NSYA 1F92A 1QURH 2NWNA 4YT7H 2BDCA 2Z3CA 3GCHC 1CBWB 2ZQ2A 1VITF 1QHRB 4A7IB 4ZKOU 2GCTB 2PLXA 4O9VA 1J17T 5HMAA 3W94A 4YT6H 1W12U 3MU0A 4KELA 1PPBH 1C1NA 3RU4T 3RMNH 1HJ9A 1EOJA 4ABEA 4GAWA 4Y8XA 3SQHE 1WBGB 1P2NA 1O2RA 6CHAB 2C4FH 1TNIA 4OS6A 2CHAB 5IYTA 3A8AA 1W0YH 3EA8A 4H6TA 2A5KA 1OOKB 4MNYA 2QXHA 2ZG0H 4WWYA 1THPB 4TPIZ 1ABIH 1ZPCA 1FY1A 1W0ZU 3M3SA 2OLGA 4YTAA 3VB3A 1QBVH 3FZDA 4X6NA 1ZHPA 1C1UH 1O37A 2BTCE 1HIAA 2ZDLA 2H5CA 1HAZB 3PTBA 2J92A 2STAE 2XBVA 4NG9H 4ISOA 2GT7A 5DK1A 3U8RH 1W3CA 2FTLE 1F5LA 1W10U 4X0WU 3SNDA 2OP9A 2ZFPH 2GKVE 2R2MB 2IN2A 1NFXA 1UVUH 3ENSB 1K28D 4BXWA 3DFJA 2ZTYA 3MWIU 3QX5H 4J1YA 1LHEH 3P6ZB 2FP7B 4INKA 1SL3A 1TNHA 3VGCC 3ZYEA 3SUGA 1O33A 2JH5D 4U01A 1CA0C 1OP8A 2OINA 5T3HA 4B2AA 3P8FA 4CRCA 1SLWB 6GCHF 1LVMA 3MH6A 4OS1A 3UFAA 1O2NA 5T6FA 2XRCA 1C1SA 3ZYDA 4JZFH 1P3EA 2UWPA 3UIRA 2ZCLP 1S6FA 3SZNA 3UR6A 4AOQA 1ARCA 4VGCC 3VXEH 5EW2H 2JH0D 1EOLA 3MO9A 4X6MA 3QN7A 2OBQA 2WUCA 2A4RA 3MOCA 1ZHRA 4H4FA 2ZFTA 1D3QB 1RIWB 1YPKH 1T4UH 2B8OH 1J16A 3G01A 1SFIA 4CRFA 1BMAA 1QQUA 1QB6A 2GZ9A 3A8BA 1MTNB 3ZVDA 3LC3A 3HATH 4Z6AH 3UWIA 4X1RU 1ZMLA 1Y3YA 1UCYH 1QBNA 5EU8A 3PYHA 4GCHF 3UQVA 3RP2A 3ZVGA 4D8NA 5HM9A 1MKWH 2Q6FA 1FNIA 3FVFB 1Y3XA 2HPQH 2RCEA 3CP7A 4ESTE 3ODDA 2WPLS 5F6MA 2BDHA 3KNXA 4E7NA 1G9IE 1XVOA 1GI6A 1MTWA 3KCGH 3MNXA 4UE7H 2IOTA 2VIVA 5C20A 3ATKA 2VJ1A 1UTLM 3OYPA 3SU2A 2ZCKP 1V2VT 1IOEA 1TOMH 4FUBA 1O2XA 1EUFA 2AIPA 1GBKA 3RXTA 3I77A 2BOHB 3LC5A 3UUZA 5FCRA 2BB4A 1C2JA 4BANB 1KXBA 4FUEA 3ATLA 4NZQA 1VR1H 1QGFA 3M36A 5DP5A 1XKBC 2JKHA 1K2I1 2BLQA 4K1SA 4X2VA 1JBUH 2Z94A 1VITG 2PFEA 3M5MA 1S81A 2OBOA 1AU8A 4X2WA 3RLWH 2Z3EA 3PMJA 1O5GH 2STBE 3F9HA 1HAIH 3D49H 3BTFE 4XSKU 1DLEA 1O5BB 2ZFFH 3GY2A 1B0EA 1QRWA 2ANMH 1V2RT 2FM2A 3BEIB 1BHXB 3M7TA 2J94A 3A7WA 1Y59T 4A1VA 1YC0A 1T8OA 2QYIA 1O3NA 4CHAC 2AGEX 4WMFA 5DJ7A 2WYGA 2TRMA 1XMNB 1AB9C 3SNAA 1JIMA 1SLXB 1YP9A 2BHGA 2XC4A 1OWIA 3FP7E 5I46H 5EXLA 1ELGA 1C2DA 2AGGX 4NIXA 1C4Y2 3A7TA 1EAUA 4D9RA 1FN6A 5GWZA 1ZJKA 2WUBA 4TY6A 1EJMA 2BY7X 2ZGHA 1F0SA 3A7XA 5JPMH 3RXEA 4DIIH 1HNEE 4NIWA 1ARBA 2TPIZ 1L4DA 1BJUA 5DGJA 1Z6JH 6GCHG 3TJOA 1DUEA 3T29A 3RXAA 4B75A 5E0GA 2M5TA 1QFKH 1SGIB 2ANWA 3SV2H 3SW2B 3VXFH 1BUIA 1P3CA 1V2OT 3VB6A 4ZHAA 2P3FH 3MU4A 1WAYB 2Y5GA 5FXLA 1C5MD 3S9AA 1GBIA 1Q3XA 1SR5C 2FOEA 3UNSA 2ZU1A 1UTKA 4WH8A 1SGTA 3KQCA 1GI5A 1LCYA 1FLEE 3A7YA 1UCYK 4RSPA 3VB5A 2A0QB 2R0KA 3NCLA 1C1RA 1MKWK 1AE5A 2C93B 1EQ9A 1O2UA 3ZVCA 2RG3A 3RXLA 4DURA 3W95A 1EZUC 5K0HA 2ALPA 3F9GA 1ZMNA 1ZTKA 2AIQA 3SGQE 1C5YB 3T26A 5EQRA 1C2KA 1ZR0A 3LGWA 4X2YA 1ANCA 2PKSB 1JOUB 3QZQA 5LPEA 1C5SA 3U98H 3TK5A 5JB9S 1Z6EA 5HXFA 1AI8H 5C2ZA 1SGRE 2BYAX 3TGIE 3NUMA 2XBWA 2C90B 3SGAE 3ZVEA 1TALA 1AQ7A 1ZSLA 1O2WA 2ODYB 1NT1A 1LHGH 1NZQH 5A0BA 1P2IA 1LO6A 2ZPSA 1O3DA 4OS2A 1DM4B 3TPIZ 2ZPQA 2J4IA 2XBYA 1EJNA 2CF9H 2F9OA 4CH2B 1V2UT 4J2YB 1MU8B 4CBNA 1W14U 3SI3H 5L6NH 1O38A 1TAWA 4NFEA 3VPKA 3RDZA 2UWLA 2ZC9H 2B7DH 1YPHC 4FUDA 1HDTH 2F9BH 3RXFA 3QUMP 1CT0E 1YM0A 4ISHH 4NSVA 1Z8IB 2A5IA 3VFEA 1S84A 4ABHA 2Z9GA 5E8EH 2WPIS 5GDSH 1HFDA 1FAKH 1SGCA 1TFXA 1T8NA 1GGDC 1NU7B 2C8ZB 4ABAA 2VIQA 3E8LA 4A5TS 5A8YA 3F6UH 1ZYOA 4B74A 1C1QA 1CBWC 1GI8B 2FOFA 2GT8A 2NU3E 4IW4E 4ZMAH 2DUCA 2WPHS 1HAYB 2GCTC 1AWHB 1TMBH 3P17H 2BD4A 1GBFA 3QK1A 3RXSA 5EW1H 3DUXH 4DW2U 1A3BH 3O8DA 3F1SB 1O3FA 3SU3A 2ZIQH 1AZZA 3LJOA 6CHAC 2CHAC 3E6PH 3BV9B 1CE5A 1EP6A 2AFQB 2BXUH 2VU8E 3SU6A 1FIWA 2BY8X 1O2VA 3SJ8A 3V3MA 2FYRA 3QGJA 1G3BA 1F0UA 1DANH 1RJXB 3SNCA 1AFQB 2GMTB 4NIYA 1F7ZA 1QRXA 2RA3A 5A09A 1Q2WA 4BTUB 1P02A 2A2QH 1LPZB 2BD2A 4CH8B 1SFQB 3RMLH 3L6PA 4BAKB 1ABJH 3JZ2B 4AFZA 5DP7A 1O3PB 2SNVA 3RM0H 1ZTLA 2XYAA 4YOGA 1AUTC 1TBQH 4RKOB 3ZZAA 3LGTA 1TNGA 2O8TA 4U32A 2Y82A 3K6YA 3HKJB 5CE1A 2D2DA 3SV6A 2ZFQH 2HRVA 1O32A 4I8JA 4ABIA 4E06H 1IQHA 4MVNA 4NCYA 2FPZA 5GJ4B 1VITH 1BBRE 2D8WA 2ZDKA 6ESTA 2BVRH 1AVXA 1GBJA 2Y7ZA 3A84A 2O8UA 1CGHA 3DT0H 2V6NA 2QF3A 1P2OA 5AFYH 2SGFE 3V0XA 2IJOB 5L2YH 3LGVA 4AORA 1ZGVA 3PROA 1CU1A 1WQVH 2XWAA 2O8MA 3MH7A 3ATMA 4Y7BA 1GI0A 1O3EA 1BMMH 2HGTH 2THFB 1FIZA 1T31A 1DUAA 4ZXXH 5AF9H 2QIQA 2ZCHP 1K1OA 1NU9A 1BTUA 1K1JA 2GCHF 3KIDU 4GPGA 1H9LB 1XUFA 1RIWC 5B6OA 1CHGA 2FLBH 1G2LA 1O3GA 1E34B 1LQEA 1IQFA 4U2WA 3M7UA 4IMZA 1J15A 4TPYA 2WPJS 2UUYA 1GI7B 2J9NA 1YPJH 1MTNC 1S6HA 2J34A 3A8CA 4NZLA 1DE7H 3RXCA 3RU4D 1SGEE 1EATA 2FTMA 1MBQA 3FFGA 2BD8A 2NU0E 1A61H 1ANEA 3SORA 1QJ6B 1YBWA 1IQLA 1C5ZB 5DPAA 2F83A 3PLKA 4CR5A 1AUJA 4MNXA 1W2KH 1EX3A 2ZECA 2VGCB 2OUAA 6LPRA 2XCFA 1EPTB 1WYKA 2SGAA 2DE9A 3EGKH 3SUDA 4XBDA 3TH4H 3D23A 4QT8C 2TGPZ 1F5KU 1EAWA 1Y5AT 1AD8H 1N8OB 1GJDB 4R0IA 1CHOF 1EZSC 1PPZA 1GHAF 1MTUA 2PW8H 3TITA 3BIVH 1FZZA 2H1UA 4INHA 3I29A 2FESH 3BTDE 1W7XH 2OCVB 1D4PB 2ZHQH 3TK6A 4NA9H 1MD8A 5C67A 7ESTE 2HNTC 2ANKH 1GMHG 2F9NA 1DDJA 3KQEA 2ASUB 4ABDA 1S83A 1O3KA 2OC0A 3LJJA 3P92A 1TMTH 2XXLA 4ABBA 1C5PA 1UTPA 1L1GA 1SGQE 1AGJA 2BDAA 3PO1B 1C5OH 1XUGA 2PWXA 3QO6A 3M3TA 1FN8A 1UMAH 2P93A 5CHAB 2VVCA 1VZQH 3CENA 3H7OA 1C5RA 1HAVB 2FMJA 4HTCH 2QAAA 3SNEA 4DCDA 3SJ9A 3TH2H 1B0FA 2ZDNA 3GYMA 5DO4H 1MZAA 3RXMA 3TU7H 1GVLA 1GBAA 2PSXA 5TJXA 4HI3A 3EQ0H 4E7RG 4AG1A 1IAUA 3PMAB 2Y7XA 1V2ST 2OQ5A 5C3NA 1YPLH 3ZZ3A 1JWTA 1S85A 1IQIA 1O3IA 2GZ8A 4KGAA 1HAGE 1DWDH 3BEUA 3AAUA 1EXFA 1O3OA 5C1XA 1GBDA 3BTQE 4X8VH 5I25A 3RXKA 1E38B 1GG6B 2GP9B 4MPVA 4WF8A 1QR3E 1TPPA 4ISLA 3S0NA 1WOFA 5DG6A 1Y3WA 1PQ7A 5FHTA 3T2NA 4Q2KA 3VEQB 5EODA 3SHAH 1GBBA 3PLBA 1G32B 1QRZA 3SU1A 1AO5A 1P2JA 4X1PU 3DA9B 3UWJH 1BMLA 4AZ2B 4H6SB 1QB9A 3Q3KA 4B73A 4OGYA 3ZZ7A 1O36A 5TCCA 1E35B 1V2PT 3BTHE 5K7RA 1GDUA 3VB7A 3KN2A 3STJA 7LPRA 4LZ4B 2V3OH 3AW1A 1QTFA 1K9OE 4X1QU 2GVFA 1ACBE 3RXRA 4ISIH 1WQSA 1TABE 3S9CA 1ZRKA 5J4SA 2ZTZA 3R3GB 1P9SA 3GCOA 1BBRH 1A1RA 2GCHG 3TIUA 3T27A 2LPRA 2P3UB 4IMQA 2FXRA 1HV7A 1V2MT 1MH0A 3GY7A 1L0ZA 1V3XA 3NWUA 1QQ4A 5FPSA 2EC9H 4BXSA 4K8YA 3V13A 4CRAA 4I8HA 4K1TA 4I8LA 2O9QA 2ODQA 2Z9IA 3D65E 3UTUH 2QF0A 1TQ0B 1GJ8B 4Y76A 1BTXA 2H9TH 1TRNA 1DOJA 2W7SA 1DX5M 4Y0YE 1MBMA 2SGQE 4BNRA 3QTVH 3HKIB 3SU5A 5C1UA 1TBRH 3UNQA 1FY5A 1ZJDA 2CXVA 2ZGXH 4D7FA 2Q6GA 4HGCA 3LH1A 1TPOA 4Y6DA 4M7GA 4ZKRU 2ODPA 3JZ1B 1P2MA 3GOVB 1ESTA 1VCQA 3M61U 1CHOG 1C1PA 2NU1E 1C5UA 2HLCA 5FX5A 1GHAG 1C1MA 1HJAB 1O5FH 2QCYA 3D62A 1YF4A 3MH4A 4KTSA 5FCKA 1SSXA 1MZDA 1J8AA 3GYLB 4IN1A 5DP8A 3RUOA 1NO9H 1O39A 4INLA 5ESTE 1TRYA 5SGAE 4JK6A 3T62A 3ZV9A 3O8CA 2Y80A 3M5NA 5EOKA 1SMFE 4MPXA 1ZSJA 1K1MA 1FPCH 4WXVA 1NFUA 1XXFA 1NRNH 3A88A 4IC5A 1LQDB 1THRH 3P8GA 1IQGA 1KDQB 1LVOA 1EPTA 2ZQ1A 2G4TA 1DWCH 3R0FA 3SN8A 4AB8A 2D1JA 4Y0ZE 1BTHH 1BCUH 3MHWU 2FOAA 4ZHMU 5EPNA 2ZZUH 1FY4A 3MU8A 3ZZBA 1HLTH 4MNVA 1YCPM 2R3UA 2PSYA 4E05H 1F5RA 4Y11E 1GHBF 2FZZA 2BDYA 2BD5A 4UDWH 3MU5A 1UVOA 1H8DH 2JH6D 2I6SA 1NFYA 2BLOA 5BRRE 1EAXA 4O03A 3RC4A 2P8OB 4CR9A 1TPAE 2ANYA 5A0AE 1BRAA 1C5XB 2XC5A 3STIA 2HPPH 3TNTA 5C5OA 1GCTB 3RXGA 3P70B 4O3UA 1A0JA 4WMDA 1DT2A 1EASA 3B8JA 1OWDA 4I7YH 1AFQC 2CMYA 3M3VA 2GMTC 1ELAA 3SI4H 1TGTA 1TLDA 1VCWA 2ZF0H 2Y81A 2BVXH 2J95A 1LHCH 2AMQA 1IQEA 1HAVA 1UTQA 4DY7B 1RTLA 2SNWA 2PGQB 1DITH 1GJ5H 2BX3A 1QCPA 1P09A 2FI3E 1W11U 1MKXH 1XKAC 2JETB 1INCA 1S82A 3Q77A 1SGNE 1V2JT 2GX4A 2J2UA 1V2TT 9ESTA 1YPHE 4H42U 5FX6A 3KGPA 3F68H 5DP3A 1BBRK 1FY3A 1A4WH 4CRGA 1AMHA 1O3HA 1SI5H 2BLWA 1UVPA 1H9IE 1KY9A 4MPUA 5LGOA 3FAOA 1YLCA 3MTYA 3PV4A 3P8OA 4TY7A 1B5GH 1IHTH 3NKKA 2YOLA 1O2ZA 4WXIA 1EKBB 4BAOB 1DICA 2R2WU 1PQ5A 2GGVB 4K3JA 4OS4A 3A87A 1OWEA 3S7KB 1BA8B 3UNRA 2H6MA 1GJ9B 1A0HB 1EAIA 4K5ZA 1C2GA 1O2PA 3MNBA 3M37A 3HGNA 2WV4A 1YLDA 1BRCE 4D7GA 5JBAS 1UTNA 3SQEE 1H9HE 1GI9B 1ZZZA 1QB1A 1DWEH 3EYDA 3I78A 4XFQA 3SJKA 1C2EA 4AG2A 5GIBA 5GCHG 1GL0E 2WV5A 3M5LA 1JRTA 3U8OH 1UO6A 1NM6A 1K1LA 1V2KT 1ETRH 1A46H 1BIOA 3V12A 1KTSB 2TGTA 1ID5H 4B71A 3BTEE 5LPFA 3UQOA 2TGDA 1P03A 5L30H 1P01A 4AGJA 3GY4A 1WV7H 4HZHA 3IITA 2VGCC 1OWJA 2B0FA 4CREA 1EPTC 1G2MA 1Z8JB 2R9PA 3H7TA 4BAHB 3DHKH 3LU9B 5A8ZA 1N6YA 4FVDA 1N8OC 1QA7A 3LGUA 1P2QA 1AN1E 2QGRA 3LDXH 1O30A 4CRBA 3U8TH 1MQ6A 3KQDA 5ETXA 2GV6A 4XBBA 1D6WA 3OTJE 1C5QA 1DLKB 4LOYH 3ITIA 1ZSKA 2G00A 4DIHH 1MTVA 1C9PA 1KXFA 2FS9A 4JYTA 3TJVA 1GL1A 1GI3A 8GCHG 1YCPH 2TBSA 4NA8A 1ZPBA 1A3EH 3PO1C 1AKSB 1KXEA 3WY8A 1LVBA 1DSUA 1GHBG 1NPMA 2EI6A 2HALA 2A7CA 1ETSH 1NC6A 2FDAA 3H5CB 1PYTD 1OP0A 2ZO3H 1JIRA 2VWMA 5CHAC 1AHTH 3O8RA 1GBMA 4K69A 4X6OA 2C8XB 3SNBA 1GJ6A 1T4VH 1GMHF 1K1PA 2ZGJA 1QL7A 4ABGA 3K9XB 1RD3B 1IQKA 1G3CA 1Z1JA 3GY8A 3E91A 2PTNA 3CS7A 4B2BA 1C4U2 1OS8A 3M35A 3ZZ4A 1KDQA 1MKXK 1V2WT 1F0TA 2AEIH 2ZDAH 4OS7A 5EGMA 3LT3A 1AZ8A 2G8TA 4I8KA 1GJAB 4HFPB 1ELVA 1A5HA 1DXPA 1KLJH 3FANA 2O8LA 4NWKA 3QGNB 4KP0A 3F9EA 1QBOA 1SGYE 3CS0A 1HGTH 3N7OA 3PM3A 1QNJA 4PROA 3ZZDA 1Y5BT 1GG6C 1NS3A 2V0BA 4XOJA 1UVTH 4YOJA 1KXCA 1GVZA 1P12E 4UFDH 5AHGH 1AVGH 1DSTA 2A7JA 1DXWA 2H9EH 3A83A 4FVBA 3HPTB 2Z7FE 2CJIA 4YESB 1O5CB 1Z8GA 1S5SA 3AW0A 4JZ1A 2A4QA 2Y6TA 3E90B 2HNTE 3ZZ5A 1MCTA 2AGIX 4UD9H 2K1QA 4I33A 3U9AH 1O2JA 1LHFH 4SGBE 5E0HA 5J4QA 4LZ1H 1Y3VA 1K22H 4K1EA 4A1XA 3SUEA 1Y3UA 2BY6X 5EG4A 3ZZ6A 2GDDA 2NU4E 3BTTE 1PPFE 2SFAA 1DY9A 1C2IA 4DOQA 1MD7A 4OS5A 1AWFH 1H8IH 1BITA 1SQOA 5H4IB 4ZXYH 4RKJB 1WSSH 1SBWA 1C9TA 5JDUB 2XCNA 3ATWA 1SHHB 2VIOA 2W3KA 1GI2A 3RXHA 4LXBH 3DD2H 3RXUA 1YPGH 3GY3A 4AFSA 1KTTB 1V2NT 1O35A 3Q3XA 2VB0A 1UHBB 3PWCA 1SG8B 5A2MH 3KF2A 3U1IB 3LOXA 2VWNA 1GBHA 2CGAA 3MH5A 3ZV8A 2GV7A 2A32A 3KL6A 3SO3A 3TH3H 1V2LT 2Z6BD 3SUFA 1BJVA 1KYNA 1ZRBA 4Q7YA 2AS9A 2OTVA 4MTBA 1ZOMA 1CO7E 2A45B 4X8SH 4TWWA 2CF8H 4WH6A 4Y71A 2BVSH 1PYTC 2FOGA 2ZHFH 1C2MA 2FOHA 1C5WB 5A8XA 3RU4E 3BIUH 2WINI 1QJ1B 1YCPK 3GY6A 2YNAA 3EA9A 2W5EA 2VH6A 3K65B 2QV1A 1Y8TA 1ZMJA 1X7AC 7GCHF 1ELFA 4ISNA 1SB1H 2QC2A 1W13U 3O8BA 4AFUA 4WJG2 1L1NA 4CBOA 3A82A 1O2MA 2PR3A 4JK5A 1O31A 4IN2A 1BOQA 1SOTA 4K2YA 4ZUHA 2BD7A 1OX1A 2BQWB 2ESTE 2OC8A 1D9IA 4Y79A 1RXPA 3E16B 2BY5X 5G4BA 1RTFB 1QY6A 1C2LA 1CA8B 1HXFH 3S7HB 3GICB 5E2PA 1UK2A 1VGCB 2GZ7A 3ZVBA 2PKAB 4TWYA 4CRDA 1O3BA 1TA6A 1GJBB 1FXYA 1Z8RA 1O3AA 3LPRA 1LDTT 4X2XA 2P8OC 5E0JA 1PPGE 3LONA 1GCTC 4UONA 1HB0B 8LPRA 2FX6A 5DP4A 4RN6A 4LK4A 1O34A 3A89A 2VINA 1AKSA 3RXDA 1C2HA 4UFFH 3RXVA 1NROH 1J9CH 2ZU3A 4JYUH 2XWBI 3K2UA 3ESTA 1QJ7B 4ASHA 1PPHE 2JETC 2GTBA 4NIVA 1NRPH 1L4ZA 2P3TB 4FU8A 2HWLB 1SGFA 3FP6E 3EDXB 1FDPA 3RC5A 1XVMA 4B2CA 2QXJA 3KQBA 5JYIA 1C1OA 4JZIA 2Q6DA 1LKBA 2ZFRH 3ODFA 3PLPA 2G5VA 2Y5HA 4ZH8A 4A1TA 1JRSA 3TGJE 2AMDA 3LGIA 2UWOA 3A85A 4ABJA 4FUCA 2ZPRA 1B7XB 1OSSA 1SQTA 1O3LA 2VIPA 4FUFA 2C8WB 1BDAA 2ZDVH 1NTPA 4IC6A 2XNIA 2GDEH 1TOCB 3SBKA 1BTPA 2WPMS 2PV9B 2FOBA 3K6ZA 2Y5FA 1ZHMA 1FPHH 1P0SH 1V6DA 4ZHLU 1OKXA 1C5LH 3T28A 2R0LA 2BY9X 3M7QA 4BAQB 3A7ZA 1D3PB 2F9UA 1G36A 3GDUA 3S9BA 3UREA 3AAVA 1UK4A 3KEEA 1FUJA 2ZI2H 3RMMH 3GY5A 4FUHA 3C1KA 2BMGB 1P8VC 1UK3A 2FYQA 3RXJA 1YPMH 1F2SE 1GJCB 3BTWE 2FOMB 3RXIA 4UFGH 1Z7KA 4YLQH 3V7TA 1UVSH 1GVKB 4Y10E 3RXQA 1D6RA 4YZUA 1KLTA 2PKSC 5GCHF 4BAMB 2BLVA 3TJUA 2B5TB 3A8DA 1CT4E 2EI7A 1GBCA 3LGYA 1TNJA 2A7HA 2ZGCA 3HK6B 2BM2A 3BTGE 3NXPA 1UHBA 1O3CA 4MG3A 1GHZA 1TRMA 2Q1JA 2ZHEH 4FU7A 7GCHG 3F9FA 1TBZH 2BXTH 3NK8A 3DFLA 1TNLA 1O2HA 2BDGA 1Q31A 4FUIA 4B1TA 3EE0B 3OY5U 1S0QA 4X1SU 1IQJA 3T5FH 2AYWA 2BDBA 4ZAEA 3IWMA 1O2GH 2EA3A 1TX8A 3QDZB 3BG8A 4KTUA 3LIWA 1ZLRA 2P59A 3MYWA 3GISB 4FXGH 4JMYA 2RDLA 1L1JA 1AY6H 2PUQH 2ZNKH 1WTHD 4MLFB 1ZPZA 2AMPA 5EQQA 3TK9A 3QZRA 2FI5E 3BG4B 1PJPA 1K21H 3UY9A 2XW9A 4A6LA 3MI4A 1N6XA 3PWBA 2VH0A 1OYTH 3RLYH 1XXDA 3L3TA 3RC6A 3RXBA 2A2XH 1T8LA 2FLRH 1L2EA 1XM1A 5EQSA 5JBBS 2FX4A 8GCHF 4X6PA 2UUFB 2HVXA 2ZDMA 1C5TA 3P8NA 1DVAH 4AYVB 1VCPA 1O2SA 2PGBB 2BQ7B 3L33A 3GDSA 3U69H 4U30A 1LVYA 5HGGA 2VIWA 1UJ1A 1D3TB 1BRBE 1HAXB 1TA2A 4AYYB 3FZZA 2A4OA 1MUEB 1TX6A 3UOPA 3ZZCA 1ELEE 1TX7A 4FU9A 1AIXH 1WTGH 2EEKA 1GHXH 3UOUA 1CT2E 2AERH 5ABWA 2D26C 1PQAA 1UTMA 3MU1A 2KAIB 1M9UA 2PKAA 1EP5A 5EPYA 1O2QA 1BT7A 3UR9A 4I32A 5FAHA 3HGPA 4XDEA 1WUNH 1LTOA 1C1TA 1KLIH 1F0RA 3ZVFA 1TB6H 1GHWH 1GMDF 3A86A 2J38A 1GHVH 2Z9LA 4NFFA 4SGAE 4GUXA 1W7GH 2HNTF 3GCTF 3NZIA 1Z1IA 1P10A 1NRRH 3E3TA 2H9HA 1PPCE 1T32A 1T7CA 4Y8ZA 1CGIE 1OP2A 3AVZA 1TMUH 2ZGBH 3BEFB 3TNSA 2F9VA 1OYQA 1A5GH 1YYY1 4F49A 2BZ6H 1ELDE 3GCNA 1FY8E 2W7UA 4D76A 1HBTH 2IPHA 7KMEH 4JYVH 2TGAA 1P06A 1XX9A 5LH8A 3GCHB 2ZP0H 2G55A 3TVJB 1RFNA 1EB1H 5AFZH 4B76A 1C5VA 4YOIA 3Q00A 1AE8H 1PPEE 3RMOH 1V2QT 1BHXF 4OGXA 3MO6A 1O5EH 1P9UA 2P16A 1HRTH 2BD9A 2ZU4A 2V35A 3SU0A 1AVWA 1P2KA 4DGJA 1C2FA 1DWBH 3SOSA 1P11E 4ZKSU 4UFEH 1VJ9U 4Q80A 3T25A 2OXSA 2ZA5A 3OY6U 4K8BA 3A80A 5FBEA 3SV8A 1HXEH 3AASA 2I6QA 3EA7A 4A92A 1CSOE 5F03A 1SVPA 3PMHB 1O5AB 2A31A 1TIOA
chains in the Genus database with same CATH superfamily
4I31A 1PQ8A 2H2ZA 5JBTA 1GCDA 4UEHH 4YO9A 3SJIA 5T6GA 1ORFA 3OU0A 5C1YA 4ZKNU 1RS0A 1SQAA 2VWLA 1SLUB 8ESTE 1GMCF 2BDIA 1GDQA 4MPWA 1XUIA 1QIXB 2TIOA 4WY3A 3FP8E 4RT1A 2KCPA 4ZROA 3A81A 3DSPA 1A0LA 3VGCB 1TGBA 2EQNA 4AGKA 1QL9A 1CA0B 1YGCH 4FETA 3VB4A 2QN5T 1FJSA 2ZU2A 4FUGA 3W1EA 2CN0H 2ZTXA 4MDSA 1EB2A 2ILNA 4BTTB 1E0FD 3NPSA 5BPEA 2HOBA 1C5NH 1O5DH 3C27B 4X1NU 2OC1A 2ALVA 2PHBA 1MQ5A 1C1WH 4B6EA 1MTSA 1UTOA 2G51A 4VGCB 3RXOA 1HAOH 4GCHG 4XBCA 1FI8A 1HCGA 2FOCA 3IG6B 1D3DB 2ZKSA 1RRKA 2KCAA 3ZZ9A 2XC0A 4MQAA 1QA0A 2GD4B 1VJAU 1HAHH 1PFXC 1VGCC 3URCA 1BRUP 2V3HH 5E2OA 2FIRH 1TWXB 3ZZ8A 1IHSH 5F8TA 5F8XA 4NGAH 5PTPA 5HM2A 4KTCA 1FV9A 2J5UA 2BOKA 4TSFD 5HYOA 2AH4X 4BTIB 2F91A 1P57B 1BTZA 3BF6H 4R8TB 3LH3A 1NN6A 1GDNA 1GJ7B 5FPYA 1QL8A 4ABFA 4DVAU 2Z3DA 1GI4A 2RA0A 5EXNA 5JBCS 2FEQH 1G37A 1YPEH 1YKTA 2VIDA 1DPOA 2QXIA 1O2LA 3UPEA 1K1NA 4Y7AA 1BTYA 1CGJE 1Y5UT 5JB8S 5L2ZH 4WVPE 2EI8A 1SC8U 1IQNA 2FODA 1GMDG 1K1IA 1FMGA 2G4UA 4X8TH 3SJOA 1FQ3A 1OWHA 2FWWA 3E1XB 4DJZB 1TYNA 3GCTG 4NA7A 2BQ6B 1LPKB 3RXPA 2XTTB 1S0RA 1O2TA 4AN7A 3TGKE 1ZGIA 3UB0A 5DP6A 1Z71A 5ESBA 2RFKC 1W8BH 2OQUA 2ZFSA 4Q7XA 1EZXC 1A7SA 1T8MA 1MAXA 1XUHA 4GVUA 3QTOH 2KAIA 3OSYA 2BX4A 1J14A 1GPZA 1NRQH 3PTNA 3P95A 5A0CA 2CV3A 2QXGA 1GBEA 3A7VA 3ELAH 3MO3A 1HIAB 5DKMA 1NBME 1NRSH 3QLPH 3B23B 1KSNA 3HK3B 3LKWA 4IS5A 5IDKA 1NESE 2W3IA 5CMXH 4DT7B 2UUJB 4YM9A 1HUTH 1GWAA 1TE0A 2NU2E 1H4WA 3M5OA 1XUKA 3E0PB 1AFEH 1C4V2 2VNTA 2W26A 3MNCA 4CHAB 2SGEE 1TONA 1TGCA 2F43B 3RM2H 4YLUA 1KIGH 1LHDH 4GHQA 1WCZA 2B9LA 4MNWA 1MCVA 1E36B 4O97A 1AB9B 1MMJN 2PTCE 1HPGA 4K60A 2P94A 2ZU5A 1O2IA 1HYLA 1IQMA 2ZHDA 1OPHB 1XUJA 5FPTA 2VVUA 2PUXB 5FBIA 1O0DH 1G3DA 1GMCG 2A4GA 2F3CE 4DG4A 3S69A 2XBXA 5TCAA 2Z9JA 1TPSA 3B9FH 3BTKE 1BB0B 4I8GA 1GJ4H 4GHTA 1OWKA 2V7QD 2FI4E 2G5NA 2QY0B 2SGDE 1DFPA 2C3SA 4Q7ZA 4TYDA 1TQ7B 3BTME 5DP9A 3U1JB 1SPJA 1RTKA 1LKAA 3GDVA 4O3TA 4X8UH 1GBLA 1MAYA 3PMBB 2WYJA 3SHCH 2FO9A 3KHVA 3BSQA 1NFWA 2A5AA 5GXPA 1SOZA 1ANBA 1CVWH 1THSH 1DY8A 1ELBA 2ULLA 3PB1E 1WU1A 4JCNA 1ELCA 1FONA 3ZVAA 9LPRA 3OX7U 1SHYA 1HJAC 1TGNA 2H5DA 4HG6A 2F9PA 4THNH 1BTWA 1JMOH 1P04A 1RGQA 2SGPE 4Y8YA 1UCYE 3Q3YA 1G30B 1BZXE 3TJNA 4YXWD 3MNSA 1KXDA 2VVVA 1BQYA 4WMEA 1C1VH 1A2CH 1BMNH 1GBTA 4NWLA 2Z9KA 1SQRA 5GPIB 3BG4C 4F4OC 5AVDA 3SU4A 1CQQA 4GSOA 3Q76A 3SGBE 2P95A 1OHHD 3SV9A 1FAXA 3URDA 3SV7A 2KX4A 1KXAA 1O2KA 4KKDA 3H09A 1UTJA 1GI1A 4IBLH 3GS9A 2C8YB 1JXPA 1H1BA 1NY22 2LNCA 1GHYH 1O3JA 4BOHA 1P05A 1LPGB 1ESBA 2OD3B 2O8WA 5F8ZA 1TGSZ 2PP6A 5LPRA 4AX9H 5EXMA 3PRBA 1OXGA 2W6JD 5C5NA 1ETTH 2BZAA 2OC7A 5F53A 4XE4A 3TLOA 4ASUD 2WPKS 2YNBA 3MFJA 3QWCH 1G3EA 4D9QA 1O2OA 3OAAD 2ZWLH 4AFQA 1EZQA 1O2YA 1SGDE 1U6QA 1ESAA 2BD3A 8KME2 1E37B 4IGDA 1ANDA 2ZHWH 1N1LA 4FUJA 2R3YA 5T6DA 2FS8A 1SGPE 2DE8A 4GLYA 4JZEH 2VWOA 1LMWB 1MU6B 4Z0KA 1ZTJA 1W0KD 1TNKA 1EJAA 3ATIA 3MMGA 1SLVB 3E0NB 3N99A 4AB9A 3BN9A 1HJ8A 2ZEBA 1SGFG 1A5IA 1EFRD 2UUKB 1ELTA 1O3MA 1HAPH 2A1DB 2G52A 2QA9E 1GGDB 2G81E 4JZDH 1DS2E 3EAJA 4NSYA 1F92A 1QURH 2NWNA 4YT7H 2BDCA 2Z3CA 3GCHC 1CBWB 2ZQ2A 1VITF 1QHRB 4A7IB 4ZKOU 2GCTB 2PLXA 4O9VA 1J17T 5HMAA 3W94A 4YT6H 1W12U 3MU0A 4KELA 1PPBH 1C1NA 3RU4T 3RMNH 1HJ9A 1EOJA 4ABEA 2RDEA 4GAWA 4Y8XA 3SQHE 1WBGB 1P2NA 1O2RA 6CHAB 2C4FH 1TNIA 4OS6A 2CHAB 5IYTA 3A8AA 1W0YH 3EA8A 4H6TA 2A5KA 1OOKB 4MNYA 2QXHA 2ZG0H 4WWYA 1THPB 4TPIZ 1ABIH 1ZPCA 1FY1A 1W0ZU 3M3SA 2OLGA 4YTAA 3VB3A 1QBVH 3ZIAD 3FZDA 4X6NA 1ZHPA 1C1UH 1O37A 2BTCE 1HIAA 2ZDLA 2H5CA 2WPDD 1HAZB 3PTBA 2J92A 2STAE 2XBVA 4NG9H 4ISOA 2GT7A 5DK1A 3U8RH 1W3CA 2FTLE 1F5LA 1W10U 4X0WU 3SNDA 2OP9A 2ZFPH 2GKVE 2R2MB 2IN2A 1NFXA 1UVUH 3ENSB 1K28D 3F0PA 4BXWA 2QF4A 3DFJA 2ZTYA 3MWIU 3QX5H 2AHME 4J1YA 1LHEH 3P6ZB 2FP7B 4INKA 1SL3A 1TNHA 3VGCC 3ZYEA 3SUGA 1BMFD 1O33A 2JH5D 4U01A 1CA0C 1OP8A 2OINA 5T3HA 3FOAA 4B2AA 3P8FA 4CRCA 1SLWB 6GCHF 1LVMA 3MH6A 4OS1A 3UFAA 1O2NA 4TT3D 5T6FA 2XRCA 1C1SA 3ZYDA 4JZFH 1P3EA 2UWPA 3UIRA 2ZCLP 1S6FA 3SZNA 3UR6A 4AOQA 1ARCA 4VGCC 4FOUC 3VXEH 5EW2H 2JH0D 1EOLA 3MO9A 4X6MA 3QN7A 2OBQA 2WUCA 2A4RA 3MOCA 1ZHRA 4H4FA 2ZFTA 1D3QB 1RIWB 1YPKH 1T4UH 2B8OH 1J16A 3G01A 1SFIA 4CRFA 5C94A 1BMAA 1QQUA 1QB6A 2GZ9A 3A8BA 2V3MA 1MTNB 3ZVDA 3LC3A 3HATH 4Z6AH 3UWIA 4X1RU 1ZMLA 1Y3YA 1UCYH 1QBNA 5EU8A 5KGOA 3PYHA 4GCHF 3UQVA 3RP2A 3ZVGA 4D8NA 5HM9A 1MKWH 2Q6FA 3SYJA 1FNIA 3FVFB 1Y3XA 2HPQH 2RCEA 3CP7A 4ESTE 3ODDA 2WPLS 5F6MA 2BDHA 3KNXA 4E7NA 1G9IE 1XVOA 1GI6A 1MTWA 3KCGH 3MNXA 4UE7H 2IOTA 3OEED 2VIVA 5C20A 3ATKA 2VJ1A 1UTLM 3OYPA 2J98B 3SU2A 2ZCKP 1V2VT 1IOEA 1TOMH 4FUBA 1O2XA 1EUFA 5GNDA 2AIPA 1GBKA 3RXTA 3I77A 2BOHB 3LC5A 3UUZA 5FCRA 2BB4A 1C2JA 4BANB 1KXBA 4FUEA 3ATLA 4NZQA 1VR1H 1QGFA 3M36A 5DP5A 1XKBC 2JKHA 1K2I1 2BLQA 4K1SA 4X2VA 1JBUH 2Z94A 1VITG 2PFEA 3M5MA 1S81A 2OBOA 1AU8A 4X2WA 3RLWH 2Z3EA 3PMJA 1O5GH 2STBE 3F9HA 1HAIH 3D49H 3BTFE 4XSKU 1DLEA 1O5BB 2ZFFH 3GY2A 1B0EA 1QRWA 2ANMH 1V2RT 2FM2A 3BEIB 1BHXB 3M7TA 2J94A 3A7WA 1Y59T 4A1VA 1YC0A 1T8OA 2QYIA 1O3NA 4CHAC 2AGEX 3F2GA 4WMFA 5DJ7A 5C0TA 2WYGA 2TRMA 1XMNB 1AB9C 3SNAA 1JIMA 1SLXB 1YP9A 2BHGA 2XC4A 1OWIA 3FP7E 5I46H 5EXLA 1ELGA 1C2DA 2AGGX 4NIXA 5HIZA 1C4Y2 3A7TA 1EAUA 4D9RA 1FN6A 5GWZA 1ZJKA 2WUBA 4TY6A 1EJMA 2BY7X 2ZGHA 1F0SA 3A7XA 5JPMH 3RXEA 4DIIH 1HNEE 4NIWA 1ARBA 2TPIZ 1L4DA 1BJUA 5DGJA 2JJ1D 1Z6JH 6GCHG 3TJOA 5CHBA 1DUEA 3T29A 3RXAA 4B75A 5E0GA 2M5TA 1QFKH 1SGIB 2ANWA 3SV2H 3SW2B 3VXFH 1BUIA 1P3CA 1V2OT 3VB6A 4ZHAA 2P3FH 3MU4A 3N7EA 3WWFA 1WAYB 2Y5GA 5FXLA 1C5MD 3S9AA 1GBIA 1Q3XA 1SR5C 2FOEA 3UNSA 1COWD 1UTKA 2ZU1A 4WH8A 1SGTA 3KQCA 1GI5A 1LCYA 1FLEE 3A7YA 1UCYK 4RSPA 3VB5A 2A0QB 2R0KA 3NCLA 1C1RA 3DSGA 1MKWK 1AE5A 2C93B 3CNRA 1EQ9A 1O2UA 3ZVCA 2RG3A 3RXLA 4DURA 3W95A 1EZUC 5K0HA 2ALPA 3F9GA 1ZMNA 1ZTKA 2AIQA 3SGQE 1C5YB 3T26A 3F2FA 1C2KA 1ZR0A 3LGWA 5EQRA 4X2YA 1ANCA 2PKSB 1JOUB 3QZQA 5LPEA 2F4LA 1C5SA 3U98H 3TK5A 5JB9S 1Z6EA 5HXFA 1AI8H 5C2ZA 1SGRE 2BYAX 2IJD1 3TGIE 3NUMA 2XBWA 2C90B 3SGAE 3ZVEA 1TALA 1AQ7A 1ZSLA 1O2WA 2ODYB 1NT1A 1LHGH 1NZQH 5A0BA 1P2IA 1LO6A 2ZPSA 1O3DA 4OS2A 1DM4B 3TPIZ 2ZPQA 2J4IA 2XBYA 3MQKC 3VG8A 1EJNA 2CF9H 2F9OA 4CH2B 1V2UT 4J2YB 1MU8B 4CBNA 1W14U 3SI3H 2EY4C 1O38A 5L6NH 1TAWA 4NFEA 3VPKA 1KMHB 3RDZA 2UWLA 2ZC9H 2B7DH 1YPHC 4FUDA 1HDTH 2F9BH 2KCYA 3RXFA 3QUMP 1CT0E 1YM0A 4ISHH 4NSVA 1Z8IB 2A5IA 3VFEA 1S84A 2OK5A 4ABHA 2Z9GA 5E8EH 2WPIS 5GDSH 1HFDA 1FAKH 1SGCA 1TFXA 1T8NA 1GGDC 1NU7B 2C8ZB 4ABAA 2VIQA 3E8LA 4A5TS 5A8YA 3F6UH 3KYFA 1ZYOA 4B74A 1C1QA 1CBWC 1GI8B 2FOFA 2GT8A 2NU3E 3DSOA 4IW4E 2J98A 3U28C 4ZMAH 2DUCA 2WPHS 1HAYB 2GCTC 1AWHB 1TMBH 3F0OA 3P17H 2BD4A 1GBFA 3QK1A 3RXSA 5EW1H 2JDID 3DUXH 4DW2U 1A3BH 3O8DA 3F1SB 1O3FA 2KCOA 3SU3A 2ZIQH 1AZZA 3LJOA 6CHAC 2CHAC 3E6PH 3BV9B 1CE5A 1EP6A 2AFQB 2BXUH 2VU8E 3SU6A 1FIWA 2BY8X 1O2VA 3SJ8A 3V3MA 2FYRA 3QGJA 1G3BA 5EJLA 1F0UA 1DANH 1RJXB 3SNCA 1AFQB 2GMTB 4NIYA 1F7ZA 1QRXA 2RA3A 5A09A 1Q2WA 4BTUB 1P02A 2A2QH 1LPZB 2BD2A 4CH8B 1SFQB 3RMLH 3L6PA 5EJZA 4BAKB 1ABJH 3JZ2B 4AFZA 5DP7A 1O3PB 2SNVA 3RM0H 1ZTLA 2XYAA 4YOGA 1AUTC 1TBQH 4RKOB 3ZZAA 3LGTA 1TNGA 2O8TA 4U32A 2Y82A 3K6YA 3HKJB 5CE1A 2D2DA 3SV6A 2ZFQH 2HRVA 1O32A 4I8JA 4ABIA 4E06H 1IQHA 4MVNA 4NCYA 2FPZA 5GJ4B 1VITH 1BBRE 2D8WA 2ZDKA 6ESTA 2CK3D 2BVRH 1AVXA 1GBJA 2Y7ZA 3A84A 2O8UA 1CGHA 3DT0H 2V6NA 2QF3A 1P2OA 5AFYH 5C17A 2SGFE 3V0XA 2IJOB 5L2YH 3LGVA 4AORA 1ZGVA 3PROA 1CU1A 1WQVH 2WZQA 2XWAA 2O8MA 1K0HA 3MH7A 3ATMA 4F55A 4Y7BA 1GI0A 1O3EA 1YWUA 1BMMH 2HGTH 2THFB 1FIZA 1T31A 1DUAA 4ZXXH 5AF9H 2QIQA 2ZCHP 1K1OA 1NU9A 1BTUA 1K1JA 2GCHF 3KIDU 4GPGA 1H9LB 1XUFA 1RIWC 5B6OA 1CHGA 2QE7D 2FLBH 1G2LA 1O3GA 1E34B 1LQEA 1IQFA 4U2WA 3M7UA 4IMZA 1J15A 4TPYA 2WPJS 2UUYA 1GI7B 2J9NA 1YPJH 1MTNC 1S6HA 2J34A 3A8CA 1YY3A 4NZLA 1DE7H 2LELA 3RU4D 3RXCA 1SGEE 1EATA 2FTMA 1MBQA 3FFGA 2BD8A 2NU0E 1A61H 1ANEA 4ACAA 3SORA 1QJ6B 1YBWA 1IQLA 1C5ZB 5DPAA 2F83A 3PLKA 4CR5A 4B6FA 1AUJA 4M9FA 1E79D 4P02A 4MNXA 1W2KH 1EX3A 2ZECA 2VGCB 2OUAA 6LPRA 2XCFA 1EPTB 1WYKA 2SGAA 2DE9A 3EGKH 3SUDA 4XBDA 3TH4H 3D23A 4QT8C 2TGPZ 1F5KU 1EAWA 1WDIA 1Y5AT 1AD8H 1N8OB 1GJDB 4R0IA 1CHOF 1EZSC 1PPZA 1GHAF 1MTUA 2PW8H 3TITA 3BIVH 1FZZA 2H1UA 4INHA 3I29A 4P00A 2FESH 3BTDE 1W7XH 2OCVB 1D4PB 2ZHQH 3TK6A 4NA9H 1MD8A 5C67A 7ESTE 4I86A 2HNTC 2ANKH 1GMHG 2F9NA 1DDJA 3KQEA 2ASUB 4ABDA 1S83A 1O3KA 2OC0A 3LJJA 3P92A 1TMTH 2XXLA 4ABBA 1C5PA 1UTPA 1L1GA 1SGQE 1AGJA 2BDAA 3PO1B 3FN8A 1C5OH 1XUGA 2PWXA 3QO6A 3M3TA 1FN8A 1UMAH 2P93A 5CHAB 2VVCA 1VZQH 3CENA 1E1QD 3H7OA 1C5RA 1HAVB 2FMJA 4HTCH 2QAAA 2QF5A 3SNEA 4DCDA 3SJ9A 3TH2H 1B0FA 2ZDNA 3GYMA 5DO4H 1MZAA 3RXMA 3TU7H 1GVLA 1GBAA 2PSXA 5TJXA 4HI3A 3EQ0H 4E7RG 2K8IA 4AG1A 1IAUA 3PMAB 2Y7XA 1V2ST 2OQ5A 5C3NA 1YPLH 3ZZ3A 1JWTA 1S85A 1IQIA 1O3IA 2GZ8A 4KGAA 1HAGE 1DWDH 3BEUA 3AAUA 1EXFA 1O3OA 5C1XA 1GBDA 2YMSB 3BTQE 4X8VH 5I25A 3RXKA 1E38B 1GG6B 2GP9B 4MPVA 4WF8A 1QR3E 1TPPA 4ISLA 3S0NA 1WOFA 5DG6A 1Y3WA 1PQ7A 5FHTA 3T2NA 4Q2KA 3VEQB 5EODA 3SHAH 1GBBA 3PLBA 5DSFA 1G32B 1QRZA 3SU1A 1AO5A 1P2JA 4X1PU 3DA9B 3UWJH 1BMLA 4AZ2B 4ACBA 4H6SB 1QB9A 3Q3KA 4B73A 4OGYA 3ZZ7A 1O36A 5TCCA 1E35B 2KM0A 1V2PT 3BTHE 5K7RA 1GDUA 3VB7A 3KN2A 3STJA 7LPRA 4LZ4B 2V3OH 3AW1A 1QTFA 1K9OE 4X1QU 2GVFA 1ACBE 3RXRA 4ISIH 1WQSA 1TABE 3S9CA 1ZRKA 5J4SA 2ZTZA 3R3GB 1P9SA 2IPQX 3GCOA 1BBRH 1A1RA 2GCHG 3TIUA 3T27A 2LPRA 2P3UB 4IMQA 2FXRA 1HV7A 1V2MT 1MH0A 3GY7A 1L0ZA 1V3XA 3NWUA 1QQ4A 5FPSA 2EC9H 4BXSA 4K8YA 3V13A 4CRAA 4I8HA 4K1TA 4I8LA 2O9QA 2ODQA 2Z9IA 3D65E 3UTUH 2QF0A 1TQ0B 1GJ8B 4Y76A 1BTXA 2H9TH 1TRNA 1DOJA 3FO8D 2W7SA 1DX5M 3N7DA 4Y0YE 1MBMA 2SGQE 4BNRA 3QTVH 2W6ID 3HKIB 3SU5A 5C1UA 1TBRH 3UNQA 1FY5A 1ZJDA 2CXVA 2ZGXH 4D7FA 2Q6GA 4HGCA 3LH1A 1TPOA 4Y6DA 4M7GA 4ZKRU 2ODPA 3JZ1B 1P2MA 3GOVB 1ESTA 1VCQA 3M61U 1CHOG 1C1PA 2NU1E 1C5UA 2HLCA 5FX5A 1GHAG 1C1MA 2WHXA 1HJAB 1O5FH 2QCYA 3D62A 1YF4A 3MH4A 4KTSA 5FCKA 1SSXA 1MZDA 1J8AA 3GYLB 4IN1A 5DP8A 3OFND 3RUOA 1NO9H 1O39A 4INLA 5ESTE 1TRYA 5SGAE 4JK6A 3T62A 3ZV9A 3O8CA 2Y80A 3M5NA 5EOKA 1SMFE 4MPXA 1ZSJA 1K1MA 1FPCH 4WXVA 1NFUA 1XXFA 1NRNH 3A88A 4IC5A 1LQDB 1THRH 3P8GA 1IQGA 1KDQB 1LVOA 1EPTA 2ZQ1A 2G4TA 1DWCH 3R0FA 3SN8A 4AB8A 2D1JA 4Y0ZE 1BTHH 1BCUH 3MHWU 2FOAA 4ZHMU 5EPNA 1H8HD 2ZZUH 1FY4A 3MU8A 3ZZBA 1HLTH 4MNVA 1YCPM 2R3UA 2PSYA 4E05H 1F5RA 4Y11E 1GHBF 2FZZA 2BDYA 2BD5A 4UDWH 3MU5A 1UVOA 1H8DH 2JH6D 2I6SA 1NFYA 2BLOA 5BRRE 1EAXA 4O03A 3RC4A 2P8OB 4CR9A 1TPAE 2ANYA 5A0AE 1BRAA 1C5XB 2XC5A 3STIA 2HPPH 4AC9A 3TNTA 4RT0A 5C5OA 1GCTB 3RXGA 3P70B 4O3UA 1A0JA 1MABB 4WMDA 1DT2A 1EASA 3B8JA 1OWDA 4I7YH 1AFQC 2CMYA 5B6LA 3M3VA 2GMTC 1ELAA 3SI4H 1TGTA 1TLDA 1VCWA 2ZF0H 2Y81A 2BVXH 2J95A 1LHCH 2AMQA 1IQEA 1HAVA 1UTQA 4DY7B 1RTLA 2SNWA 2PGQB 1DITH 1GJ5H 2FI3E 2BX3A 1P09A 1QCPA 1W11U 1FX0B 1MKXH 1XKAC 2JETB 1INCA 1S82A 3Q77A 3SZEA 1SGNE 1V2JT 2GX4A 2J2UA 1V2TT 9ESTA 5EJ1A 1YPHE 4H42U 5FX6A 3KGPA 3F68H 5DP3A 1BBRK 1FY3A 1A4WH 4CRGA 1AMHA 1O3HA 1SI5H 2BLWA 1UVPA 1H9IE 1KY9A 4MPUA 5LGOA 3FAOA 1YLCA 3MTYA 3PV4A 3P8OA 4TY7A 1B5GH 1IHTH 3NKKA 2YOLA 1O2ZA 4WXIA 1EKBB 2KR7A 4BAOB 1DICA 2R2WU 1PQ5A 2GGVB 4K3JA 4OS4A 3A87A 4Q63A 1OWEA 3S7KB 1BA8B 3UNRA 2H6MA 1GJ9B 1A0HB 1EAIA 4K5ZA 1C2GA 1O2PA 2YMSD 3MNBA 3M37A 3KQ5A 3HGNA 2WV4A 1YLDA 1BRCE 3FKSD 3PV2A 4D7GA 5JBAS 1UTNA 3SQEE 1H9HE 1GI9B 1ZZZA 1QB1A 1DWEH 3EYDA 3I78A 4XFQA 3SJKA 1C2EA 4AG2A 5GIBA 4RI0A 5GCHG 1GL0E 2WV5A 3M5LA 1JRTA 3AK5A 3U8OH 1UO6A 1NM6A 1K1LA 3OE7D 1V2KT 1ETRH 1A46H 1BIOA 3V12A 1KTSB 4DT4A 2TGTA 1ID5H 4B71A 3BTEE 5LPFA 3UQOA 2TGDA 1P03A 4XRNA 5L30H 1P01A 4AGJA 1WXRA 3GY4A 1WV7H 4HZHA 3IITA 1W0JD 5HIYA 2VGCC 1OWJA 2B0FA 4CREA 1EPTC 1G2MA 1Z8JB 2R9PA 3H7TA 4BAHB 3DHKH 3LU9B 5A8ZA 1N6YA 4FVDA 1N8OC 1QA7A 2J97A 3LGUA 1P2QA 1AN1E 2QGRA 3LDXH 1O30A 4CRBA 3U8TH 1MQ6A 5KECA 3KQDA 3F3BA 5ETXA 2GV6A 4XBBA 1D6WA 3OTJE 5C0UA 1C5QA 1DLKB 4LOYH 3ITIA 1QZ8A 1ZSKA 2G00A 4DIHH 1MTVA 1C9PA 1KXFA 2FS9A 4JYTA 3TJVA 1GL1A 1GI3A 8GCHG 1YCPH 2TBSA 4NA8A 1ZPBA 1A3EH 1SKYE 3PO1C 2XOKD 1AKSB 1KXEA 3WY8A 1LVBA 1DSUA 1GHBG 1NPMA 2EI6A 2HALA 2A7CA 1ETSH 1NC6A 2FDAA 3H5CB 1PYTD 1OP0A 2ZO3H 1JIRA 2VWMA 5CHAC 1AHTH 3EE7A 3O8RA 1GBMA 4K69A 4X6OA 2C8XB 3SNBA 1GJ6A 1T4VH 1GMHF 1K1PA 2ZGJA 1QL7A 4ABGA 3NRLA 3K9XB 1RD3B 1IQKA 1G3CA 1Z1JA 3GY8A 3E91A 2PTNA 3CS7A 4B2BA 1C4U2 1OS8A 3M35A 3ZZ4A 1KDQA 1MKXK 1V2WT 1F0TA 2AEIH 2ZDAH 4OS7A 5EGMA 3LT3A 1AZ8A 2G8TA 4I8KA 1GJAB 4HFPB 1ELVA 1A5HA 1DXPA 1KLJH 3FANA 2O8LA 4NWKA 3QGNB 4KP0A 2YMSC 3F9EA 1QBOA 1SGYE 3CS0A 1HGTH 3N7OA 3PM3A 1QNJA 4PROA 3ZZDA 1Y5BT 1GG6C 1NS3A 2V0BA 4XOJA 1UVTH 4YOJA 1KXCA 1GVZA 1P12E 4UFDH 5AHGH 1AVGH 1DSTA 2A7JA 1DXWA 2H9EH 3A83A 4FVBA 3HPTB 2Z7FE 2CJIA 4YESB 1O5CB 1H8ED 1S5SA 1Z8GA 1NBMD 5DN6D 4Q4LA 3AW0A 4JZ1A 2HVYB 2KZ4A 2A4QA 2Y6TA 3E90B 2HNTE 5FL7D 3ZZ5A 1MCTA 2AGIX 4UD9H 2K1QA 4I33A 3U9AH 1O2JA 1LHFH 4SGBE 5E0HA 4F48B 5J4QA 4LZ1H 2L74A 1Y3VA 1K22H 4K1EA 4A1XA 3SUEA 1Y3UA 2BY6X 5EG4A 3ZZ6A 2GDDA 2NU4E 3BTTE 1PPFE 2SFAA 3PV5A 1DY9A 1C2IA 4DOQA 1MD7A 4OS5A 1AWFH 1H8IH 4ZCNA 1BITA 2WSSD 1SQOA 5H4IB 4ZXYH 4RKJB 1WSSH 1SBWA 1C9TA 5JDUB 2XCNA 3ATWA 1SHHB 2VIOA 2W3KA 1GI2A 3RXHA 4LXBH 3DD2H 2GJGA 3RXUA 1YPGH 3GY3A 4AFSA 1KTTB 1V2NT 1O35A 3Q3XA 2VB0A 1UHBB 3PWCA 1SG8B 5A2MH 3KF2A 3U1IB 3LOXA 2VWNA 1GBHA 2CGAA 3MH5A 3ZV8A 2GV7A 2A32A 3KL6A 3SO3A 3TH3H 1V2LT 2Z6BD 3SUFA 1BJVA 1KYNA 1ZRBA 4Q7YA 2AS9A 2OTVA 4MTBA 1ZOMA 1CO7E 2A45B 4X8SH 2LP6A 4TWWA 2CF8H 4WH6A 2WV9A 3F2HA 4Y71A 2BVSH 1PYTC 2FOGA 2ZHFH 1C2MA 2FOHA 1C5WB 5A8XA 3RU4E 3BIUH 2XNDD 2WINI 1QJ1B 1YCPK 3GY6A 2YNAA 3EA9A 2W5EA 2VH6A 3K65B 2QV1A 1Y8TA 1ZMJA 1X7AC 7GCHF 1ELFA 4XD7D 4ISNA 1SB1H 2QC2A 2VBCA 1W13U 3O8BA 4AFUA 4WJG2 1L1NA 4CBOA 3A82A 1O2MA 2PR3A 4JK5A 1O31A 2KFWA 4IN2A 1BOQA 1SOTA 4K2YA 4ZUHA 2BD7A 1OX1A 2BQWB 2ESTE 2OC8A 1D9IA 4Y79A 1RXPA 3E16B 2BY5X 5G4BA 1RTFB 1QY6A 1C2LA 1CA8B 1HXFH 2K0QA 3GICB 3S7HB 5E2PA 1UK2A 1VGCB 2GZ7A 3ZVBA 1UW7A 2PKAB 4TWYA 4CRDA 1O3BA 1TA6A 1GJBB 1FXYA 1Z8RA 1O3AA 3LPRA 1LDTT 4X2XA 2P8OC 5E0JA 2L6OA 1PPGE 3WWBA 3LONA 1GCTC 4UONA 1HB0B 8LPRA 2FX6A 5DP4A 4RN6A 4LK4A 1O34A 3A89A 2VINA 1AKSA 3RXDA 1C2HA 4UFFH 3RXVA 1NROH 1J9CH 2ZU3A 4JYUH 2XWBI 3K2UA 3ESTA 1QJ7B 4ASHA 1PPHE 2JETC 2GTBA 4NIVA 1NRPH 1L4ZA 2P3TB 4FU8A 2HWLB 3KYGA 1SGFA 3FP6E 3EDXB 1FDPA 3RC5A 1XVMA 4B2CA 2QXJA 2HLDD 3KQBA 5JYIA 1C1OA 4JZIA 2Q6DA 1LKBA 2ZFRH 1E1RD 3ODFA 3PLPA 2G5VA 2Y5HA 4ZH8A 4A1TA 1JRSA 3TGJE 2AMDA 3LGIA 2UWOA 3A85A 4ABJA 4FUCA 2ZPRA 1B7XB 1OSSA 1SQTA 1O3LA 2VIPA 4FUFA 2C8WB 1BDAA 2ZDVH 1NTPA 4IC6A 2XNIA 2GDEH 1TOCB 3SBKA 1BTPA 2WPMS 2PV9B 2FOBA 3K6ZA 2Y5FA 1ZHMA 1FPHH 1P0SH 1V6DA 4ZHLU 1OKXA 1C5LH 3T28A 2R0LA 2BY9X 3DCLA 3M7QA 4BAQB 3A7ZA 1D3PB 2F9UA 1G36A 3GDUA 3S9BA 3UREA 3AAVA 1UK4A 3KEEA 1FUJA 2ZI2H 3RMMH 3GY5A 4FUHA 2JIZD 3C1KA 2BMGB 1P8VC 2JJ2D 1UK3A 2FYQA 3RXJA 5CDFE 1YPMH 1F2SE 1GJCB 3BTWE 2FOMB 3PRDA 3RXIA 4UFGH 1Z7KA 4YLQH 3V7TA 1UVSH 1GVKB 4Y10E 3RXQA 5KEDA 3UAIC 1D6RA 4YZUA 1KLTA 2PKSC 1YLNA 5GCHF 4BAMB 2BLVA 3TJUA 2B5TB 3A8DA 1CT4E 2EI7A 1GBCA 1VKYA 3LGYA 1TNJA 2A7HA 2ZGCA 3HK6B 3OTPA 2BM2A 3BTGE 3NXPA 1UHBA 1O3CA 4MG3A 1GHZA 1TRMA 2Q1JA 3WW7A 2ZHEH 4FU7A 7GCHG 3F9FA 1TBZH 2BXTH 3NK8A 3DFLA 1TNLA 1O2HA 2BDGA 1Q31A 4FUIA 4B1TA 3EE0B 3OY5U 1S0QA 4X1SU 1IQJA 3T5FH 2AYWA 2BDBA 4ZAEA 3IWMA 1O2GH 2EA3A 1TX8A 3QDZB 3BG8A 4KTUA 3LIWA 1ZLRA 2P59A 3MYWA 4Z1MD 3GISB 4FXGH 4JMYA 2RDLA 1L1JA 1AY6H 2PUQH 2ZNKH 1WTHD 4MLFB 1ZPZA 2AMPA 5EQQA 3TK9A 5T1VA 3QZRA 2FI5E 3BG4B 1PJPA 1K21H 3UY9A 2XW9A 4A6LA 3MI4A 1N6XA 3PWBA 2VH0A 1OYTH 3RLYH 2M2AA 1XXDA 3L3TA 3RC6A 3RXBA 2A2XH 1T8LA 2FLRH 1L2EA 1XM1A 5EQSA 5JBBS 2FX4A 8GCHF 4X6PA 2UUFB 2HVXA 2ZDMA 1C5TA 3P8NA 1DVAH 4AYVB 1VCPA 1O2SA 2PGBB 2BQ7B 3L33A 3GDSA 4OM9A 4U30A 3U69H 1LVYA 5HGGA 2VIWA 1UJ1A 1D3TB 1BRBE 1HAXB 1TA2A 4AYYB 3FZZA 2A4OA 1MUEB 1TX6A 3UOPA 3ZZCA 1ELEE 1TX7A 4FU9A 1AIXH 1WTGH 2EEKA 1GHXH 3UOUA 2AERH 1CT2E 1S6LA 2D26C 1PQAA 1UTMA 5ABWA 3MU1A 2KAIB 1M9UA 2PKAA 1EP5A 5EPYA 1O2QA 1BT7A 3UR9A 3OEHD 4I32A 5FAHA 3HGPA 4XDEA 1WUNH 1LTOA 1C1TA 1KLIH 1F0RA 3ZVFA 1TB6H 1GHWH 1GMDF 3A86A 2J38A 1GHVH 5IK2D 2Z9LA 4NFFA 4SGAE 4GUXA 1W7GH 2HNTF 3GCTF 3NZIA 1Z1IA 1P10A 1NRRH 3E3TA 2H9HA 1PPCE 1T32A 1T7CA 4Y8ZA 1CGIE 1OP2A 3AVZA 1TMUH 2ZGBH 3BEFB 3TNSA 2F9VA 1OYQA 1A5GH 1YYY1 4F49A 2BZ6H 1ELDE 3GCNA 1FY8E 2W7UA 4D76A 1HBTH 2IPHA 7KMEH 4JYVH 2TGAA 1P06A 1XX9A 5EIYA 5LH8A 3GCHB 2ZP0H 2G55A 3TVJB 1RFNA 1EB1H 5AFZH 4B76A 1C5VA 4YOIA 3Q00A 1AE8H 1PPEE 3RMOH 1V2QT 1BHXF 4OGXA 3MO6A 1O5EH 1P9UA 2P16A 1HRTH 2BD9A 2ZU4A 5HKKD 2V35A 3SU0A 1AVWA 1P2KA 4DGJA 1C2FA 1DWBH 3SOSA 1P11E 4ZKSU 4UFEH 1VJ9U 4Q80A 3T25A 2OXSA 2ZA5A 3OY6U 4K8BA 3A80A 5FBEA 3SV8A 1HXEH 3AASA 2I6QA 3EA7A 4A92A 1CSOE 5F03A 1SVPA 3PMHB 1O5AB 2A31A 1TIOA
chains in the Genus database with same CATH topology
4I31A 1PQ8A 2H2ZA 5JBTA 1GCDA 4UEHH 4YO9A 3SJIA 5T6GA 1ORFA 3OU0A 5C1YA 4ZKNU 1RS0A 1SQAA 2VWLA 1SLUB 8ESTE 1GMCF 2BDIA 1GDQA 4MPWA 1XUIA 1QIXB 2TIOA 4WY3A 3FP8E 4ZROA 3A81A 1A0LA 3VGCB 1TGBA 4AGKA 1QL9A 1CA0B 1YGCH 3VB4A 2QN5T 1FJSA 2ZU2A 4FUGA 2CN0H 2ZTXA 4MDSA 1EB2A 2ILNA 4BTTB 1E0FD 3NPSA 5BPEA 2HOBA 1C5NH 1O5DH 3C27B 4X1NU 2OC1A 2ALVA 2PHBA 1MQ5A 1C1WH 1MTSA 1UTOA 2G51A 4VGCB 3RXOA 1HAOH 4GCHG 4XBCA 1FI8A 1HCGA 2FOCA 3IG6B 1D3DB 2ZKSA 1RRKA 3ZZ9A 2XC0A 4MQAA 1QA0A 2GD4B 1VJAU 1HAHH 1PFXC 1VGCC 3URCA 1BRUP 2V3HH 5E2OA 2FIRH 1TWXB 3ZZ8A 1IHSH 5F8TA 5F8XA 4NGAH 5PTPA 5HM2A 4KTCA 1FV9A 2BOKA 5HYOA 2AH4X 4BTIB 2F91A 1P57B 1BTZA 3BF6H 4R8TB 3LH3A 1NN6A 1GDNA 1GJ7B 5FPYA 1QL8A 4ABFA 4DVAU 2Z3DA 1GI4A 2RA0A 5EXNA 5JBCS 2FEQH 1G37A 1YPEH 1YKTA 2VIDA 1DPOA 2QXIA 1O2LA 3UPEA 1K1NA 4Y7AA 1BTYA 1CGJE 1Y5UT 5JB8S 5L2ZH 4WVPE 2EI8A 1SC8U 1IQNA 2FODA 1GMDG 1K1IA 1FMGA 2G4UA 4X8TH 3SJOA 1FQ3A 1OWHA 2FWWA 3E1XB 4DJZB 1TYNA 3GCTG 4NA7A 2BQ6B 1LPKB 3RXPA 2XTTB 1S0RA 1O2TA 4AN7A 3TGKE 1ZGIA 5DP6A 1Z71A 5ESBA 1W8BH 2OQUA 2ZFSA 4Q7XA 1EZXC 1A7SA 1T8MA 1MAXA 1XUHA 4GVUA 3QTOH 2KAIA 3OSYA 2BX4A 1J14A 1GPZA 1NRQH 3PTNA 3P95A 5A0CA 2CV3A 2QXGA 1GBEA 3A7VA 3ELAH 3MO3A 1HIAB 5DKMA 1NRSH 3QLPH 3B23B 1KSNA 3HK3B 3LKWA 4IS5A 5IDKA 1NESE 2W3IA 5CMXH 4DT7B 2UUJB 4YM9A 1HUTH 1GWAA 1TE0A 2NU2E 1H4WA 3M5OA 1XUKA 3E0PB 1AFEH 1C4V2 2VNTA 2W26A 3MNCA 4CHAB 2SGEE 1TONA 1TGCA 3RM2H 4YLUA 1KIGH 1LHDH 4GHQA 1WCZA 2B9LA 4MNWA 1MCVA 1E36B 4O97A 1AB9B 1MMJN 2PTCE 1HPGA 4K60A 2P94A 2ZU5A 1O2IA 1HYLA 1IQMA 2ZHDA 1OPHB 1XUJA 5FPTA 2VVUA 2PUXB 5FBIA 1O0DH 1G3DA 1GMCG 2A4GA 2F3CE 4DG4A 3S69A 2XBXA 5TCAA 2Z9JA 1TPSA 3B9FH 3BTKE 1BB0B 4I8GA 1GJ4H 4GHTA 1OWKA 2FI4E 2G5NA 2QY0B 2SGDE 1DFPA 2C3SA 4Q7ZA 4TYDA 1TQ7B 3BTME 5DP9A 3U1JB 1SPJA 1RTKA 1LKAA 3GDVA 4O3TA 4X8UH 1GBLA 1MAYA 3PMBB 2WYJA 3SHCH 2FO9A 3KHVA 3BSQA 1NFWA 2A5AA 5GXPA 1SOZA 1ANBA 1CVWH 1THSH 1DY8A 1ELBA 2ULLA 3PB1E 1WU1A 4JCNA 1ELCA 1FONA 3ZVAA 9LPRA 3OX7U 1SHYA 1HJAC 1TGNA 2H5DA 2F9PA 4THNH 1BTWA 1JMOH 1P04A 1RGQA 2SGPE 4Y8YA 1UCYE 3Q3YA 1G30B 1BZXE 3TJNA 3MNSA 1KXDA 2VVVA 1BQYA 4WMEA 1C1VH 1A2CH 1BMNH 1GBTA 4NWLA 2Z9KA 5GPIB 3BG4C 4F4OC 5AVDA 3SU4A 1CQQA 4GSOA 3Q76A 3SGBE 2P95A 3SV9A 1FAXA 3URDA 3SV7A 1KXAA 1O2KA 4KKDA 1UTJA 1GI1A 4IBLH 2C8YB 1JXPA 1H1BA 1NY22 2LNCA 1GHYH 1O3JA 4BOHA 1P05A 1LPGB 1ESBA 2OD3B 2O8WA 5F8ZA 1TGSZ 5LPRA 4AX9H 5EXMA 1OXGA 5C5NA 1ETTH 2BZAA 2OC7A 3TLOA 4XE4A 2WPKS 2YNBA 3MFJA 3QWCH 1G3EA 4D9QA 1O2OA 2ZWLH 4AFQA 1EZQA 1O2YA 1SGDE 1U6QA 1ESAA 2BD3A 8KME2 1E37B 4IGDA 1ANDA 2ZHWH 1N1LA 4FUJA 2R3YA 5T6DA 2FS8A 1SGPE 2DE8A 4GLYA 4JZEH 2VWOA 1LMWB 1MU6B 4Z0KA 1ZTJA 1TNKA 1EJAA 3ATIA 3MMGA 1SLVB 3E0NB 4AB9A 3BN9A 1HJ8A 2ZEBA 1SGFG 1A5IA 2UUKB 1ELTA 1O3MA 1HAPH 2A1DB 2G52A 2QA9E 1GGDB 2G81E 4JZDH 1DS2E 3EAJA 4NSYA 1F92A 1QURH 2NWNA 4YT7H 2BDCA 2Z3CA 3GCHC 1CBWB 2ZQ2A 1VITF 1QHRB 4A7IB 4ZKOU 2GCTB 2PLXA 4O9VA 1J17T 5HMAA 3W94A 4YT6H 1W12U 3MU0A 4KELA 1PPBH 1C1NA 3RU4T 3RMNH 1HJ9A 1EOJA 4ABEA 4GAWA 4Y8XA 3SQHE 1WBGB 1P2NA 1O2RA 6CHAB 2C4FH 1TNIA 4OS6A 2CHAB 5IYTA 3A8AA 1W0YH 3EA8A 4H6TA 2A5KA 1OOKB 4MNYA 2QXHA 2ZG0H 4WWYA 1THPB 4TPIZ 1ABIH 1ZPCA 1FY1A 1W0ZU 3M3SA 2OLGA 4YTAA 3VB3A 1QBVH 3FZDA 4X6NA 1ZHPA 1C1UH 1O37A 2BTCE 1HIAA 2ZDLA 2H5CA 1HAZB 3PTBA 2J92A 2STAE 2XBVA 4NG9H 4ISOA 2GT7A 5DK1A 3U8RH 1W3CA 2FTLE 1F5LA 1W10U 4X0WU 3SNDA 2OP9A 2ZFPH 2GKVE 2R2MB 2IN2A 1NFXA 1UVUH 3ENSB 1K28D 4BXWA 3DFJA 2ZTYA 3MWIU 3QX5H 4J1YA 1LHEH 3P6ZB 2FP7B 4INKA 1SL3A 1TNHA 3VGCC 3ZYEA 3SUGA 1O33A 2JH5D 4U01A 1CA0C 1OP8A 2OINA 5T3HA 4B2AA 3P8FA 4CRCA 1SLWB 6GCHF 1LVMA 3MH6A 4OS1A 3UFAA 1O2NA 5T6FA 2XRCA 1C1SA 3ZYDA 4JZFH 1P3EA 2UWPA 3UIRA 2ZCLP 1S6FA 3SZNA 3UR6A 4AOQA 1ARCA 4VGCC 3VXEH 5EW2H 2JH0D 1EOLA 3MO9A 4X6MA 3QN7A 2OBQA 2WUCA 2A4RA 3MOCA 1ZHRA 4H4FA 2ZFTA 1D3QB 1RIWB 1YPKH 1T4UH 2B8OH 1J16A 3G01A 1SFIA 4CRFA 1BMAA 1QQUA 1QB6A 2GZ9A 3A8BA 1MTNB 3ZVDA 3LC3A 3HATH 4Z6AH 3UWIA 4X1RU 1ZMLA 1Y3YA 1UCYH 1QBNA 5EU8A 3PYHA 4GCHF 3UQVA 3RP2A 3ZVGA 4D8NA 5HM9A 1MKWH 2Q6FA 1FNIA 3FVFB 1Y3XA 2HPQH 2RCEA 3CP7A 4ESTE 3ODDA 2WPLS 5F6MA 2BDHA 3KNXA 4E7NA 1G9IE 1XVOA 1GI6A 1MTWA 3KCGH 3MNXA 4UE7H 2IOTA 2VIVA 5C20A 3ATKA 2VJ1A 1UTLM 3OYPA 3SU2A 2ZCKP 1V2VT 1IOEA 1TOMH 4FUBA 1O2XA 1EUFA 2AIPA 1GBKA 3RXTA 3I77A 2BOHB 3LC5A 3UUZA 5FCRA 2BB4A 1C2JA 4BANB 1KXBA 4FUEA 3ATLA 4NZQA 1VR1H 1QGFA 3M36A 5DP5A 1XKBC 2JKHA 1K2I1 2BLQA 4K1SA 4X2VA 1JBUH 2Z94A 1VITG 2PFEA 3M5MA 1S81A 2OBOA 1AU8A 4X2WA 3RLWH 2Z3EA 3PMJA 1O5GH 2STBE 3F9HA 1HAIH 3D49H 3BTFE 4XSKU 1DLEA 1O5BB 2ZFFH 3GY2A 1B0EA 1QRWA 2ANMH 1V2RT 2FM2A 3BEIB 1BHXB 3M7TA 2J94A 3A7WA 1Y59T 4A1VA 1YC0A 1T8OA 2QYIA 1O3NA 4CHAC 2AGEX 4WMFA 5DJ7A 2WYGA 2TRMA 1XMNB 1AB9C 3SNAA 1JIMA 1SLXB 1YP9A 2BHGA 2XC4A 1OWIA 3FP7E 5I46H 5EXLA 1ELGA 1C2DA 2AGGX 4NIXA 1C4Y2 3A7TA 1EAUA 4D9RA 1FN6A 5GWZA 1ZJKA 2WUBA 4TY6A 1EJMA 2BY7X 2ZGHA 1F0SA 3A7XA 5JPMH 3RXEA 4DIIH 1HNEE 4NIWA 1ARBA 2TPIZ 1L4DA 1BJUA 5DGJA 1Z6JH 6GCHG 3TJOA 1DUEA 3T29A 3RXAA 4B75A 5E0GA 2M5TA 1QFKH 1SGIB 2ANWA 3SV2H 3SW2B 3VXFH 1BUIA 1P3CA 1V2OT 3VB6A 4ZHAA 2P3FH 3MU4A 1WAYB 2Y5GA 5FXLA 1C5MD 3S9AA 1GBIA 1Q3XA 1SR5C 2FOEA 3UNSA 2ZU1A 1UTKA 4WH8A 1SGTA 3KQCA 1GI5A 1LCYA 1FLEE 3A7YA 1UCYK 4RSPA 3VB5A 2A0QB 2R0KA 3NCLA 1C1RA 1MKWK 1AE5A 2C93B 1EQ9A 1O2UA 3ZVCA 2RG3A 3RXLA 4DURA 3W95A 1EZUC 5K0HA 2ALPA 3F9GA 1ZMNA 1ZTKA 2AIQA 3SGQE 1C5YB 3T26A 5EQRA 1C2KA 1ZR0A 3LGWA 4X2YA 1ANCA 2PKSB 1JOUB 3QZQA 5LPEA 1C5SA 3U98H 3TK5A 5JB9S 1Z6EA 5HXFA 1AI8H 5C2ZA 1SGRE 2BYAX 3TGIE 3NUMA 2XBWA 2C90B 3SGAE 3ZVEA 1TALA 1AQ7A 1ZSLA 1O2WA 2ODYB 1NT1A 1LHGH 1NZQH 5A0BA 1P2IA 1LO6A 2ZPSA 1O3DA 4OS2A 1DM4B 3TPIZ 2ZPQA 2J4IA 2XBYA 1EJNA 2CF9H 2F9OA 4CH2B 1V2UT 4J2YB 1MU8B 4CBNA 1W14U 3SI3H 5L6NH 1O38A 1TAWA 4NFEA 3VPKA 3RDZA 2UWLA 2ZC9H 2B7DH 1YPHC 4FUDA 1HDTH 2F9BH 3RXFA 3QUMP 1CT0E 1YM0A 4ISHH 4NSVA 1Z8IB 2A5IA 3VFEA 1S84A 4ABHA 2Z9GA 5E8EH 2WPIS 5GDSH 1HFDA 1FAKH 1SGCA 1TFXA 1T8NA 1GGDC 1NU7B 2C8ZB 4ABAA 2VIQA 3E8LA 4A5TS 5A8YA 3F6UH 1ZYOA 4B74A 1C1QA 1CBWC 1GI8B 2FOFA 2GT8A 2NU3E 4IW4E 4ZMAH 2DUCA 2WPHS 1HAYB 2GCTC 1AWHB 1TMBH 3P17H 2BD4A 1GBFA 3QK1A 3RXSA 5EW1H 3DUXH 4DW2U 1A3BH 3O8DA 3F1SB 1O3FA 3SU3A 2ZIQH 1AZZA 3LJOA 6CHAC 2CHAC 3E6PH 3BV9B 1CE5A 1EP6A 2AFQB 2BXUH 2VU8E 3SU6A 1FIWA 2BY8X 1O2VA 3SJ8A 3V3MA 2FYRA 3QGJA 1G3BA 1F0UA 1DANH 1RJXB 3SNCA 1AFQB 2GMTB 4NIYA 1F7ZA 1QRXA 2RA3A 5A09A 1Q2WA 4BTUB 1P02A 2A2QH 1LPZB 2BD2A 4CH8B 1SFQB 3RMLH 3L6PA 4BAKB 1ABJH 3JZ2B 4AFZA 5DP7A 1O3PB 2SNVA 3RM0H 1ZTLA 2XYAA 4YOGA 1AUTC 1TBQH 4RKOB 3ZZAA 3LGTA 1TNGA 2O8TA 4U32A 2Y82A 3K6YA 3HKJB 5CE1A 2D2DA 3SV6A 2ZFQH 2HRVA 1O32A 4I8JA 4ABIA 4E06H 1IQHA 4MVNA 4NCYA 2FPZA 5GJ4B 1VITH 1BBRE 2D8WA 2ZDKA 6ESTA 2BVRH 1AVXA 1GBJA 2Y7ZA 3A84A 2O8UA 1CGHA 3DT0H 2V6NA 2QF3A 1P2OA 5AFYH 2SGFE 3V0XA 2IJOB 5L2YH 3LGVA 4AORA 1ZGVA 3PROA 1CU1A 1WQVH 2XWAA 2O8MA 3MH7A 3ATMA 4Y7BA 1GI0A 1O3EA 1BMMH 2HGTH 2THFB 1FIZA 1T31A 1DUAA 4ZXXH 5AF9H 2QIQA 2ZCHP 1K1OA 1NU9A 1BTUA 1K1JA 2GCHF 3KIDU 4GPGA 1H9LB 1XUFA 1RIWC 5B6OA 1CHGA 2FLBH 1G2LA 1O3GA 1E34B 1LQEA 1IQFA 4U2WA 3M7UA 4IMZA 1J15A 4TPYA 2WPJS 2UUYA 1GI7B 2J9NA 1YPJH 1MTNC 1S6HA 2J34A 3A8CA 4NZLA 1DE7H 3RXCA 3RU4D 1SGEE 1EATA 2FTMA 1MBQA 3FFGA 2BD8A 2NU0E 1A61H 1ANEA 3SORA 1QJ6B 1YBWA 1IQLA 1C5ZB 5DPAA 2F83A 3PLKA 4CR5A 1AUJA 4MNXA 1W2KH 1EX3A 2ZECA 2VGCB 2OUAA 6LPRA 2XCFA 1EPTB 1WYKA 2SGAA 2DE9A 3EGKH 3SUDA 4XBDA 3TH4H 3D23A 4QT8C 2TGPZ 1F5KU 1EAWA 1Y5AT 1AD8H 1N8OB 1GJDB 4R0IA 1CHOF 1EZSC 1PPZA 1GHAF 1MTUA 2PW8H 3TITA 3BIVH 1FZZA 2H1UA 4INHA 3I29A 2FESH 3BTDE 1W7XH 2OCVB 1D4PB 2ZHQH 3TK6A 4NA9H 1MD8A 5C67A 7ESTE 2HNTC 2ANKH 1GMHG 2F9NA 1DDJA 3KQEA 2ASUB 4ABDA 1S83A 1O3KA 2OC0A 3LJJA 3P92A 1TMTH 2XXLA 4ABBA 1C5PA 1UTPA 1L1GA 1SGQE 1AGJA 2BDAA 3PO1B 1C5OH 1XUGA 2PWXA 3QO6A 3M3TA 1FN8A 1UMAH 2P93A 5CHAB 2VVCA 1VZQH 3CENA 3H7OA 1C5RA 1HAVB 2FMJA