5FDBA

Iron free rat cysteine dioxygenase r60qc164r variant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTQNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTRHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Iron free rat cysteine dioxygenase R60QC164R variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fdbA00
4Q0PA 5KBFA 1RL3A 1CAUA 4YRDA 4IEZA 2K9ZA 1WGPA 4WVZA 3DV8A 2QDRA 2MHFA 3CL1A 3RYPA 1FI2A 2ET7A 4GULA 5BPXA 3ROUA 3VHRA 1ZZ9A 3U0ZA 3NKTA 3WW4A 3O14A 1PMIA 2Y0OA 2BNMA 3JZVA 3H1YA 3D82A 3U11A 3FE5A 1J3PA 2O1QA 4XF1A 1VJ2A 3OD0A 1J3QA 3SMHA 2UY9A 3HIFA 2PHLA 1YLLA 3LA2A 2D5FA 1OMIA 4FAGA 2Q4SA 1CAUB 3L2HA 1OD5A 1X8MA 3RZZA 4XFAA 1NYWA 3FFQA 2XL7A 4XF9A 3ES4A 1G6NA 2ET1A 1CGPA 3IBMA 4A2UA 5D1IA 4UBGA 4BYYA 2UYAA 2WC2A 3I59A 1NE4A 4MH0E 1SFNA 4LEJA 3HQXA 4O9GA 1O3TA 5E1RA 2Z69A 3GYDA 3FWEA 4UXAA 4QM9A 3H1WA 3ZDSA 3KSCA 4META 1YHFA 3ELNA 1NXMA 1VR3A 4K8FA 4XFFA 3USSA 4PIYA 3SCGA 1Q43A 3CJXA 3KGZA 2UYBA 1X82A 3C3VA 4AXOA 1LB2A 4XFIA 1QWRA 5CU1A 5KHIA 1O3RA 1ZNPA 3HT1A 1YWKA 2CAUA 3MZHA 5CVRA 3RYKA 2IXJA 3I59B 1GQHA 1LKNA 3D0JA 3BALA 1SEFA 4LA2A 5FQ0A 4XF0A 3LWCA 1ZZ6A 3IDBB 2F4PA 1DZRA 1EP0A 3E97A 4QGMA 4EWDA 5I93A 4Z07A 3CLPA 3H1MA 4YSFA 3SHRA 4I2OA 5KHKA 4MGKE 1XE8A 1JUHA 2Q0AA 4FT8A 1Q5OA 4D7TA 1OI6A 3OGJA 1OFNA 1IPJA 4MGIE 1J3RA 5I8YA 3G7DA 2PFWA 4P9GA 2EVXA 4EROA 4E2QA 1HW5A 3S7EA 5FCCA 3EJKA 4HMZA 2QVSB 4N9HA 4R52A 2VQAA 4QMAA 4ONUA 2QCSB 5JR7B 4FAHA 1I6XA 2XLFA 4AVAA 4J1XA 2Z2SB 3QACA 3HT2A 2CGPA 1SQ4A 1WLTA 2QNKA 2OZJA 3LA3A 4QGNA 1ZZ8A 3SXWA 4I0BA 1RUNA 4HVQA 3SCHA 3H7JA 4HVOA 1O4TA 4QGLA 2IXCA 4IERA 3E6BA 5KHJA 5I8SA 4XETA 4NVPA 3NVCA 3PNAA 4AQ2A 1O3SA 4HZFA 1UW8A 5C6CA 3FJSA 1IPKA 4XEZA 1ZRDA 2EA7A 4KU7A 1O3QA 3RYRA 3ST7A 5I0UA 2MPFA 3QOPA 2C0ZA 3I54A 5JCTA 2OA2A 4R8HA 3EQEA 3WW2A 3RPQA 5FLHA 1FXZA 4L2NA 4Z82A 1UPIA 1X7NA 1Y9QA 2PAKA 5FPZA 4IEWA 4AVBA 1YUDA 3E5QA 2B8MA 3KMHA 2QJVA 5J7MA 1YFUA 2IC1A 2GC3A 2CAVA 3RDIA 1ZZCA 3DKWA 3E5UA 4IEYA 4ZU7A 5FPXA 3OCPA 3R6SA 3KCCA 2CV6A 4QM8A 2UY8A 2Q30A 1TQ5A 5E16A 1L3JA 2H6CA 1QXRA 1ZREA 1Y3TA 3NL1A 3OTFA 3TNQA 1RUOA 4PIXA 2MNGA 4MV2A 5HI0A 3CEWA 2D40A 2BGCA 3PLQA 1ZVFA 4L11A 1ZX5A 4HLTA 1VP6A 5AVPA 2IXHA 1J1LA 1DGRA 4LUMA 4IEVA 5BXXA 1UIJA 3EBRA 2GAUA 1O7FA 5J48A 2WFPA 1O5UA 3RNSA 3EO6A 4LA3A 2B9UA 4YYOA 2IXIA 4CYDA 4HN1A 4LUKA 4OLLA 4ORFA 4AQ6A 1QY4A 1RTVA 2O8QA 2OZ6A 4UBHA 4J1WA 3NW4A 4IEXA 4QXKA 3PVBB 4WZCA 4E2GA 3H50A 3ETQA 3BCWA 4I0AA 3H7YA 4XF4A 4HSLA 2PQQA 3LA7A 5JSOA 4HBNA 4I01A 5K8SA 3ACLA 4F7ZA 5I0TA 1UD1A 1YFYA 4D7SA 4EWAA 4IEOA 4MUVA 3DN7A 4TLFA 4X6RB 3H9AA 2VPVA 4I02A 4PJYA 2HJIA 1Q3EA 3SCFA 4Q0SA 1WA4A 4JVAA 2KXLA 5LRRA 1V70A 5I0RA 1H1IA 1O5LA 4IETA 4WBBA 2VECA 2ATFA 3H8UA 1ZRFA 3IIAA 1ZRRA 1CAXB 3H3UA 4HN0A 4BH9A 4IEPA 3S7IA 2XGXA 4Q0VA 3CO2A 3MPBA 4DINB 3LZZA 1DZTA 4MGZE 3BU7A 4BHPA 5BV6A 1RGSA 1LR5A 1NE6A 4PIZA 3MYXA 4EWEA 2XKOA 4XFBA 3KGLA 4Q0UA 2K0GA 2BEOA 4FBFA 2ETEA 3LOIA 4O9EA 3NSTA 2PYTA 2E9QA 4MZUA 4XFCA 4IEUA 3E6CC 3E5XA 5JAXA 2H6BA 1ZZ7A 4XFGA 3I7DA 1J58A 4KWLA 3LAGA 2BYVE 5BUVA 1YFXA 3TNPB 2PAMA 3M70A 1YFWA 2FQPA 4YNIA 1CAVA 3UKTA 3MDPA 2EAAA 1J59A 4X6QB 2PAEA 2XKPA 4Q0QA 3IWZA 1CX4A 1I5ZA 2HKXA 2XLGA 3FZ3A 3M3IA 2BNNA 4HSJA 3S0MA 4KWKA 2D93A 4JTNA 4N9IA 2B5HA 5BY5A 4AVCA 2PA7A 5I91A 2GC2A 4LTAA 1RC6A 4EV0A 3NJZA 1H1MA 2IXKA 5JSPA 3BB6A 4ZU5A 3B02A 4XFHA 1QXJA 2GC0A 2PTMA 2XLAA 3DL3A 1ZRCA 2N7GA 2XL9A 3UKNA 2OPKA 5I0SA 5C8WA 4KWJA 2OYZA 1U12A 4LULA 4MGYE 1CAVB 2GH2A 2Q1ZB 2ZCWA 3WW1A 5JSRA 2GC1A 3ES1A 2IXLA 5KHHA 5LEKA 4F8AA 4I09A 2I45A 4JTOA 4ZU4A 5I8TA 4XF3A 4IEQA 4RD7A 2H0VA 4BIFA 3WW3A 1CAWA 3UKVA 3IDCB 5CADA 4JV4A 3GBFA 1X8EA 4I3PA 5J3UA 1EY2A 5EFUA 2XHKA 3FX3A 3N4MA 4B29A 4Q29A 4YARA 3H3ZA 3OF1A 4HVRA 1DGWA 4H7LA 1LRHA 3CF6E 1CAXA 2DCTA 5FDBA 5FLIA 1EPZA 4LLOA 2GZWA 5KHGA 1NZCA 2V09A 3EHKA 4E2SA 2D5HA 5F1RA 5T3NA 1EYBA 1GQGA 2ZKLA 4QX5A 3FHIB 4KU8A 5FLJA 1XE7A 2FMYA 4OFGA 4MX3A 5LRSA 2PHDA 2GU9A 5LEJA 1CAWB 5FQ0B 1PM7A 3E6DA 4KL1A 3U10A 1FT9A 5EZWA 1ZZBA 2P17A 1UIKA 2BNOA 1UCXA 1XRUA 3BPZA 3D0SA 4IESA
chains in the Genus database with same CATH superfamily
4HOOA 1LHUA 4Q0PA 5FY7A 1RL3A 3R4DB 1OF3A 5EQUA 4QPIC 5T50A 4BLIA 3LD8A 3RMYA 2NN8A 4YRDA 5L36A 4KQ7A 1SG3A 1CJPA 1WGPA 2VW1A 2XONA 4Y1ZA 2WO3A 2V4AA 4OMCA 2G9GA 3DF0A 1T2XA 3N7KA 3LDBA 3J4UH 1SMVA 5H9QA 2BFUL 2ET7A 4ISQA 3TOJA 4GULA 2R49A 4E4SA 1XNTA 3U0ZA 1HV1A 5FZGA 3VB9A 1R093 5JLVA 2VZTA 4M0HA 4M3CE 3I3BA 3TEYA 2VOWA 3BOPA 4RFT0 4QPGC 1OC1A 4CCCA 4WVWA 5FRAA 3D82A 1SBEA 3U11A 2WNOA 3FLPA 3FE5A 3VBRB 2CY6A 3I3DA 4D3WA 2Y33A 4DEVA 2DTYA 3ZOIA 2P3JA 5A3WA 2WT1A 3JB8A 4N43B 4PQQA 3OD0A 4NHMA 4CDXC 4FPJA 2UY9A 3HIFA 4MVTA 4LBOA 4YVSC 1PO11 4G4FA 2D5FA 3T30A 3W21A 5ACA3 2YV8A 1U5IA 3T1MA 4FAGA 1JYTA 2DF7A 3AKTA 3IZOA 2JG8A 2DU1A 3GF6A 3HAGA 2BPA2 3FFQA 1M06G 4NWVA 1QJZA 4EN7B 1W06A 3AKSA 4JDMA 4EJRA 3M2MA 3C7FA 4LORA 3PIJA 4N53B 2WT0A 5LBFA 2XHNA 1H0BA 4XJWA 1CGPA 2YU1A 3IBMA 1OF4A 4UBGA 3I59A 3UGFA 3RI8A 4SBVA 4LXLA 2OX0A 2P3KA 3OGVA 5E1RA 3GYDA 2PXJA 2NYYA 4KGGA 3FWEA 1HQLA 1AYN2 1OA2A 3AVSA 3NQHA 1AR83 3B5LB 3H1WA 4MXWB 4QM9A 3ZDSA 5JMCA 3KT1A 1OH4A 2L9LA 2XJRA 3DYOA 2NMNA 3KSCA 2ENRA 1AX2A 2ZGKA 1NXMA 3ELNA 4UFJA 1HRI2 3PHMA 3BODA 4XBLA 4GKXA 4XFFA 5FZEA 3WY6A 3USSA 4PIYA 1Q43A 4AK3A 3DUIA 1MZFA 3KHCA 5GZDA 3VBFC 1FPN2 1H4GA 2UYBA 2XXZA 4O65A 3K3NA 2YZ4A 5A6XA 1VBE3 4XFIA 3JQWA 1O3RA 2Y38A 3AVRA 4OUSA 2ID4A 1QIQA 2O0OA 1A78A 4R9CA 1CPNA 3OY8A 5CVRA 1JUIA 1RUC3 3GM8A 5IATA 1SFYA 3ILNA 3RZGA 3I59B 1LCLA 3MIFA 4UF0A 5J36A 1U5ZA 2JB4A 3IAPA 2XR4A 4LBQB 4XCAA 1F4AA 1KGYA 2RG4A 1W8WA 1RUF2 3ZKYA 1V6MA 1IQDC 1H2LA 2F4PA 4XQDA 4NN0A 1DZRA 1EP0A 1UX6A 2QQMA 5A33A 2WLQA 2FDKA 1CZSA 4EN6B 2QQVA 2QQOA 3CLPA 1GLHA 1NA1A 1QGLA 3OUHA 1CJDA 1RUG1 4LK7A 1LEDA 1PIV2 5KHKA 4PLMA 4IDZA 1N3PA 4PDWA 4XBNA 2I74A 4KWUA 2NM1A 5FMDA 5KC5A 4FT8A 3QH6A 2VJXA 1OFNA 1IPJA 2CSGA 2D6NA 5I8YA 4NROA 3OD4A 4PLOA 1IS5A 2E31A 1SPPA 2UWAA 4P14A 4CDQA 1FOD2 4XXAA 1LOAA 4EROA 2VCCA 3BIWE 5GKAC 4EN8B 2VMEA 1X33A 2JDUA 4X8NA 4YGBA 2PHWA 5FP4A 5C3QA 2R042 3PTYA 1VAKA 4QX8A 4N9HA 4R52A 5IAVA 3D6EA 5JZGC 2DV9A 2QCSB 4BMEA 4HPKA 3NKGA 1NT0A 2HEWF 1I6XA 3OGRA 4CU9A 4AI0A 1IS3A 3QACA 3PL0A 4P00B 3CZJA 4XBQA 2QQKA 4P9XA 5C5TA 2A3YA 2P34A 3FMGA 5EJZB 2VBDA 1NG0A 1KXGA 4LBQD 4QGNA 4GMP3 1BEV3 1ZZ8A 4PDWB 2W47A 3J7LA 4I0BA 3AL5A 4A6OA 2DVDA 4FVVA 2CYFA 3C7HA 1JTZX 4CEYB 3H7JA 1Q56A 1JMUB 2IXCA 2IFWA 2SBAA 5C3RA 3THCA 4RR3B 1H30A 4XETA 2VOTA 4CDQB 2VU9A 5HBAA 2BQPA 4FPKA 4J25A 3PNAA 1Z7S2 4UFHA 4AVVA 2E7AA 3TB0A 1VE0A 2JDMA 1WW6A 3DYMA 5FY8A 4AQ2A 3I3MA 4QU1A 2W9XA 4AFMA 4QKFA 4XVHA 4V2VA 3VZMA 1BYHA 3I8TA 1O3QA 1G8WA 3ST7A 3FBMA 1H8TC 3UGHA 4AFAA 1D2SA 2HWD1 5JCTA 2P6CA 4CU7A 3T2PA 4YLZA 1SCSA 2PLV3 3WXPA 5DPNA 4N7UA 4R8HA 2VY0A 1CVNA 2CTVA 2EXHA 3ILRA 3N3HA 5DUUA 4AAPA 4HKLA 2H0BA 1GP5A 2DBNA 3SEEA 4Q27A 3CKHA 1AYN1 4NRMA 5KC6A 1X7NA 1VMJA 3W9AA 4K3UA 1Y9QA 1WW7A 5F5IA 5FYTA 1ODMA 5BNNC 4AQTA 3ZLIA 3K77A 1HRI1 1OUXA 5FPZA 3O1VA 4ZHNA 1W90A 3OEAA 2BBAA 3WQ1A 4AVBA 4QPGB 2DVGA 4RA0A 3WD5A 3GGLA 1FPN1 5E8AA 2B8MA 4OULA 3LCPA 3H42B 1IG0A 3PVNA 1REFA 3MIGA 5FR3A 3I2IA 4V1PA 4K40A 2GC3A 2W87A 4AE2A 1KFXL 2WO1A 2C4XA 3WP6A 4E8CA 3KQRA 1BQPA 5KWRA 2KA3A 5FPXA 2A1XA 4COVA 2Z5WA 3KCCA 4OYUA 3PUQA 3O0WA 3T2OA 2P1BA 3EB7A 1K12A 3AX4A 2MEV3 1FYUA 4FPLA 4LO6B 1RJ7A 2UY8A 1RUF1 1W2OA 2J1RA 2XG3A 3KCXA 3AP4A 1OUSA 4JKMA 3WEZA 3VD5A 1L3JA 2H6CA 3RFRA 3WUDA 3HQRA 2AH2A 1JOJA 4TN7A 3TNQA 1PK6A 2DTWA 1AR62 2XBO2 2HYKA 2RS13 3R0RA 3ZXLA 2BOJA 1PIV1 3WT3A 3ZMOA 4BQ2A 5HI0A 2D43A 2QQNA 4JKLA 5BNOB 1ZVFA 5A7PA 3PVOA 3O7OA 3UV9A 4UFIA 2Q1MA 2WAOA 1J84A 2QZ2A 3R05A 3R4SA 2XB6C 4FFGA 5FYCA 2BP6A 1NKGA 2J22A 4XJZA 1FOD1 1VBD2 3RSJA 4DXZA 2GN3A 3T0AA 1OLQA 3HJRA 3T0DA 1OQ1A 4YPJA 1DYOA 2WFPA 3AM2A 4A3ZA 1QJX3 3RZHA 5ABJA 4FQ4A 1BVP1 1ZA7A 3MIDA 4W6XA 4BISA 1GWMA 3BTZA 2W91A 2QBXA 2TEPA 4LJHA 5C4WA 1V0AA 4YYOA 4ZZ8A 3SH3A 4R9DA 5CFDB 1C8M2 4A7ZA 5FXXA 4DXRA 2VCMA 4M00A 1Z0HA 5FZ6A 3I49A 3BYWA 1A8MA 4XHBA 3EMRA 4IXLA 1UO9A 1QHDA 3KF3A 2YG0A 1W8FA 3PUAA 3PVBB 1RUD2 3MI8A 1DF0A 1UYZA 2R6QA 4RHV2 3N9PA 4QXHA 3ZM8A 4NE9A 2X5IC 4K8RB 5FY1A 4HSLA 3LA7A 4JZRA 5A3OA 4ATFA 1XPWA 2VVEA 5JSOA 4XAAA 2WSVA 4D6RA 1MEC2 5K8SA 1IG3A 1LHNA 1Z7S1 5I0TA 3VKFC 1BMV2 2JEMA 1JYCA 1YFYA 2VCAA 1UXXX 3J7HA 1VPHA 3RG0A 5HV4A 1JZ7A 1HXS3 2LTNA 1JYIA 4EWAA 3OOXA 4AEMA 4GALA 3DN7A 5GLZA 1WCQA 2VZUA 3IDEA 4PJYA 5C4WB 1Q3EA 1MS9A 4P08A 1C5HA 3LFIA 4KI5M 4F83A 3B94A 1X50A 2CWSA 2D6OX 3RJRA 3VL9A 3TRSB 1BXHA 1GSLA 1LOEA 3RJ2X 3ZYRA 1SDWA 1R1ZA 5CKQA 3HOBA 1QDCA 1OSGA 1O5LA 3PURA 4IETA 1CZVA 1RUH3 2A5ZA 2HWE2 3NJXA 1VBB3 2I2SA 4FPYA 5CZKA 1W8NA 3I2KA 1BBT2 3GDBA 5DAQA 1XOYA 4XTMA 1O8SA 2WBKA 3S7IA 1IPSA 3MIBA 1JN2P 3M3EA 4Q0VA 1LAJA 1DU3D 3MF6A 3VBHC 2Y64A 1DZTA 4P9WA 2DCKA 2RJ2A 4GH4C 3U14A 4CU6A 1RVF2 3SITA 5JXGA 2BOIA 4M3CA 2B46X 1NZIA 2VZPA 1W03A 3MYXA 5I0DA 3WF4A 1VLNA 1HX6A 4XFBA 3KGLA 4AEJA 3NMBA 3KLSA 1W6NB 4CUBA 4FBFA 4B1LA 2FDFA 1OA3A 5T5PA 3IMNA 1RXFA 1GV9A 2WN2A 4XUNA 1G9CA 4IQPA 1MR5A 1RUE3 3M3QA 4MZUA 2W1UA 5L9VA 4KG0A 3ME2A 2C24A 3GZAA 1OPMA 1H8TB 2WS92 4YG3A 1W9SA 2KD7A 1J58A 3I7DA 4CPBA 2GNBA 4DB5A 2DDUA 1WLCA 1YFXA 3UESA 1DCSA 1I3HA 1KJLA 1AR61 2XBO1 5DQ0A 3N9NA 4P5HA 5DUXA 1XNAA 2PHTA 2C1FA 3ZSKA 1K45A 2FQPA 4M01A 4YNIA 1CAVA 1W6PA 4P9IA 5CYYA 5FY5A 3TN93 5IW0A 2VBPA 4XJ9A 1V6KA 5BNNB 3M3IA 2WABA 2BNNA 4AHWA 1WMDA 1F5JA 4CXWA 2HBTA 2D93A 1VBD1 3WHTA 2Q8CA 3POGA 1W9TA 1LJ7A 5D21A 1UWWA 3WNXA 4ARXA 1YQCA 1H1MA 2J7MA 5LA9A 4V2WA 4XUTA 3B02A 1XYNA 1FV2A 1ZBE3 1UY2A 1R092 4IV1A 1C8M1 4Z2AA 1ZRCA 1KQRA 4FPFA 1DGLA 1KFUL 2WA4A 3MPPG 2RM22 3FLTA 3PIGA 1QOSA 1UKGA 3ASIA 1NXD1 1RUI3 4P02B 2OYZA 1ZBA3 4FPCA 2OS2A 4DY3A 4OHVA 5A1AA 1CAVB 2F4LA 2Q1ZB 3WW1A 1W6PB 1E5HA 3JUUA 1WMFA 4YG0A 3OPWA 1OXCA 2WQ4A 3GJBA 4ZU4A 5I8TA 2CDPA 2LM3A 5B2GB 4PCRA 5F2WA 5ACA2 4XQWA 3VGIA 4LIVA 1LOCA 1MEC1 1W6OB 3MFCA 4XABA 2JDAA 4CCDA 1JHNA 1EPWA 5FWEA 3ZFGC 5FYIA 3VBOC 1CAWA 2DCJA 2HWC3 3KB5A 1BMV1 3IDCB 5DAWA 5FYZA 5FAXA 2WNUA 1REDA 2WZR3 2CGOA 1EY2A 5EFUA 2XHKA 5IFPA 3N7MA 5IVJA 4YFWA 5DG2A 2YB7A 3FN9A 3POEA 5ANNA 3WNKA 4IV1B 2VQTA 2DCTA 5A1LA 1VAVA 2YUEA 4YW6A 5FLIA 1HLCA 1S0DA 2UU8A 5L19A 4IE7A 1POV0 3VKLA 1AR82 1RXGA 2V09A 3OYWB 1AYM3 1NY72 1EV13 2RR13 3P3PA 4XDOA 1PZ7A 2XVKA 4JGYA 3WCRA 4B7EA 3MBWA 2ZOEB 2ZKLA 4FTBA 3NV3A 1F4HA 4KU8A 3AKQA 4CCJA 4UFMA 1WWYA 4ASMB 1XE7A 4RS5A 1ENXA 2NMOA 4LBNA 4MX3A 3TEXA 5LRSA 1YQ2A 2Y6KA 2OPWA 3AMHA 4CP0A 2GU9A 4KNCA 5LEJA 1RVF1 1YNAA 4LK6A 5AFBA 1VBE2 4IL7A 1CAWB 3WLUA 5FQ0B 1GZWA 2YDEA 2JB8A 2BJSA 5F2SA 1SCRA 2VMHA 1FT9A 2X5IB 1JZ5A 4QHZA 1H2NA 2J1VA 4MGSA 1RUC2 4BQWA 4XILA 5C5UA 2BNOA 2ZGSA 4CUGA 1QOOA 5EJ1B 3ZN6B 1XRUA 4CU8A 1MS4A 1MQTA 4GWNA 1BCXA 2E53A 1ND3A 4A3XA 1Y9GA 2ZGMA 3NV2A 2XUMA 3ZMNA 1RMU3 3WP4A 1C3HA 2JKBA 2ZGUA 2WL1A 3O1UA 1QNYA 2ZX0A 4XJAA 3VBUA 3LOBA 2JJ6A 2VCBA 3CL1A 4P9LA 3W20A 4JDNA 4AGGA 5FXVA 3ZSJA 2ZMNA 3ROUA 5BPXA 3WW4A 1AZDA 1NAEA 3O14A 4EZ4A 2OXBA 5FV3A 3T4VA 3M3OA 1GZWB 1OQDA 2V5YA 3WOGA 5FZ1A 3P3NA 3NNGA 2A75A 3Q8FA 3HN3A 4MGQA 4AHYA 5HV0A 1V9U3 3LSEA 3Q8AA 2XDVA 1J3PA 3VBHB 4BQ4A 4D69A 5GZCA 1W6QB 4XF1A 3J26N 3AFKA 1SBFA 1VJ2A 2DVBA 2VQ0A 2WWUA 4DXSA 2VNVA 2P6HA 2WNVA 1BZWA 2BWAA 3SMHA 1YLLA 2YY1A 1X9PA 2OIIA 2RMU3 3LA2A 3OJBA 5F5QA 3W59A 2WJSA 5EYXA 2YGLA 2HBUA 3L2HA 2NZ9A 4YGEA 1X8MA 2JG9C 3KHBA 4QQLA 4XFAA 1NYWA 3WG2A 1R091 2XL7A 2HWF3 3ZFFA 5IYYA 3VBUB 4WM8A 2FCTA 2VXRA 1OKOA 1A3KA 1C28A 1C8NA 1BHGA 1G6NA 1NLRA 2C6SA 1D4M3 5FYSA 4A2UA 1WCKA 2WC2A 1NE4A 1TMF3 4N8MA 3HQXA 1DBNA 4XZPA 3VZKA 5FK8A 2XPJA 2Z69A 3MUY1 1DGWX 3RRDA 3ZO0B 2A73B 5F39A 5ACA1 1IQAA 4IGOA 1VMFA 3PDQA 2BBVA 4META 4ZXEA 4AFDA 5A3LA 5FPBA 1TME3 2VMCA 2WNVB 3BKZA 4NJ4A 4K8FA 1LNSA 3WF2A 3NNFA 2JG8C 3ZFEC 1LENA 4MGTA 3C3VA 4QHBA 4I30A 4DMIA 1TVGA 5A6ZA 3BI3A 1LB2A 4A44A 4DQAA 4XUPA 2PLV2 1F8VA 1ULCA 4QQ2A 2VZSA 5CIRA 1GR3A 1K5MB 2JKXA 5A3NA 2P3YA 1G7YA 4Y22A 5LCWL 1NCQC 3VDDC 4CDWB 1AR81 3O1TA 1NY71 4QHOA 1L7LA 1LKNA 3D0JA 4H2AA 3BALA 4EE2A 5C33A 4C90A 4XF0A 4OMDA 2RDNA 2ARAA 2ZHMA 4LO5B 5T54A 3LGRA 3D5OA 3LDKA 4XXPA 5ERLA 4IE6A 4XMAA 2RS52 2VXJA 2ZPXA 4QWNA 5K7PA 1LECA 4EWDA 1LOFC 1UY0A 3BIEA 1KDKA 2WLPA 4Z07A 1VBE1 2QZ3A 3V56A 1Y4WA 4YSFA 1VIWB 3M3CA 5FP9A 2BDRA 3ZVXA 2Q0AA 2HH9A 4FOVA 4G3YC 1RUC1 1OI6A 1E57A 5JXHA 4PHZA 1UYYA 5FZFA 3DKQA 4Q4V3 5FZLA 3G7DA 1TEIA 2PFWA 1WLDA 3BOWA 1W2TA 3CJIA 2EVXA 3VBOB 3GZUC 3LEGA 1UU5A 1GP4A 4Y22B 3Q9OA 4E2QA 1LU2A 2XQRA 4BQ5A 1RINA 1SLTA 2PHRA 2RHPA 3GZEA 1OLRA 4UAPA 5F3GA 2VQUA 3HPNA 4HMZA 5FCCA 2FMDA 4KG8A 1RUG2 2WA3A 4ONUA 4C0BA 4EN9B 2ADEA 2ZABA 1UPSA 1DQ4A 3AXEA 2RS12 2WO2A 4LLFA 3F2ZA 3LDRA 4CP1A 3VBRA 2XJSA 4AVAA 2EIGA 3WP3A 2Z2SB 1S0GA 4E8DA 1B09A 2GH8A 3CZUA 4WM7B 3AYCA 5ISLA 1QH7A 4Y3OA 1S0JA 4BMBA 4J6GA 2BTVC 2OZJA 4PF1A 2A7AA 4ZY9A 2ZEYA 1RUNA 3SCHA 1WLWA 3WHUA 2VW0A 1O4TA 4Q1RA 4IERA 1QJX2 5JOXA 3CJIB 5HCAA 4NVPA 2ARCA 2EF6A 5FZHA 5GZGA 4LE3A 3CBNA 4Y20B 4S2GA 3W5NA 5LA1A 4N53A 1LU1A 1OLME 5C3SA 1RB8G 2ZX2A 1O3SA 1Y9MA 1W2AX 1W9FA 2AR6A 1B35C 1WW4A 1QJU3 1ULOA 1C1FA 2EA7A 2X29A 4NHYA 4KU7A 2YC0A 4WZFA 3H8RA 2PN5A 4NHXA 1D0GA 3B69A 3SH4A 5IVBA 2MPFA 4MXWA 4QX1A 4GMP1 1BEV1 3R4UA 1Y43B 3C8XA 2V73A 4XAEA 3H8XA 1HB4A 4TSVA 1F35A 1WCSA 2OA2A 3WW2A 1PX4A 1HJFA 3AYEA 4AVSA 3T2QA 3ACIA 5FLHA 2BFUS 2JE7A 3GHMA 4L2NA 3WG4A 3VZLA 4W6YA 1QJY3 2GMEA 4URAA 1J1TA 4OUMA 1IOAA 2PAKA 4XIKA 2AGSA 3WF0A 2HWD2 3HMYA 3WDXA 5D8AA 5FWJA 5L7OA 4OHYA 1F15A 1COV3 1XYOA 4L0PA 4URTA 4YFZA 3E5QA 3K4AA 3H0OA 5SV5A 3KMHA 3Q8CA 5J7MA 5AC93 2PLV1 2AREA 4LBQA 1YFUA 1RIRA 2CAVA 3RDIA 2P2KA 5FZ0A 4IGQA 1RUH2 2YC2A 1VBB2 1W8TA 3I3QA 3S57A 3N7LA 2OKXA 4MXVA 4IEYA 1WW5A 4Q4X3 1S1AA 3R6SA 4CCOA 1X36A 2XJPA 2VNRA 3VBSB 1YO8A 3HVDA 4QXBA 5IJRA 1DHKB 5JR2A 3E1F1 3K75B 3KM5A 3H3LA 1TQ5A 2D6MA 2RS51 2Y6HA 3K2OA 4DUVA 1J83A 2QTWB 2ILMA 3OTFA 2EIBA 5JXIA 4ZS2A 1GMMA 3MEPA 3RQ0A 5FPVA 5FXWA 2ZA9A 2WR9A 5D8AB 1ULDA 5L7OB 1VALA 4MV2A 1OVPA 1Q8SA 2LROA 2PHFA 2D40A 3MLJA 2GP3A 5LK7B 1VP6A 4M4PA 5F7UA 2ZBJA 2IXHA 5AVPA 1RUE2 5C70A 1CONA 1J1LA 1ZA4A 1W6MA 2R0FA 1CIWA 4LUMA 3CMGA 5BXXA 1XYPA 1KD7A 2ZGNA 3HN1A 3LE0A 1ACCA 1REEA 3L2YA 4LOTA 3HNYM 2W94A 1SLCA 3TEWA 4PI2A 3WG3A 5IVEA 4R4XA 1O4ZA 3LEIA 3RNSA 1YI9A 3EO6A 4UWDA 4DOUA 4XYXA 1UOGA 4RGKA 1YQ8A 2EXKA 2RS11 2VMIA 1UYXA 2VC9A 1BKZA 1WBFA 2IXIA 4CEYA 4OZXA 1AX0A 4OLLA 4CEWA 1NCRA 5C3OA 1NCQB 3Q8EA 3TN92 1ZYBA 3O0VA 1OT5A 1H9WA 3AJYA 1AHSA 1ULEA 2Q1FA 3CIHA 4FFIA 4RGAA 4RR3A 4AF9A 2WN3A 5BNOA 1V6OA 1VMHA 2W2IA 3ZSMA 1AJKA 3H50A 5JOZA 4Q4W3 5A32A 3SKJE 3ETQA 3BCWA 4JHZA 1CESA 3H7YA 4RGGA 1X9TA 2PQQA 2JICA 2V4VA 2VOKA 1QJX1 1W6MB 4LE4A 4W50A 3LF7A 5A7NA 2E32A 3SEPA 1SDDB 5L9RA 4F7ZA 2FZ1A 5K0UC 4CDUC 4ASKA 5DZGA 1ZBE2 5IFTA 4QPIA 4YW1A 1GNHA 3DECA 1S2KA 3UETA 4D7SA 1KRIA 1PGSA 4GJZA 5FXZA 5DABA 5J96B 2W0XA 3H9AA 2VUAA 1DYKA 1RUI2 2WKKA 4CEWB 2ZGRA 1NCRB 4GKYA 3KV5A 4JVAA 1GP6A 3BTYA 3GCWA 1H1IA 4GQ7A 3OGSA 5DDJ3 4EZHA 1W05A 2ZAHA 1PNFA 4QPGA 1FMD3 2Q8DA 1ZRFA 1JH5A 3IIAA 1MS1A 2R073 5A32B 1QJEA 4HN0A 2HWC2 4FQZA 4XPVA 3Q8BA 4BQ3A 2HYXA 1R083 2XGXA 2YYOA 2ZHNA 1H8VA 3CO2A 1HXS1 3FUQA 2YFZA 4KGQA 4YZ1A 5JUVA 2WZR2 4PF5A 4MGZE 1MVQA 4UT5A 4HONA 4CDXA 3BTXA 4CVUA 3BU7A 1U5YA 2W46A 3I2GA 4PIZA 4QPIB 3JB4C 5GLWA 3ZYHA 4DO0A 1HIXA 3HR9A 3S30A 2B45X 2WZ8A 3RS6A 1JU4A 3LIGA 1AR73 1QQP3 4Q0UA 5IVFA 2K0GA 1AYM2 1RUH1 1EV12 1OQEA 2BEOA 2RR12 4UW3A 1VBB1 3W5MA 3IPVB 2RS33 2ZZJA 4BDVB 4B7KA 1NUKA 1O8PA 4O9EA 2PYTA 1VB4A 2E9QA 1QKQA 1B35B 2OQ6A 1MVEA 1KDMA 2H6BA 4BA6A 4NRPA 2A3XA 1V6LA 3OBRA 1MS3A 3BN6A 4KMQA 4HKWA 5A7OA 3TAYA 1RITA 1UY4A 2BYVE 1G9DA 3TNPB 3MLKA 4AGVA 2D6PA 1PVXA 2PAMA 1KJRA 3M70A 4BB3A 1WZXA 4YVSB 4CDXB 4KH9A 3POIA 1AXZA 2VD7A 2R1BA 3UKTA 3MDPA 4CCKA 4X6QB 2PAEA 2XKPA 4PQ9A 4ISRA 5GLUA 5IK8A 4QPYA 4OZOA 3IWZA 1CX4A 1I5ZA 1F31A 1KEXA 1RUE1 4HSJA 5FKBA 4KWKA 3S0MA 5FJKA 2VMDA 1RMU2 4Y5Z0 1UMHA 5CFDA 2VE1A 4ZPIA 4DIQA 5LY2A 4YGCA 2B5HA 5BY5A 2PA7A 5I91A 2GC2A 5DG1A 5FZ3A 4OI0A 1ULGA 2LW8A 1OOPC 3POFA 4P9JA 1N1VA 2IXKA 2J1UA 4GMP0 4DFSA 2GNMA 5JSPA 4HKOA 4XJUA 1ST8A 2XLAA 3A0KA 3DL3A 4NAMA 2HWB3 3RZKA 1DDLA 3TN91 2LUWA 3PUSA 3KT7A 2P3IA 3D3AA 1V9U2 5KXCA 5FREA 3U78A 4G9SB 1U12A 1UF2C 4FXKB 1KITA 4LIUA 3VBFB 1SZBA 2EIDA 4A7YA 4JDOA 3ITQA 4XJ8A 3ES1A 4E27A 5HPOA 5LEKA 2XWJB 3KVAA 4Q26A 2I45A 1PGW1 3A22A 3N9MA 4XF3A 2NLRA 2H0VA 2WO7A 5JI7A 5A7QA 1YEWA 1N3QA 1ZBE1 2V5DA 5CADA 1BLZA 1UZ0A 2W92A 3GBFA 4GWIA 2UWCA 4I3PA 3WCSA 5J3UA 4WVMB 5JZGA 1US3A 4FXGB 2RV9A 1D4M2 4B29A 3N4MA 3H3ZA 2ZX4A 4WVVA 3AKPA 1DGWA 1DYPA 1RUI1 4H7LA 1ZBA1 1TMF2 3KQ4B 2BUKA 1SLIA 1O91A 2BVBA 3ZR6A 4Y5TA 1DQ0A 3FBYA 5HCFA 1ND2C 2EICA 4OHZA 5EIYB 1CPMA 1EPZA 1NOVA 3LFMA 1IKPA 1PMHX 1ULPA 3WSOA 4A42A 2BZDA 1DQ5A 4NAOA 2E26A 4EN0A 1RUJ3 3WG1A 1EYBA 1GQGA 4GB33 1TME2 3GJAA 2VW2A 2HWC1 3J9SA 4TZDA 1L7RA 1QMJA 1AJOA 2WUHA 4LHNA 4LT5A 4IV3C 4OFGA 4PBPA 4RSUA 2WZR1 2A6VA 2GALA 1W6NA 4C8DA 5FIXA 4XDPA 1XSRA 3SC7X 3I3EA 1H4HA 4JQTA 4AG4A 1JZ8A 3A4UA 1Q8VA 2JIJA 5FY4A 3POJA 3J8F3 4CCLA 4KL1A 3DEMA 1DIWA 5EZWA 5JZGB 1ZZBA 2RDRA 4XCBA 2FDHA 2P17A 5FPAA 1TE1B 2ZGPA 1AYM1 1H8TA 1EV11 2RR11 3PUHA 4HANA 4QKBA 4IESA 4ITCA 1YRZA 2DWRA 5FZAA 4CSWA 1YJKA 1YCIA 2VO5A 1OLMA 2WINB 4JGYC 4L8QA 4LHLA 1U0AA 2D6LX 2IWGB 4NPLA 4Z2WA 3AZZA 5DMYA 3S5AA 3ATGA 4JX0A 2CU5A 4IEZA 2I07B 2K9ZA 2BWCA 2ZMKA 4AEKA 4N90A 4TWTA 2Z4FA 3WF3A 1D7PM 3MW4A 3O1OA 3KT4A 2MHFA 2ZEXA 1UMZA 1O59A 2JECA 4QB6A 4S2FA 5F32A 5BNNA 2QQPA 3RYPA 1FI2A 4RQPC 4FPOB 4DZGA 5LA2A 2JDNA 3NKTA 3T1LA 4AFCA 1DFQA 4R9AA 5DZFA 2Y0OA 3V0BB 4JHTA 4Q4V2 1VBA3 1L7QA 1GZ9A 2J1TA 3IT8A 3GBWA 3SKVA 4AI1A 5JIUA 1JXNA 2CNAA 2W3JA 1QXPA 2VNOA 2G9FA 1WKYA 3AP5A 3CU7A 4NIAA 4K21A 1RMU1 2FDIA 3V0AA 2YFUA 2RDQA 3RVHA 4XTPA 3WZ1A 4JCKA 3VUOA 1W9YA 1F9KA 3PUIA 4NR1A 2Q4SA 5HCHA 1AVBA 3LSDA 3GXUA 3WV6A 4Y4RA 3RZZA 1D0HA 1APNA 4D6QA 4PLNA 3VN4A 5IVVA 1LULA 2JIGA 5F6LB 1POV3 2WRAA 4CTEA 1V9U1 2ET1A 3C7GA 4B4PA 4UI9L 1W6OA 5D1IA 5CAZA 3MUZ1 4MH0E 5T5JA 1UZVA 3KS7A 4LEJA 5FY0A 3C2UA 2BU9A 1O3TA 1ENQA 3I4IA 3GBGA 5FZ9A 4K1YA 5SV8A 5FMCA 4UXAA 1OA4A 4COZA 4U2AA 1UU4A 4AFBA 5FZCA 1YHFA 3PU3A 5F8PA 4F3JA 3V0AB 4QB2A 1QJU2 3SH5A 1FX5A 1VR3A 5CEHA 2BGOA 2FD8A 1FATA 3SCGA 2HWF1 4QQHA 2XVLA 3OG2A 1WCUA 1XJAA 2EALA 3OYWA 5A3PA 4OQ9A 3AZYA 1XB9A 4AXOA 1D4M1 2P37A 2R043 1QWRA 1H9PA 4RN5A 5CU1A 5FYHA 3ZIWA 4FTEA 4DY5A 1ZNPA 1TMF1 3HT1A 5A3UA 5C8CC 2RDSA 1CD3G 1YWKA 2HEYF 5FZOB 5FYUA 3ILFA 1YJLA 1OOPB 1GOFA 3RYKA 5KXDA 1IS6A 4Q4Y3 4AWDA 1W28A 2IXJA 4CRQA 1QJY2 2YPDA 1GQHA 2W5FA 2E33A 3FLRA 3PMEA 4H7MA 4FP3A 4OI2A 4LA2A 4OI4A 5FZDA 5K4LA 4A41A 5FQ0A 5FMOS 1TME1 1S2BA 4YW4A 4LHSA 1ZZ6A 1R1A3 2X5IA 3IDBB 3M7AA 3L9JT 4JGZC 4NPRA 3E97A 2W1QA 3ZN6A 5BNPC 3JBG3 3WF1A 5AC92 4AAXA 1AF9A 1W2NA 1MS8A 3SHRA 4I2OA 3FUOA 3KCYA 2FHRA 4OCTA 1XE8A 1JUHA 1XC6A 1Z7S3 4YM3A 4M0NA 4QX2A 4JAAA 1Q5OA 4D7TA 2LS6A 3P5BA 1LGCA 1UU6A 3OUJA 4MGIE 4Q4X2 2E63A 4RYDA 5CFCC 3NAPC 2Y6FA 4IE5A 4P9GA 3ZSLA 5C9AC 3OSDA 2VMGA 2LALA 1PGL2 3CHXA 5JVVA 3S7EA 1GNYA 3EJKA 4Y1VA 1H2KA 2QVSB 4DNYA 2YGMA 4LR4A 3O0XA 4QKDA 4QMAA 4GZ9A 1FNZA 2QQWA 5FZIA 4QQOA 4BPZA 5FUNA 4FAHA 2XLFA 1MZEA 3WNMA 4Y24A 4J1XA 3VBHA 4FO9A 4AHXA 1W6QA 3AZWA 4NIDA 2YPJA 3HT2A 1SQ4A 2K46A 4P9YA 2Q8EA 5T55A 1HQNA 3RWKX 4ARYA 2QNKA 4CP2A 3GHNA 4Q4V1 4XUOA 1C5IA 2ZAAA 3LA3A 2JDHA 3VHNA 1QJFA 4AI3A 4YVWC 4YZ2A 2Y34A 1MZ5A 3MIHA 4HVQA 4IV3B 4AHZA 4HVOA 1KS4A 2D3PA 4GWJA 3WNLA 5C7GA 3WDTA 4QX7A 4BE3A 3VZNA 4AI2A 1WBLA 5A70A 4TXWA 2R16A 1JZ3A 3DPRC 4HZFA 1TZOA 2BRTA 5F5AA 5C6CA 3FJSA 1IPKA 1ZRDA 3RYRA 3SLIA 2WQZC 3OGGA 1AR93 1C4RA 4N43C 3PU8A 3HNMA 4AEDC 2IZWA 1UAIA 3ALQA 4GH4B 4Q4W2 5FP8A 1W8OA 4NWWA 1EAH3 4FOWA 3POSA 2B7YA 4UFKA 2VOXA 3EQEA 3RPQA 3ZR5A 3NWKA 4CUCA 1DP0A 1GKBA 1UY3A 5H9RA 3WNPA 3RZJA 1FXZA 3OBAA 5DZEA 4Z82A 2ARXA 3V64A 3LEKA 4DXTA 1ALYA 2QE3A 4LO4B 4QDQA 4MHRA 2XOMA 2ZHKA 3MICA 1QJU1 4OHXA 1K5MA 3NNJA 3PTRB 5FO8B 1BEV2 2XJUA 5IK5A 1UZYA 1YUDA 1LESA 5F9TA 1CZTA 3IB3A 2VZOA 1IGOA 4CDWA 3H8OA 3D4KA 2ZHLA 2QJVA 5CISA 1HB2A 3I2JA 4CP9B 2IC1A 2ZZQA 3G6JB 4P5YA 3T2TA 2QFEA 2WZEA 5JPMB 3NJVA 4XMIA 4YZ4A 4DUWA 1DLCA 3DKWA 3E5UA 1FMD2 4HXCA 2VM9A 4GD4A 5LBBA 4LNVA 1JZ2A 2B42B 1XNCA 1ONAA 1W0OA 1RJ8A 1QJY1 3I2OA 1AXKA 2VR4A 1R082 2WWSA 2D7FA 3AMNA 5FZ7A 5IUQA 3KZ4C 2Q5TA 4YM1A 4JRLA 3KV6A 4UOJA 4COUA 1RUD3 2Q30A 5LB6A 5DAVA 1COV1 5E16A 1K3IA 1MZ6A 3V65A 4RHV3 3KWVA 1BK1A 5I0UA 1Y3TA 2Q8OA 5LZ6A 3NL1A 5EYYA 2ERFA 1IKQA 5AFEA 4GA9A 2ZEWA 5AC91 3ZFGA 3VBOA 5LATA 5KXEA 4PIXA 1AR72 1QQP2 5DN2A 1RHI3 2D6KA 3CEWA 4XQ4A 3PLQA 1GOGA 2X10A 5T52A 4L11A 4BCUA 1ZX5A 3UYJA 1R64A 4HLTA 3ZXGA 3UT0A 4Q4X1 4M4RA 3AZVA 4B4QA 2AEYA 4IEVA 2VAUA 5K9YA 4HG6B 2AEZA 1PGL1 2GAUA 1XNDA 4WM7A 5J48A 4GWMA 2IUWA 2FZ2A 5H9SA 1GWKA 1O5UA 1LGBA 3WQ7A 5DUWA 4QD2A 5C8CB 2JDPA 4LA3A 1N47A 2HWE3 3FL7A 3URFA 4K20A 1BBT3 5JIAA 4HN1A 4CYDA 5JDBA 1RYYA 1NX9A 2BVVA 4AQ6A 2O8QA 1RTVA 4UYBA 5A7WA 5KXBA 1AX1A 5L9BA 5IHRA 2OUJA 3ZFGB 1LHVA 3NW4A 3VKMA 4BK4A 4IEXA 4ZKTB 4QDSA 4Y20A 5CKMA 2A6WA 2A71A 2MEV2 5IT6A 1W9WA 4QXCA 5GZFA 4XE9A 4FSJA 4I0AA 4JGZB 1W8ZA 4XF4A 3AXDA 4MYEA 4A4AA 1W2UA 3VD9A 2QUOA 2RVAA 1NA1C 1P8JA 1UD1A 3VDAA 2HWB2 4BQYA 3HEIA 4PDWC 4IEOA 4MUVA 4X6RB 4CEYC 4BM8A 2HJIA 4B8EA 4AGRA 4QX0A 3LKJA 3SCFA 4OQ8A 1LEMA 3WNOA 4ES9A 5C9AB 3P1IA 3OB8A 4FPHA 2VZ1A 2WS93 4Q0SA 1PMJX 1YXWA 5A7WB 2HLEA 1WA4A 4Q4W1 3T4HB 4CDQC 4Q8KA 5F3EA 2D3RA 3APBA 1HRV3 1V70A 1DQ1A 5JPNB 4LITA 1XXNA 1V6IA 1ZM1A 4WBBA 3AB0A 1OHFA 2ATFA 4QB1A 3H8UA 3O5SA 1OD3A 1S0CA 1W3VA 1CAXB 1XNKA 1XNBA 1ZRRA 4IEPA 4MG2A 3RZMA 3MPBA 4IUGA 4DINB 2G1MA 4MLOA 4MSVA 4Y1UA 2R0HA 5JMOA 3JD73 1UZZA 4COWA 1US2A 5GJ6A 3AK0A 3VKOA 5BV6A 5A3MA 2LRPA 1LR5A 1YIFA 2WDBA 1IHMA 1OPOA 3LIHA 4YVWB 5H9PA 1ASJ3 4EWEA 2VBBA 5FZKA 2XKOA 3UK9A 2JG9A 4BK5A 2JENA 1PO23 3WR0A 1WD3A 3JQXA 1QU0A 3KV9A 3T09A 3VBSA 3ZN4A 1W04A 3PVEA 4YW3A 5APAA 1OFSA 2A3WA 5FJHA 5DDJ1 3BVCA 1YIPA 2ETEA 1FMD1 3U75A 1RUJ2 3VD3A 4DS0A 2R071 4GB32 2WQ8A 1HV0A 1HXS2 3DPRB 4QX3A 1R081 2RM23 2DVAA 4IEUA 1W39A 3E6CC 4LO8A 3S5QA 2VZVA 5JAXA 4XFGA 4CCEA 4DRRA 3INAA 5JWPA 4QT6A 2CGNA 4FPEA 5LASA 2J42A 1VBC3 3LAGA 4AEDB 2A6YA 1JI6A 2FDGA 5LBCA 3J8F2 4TTGA 1W0NA 2J1SA 3GCXA 4FPGA 3VHOA 5J1XA 1WD4A 5LA0A 1YFWA 2D97A 1AR71 1QQP1 5FP3A 3ZFEA 2VH9A 2ADDA 2Y8KA 2AYHA 3OPTA 2RS31 5HXVA 4CCNA 1GU3A 3A23A 2JG9B 4JQRA 2HKXA 4A6SA 3FZ3A 4M3CF 3NRUA 1G9AA 2JE9A 5ANQA 3MW2A 2VTXA 4CA9A 4N9IA 2ZGLA 2DFCA 1DG6A 1NCQA 3VDDA 1YQ6A 1RC6A 5EHDA 1A6CA 4EV0A 3C7EA 1EUUA 1ENRA 3NJZA 2WZPP 2CDOA 4Q1PA 5A1FA 4CXYA 3BB6A 5DAXA 5F5CA 5FKCA 1C57A 4K9SA 2VULA 3N9QA 1QXJA 2PTMA 5J98B 2FBEA 1OBNA 3MFAA 1VBA2 2GSYA 5EWSA 1LOFA 3IM0A 5FZ4A 5FPUA 3UKNA 2DCZA 2BW8A 5I0SA 1JU3A 3CQOA 5CB7A 5CA6A 3N36A 2JG8B 4LULA 3ZFEB 1IZ3A 2MEV1 5FO9B 2GH2A 2WYFA 5JSRA 1JW6A 1UZWA 2DUQA 2R063 4YG6A 4B1MA 2EXJA 5KHHA 5CG9A 1YYNA 4JTOA 1Q8OA 1HB3A 5CFDC 3AMQA 1G86A 4RD7A 1CQ9A 3U37A 2NPIA 3U4XA 1PK6C 2Y60A 4LKFA 4BIFA 3ZX7A 1H1AA 4JKKA 3VDDB 1JS9A 1AL23 2WFF3 4O61A 1W3XA 1W99A 2HWB1 3IKWA 2ZX3A 1O6UA 1VAMA 4JV4A 5FY9A 4C1WA 4QDRA 1T6GC 5LK5A 1MS5A 4HVRA 3AFGA 4S2DA 2A6XA 2Y0IA 3CF6E 2IVIB 3ZN5A 3LEMA 5FDBA 1HN1A 1PGW2 2DUPA 5J09A 4BWOA 5F3CA 4LLOA 2WWJA 3EHKA 4S2HA 2E7QA 1PVC3 4E2SA 5J37A 2XJQA 5ABJC 1VRH3 5F1RA 1M4WA 2GP5A 3K3OA 5C4WC 1H6YA 3FHIB 3USUA 2Y6LA 5BNQA 4W65A 5FLJA 2XJTA 2FMYA 2X05A 3OY8B 2D3SA 4K7JA 3THPA 2ZTNA 2JD4A 4IE4A 1FNYA 1ZBA2 3DGTA 4XC9A 3ZIXA 4UF0B 3IPVA 3ECQA 1PM7A 5FUIA 4HL0A 3E6DA 2YXSA 1TG7A 1UN1A 3U10A 1B35A 4E4ZA 1MPXA 4PBOA 3OUIA 3LPFA 4Q4Y2 1UIKA 5A33B 3B01A 1K5JA 3I2FA 1YC61 2NQYA 1OURA 1RUJ1 1NA1B 1GWLA 2OQ7A 4LBLA 1V6JA 4GB31 5DUVA 5KBFA 2UWBA 1R1A2 3NJYA 2OT7A 1PZ8A 4YVSA 1CAUA 3ETPA 3OEBA 2AUYA 4BQXA 2FDJA 3TBDA 2JDYA 3ENRA 3DV8A 3JBG2 4WVZA 2QDRA 1PO13 3USUB 2YC4A 2ORZA 2B4KA 2QQJA 4BLJA 1SPPB 3J8F1 5F6KA 2NP0A 3SNMA 3UJOA 3VHRA 1ZZ9A 2OVUA 1WMXA 5A6QA 5CBLA 3EXUA 3FC0A 1PMIA 4LPLA 4FTSA 3WDWA 3DXTA 4HPKB 5EJ3A 4C1XA 2BNMA 3JZVA 3ZXKA 4AYUA 3H1YA 2AC1A 2JWPA 5FBZA 3KVBA 1UXZA 3AMMA 3RGBA 2O1QA 4NOTA 5FZMA 4LBKA 1GZTA 5F3IA 3RMXA 1J3QA 2VG9A 4LKSA 3WP5A 1YI7A 3WUCA 5GZEA 2PHLA 2QDNA 1KS5A 1OMIA 3ACFA 1CAUB 1DQ2A 4L99A 5JOWA 4PI0A 3ZXFA 2VZ3A 2JDZA 1OD5A 2VZRA 3ZPYA 1DLLA 1CR7A 2GNDA 1PZ9A 3VBFA 3FHQA 4MO3M 4XF9A 1VBA1 3ES4A 4TYSA 3AP9A 4QQPA 5FPLA 4U36A 5IVYA 1HJGA 2RS53 2PHUA 2XVGA 4CE8A 5HXMA 2JXAA 2UYAA 4BYYA 4NRQA 1SFNA 4O9GA 4UW4A 5FYBA 3AC0A 1HKDA 2F17A 3FHAA 3JU9A 4Z1VA 2UURA 4WVMA 3QH7A 3ZXDA 5JI9A 1JZ4A 1UQXA 2GNTA 5GALA 5GM0A 1QNWA 3IMMA 1QF3A 1Z78A 3K4ZA 2TNFA 1LHWA 2F6BA 1NQJA 4K1ZA 2ZGOA 4NIIA 3OBTA 1QDOA 2BGPA 1G9FA 3CNAA 3IDAA 2G9ZA 3IN9A 3CJXA 1AR92 2WT2A 1POQA 3O1RA 3KGZA 2TBVA 1X82A 3FFZA 1POV1 1UOFA 5E89A 3EYPA 5CKNA 3C7OA 5E88A 3O1PA 3POWA 5KHIA 1UL9A 1EAH2 2PQSA 1RUG3 2A6ZA 2R30A 2W68A 2VVFA 2CAUA 4Q5OA 3B7MA 4UW5A 2RMU2 3RZLA 3MZHA 4LO7A 3AZXA 4W8JA 2XMLA 3VLBB 4AZZA 2E6VA 2ZMLA 2QQLA 1SEFA 3KD4A 1PX3A 3VKNA 2DBIA 2HWF2 5IAXA 2JDKA 4QPWA 2IFRA 3LWCA 3QBQA 4A45A 3I2DA 4IV1C 4WV8A 4OVEA 2R7EB 5CG8A 4QGMA 4HK9A 3PJYA 3J7NA 4FOQA 2HEVF 5I93A 1JOBA 2R041 3H1MA 4JC1A 4GAZA 4Y33A 2YBKA 5K0UA 4CDUA 3SISA 1S55A 3ON7A 5A7SA 3RI9A 3VZJA 1QEXA 2VUCA 4MGKE 2OUHA 5E6HA 3GZTB 4ZS3A 4Q4Y1 2QQUA 3AL6A 1GANA 3POYA 3OGJA 4IGPA 5FOJB 1J3RA 1W8UA 1PK6B 2W95A 3N9LA 4KBBA 4EYUA 1OKQA 3AJZA 4YM0A 4NHLA 2VOVA 1D4VB 1SACA 2B39A 2C9AA 4YM2A 3VZOA 5LW9A 1HW5A 1CWPA 3ZKUA 1TNRA 4HK8A 4Q8LA 1R1A1 4YW2A 1JYVA 3MV11 2C9KA 2CWMA 2WNUC 5LBEA 1S2EA 3V0BA 4YWAA 4OHWA 1PM4A 4DUXA 2VQAA 1CN1A 4R9BA 1CIYA 1VRBA 3JBG1 5DXDA 5JR7B 1D2QA 4XW3A 1SLBA 2FCVA 1RHI2 5L73A 5IK4A 4Y4YA 4LMFA 2CGPA 3ZDVA 5K0UB 1EUTA 4CDUB 5ABJB 5FFOC 1WLTA 3ZYPA 4Y1XA 5A80A 1YQ5A 2HWD3 2SLIA 3SXWA 4YW7A 3JXSA 3GALA 3HBKA 3O12A 3IIIA 4CCMA 4FP2A 3QCWA 4NIGA 4QGLA 2C26A 4RS5C 3E6BA 1JOPA 3MV01 4L97A 1ULFA 4MHUA 5KHJA 5I8SA 3K46A 1MS0A 3PMSA 3NVCA 1AYN3 4IE0A 2X53S 2WYSA 5KR7A 4CUAA 4AVTA 1PHMA 3NNMA 1GZCA 1UW8A 4ASLA 3D8CA 1VB2A 1HRI3 4AL9A 4XEZA 4AQSA 3U07A 3AP6A 2XWBB 4XACA 4HFSA 5FO7B 5GLTA 4NIHA 1FPN3 3MIEA 1LGNA 1MQTC 2EIEA 3QOPA 3AYDA 2C0ZA 3I54A 3I97A 4JRAA 1S0IA 1K42A 1ND3C 2K2SA 2CL2A 4D94A 3HWJA 3ACHA 2X09A 1LOBA 2R1DA 4E4HA 2DU0A 2QQIA 2VTFA 3P6BA 5EXOA 1UPIA 4XHXA 3KF5A 2C5DA 3VBUC 4CZSA 2ZXQA 3LB9A 1FV3A 1GUIA 2JE8A 5FZOA 4IEWA 3O1MA 1UMIA 3VD4A 4GXLA 1RUF3 4L9BA 1AR91 4XUQA 1OOPA 4ET7A 5FUPA 4E9KA 1BK0A 5TSWA 3N7JA 1CX1A 3LQCA 4SLIA 3UGGA 4BZ4A 1URXA 5FP7A 1EAH1 4QKNA 4FFHA 1HRV2 3KV4A 1PIV3 2ZGQA 1ZZCA 4YGDA 2D98A 2RMU1 2W39A 3B3QE 2JD9A 3ZXEA 2WNVC 4XDQA 4BXSV 4M3CB 3NV4A 5FZ8A 3THDA 3TYJA 1AUYA 4DPNA 4Z92B 2VTXJ 4ZU7A 3OCPA 2ZKNA 1S4CA 4AR2A 3ABZA 1FOD3 1GICA 2CV6A 3JD72 4QU2A 4QM8A 4OI1A 4N7IA 5GLVA 5DAPA 3ZFFC 4NO4A 4WM8C 1GOHA 1K5MC 1QXRA 1GNZA 2O14A 4NUBA 4OUEA 5G05L 5A3TA 1ZREA 1ASJ2 1RUOA 2V72A 1PO22 4CDWC 2G19A 3ZYFA 2Z42A 2PHXA 3ORJA 3ZPOA 1JYWA 2CHHA 2MNGA 4CXXA 1ODNA 4YZ3A 1UOBA 5EV7A 2GMMA 5T5OA 2BGCA 4AOCA 3UNPA 2ZEZA 5FYYA 3M1HA 2VNGA 1U5XA 4UW6A 3LPGA 5FMOL 3ZYIB 1DGRA 2VL4A 2X8KA 2E7TA 1E5IA 2VUDA 1COV2 1UIJA 3EBRA 1ND2A 4AI8A 1RUD1 1O7FA 2BERA 2WAAA 3WINE 1VBC2 3ZYJB 4X8PA 4E4DX 4RHV1 1G9BA 3RWNA 3K48A 2RJKA 4LBMA 1S0FA 4GIQA 1F5FA 1XQNA 2G4IA 3MO4A 2B9UA 1BJQA 2OW4A 4TLGA 4ZXKA 4XIOA 1SHWB 4IV3A 4LUKA 1RHI1 3B9CA 3HQUA 4FCAA 4LKEA 4ORFA 4UFLA 4LQRA 1QY4A 2OZ6A 1PNGA 4UBHA 4COYA 4J1WA 4D6SA 1WCDJ 3BTAA 5FOBB 2ZX1A 2YHJA 2TUNA 4QXKA 3MF9A 4WZCA 4E2GA 1SLAA 2O8OA 1SBDA 2B9VA 2J1EA 3WDYA 3WDVA 3B9IA 3W58A 1WMEA 3AKRA 3MLLA 4W4ZA 2IVJA 3A21A 4QAWA 2DUOA 1ENSA 3ZYGA 3F95A 4HBNA 4I01A 4Y1YA 2DVFA 3BPSA 5EPAA 4A7KA 5BYNA 1JZ6A 3T08A 4WM7C 2VGDA 2Z79A 3ACLA 1ND2B 1JYXA 2HWE1 2ZS6B 4GH4A 4CPBD 1BBT1 3ZSEA 2GN7A 4I3GA 3HBZA 4K6BA 5IWFA 4RL7A 2XUEA 4TLFA 1MACA 4B4RA 2VPVA 4FFFA 2JX9A 3NNLA 4I02A 3UJQA 4HETA 3IAQA 5FK7A 2GDFA 1S0EA 3CDZB 5EP9A 4W6WA 1DGRN 3CJIC 1F2NA 4RQPA 2E51A 1V00A 3MGUA 4Q2FA 2R062 2KXLA 5LRRA 2WNUB 5M0TA 5I0RA 1UX7A 2VECA 1XE0A 4NPMA 2VZQA 5FBJA 2ES3A 3PJQA 5FYVA 3U4SA 3ZXJA 3H3UA 1HB1A 4BH9A 4RFRB 2RE9A 1H6XA 1GBGA 1AL22 2WFF2 3JCIA 4I0WB 4NMIA 3VBRC 4ES8A 3LZZA 4CP9A 5FTTC 1XU2A 4Z8BA 3AYAA 3TEZA 1GFF2 1ZRIA 2AZ5A 2AACA 3WQ0A 4BHPA 4BXFA 1OVSA 1RGSA 1BVVA 1AL0G 1NE6A 1TNFA 4JGYB 5FZBA 4C91A 1T6BX 1XBFA 2WS91 3A7QA 3B93A 4GJYA 4KBZA 3MHZA 1N3OA 1AR63 1N1SA 2XBO3 1S0BA 4RS5B 3WNNA 1HRV1 1LTEA 4D8MA 5FYMA 4LHKA 1PVC2 3K51A 4ZONA 1LHOA 1QH6A 1A34A 4MOAA 4RQPB 1VRH2 2P5BA 4HT1T 4LKDA 4AW7A 3LOIA 4YZ5A 3NSTA 4N53C 3OBZA 3M8LA 2KR2A 2YU2A 1C1LA 2Y6GA 4XFCA 2J1AA 1VBD3 3E5XA 3JD71 2GMPA 3BU0A 1ZZ7A 2ORXA 4INDA 4MADA 5A6YA 1NLSA 2PELA 1MQTB 4KWLA 3T0BA 3GNEA 2WSUA 5BUVA 1V6NA 2ZACA 1ND3B 1SLLA 3DXUA 1Q8QA 1ASJ1 3K4DA 1W0PA 4ATEA 3QLQA 3THTA 1PO21 1XU1A 2ZGTA 5DDJ2 1E5SA 2DFBA 3O1SA 3VDCA 1C8M3 2YMZA 1UYPA 2R072 1JYNA 2EAKA 2XJVA 2EAAA 4BOWA 1J59A 2KM2A 4Q0QA 2Y6JA 3HNBM 3VBSC 4DEQA 2XLGA 3DYPA 3M4FA 3TWIA 2D44A 5C8CA 5AVAA 2RM21 5G04L 5B4NA 5HCBA 1I9RA 4JTNA 4BIOA 2DURA 1GYKA 4AVCA 5T5LA 2VVDA 3WQBA 4LTAA 2FCUA 5D8AC 3SQOA 1PO12 1VBC1 4YW5A 2W1WA 5L7OC 1DQ6A 2A70A 1MEC3 1HN0A 2AENA 3POBA 4ZU5A 4ZZ5A 2R32A 2YBPA 4XFHA 4XZUG 2GC0A 3N35A 5IK7A 2RS32 4DRVA 3UL2A 1UY1A 4R4ZA 4BJ0A 1DZQA 1LOGA 1STMA 2N7GA 2YROA 4JGZA 1UKRA 2XL9A 1N1YA 3AP7A 1UOJA 5BNPA 2OPKA 1JODA 3DCQA 3HD8B 5D2AA 5C3PA 5C8WA 4KWJA 1SFPA 4MGYE 2W52A 2WNEA 1LODA 1AXYA 2ZCWA 2XQXA 1NLQA 4LBJA 2GC1A 1HQWA 3ZFFB 2IXLA 4WM8B 3MW3A 3VV1A 4F8AA 1E5RA 4I09A 5FMBA 3NV1A 3T3YA 5B4XA 4IEQA 2VUJA 3BUCA 4FI9A 2W08A 3AMPA 5CFCA 3NAPA 5C9AA 3U1XA 5LY1A 2DCYA 4EQVA 4L92A 3VD7A 3WW3A 3UKVA 3NO8A 4PT6A 4XOGA 5JOYA 3ZXAC 2DYCA 1JBCA 2QKDA 2VMFA 1X8EA 2EXIA 4D7YA 2BV4A 3FX3A 1QOTA 4Y26A 4H55A 1RVF3 2P4EA 4Q29A 4YARA 1OH3A 3OF1A 1JHJA 3OPZA 1LRHA 1CAXA 1N1TA 1Q8PA 3ZYBA 4NHKA 1FAYA 3WX5A 4XURA 2R061 3WVJA 5BNPB 4D0QA 2ARBA 1IS4A 2GZWA 3A0NA 5KHGA 1NZCA 4FOYA 1GQPA 3S6PA 5LWBA 2XH6A 1HDKA 2D5HA 3B00A 3X29B 3N9OA 5C71A 3VDBA 3I2HA 4YVWA 5T3NA 2RJLA 1NQDA 4O7XA 4QX5A 2W1SA 2ZJCA 2PMWB 3QD6A 1AL21 2WFF1 4Y5SA 4BU2A 4CEWC 1NCRC 2PHDA 2Y26A 1I5PA 5CFCB 3NAPB 4H3WA 4C0HA 5F37A 3J7MA 3VHPA 1Y7BA 4RR3C 4H14A 1WUVA 1A8DA 3ACGA 3WDUA 1XSQA 4LOSA 3DPRA 2WIIB 4BQ1A 5BNOC 1H2MA 5JXJA 1UNBA 1W8HA 4IW3A 1I1EA 4B3NA 1WA6X 2YBSA 3BGAA 5CNAA 3VL8A 1UCXA 1PVC1 3BPZA 5IVCA 3D0SA 4N43A 1VRH1 4AI9A 1O4YA 4AEDA
chains in the Genus database with same CATH topology
1LHUA 4Q0PA 1RL3A 3R4DB 5L36A 4QPIC 5T50A 4BLIA 3RMYA 2NN8A 4YRDA 4KQ7A 1CJPA 1WGPA 2VW1A 4Y1ZA 2G9GA 3DF0A 3N7KA 3J4UH 1SMVA 5H9QA 2BFUL 2ET7A 4ISQA 3TOJA 4GULA 2R49A 4E4SA 3U0ZA 1HV1A 1R093 5JLVA 4M0HA 4M3CE 2VOWA 3BOPA 4RFT0 4QPGC 4WVWA 5FRAA 3D82A 1SBEA 3U11A 3FLPA 3FE5A 3VBRB 2CY6A 4D3WA 2DTYA 2P3JA 2WT1A 3JB8A 4N43B 3OD0A 4NHMA 4CDXC 4FPJA 2UY9A 3HIFA 4MVTA 4LBOA 4YVSC 1PO11 4G4FA 2D5FA 5ACA3 2YV8A 1U5IA 3T1MA 4FAGA 2DF7A 3AKTA 2JG8A 2DU1A 3GF6A 3HAGA 2BPA2 3FFQA 1M06G 4NWVA 1QJZA 4EN7B 3AKSA 4JDMA 4EJRA 3M2MA 4N53B 2WT0A 4XJWA 1H0BA 1CGPA 3IBMA 4UBGA 3I59A 3RI8A 4SBVA 2P3KA 5E1RA 3GYDA 2NYYA 4KGGA 3FWEA 1HQLA 1AYN2 1OA2A 4MXWB 4QM9A 1AR83 3B5LB 3H1WA 3ZDSA 5JMCA 3KT1A 2XJRA 2NMNA 3KSCA 2ENRA 1AX2A 2ZGKA 1NXMA 3ELNA 1HRI2 3PHMA 3BODA 4XBLA 4GKXA 4XFFA 3WY6A 3USSA 4PIYA 1Q43A 4AK3A 3DUIA 1MZFA 5GZDA 3VBFC 1FPN2 1H4GA 2UYBA 2YZ4A 1VBE3 4XFIA 3JQWA 1O3RA 2Y38A 4OUSA 2O0OA 1A78A 4R9CA 1CPNA 3OY8A 5CVRA 1JUIA 1RUC3 1SFYA 3ILNA 3I59B 1LCLA 3MIFA 5J36A 1U5ZA 4LBQB 1RUF2 1V6MA 1H2LA 2F4PA 4XQDA 4NN0A 1DZRA 1EP0A 1UX6A 5A33A 2WLQA 4EN6B 3CLPA 1GLHA 1NA1A 1QGLA 1CJDA 1RUG1 1LEDA 1PIV2 5KHKA 4PLMA 4PDWA 1N3PA 4XBNA 2I74A 2NM1A 5KC5A 4FT8A 3QH6A 1OFNA 1IPJA 2D6NA 5I8YA 3OD4A 4PLOA 1IS5A 4P14A 2UWAA 4CDQA 1FOD2 4XXAA 1LOAA 4EROA 4EN8B 3BIWE 5GKAC 1X33A 4X8NA 4YGBA 2PHWA 2R042 3PTYA 1VAKA 4N9HA 4R52A 3D6EA 5JZGC 2DV9A 2QCSB 4BMEA 4HPKA 3NKGA 2HEWF 1I6XA 4AI0A 1IS3A 3QACA 4XBQA 4P9XA 2A3YA 2P34A 3FMGA 1NG0A 1KXGA 4LBQD 4QGNA 4GMP3 1BEV3 1ZZ8A 4PDWB 4I0BA 2DVDA 4FVVA 2CYFA 4CEYB 1JTZX 3H7JA 1Q56A 2IXCA 2IFWA 2SBAA 4RR3B 1H30A 4XETA 4CDQB 2VU9A 5HBAA 2BQPA 4FPKA 3PNAA 1Z7S2 4AVVA 5BNOB 2E7AA 3TB0A 4AQ2A 1WW6A 4AFMA 3VZMA 1BYHA 3I8TA 1O3QA 1G8WA 3ST7A 3FBMA 1H8TC 4AFAA 1D2SA 2HWD1 5JCTA 4YLZA 1SCSA 2PLV3 3WXPA 4N7UA 4R8HA 2VY0A 1CVNA 2CTVA 2EXHA 3ILRA 3N3HA 5DUUA 4HKLA 2H0BA 4Q27A 1AYN1 5KC6A 1X7NA 3W9AA 4K3UA 1Y9QA 1WW7A 5BNNC 4AQTA 1HRI1 5FPZA 3WQ1A 4AVBA 4QPGB 2DVGA 4RA0A 3WD5A 1FPN1 5E8AA 2B8MA 4OULA 3LCPA 3PVNA 1REFA 3MIGA 4V1PA 4K40A 2GC3A 4AE2A 1KFXL 3WP6A 5KWRA 3KQRA 1BQPA 2KA3A 5FPXA 4COVA 2Z5WA 3KCCA 3O0WA 3AX4A 2MEV3 1FYUA 4FPLA 4LO6B 1RJ7A 2UY8A 1RUF1 2XG3A 3KCXA 3AP4A 3WUDA 1L3JA 2H6CA 2AH2A 1JOJA 3TNQA 1PK6A 2DTWA 1AR62 2XBO2 2HYKA 2RS13 3R0RA 3ZXLA 3WT3A 1PIV1 3ZMOA 5HI0A 2D43A 1ZVFA 3PVOA 3O7OA 3UV9A 2Q1MA 3R05A 2QZ2A 3R4SA 2XB6C 4XJZA 1FOD1 1VBD2 3RSJA 4DXZA 2GN3A 1OLQA 1OQ1A 2WFPA 3AM2A 1QJX3 5ABJA 4FQ4A 1BVP1 3MIDA 4W6XA 2TEPA 5C4WA 4YYOA 3SH3A 4R9DA 5CFDB 1C8M2 4A7ZA 4M00A 1Z0HA 4XHBA 1A8MA 4IXLA 1QHDA 3PVBB 1RUD2 3MI8A 1DF0A 2R6QA 4RHV2 2X5IC 4HSLA 3LA7A 4ATFA 5JSOA 2VVEA 2WSVA 1MEC2 5K8SA 1LHNA 1Z7S1 5I0TA 3VKFC 1BMV2 2JEMA 1JYCA 1YFYA 3RG0A 1JYIA 1HXS3 2LTNA 4EWAA 4AEMA 4GALA 3DN7A 5GLZA 3IDEA 4PJYA 5C4WB 1Q3EA 1MS9A 1C5HA 4F83A 3B94A 1X50A 2CWSA 2D6OX 3RJRA 3VL9A 3TRSB 1BXHA 1GSLA 1LOEA 3RJ2X 3ZYRA 1SDWA 1R1ZA 1QDCA 1OSGA 1O5LA 4IETA 1RUH3 2A5ZA 2HWE2 1VBB3 2I2SA 4FPYA 1BBT2 4XTMA 3S7IA 3MIBA 1JN2P 3M3EA 4Q0VA 1DU3D 3MF6A 3VBHC 1DZTA 4P9WA 2DCKA 4GH4C 1RVF2 3SITA 4M3CA 2B46X 3MYXA 1VLNA 1HX6A 4XFBA 3KGLA 4AEJA 3KLSA 1W6NB 4FBFA 1OA3A 5T5PA 3IMNA 1G9CA 1GV9A 4IQPA 1MR5A 1RUE3 3M3QA 4MZUA 4KG0A 3ME2A 3GZAA 1OPMA 1H8TB 2WS92 4YG3A 3I7DA 1J58A 4DB5A 2GNBA 1WLCA 1YFXA 1I3HA 1KJLA 1AR61 2XBO1 4P5HA 5DUXA 2PHTA 2C1FA 3ZSKA 2FQPA 4M01A 4YNIA 1CAVA 1W6PA 4P9IA 3TN93 4XJ9A 1V6KA 5BNNB 3M3IA 2BNNA 4AHWA 1WMDA 1F5JA 2D93A 1VBD1 3WHTA 1LJ7A 3WNXA 1H1MA 3B02A 1XYNA 1FV2A 1ZBE3 1R092 4IV1A 1C8M1 1ZRCA 1KQRA 4FPFA 1DGLA 1KFUL 2WA4A 3MPPG 2RM22 3FLTA 1QOSA 1UKGA 3ASIA 1NXD1 1RUI3 2OYZA 1ZBA3 4FPCA 4DY3A 4OHVA 1CAVB 2Q1ZB 3WW1A 1W6PB 3JUUA 1WMFA 4YG0A 2WQ4A 4ZU4A 5I8TA 2LM3A 5B2GB 4PCRA 5ACA2 4XQWA 3VGIA 1LOCA 1MEC1 1W6OB 3MFCA 1JHNA 1EPWA 3ZFGC 3VBOC 1BMV1 1CAWA 2DCJA 2HWC3 3KB5A 3IDCB 5FAXA 2WNUA 1REDA 2WZR3 2CGOA 1EY2A 5EFUA 2XHKA 3N7MA 4YFWA 5DG2A 4IV1B 2DCTA 1VAVA 2YUEA 5FLIA 1HLCA 1S0DA 2UU8A 5L19A 1POV0 3VKLA 1AR82 2V09A 3OYWB 5SV5A 1AYM3 1NY72 1EV13 2RR13 3P3PA 1PZ7A 2XVKA 4JGYA 3WCRA 4B7EA 2ZOEB 2ZKLA 4FTBA 3NV3A 4KU8A 3AKQA 4ASMB 1XE7A 4RS5A 1ENXA 2NMOA 4LBNA 4MX3A 5LRSA 3AMHA 4CP0A 2GU9A 4KNCA 5LEJA 1RVF1 1YNAA 5AFBA 1VBE2 4IL7A 1CAWB 3WLUA 5FQ0B 1GZWA 2YDEA 1SCRA 2VMHA 1FT9A 2X5IB 1H2NA 1RUC2 4XILA 2BNOA 2ZGSA 1QOOA 3ZN6B 1XRUA 1MS4A 1MQTA 4GWNA 1BCXA 2E53A 1ND3A 4A3XA 2ZGMA 3NV2A 2XUMA 3ZMNA 1RMU3 3WP4A 1C3HA 2JKBA 2ZGUA 2WL1A 1QNYA 2ZX0A 4XJAA 3VBUA 3LOBA 2JJ6A 3CL1A 4P9LA 4JDNA 4AGGA 3ZSJA 2ZMNA 3ROUA 5BPXA 3WW4A 1AZDA 3O14A 3M3OA 1GZWB 1OQDA 2V5YA 3WOGA 3P3NA 2A75A 4AHYA 1V9U3 3LSEA 1J3PA 3VBHB 4D69A 5GZCA 1W6QB 4XF1A 3J26N 3AFKA 1SBFA 1VJ2A 2DVBA 2VQ0A 2WNVA 1BZWA 2BWAA 3SMHA 1YLLA 2YY1A 2OIIA 2RMU3 3LA2A 3OJBA 3W59A 5F5QA 2WJSA 5EYXA 2YGLA 3L2HA 2NZ9A 4YGEA 1X8MA 2JG9C 4QQLA 4XFAA 1NYWA 3WG2A 1R091 2XL7A 2HWF3 3ZFFA 3VBUB 4WM8A 2VXRA 1A3KA 1C28A 1C8NA 1G6NA 1NLRA 1D4M3 4A2UA 1WCKA 2WC2A 1NE4A 1TMF3 3HQXA 1DBNA 4XZPA 3VZKA 2XPJA 2Z69A 1DGWX 3RRDA 3ZO0B 2A73B 5ACA1 1IQAA 2BBVA 4META 4AFDA 5A3LA 1TME3 2WNVB 4K8FA 2JG8C 3ZFEC 1LENA 3C3VA 4QHBA 4I30A 4DMIA 1LB2A 4DQAA 2PLV2 1F8VA 1ULCA 4QQ2A 5CIRA 1GR3A 1K5MB 1G7YA 4Y22A 1NCQC 3VDDC 4CDWB 1AR81 1NY71 1LKNA 3D0JA 3BALA 5C33A 4C90A 4XF0A 2ZHMA 4LO5B 5T54A 3LGRA 3D5OA 4XXPA 4XMAA 2RS52 2ZPXA 5K7PA 1LECA 4EWDA 1LOFC 1KDKA 2WLPA 4Z07A 1VBE1 2QZ3A 3V56A 4YSFA 1VIWB 3M3CA 3ZVXA 2Q0AA 4FOVA 4G3YC 1RUC1 1OI6A 1E57A 4Q4V3 3G7DA 1TEIA 2PFWA 1WLDA 3BOWA 3CJIA 3VBOB 2EVXA 3GZUC 1UU5A 4Y22B 3Q9OA 4E2QA 1LU2A 1RINA 1SLTA 2PHRA 2RHPA 5FCCA 1OLRA 5L73A 5F9TA 4HMZA 2FMDA 4KG8A 1RUG2 2WA3A 4ONUA 4C0BA 4EN9B 2ZABA 1UPSA 1DQ4A 3AXEA 2RS12 4LLFA 4CP1A 3VBRA 2XJSA 4AVAA 2EIGA 3WP3A 2Z2SB 1S0GA 1B09A 2GH8A 4WM7B 3AYCA 1QH7A 1S0JA 4BMBA 4J6GA 2BTVC 2OZJA 2A7AA 1RUNA 3SCHA 1WLWA 3WHUA 2VW0A 1O4TA 4Q1RA 4IERA 1QJX2 5JOXA 3CJIB 5HCAA 4NVPA 2EF6A 5GZGA 4LE3A 4Y20B 4S2GA 4N53A 1LU1A 1RB8G 1O3SA 2ZX2A 2AR6A 1B35C 1WW4A 1QJU3 1C1FA 2EA7A 2X29A 4KU7A 2YC0A 4WZFA 2PN5A 1D0GA 3B69A 3SH4A 2MPFA 4MXWA 4GMP1 1BEV1 3R4UA 1Y43B 2V73A 4TSVA 1WCSA 2OA2A 3WW2A 3AYEA 4AVSA 5FLHA 2BFUS 2JE7A 3GHMA 4L2NA 3WG4A 3VZLA 4W6YA 1QJY3 2GMEA 1J1TA 4OUMA 1IOAA 2PAKA 4XIKA 2AGSA 2HWD2 3HMYA 3WDXA 5D8AA 5L7OA 4OHYA 1COV3 1XYOA 4YFZA 4URTA 3E5QA 3H0OA 3KMHA 5J7MA 5AC93 2PLV1 2AREA 4LBQA 1YFUA 1RIRA 2CAVA 3RDIA 2P2KA 1RUH2 1VBB2 3N7LA 4MXVA 4IEYA 1WW5A 4Q4X3 1S1AA 3R6SA 1X36A 2XJPA 2VNRA 3VBSB 1YO8A 1DHKB 3KM5A 1TQ5A 2D6MA 2RS51 2ILMA 3OTFA 3RQ0A 3MEPA 2ZA9A 5D8AB 1ULDA 5L7OB 1VALA 4MV2A 1Q8SA 2PHFA 2D40A 3MLJA 5LK7B 1VP6A 2ZBJA 2IXHA 5AVPA 1RUE2 1CONA 1J1LA 1ZA4A 1W6MA 2R0FA 1CIWA 4LUMA 5BXXA 1XYPA 1KD7A 2ZGNA 3HN1A 1REEA 3L2YA 1SLCA 3WG3A 4R4XA 1O4ZA 3RNSA 1YI9A 3EO6A 4DOUA 4XYXA 2VMIA 2EXKA 2RS11 4CEYA 1BKZA 1WBFA 2IXIA 4OZXA 1AX0A 4OLLA 4CEWA 1NCRA 1NCQB 3TN92 1ZYBA 3O0VA 1H9WA 3AJYA 1AHSA 1ULEA 4RR3A 4RGAA 4AF9A 5BNOA 1V6OA 3ZSMA 1AJKA 3H50A 5JOZA 4Q4W3 5A32A 3ETQA 3BCWA 1CESA 3H7YA 4RGGA 2PQQA 2JICA 2VOKA 1QJX1 1W6MB 4LE4A 4F7ZA 2FZ1A 5K0UC 4CDUC 5DZGA 1ZBE2 4QPIA 4YW1A 1GNHA 4D7SA 1S2KA 1KRIA 1PGSA 5J96B 2W0XA 3H9AA 2VUAA 1DYKA 1RUI2 2WKKA 4CEWB 2ZGRA 1NCRB 4GKYA 4JVAA 1H1IA 4GQ7A 5DDJ3 2ZAHA 1PNFA 4QPGA 1FMD3 1ZRFA 1JH5A 3IIAA 1MS1A 2R073 5A32B 4HN0A 2HWC2 4FQZA 4XPVA 2YYOA 1R083 2XGXA 4KGQA 2ZHNA 1H8VA 3CO2A 1HXS1 3FUQA 3TYJA 4YZ1A 2WZR2 4PF5A 4MGZE 1MVQA 4CDXA 3BU7A 1U5YA 4PIZA 4QPIB 3JB4C 5GLWA 1HIXA 3HR9A 3S30A 2B45X 3RS6A 1AR73 1QQP3 4Q0UA 2K0GA 1AYM2 1RUH1 1EV12 1OQEA 2BEOA 2RR12 4UW3A 1VBB1 3IPVB 2RS33 2ZZJA 4B7KA 4O9EA 2PYTA 1VB4A 2E9QA 1QKQA 1B35B 1MVEA 1KDMA 2H6BA 4BA6A 2A3XA 1V6LA 3OBRA 1MS3A 4HKWA 3TAYA 1RITA 2BYVE 1G9DA 3TNPB 3MLKA 4AGVA 2D6PA 1PVXA 2PAMA 1KJRA 3M70A 4CDXB 4YVSB 4KH9A 1AXZA 2R1BA 3UKTA 3MDPA 4X6QB 2PAEA 2XKPA 4PQ9A 4ISRA 5GLUA 5IK8A 4QPYA 3IWZA 1CX4A 1I5ZA 1F31A 1RUE1 4HSJA 3S0MA 4KWKA 1RMU2 4Y5Z0 5CFDA 4YGCA 2B5HA 5BY5A 2PA7A 5I91A 2GC2A 5DG1A 4OI0A 1ULGA 1OOPC 4P9JA 4DFSA 1N1VA 2IXKA 4GMP0 2GNMA 5JSPA 4HKOA 4XJUA 2XLAA 3A0KA 3DL3A 2HWB3 1DDLA 3TN91 2LUWA 3KT7A 2P3IA 1V9U2 5KXCA 5FREA 4G9SB 1U12A 1UF2C 4FXKB 1KITA 3VBFB 4A7YA 4JDOA 4XJ8A 3ES1A 4E27A 5LEKA 2XWJB 4Q26A 2I45A 1PGW1 4XF3A 2NLRA 2H0VA 5JI7A 1N3QA 1ZBE1 5CADA 3GBFA 2UWCA 4I3PA 3WCSA 5J3UA 4WVMB 5JZGA 4FXGB 3N4MA 1D4M2 4B29A 3H3ZA 2ZX4A 4WVVA 3AKPA 1DGWA 1DYPA 1RUI1 4H7LA 1ZBA1 1TMF2 2BUKA 1SLIA 1O91A 2BVBA 5HCFA 1DQ0A 3FBYA 4OHZA 1ND2C 1CPMA 1EPZA 1NOVA 1IKPA 1DQ5A 4EN0A 1RUJ3 3WG1A 1EYBA 1GQGA 4GB33 1TME2 2VW2A 2HWC1 3J9SA 4TZDA 1QMJA 1AJOA 4LHNA 4LT5A 4IV3C 4OFGA 4PBPA 4RSUA 2WZR1 2A6VA 2GALA 1W6NA 4AG4A 1H4HA 3A4UA 1Q8VA 3J8F3 4KL1A 1DIWA 5EZWA 5JZGB 1ZZBA 2P17A 1TE1B 2ZGPA 1AYM1 1H8TA 1EV11 2RR11 4HANA 4IESA 4ITCA 1YRZA 2DWRA 1YJKA 1YCIA 2WINB 4L8QA 4JGYC 4Z2WA 4LHLA 1U0AA 2D6LX 2IWGB 3AZZA 3ATGA 4AEKA 4IEZA 2I07B 2K9ZA 2BWCA 2ZMKA 4N90A 4TWTA 3MW4A 3KT4A 2MHFA 1UMZA 2JECA 4S2FA 5BNNA 2QQPA 3RYPA 1FI2A 4RQPC 4FPOB 4DZGA 3NKTA 3T1LA 4AFCA 1DFQA 4R9AA 5DZFA 2Y0OA 3V0BB 4Q4V2 1VBA3 1GZ9A 3IT8A 3GBWA 4AI1A 5JIUA 1JXNA 2CNAA 1QXPA 2VNOA 2G9FA 3AP5A 3CU7A 4K21A 1RMU1 3V0AA 4XTPA 3WZ1A 4JCKA 3VUOA 1F9KA 4NR1A 2Q4SA 1AVBA 3LSDA 3WV6A 3RZZA 1D0HA 1APNA 4PLNA 3VN4A 1LULA 5F6LB 1POV3 4CTEA 1V9U1 2ET1A 4B4PA 5D1IA 1W6OA 5CAZA 4MH0E 5T5JA 3KS7A 4LEJA 3C2UA 1O3TA 1ENQA 3I4IA 3GBGA 4K1YA 5SV8A 4UXAA 1OA4A 4COZA 4U2AA 1UU4A 4AFBA 1YHFA 4F3JA 3V0AB 1QJU2 3SH5A 1FX5A 1VR3A 1FATA 3SCGA 2HWF1 4QQHA 2XVLA 2EALA 3OYWA 4AXOA 3AZYA 1D4M1 2P37A 2R043 1QWRA 1H9PA 5CU1A 3ZIWA 4FTEA 4DY5A 1ZNPA 1TMF1 3HT1A 5C8CC 1CD3G 1YWKA 2HEYF 3ILFA 1YJLA 1OOPB 5KXDA 3RYKA 1IS6A 4Q4Y3 4AWDA 2IXJA 4CRQA 1QJY2 1GQHA 3PMEA 3FLRA 4H7MA 4OI2A 4FP3A 4OI4A 4LA2A 5FQ0A 5FMOS 1TME1 1S2BA 4YW4A 1ZZ6A 1R1A3 2X5IA 3IDBB 3M7AA 3L9JT 4JGZC 4NPRA 3E97A 3ZN6A 5BNPC 3JBG3 5AC92 1AF9A 3SHRA 1MS8A 4I2OA 3FUOA 3KCYA 2FHRA 1XE8A 1JUHA 1Z7S3 4YM3A 4M0NA 4JAAA 1Q5OA 4D7TA 1LGCA 1UU6A 4MGIE 4Q4X2 2E63A 5CFCC 3NAPC 4P9GA 3ZSLA 5C9AC 2VMGA 2LALA 1PGL2 5JVVA 3S7EA 3EJKA 4Y1VA 1H2KA 2QVSB 4DNYA 2YGMA 4LR4A 3O0XA 4QMAA 1FNZA 4QQOA 4BPZA 4FAHA 2XLFA 1MZEA 4Y24A 4J1XA 3VBHA 4FO9A 4AHXA 1W6QA