5FDBA

Iron free rat cysteine dioxygenase r60qc164r variant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTQNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTRHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron free rat cysteine dioxygenase R60QC164R variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fdbA00
3FWEA 3PVBB 3I54A 3RPQA 2CV6A 1DZTA 1ZZ6A 2PYTA 4MUVA 1ZX5A 3MZHA 1J3PA 2OPKA 3KGZA 4PIZA 1ZRFA 4HN1A 3RZZA 4XF9A 4IESA 2XLAA 3SXWA 4CYDA 3IIAA 3OD0A 5FLIA 2IXJA 3I7DA 2GC3A 1ZZ7A 4BHPA 4QMAA 3U11A 4I0BA 1Q5OA 2UYBA 5EZWA 5FQ0B 4UXAA 3G7DA 4NVPA 2HKXA 4GULA 2IXCA 3EO6A 3SCGA 4JV4A 1WGPA 1IPJA 4FBFA 4ONUA 4HSJA 3D0JA 5FLHA 3HT1A 1VR3A 3I59A 2QNKA 5I0UA 3HT2A 1YFYA 2BEOA 1YHFA 3WW1A 3OCPA 5KBFA 3DL3A 2BNNA 3D82A 3VHRA 3NJZA 5E1RA 2GAUA 2H0VA 4I0AA 4IEUA 1CAVB 4PJYA 2O8QA 4E2GA 4DINB 2Q0AA 4QGLA 3LWCA 2VPVA 4Z07A 4X6QB 4ZU4A 5I91A 4UBGA 5LRSA 2ET1A 4X6RB 3U0ZA 2EAAA 1TQ5A 1VP6A 1RUNA 3RYPA 4AQ6A 3D0SA 2VECA 3H1MA 3I59B 5I0TA 1LKNA 1ZRDA 1YFXA 3N4MA 5JAXA 4KWJA 1EY2A 2BGCA 3FHIB 5FPXA 4AVAA 1RL3A 3TNQA 3QOPA 3PLQA 4E2SA 1CGPA 1I5ZA 5BY5A 1CAWA 4IEZA 3TNPB 4HLTA 3KSCA 2GC2A 2K9ZA 3H1YA 2MNGA 4KWLA 1X82A 1CAWB 4JTNA 5BUVA 2ETEA 3IBMA 1YLLA 3SMHA 1EP0A 3WW2A 1NYWA 1YWKA 3IDBB 4JTOA 4HMZA 4QXKA 4IEWA 4PIXA 3FZ3A 3USSA 5I0SA 1JUHA 1X8MA 1O5LA 2ET7A 4HVRA 4IEOA 2F4PA 4LA2A 3H7JA 5CADA 2XKPA 4BH9A 1V70A 4MGIE 1ZZCA 2D93A 1RUOA 5F1RA 2PFWA 5D1IA 2V09A 4XFIA 1CAUB 1CAVA 4R8HA 4XF3A 4IEPA 4EROA 5I8TA 2FQPA 3HQXA 4Q0UA 4AQ2A 2KXLA 1XRUA 4RD7A 2Z69A 4QM8A 4IEXA 3UKNA 4J1XA 3LA2A 4YYOA 1NE6A 3PNAA 3NL1A 4HBNA 3BCWA 2IXLA 3UKTA 3CO2A 4XFCA 5LRRA 4IETA 5LEKA 4IEQA 5KHHA 3H50A 3FE5A 2OYZA 2PTMA 3BPZA 1G6NA 4FAHA 4LUKA 3CEWA 3H3ZA 3FJSA 1O3RA 4L11A 2IC1A 4D7TA 2PHDA 3H1WA 5KHIA 3RYKA 1XE7A 1OFNA 5JCTA 3L2HA 4EV0A 2VQAA 4XETA 3NVCA 4AVBA 5C8WA 5HI0A 2IXIA 2Z2SB 2QVSB 4F7ZA 2QCSB 4H7LA 3S0MA 3ACLA 4LTAA 1J3RA 4XFGA 3CL1A 3E6DA 3DKWA 1SQ4A 1LB2A 2B5HA 2D5FA 1O3SA 1XE8A 2BNOA 4E2QA 3ST7A 3EQEA 1ZVFA 5FLJA 4MGZE 1GQGA 2O1QA 4TLFA 1RTVA 3E5UA 1I6XA 2PQQA 3DV8A 3KCCA 4Z82A 1LRHA 1Y3TA 3JZVA 4MX3A 4Q0PA 4EWDA 3ES4A 1YFWA 4OFGA 2GH2A 3BALA 1X7NA 2D5HA 4XF4A 1GQHA 4IEVA 4A2UA 3RDIA 4XFFA 5I0RA 2FMYA 3H7YA 1J58A 1Y9QA 4XEZA 5JSOA 1ZRCA 4YARA 1U12A 1NE4A 1QWRA 5K8SA 2WC2A 2UYAA 2Y0OA 4XFAA 4FT8A 4I09A 4R52A 2CAUA 3SCHA 2XKOA 3KGLA 4KWKA 5AVPA 1IPKA 5I8SA 1WA4A 3GYDA 4MGYE 1Q43A 2OZJA 2ZKLA 5BV6A 2GZWA 4BYYA 1DGRA 4XF0A 2GU9A 2EA7A 2IXHA 1OI6A 3M3IA 1DGWA 4EWAA 2PAMA 4L2NA 5CVRA 4YRDA 1ZREA 1LR5A 2B8MA 3ELNA 1CAUA 4KL1A 1VJ2A 4Q0QA 1O5UA 2OA2A 1H1MA 1OD5A 4Q29A 4ZU7A 3E5XA 1O4TA 4HN0A 4I2OA 4XFHA 4PIYA 2IXKA 3ZDSA 1Q3EA 3ROUA 3WW4A 2DCTA 2H6CA 2P17A 1SEFA 1FT9A 4I02A 5FPZA 5BPXA 4MH0E 4JVAA 3SCFA 5FDBA 3MPBA 5I8YA 5J3UA 2EVXA 2XLFA 4F8AA 2N7GA 2Q4SA 1NZCA 4XFBA 3BU7A 4UBHA 1CAXB 3ETQA 1FXZA 4P9GA 3NW4A 3FFQA 4IERA 3UKVA 1L3JA 1J1LA 5CU1A 3E5QA 4QGMA 5JSRA 5BXXA 5JR7B 1UPIA 4O9EA 3CLPA 4MGKE 5E16A 4D7SA 2ATFA 1WLTA 1ZZ8A 3EBRA 2D40A 1UIJA 4KU8A 3QACA 4HZFA 4WZCA 3R6SA 3CF6E 5JSPA 2XLGA 4HSLA 4LUMA 4Q0VA 3U10A 4LA3A 5J7MA 4IEYA 5I93A 1X8EA 3E6CC 2BNMA 2C0ZA 4QM9A 3KMHA 3SHRA 1O3TA 2XL7A 2UY8A 2PHLA 5FCCA 2MPFA 2Q30A 1QY4A 3E6BA 3M70A 3BB6A 1ZRRA 2UY9A 4KU7A 5KHKA 4I3PA 3IDCB 4XF1A 3LA3A 2HJIA 3C3VA 4LULA 4MV2A 3EJKA 4QGNA 2B9UA 3ES1A 2K0GA 4ZU5A 3LOIA 1O3QA 4META 4YNIA 4ORFA 1RC6A 2XHKA 4HVQA 4WBBA 4AVCA 1O7FA 2PAEA 3S7IA 1CX4A 2XGXA 3FX3A 3GBFA 3H3UA 1OMIA 1J3QA 1NXMA 3B02A 3CJXA 2QDRA 3NKTA 2QJVA 4MZUA 1YFUA 2MHFA 5EFUA 5J48A 3MDPA 1ZZBA 4WVZA 2CAVA 3RNSA 1RGSA 1DZRA 2ZCWA 1PMIA 4AXOA 1ZNPA 3MYXA 3OF1A 4B29A 1HW5A 2CGPA 5KHGA 3OTFA 5FQ0A 5KHJA 5C6CA 3DN7A 3H9AA 1CAXA 4N9HA 1EYBA 2GC0A 3S7EA 1SFNA 1ZZ9A 2I45A 3IWZA 2E9QA 4FAGA 3NSTA 1FI2A 4YSFA 1EPZA 1UD1A 4J1WA 4OLLA 1UW8A 2PAKA 4K8FA 1QXRA 3HIFA 2Q1ZB 2GC1A 2H6BA 4O9GA 4Q0SA 4BIFA 3E97A 5T3NA 1UIKA 4N9IA 3RYRA 3H8UA 1J59A 1YUDA 2OZ6A 2PA7A 3EHKA 4QX5A 3WW3A 1H1IA 3O14A 3LA7A 4HVOA 1UCXA 4EWEA 3LZZA 4I01A 4LLOA 3OGJA 1QXJA 2BYVE 2WFPA 3LAGA 4LEJA 5LEJA 1PM7A 2XL9A
chains in the Genus database with same CATH superfamily
5F7UA 2MEV3 3I54A 1HJGA 1NA1C 5FP7A 5EQUA 3RI8A 2D6OX 1B35A 1C28A 1DZTA 2OW4A 4K9SA 4XUQA 4QXHA 5FR3A 3GJAA 3POGA 1BK1A 3W59A 3DPRC 1W9YA 3K4ZA 3LPGA 4HN1A 1PK6C 4TXWA 4Y20A 3V56A 4DXRA 3RJ2X 4CYDA 3IIAA 1H2NA 4WM8A 3DYMA 4R9AA 4W8JA 2WZPP 3LDRA 1DGRN 1UZZA 1W6OA 2JG9B 2WZEA 4JGYB 4KG0A 4BHPA 4FOYA 3U11A 2JE9A 4OVEA 2VR4A 4URTA 4UFLA 2FCTA 5EZWA 4QPIC 5HXMA 1W6QA 1IS6A 2YBKA 3AMHA 1W9SA 2HKXA 4NVPA 4QB6A 1COV3 3ZYPA 3VLBB 1S2KA 1D2SA 3N35A 1ND2C 1GZWA 1TME3 3P3PA 1IPJA 3EYPA 5E89A 3D0JA 5FYTA 3HT1A 2JG8A 3KT1A 2D6NA 2BERA 2CTVA 2QNKA 3GGLA 3I59A 2HWF3 1GMMA 2J1TA 3BTAA 2XONA 1YFYA 4D7YA 1AYN2 4S2DA 2WFF1 3NNFA 1YHFA 2VXJA 4YW4A 3OOXA 5E88A 3FBMA 4XBQA 4O7XA 5DAPA 5EPAA 2CHHA 3N7MA 1UZYA 1KDKA 2YHJA 3D82A 5M0TA 1LGBA 4K20A 4PQ9A 4TWTA 2GAUA 1JZ3A 4I0AA 4IEUA 1HIXA 4PJYA 4XTMA 4CVUA 3UESA 3OPTA 2QE3A 4E2GA 2JG8C 3LDKA 1OQEA 3OUIA 3AYEA 2DBIA 4EZHA 4QWNA 1H4HA 1EAH2 3IAPA 4Z07A 1FOD2 4X6QB 1PGSA 4ZY9A 3T08A 2JKBA 3UK9A 3ZN5A 1AR61 1GU3A 2VE1A 2P2KA 4AEMA 3WOGA 3VBSB 4DMIA 4RHV3 3MHZA 1AR62 3U0ZA 3J7NA 1LEDA 2YU2A 2NMOA 5C9AA 1E5RA 2J1RA 5LBCA 1A78A 5KXCA 4CXWA 1QJX3 4D94A 2Y8KA 5CKQA 1VRH2 3D0SA 1Y9GA 1K5JA 2ZX2A 3DECA 4L92A 4RS5C 3J7MA 4NOTA 1GR3A 3IDEA 2R072 1PO22 5A3MA 3VBHA 1BMV1 1YRZA 5BNNB 4GXLA 2WO2A 5IVJA 1PO21 1V00A 2WT1A 3ME2A 2F17A 1BMV2 4ZPIA 2ZPXA 4CCLA 1LESA 5FPXA 3T1MA 1ASJ3 2E31A 4DUVA 1PK6B 4AW7A 2IZWA 4QHOA 1RHI2 4XW3A 2XB6C 3PLQA 4GH4C 4Q2FA 2FDHA 1IQAA 1CGPA 5L7OB 3KVBA 3U75A 4IXLA 2FDJA 3ZMNA 2EF6A 5HV0A 4B4QA 2C5DA 3AK0A 4BXSV 4NHXA 3KHCA 3T0DA 3WP6A 5KXBA 4ASMB 1VPHA 2G19A 4EN8B 2VZVA 4BQYA 4GA9A 4AI0A 4QPIB 1HRV3 2Q8DA 1NUKA 3DUIA 2R043 3CJIC 2K9ZA 3PIGA 3PUQA 4YW5A 5F9TA 1X82A 4WM7C 2VMCA 2VZ1A 3FMGA 1NY71 2WDBA 3HPNA 3IBMA 1MQTB 1SFPA 2XOMA 4HL0A 4YM2A 5L7OA 5A1AA 2VVDA 2HWC1 4FVVA 5A3TA 1EP0A 1RUF2 2FCVA 2YPDA 5C3RA 5FYMA 5LCWL 1YWKA 1VRBA 2HWC2 2R6QA 4ISQA 5IVCA 1JZ5A 3N36A 4KH9A 4IV3B 3UV9A 1LNSA 2QTWB 1DCSA 4LNVA 4CDXB 1UX6A 2VO5A 4Q1PA 3B01A 1E5IA 2WZR2 1O5LA 3T0AA 5F5AA 1GV9A 4XMIA 2G9GA 5FXZA 4NIAA 1TVGA 2ZHKA 1ZA7A 3H7JA 1H2LA 3THDA 1S0GA 2QFEA 4NROA 4Z1VA 4BMBA 5GLTA 2W0XA 1ZZCA 2WT2A 3AB0A 1RUOA 3CDZB 3OPWA 1MS1A 2RDQA 4R8HA 3IPVA 4XF3A 3WNXA 1YJKA 3ACHA 1VBE3 2WFF3 1V6LA 1KEXA 1W2OA 2WSUA 2ZGSA 5EHDA 4LLFA 5AC93 2FQPA 2RS12 3VBFC 4Q0UA 3IAQA 3VBSC 2KXLA 5DN2A 4AQ2A 1W8OA 4BK4A 1OHFA 5I0DA 1K42A 1HQLA 2DF7A 5FZOB 3LFIA 5IVYA 2R1BA 3HR9A 3VZMA 3JU9A 2BU9A 1SPPA 1V9U1 4J1XA 4OQ8A 2DCZA 3K77A 3NL1A 1VBD3 4HBNA 5CAZA 1PIV3 4XFCA 5DUVA 5LRRA 3CJIA 4K1ZA 1OQ1A 1A8MA 2RS53 4H3WA 1QJU1 2VD7A 4IEQA 3GCWA 5FOBB 3NNGA 3V0AA 3EMRA 3FE5A 1ONAA 2QQLA 1LHWA 3FUQA 3OGVA 5A32A 2RR11 3A7QA 1SACA 2NN8A 1G6NA 2P4EA 4RQPC 3N9NA 4AQSA 1WMXA 3FJSA 5AVAA 1MS4A 2IC1A 2R7EB 5LY2A 4CP9A 3H1WA 3I4IA 5JWPA 3I97A 2XXZA 4HKWA 1POV3 3FLRA 1XE7A 1OQDA 5JCTA 3L2HA 3B9IA 4XETA 1A6CA 1W6PA 2WNUC 1DLCA 1UYPA 4W6WA 1MZ5A 5FZCA 2BV4A 1YIFA 4Y1YA 1US2A 1WW6A 3AJZA 3NAPA 1W6NA 2BFUS 2P6CA 1WW4A 2QDNA 2R0HA 2QQJA 1HXS3 1SQ4A 4Q5OA 2B5HA 4CSWA 4XQ4A 2CU5A 4M0NA 5K4LA 1O3SA 3KM5A 1CIWA 5FPBA 3VBFA 3WY6A 4E2QA 1RJ8A 1RHI3 2DYCA 5ACA1 1YQ6A 4CP1A 2I74A 1ZVFA 1HRV1 2ZGOA 2E32A 2JKXA 4TLFA 1SDWA 3HNMA 5C3OA 3LFMA 4LKDA 5LA2A 2DUOA 2JWPA 4PBOA 2ZA9A 1I6XA 1JS9A 1H8TB 2Q1FA 5DQ0A 5FP8A 1LTEA 5FO7B 3KCCA 4Z82A 5FYUA 5F3IA 2VG9A 2ARAA 4NIIA 4BQ1A 2A73B 3FN9A 4XJ9A 3VBUA 3NJYA 1XPWA 3AZZA 3CMGA 2K2SA 1BEV2 3AKTA 4B1LA 4CUBA 2X5IC 5BNPC 1W6OB 4JGYA 1GQHA 1BEV1 1R093 1AZDA 1RUF3 3LSEA 3GBWA 3O0WA 4IEVA 2Y38A 3VDCA 4A2UA 1HB1A 2FMYA 1ZRCA 3LEKA 3CHXA 4DRRA 2B9VA 1BKZA 1U12A 4OI2A 3PTRB 4UFJA 2EIDA 1QWRA 3W21A 4LE3A 4XFAA 3ZYGA 5IATA 4FT8A 1V6KA 2LRPA 5FYZA 2HYKA 1KS4A 1NLRA 1JUIA 4JKMA 2XKOA 3SCHA 5HCHA 3GJBA 5LA9A 4KWKA 2A70A 4QU1A 3I8TA 4P5HA 1WA4A 2DV9A 3ZSMA 4IE0A 1ENSA 5FMOL 2ZKLA 1R091 1W8WA 3CIHA 3LDBA 4OHWA 2RG4A 2EA7A 2P6HA 3IDAA 2EAKA 4C0BA 4GWNA 5FYYA 3M3IA 1K5MC 2WFF2 4QQ2A 3ZKUA 5FZDA 4EWAA 4YRDA 1QQP1 2DCJA 3VD3A 4NAMA 1UU6A 3WUDA 1LR5A 1RUF1 1XU2A 3AMPA 1BYHA 2Y34A 1QQP2 1QHDA 1HRI2 4Q4W2 3ELNA 1VJ2A 2WWJA 3I49A 1O5UA 2C9KA 1ALYA 1UY4A 1ZYBA 4QXBA 2ARBA 2RDSA 3E5XA 5FYIA 2P3JA 4HN0A 1VMFA 3PIJA 1V0AA 1UZWA 4PIYA 5ANNA 3ZDSA 1EAH1 3I3QA 3ZIXA 4JX0A 5JXJA 3PVEA 2VNVA 2BTVC 1RYYA 3AM2A 4FQZA 1GBGA 4ASKA 5KXDA 2EICA 5JZGA 2H6CA 1N3QA 2XUMA 1CZTA 2YV8A 2XPJA 3QD6A 3WNKA 5BPXA 2ZABA 4MH0E 4SLIA 2E26A 4RA0A 4D0QA 5I8YA 1CD3G 4EJRA 2BGOA 5FZ7A 4ZZ5A 3K3OA 2J1AA 4NPLA 3K48A 5BNPA 2OIIA 4E4HA 2WIIB 5A7WB 3NMBA 1XNBA 2PHTA 2Z4FA 3BU7A 1G9AA 3ETQA 1VLNA 5EV7A 3FFQA 3NNJA 2FZ2A 1L3JA 4BM8A 3H8RA 2WYSA 1DQ6A 4UYBA 5KWRA 2DVFA 3LQCA 1GNZA 5FY9A 4NMIA 4AEDA 2W91A 4D7SA 4P08A 5DAXA 4KBZA 5FZIA 3WG3A 1MEC3 1ZZ8A 5IAXA 1RXGA 5FBZA 1RVF3 2G9ZA 1FPN3 4JKKA 4MYEA 5F3EA 5K0UC 3LKJA 5JSPA 1AXYA 4IQPA 4FXGB 4ARXA 1W8FA 4Q0VA 4UW6A 4OHVA 2P1BA 4A3XA 4GALA 3WX5A 2ZMKA 3RWNA 5J7MA 1PX4A 4IEYA 4PI2A 3B93A 4QM9A 3BUCA 2A7AA 1O3TA 4PF1A 5L19A 2UY8A 3WNLA 1O91A 2PHLA 1K5MB 5FCCA 4AFBA 5FZ9A 1JHJA 2BFUL 1STMA 1COV2 3B5LB 2VMEA 1JZ8A 2WNUA 4FTEA 1KXGA 2TUNA 4LK7A 1HX6A 4YG0A 1ULFA 4IV1A 4DEVA 1ND2B 1Q8PA 3BB6A 3ENRA 4COWA 2UY9A 3T2PA 2QUOA 1OF3A 1OFSA 4XF1A 2XQXA 5BNOA 5ACA2 1LGCA 1BVVA 4KI5M 4LULA 2JDKA 2GSYA 4QGNA 2B9UA 4D6RA 2ZMNA 5C9AB 1IS4A 3LOIA 5E8AA 2Z5WA 5LATA 4OUSA 4JZRA 1PVC2 1UNBA 2OPWA 2RS11 2YG0A 3GZAA 4AI8A 3DXTA 3TN91 5C5TA 3POFA 4M4RA 2XHKA 5F6KA 4CDUB 4RGGA 1DFQA 4CDUA 3ZSKA 2C24A 4YM3A 1V9U2 1E5HA 3KCYA 1CR7A 1O7FA 4UFKA 4ISRA 2EXJA 1MS3A 5B4XA 1ACCA 2RS31 3WNNA 2Q8CA 3RWKX 3NWKA 1DLLA 1CX4A 2XGXA 4GJYA 3H3UA 5FY0A 4Q4W3 3ZMOA 2RHPA 1GZTA 3GZUC 3NKTA 4M3CE 3ZSLA 4N53C 2JENA 4JC1A 4CPBA 1YFUA 2RR12 2VTFA 3MDPA 2WT0A 5JIUA 1ZZBA 5GLWA 1LHOA 4WVZA 1S0JA 4BQ4A 2ORZA 3R0RA 1GZCA 3AX4A 1RUG1 3ZFEC 3ZYRA 1DZRA 4OMCA 4L9BA 3VHOA 4D3WA 3O7OA 2Y6JA 3I2GA 3IMNA 1YQ2A 1VE0A 2VH9A 2BP6A 5FZ3A 2GP3A 3MEPA 1HW5A 1JZ2A 1EV12 3AJYA 3VKMA 1U5XA 1DQ5A 1EV11 4L0PA 1MVEA 2V4VA 4YPJA 2ZMLA 5EYYA 2XVKA 5LA1A 5C6CA 5FZMA 4GH4B 5IUQA 1PGW2 3WP5A 1GP6A 4BMEA 1JTZX 2HWE3 4ARYA 5GKAC 4Y4YA 4PCRA 3U07A 3S7EA 4FTSA 4R4XA 4BLIA 4GQ7A 5A1FA 5J09A 1QEXA 2W68A 3MLLA 3M8LA 1W6PB 2J7MA 2Y6LA 3CJIB 1FOD1 3PURA 4FOVA 4YZ5A 2Y33A 3POBA 3OY8B 4L97A 3WSOA 2XH6A 4YSFA 2BDRA 1B35B 3F95A 2J42A 4RR3C 5FK7A 3ZXGA 4AWDA 3I3MA 1CIYA 1SMVA 1NLQA 4U36A 4QX2A 3JBG1 1NLSA 1UQXA 1UW8A 2BZDA 3C8XA 1RUE3 5C8CC 3WDWA 5GJ6A 4O9GA 2XQRA 3APBA 2ORXA 4BIFA 1AXKA 3AXEA 4M00A 3T30A 3WNMA 2YBPA 4K40A 1IZ3A 3MLJA 3RYRA 3O1RA 2ZGPA 3INAA 4Z2WA 4BLJA 2AR6A 1OC1A 4PQQA 4RS5A 3T09A 4Q26A 3ZN4A 2VMDA 3O0VA 4CDUC 1YUDA 4ZKTB 5B4NA 4XILA 5C3SA 4BU2A 4QX5A 1AYM2 1OPMA 4RFRB 3U4XA 3N9QA 4AFAA 1H1IA 4HVOA 5F5IA 1OXCA 4XBNA 3LZZA 3AVRA 4QPGB 3OGJA 4AHXA 3PUSA 1QXJA 1UOFA 1VBA3 1OOPB 2BYVE 2E7TA 1NQDA 2WFPA 1NX9A 3LAGA 4GD4A 1LOEA 4G3YC 3ZYBA 5GLZA 1RUI1 1LJ7A 2AEZA 4GAZA 1YEWA 4QDRA 4RYDA 5F6LB 5H9QA 4XXPA 1BXHA 2ZEZA 4YFWA 3FLTA 2X10A 4PDWB 3O5SA 3WF2A 3VL9A 1PZ9A 4TTGA 3MZHA 1J3PA 2ILMA 2OPKA 2PMWB 3KGZA 4FOWA 1ZRFA 1PVC3 1W05A 2YROA 3TEWA 2FD8A 1H6YA 2ZOEB 2FZ1A 1DDLA 1JYXA 3SXWA 2V5YA 4W65A 4Q8LA 1JHNA 4CUAA 2TBVA 3I7DA 2GC3A 1F4AA 1XE0A 4I0BA 5K0UA 1H2MA 1Q5OA 3J8F3 1DF0A 1RUC2 2R16A 4M01A 3SKVA 4A6OA 2VTXJ 3EXUA 1DGWX 1D4M1 1NZIA 1T6GC 3EO6A 3SCGA 3LSDA 3QBQA 4JV4A 1WGPA 3RI9A 5EXOA 2PHWA 4XURA 2ZHLA 2PN5A 5JVVA 4OYUA 1C3HA 4FP3A 3MW4A 5I0UA 1UMIA 2Z79A 3ZKYA 3HT2A 4YZ1A 1VB4A 4BQ2A 2G1MA 2HWB2 2ZAAA 4HOOA 5JOZA 1PK6A 5KBFA 1BK0A 1XYNA 3MUY1 1X36A 3PL0A 2ZGMA 2BNNA 5DZEA 3VHRA 3S5AA 2R1DA 5FZ1A 2TNFA 5E1RA 2H0VA 1ZBE3 4XUPA 1EUUA 4AFCA 2VNRA 1NA1A 2VOXA 4COYA 3J8F1 3RZKA 5T50A 2HEVF 4DINB 2Q0AA 4QGLA 5C4WA 1MACA 2VPVA 1VBB3 3Q8BA 2P3YA 4ZU4A 5CFCC 3O1PA 3JB8A 3MBWA 2ET1A 3FHQA 1RUD2 5CG8A 2BQPA 4UF0A 5HCBA 4Q4V1 1W6MA 3ACFA 5A6XA 4AI1A 3NJVA 2EAAA 3OPZA 2A3WA 2ARCA 1TNRA 1RUNA 2QQKA 4FPGA 1AL21 3DCQA 1TZOA 2DUQA 3NO8A 5IYYA 2BBAA 3WDXA 1JYIA 5FXWA 2WUHA 1RMU1 1LU1A 4KWJA 1GZWB 1ODMA 3FHAA 4E8CA 1OPOA 2NLRA 2VUCA 3ZXJA 3AKSA 4LBNA 5DAVA 4XTPA 1PIV2 3TEXA 3KCXA 1O4YA 2CGOA 2UWCA 3GF6A 3M3OA 4MVTA 4E2SA 5FY5A 2JG9A 4B7EA 2P34A 2I07B 5D21A 3C7GA 1BJQA 4AL9A 3O1UA 4FSJA 3A0NA 4HLTA 2WNUB 3KSCA 4IE6A 4YGEA 5GZDA 3J7HA 4PHZA 2GC2A 4QPWA 3ZN6B 1W8NA 3H1YA 2FDGA 4KWLA 1H9PA 4TSVA 4NRPA 4E8DA 4CXYA 1CAWB 3WHUA 4AE2A 1LU2A 1YLLA 3PHMA 5FO8B 2DTYA 1DHKB 1PHMA 1DG6A 1JZ4A 4HMZA 1NCRA 4QXKA 1IG3A 1HQNA 2PHFA 3R4UA 5H9PA 4SBVA 4CU8A 5F5QA 2O0OA 4UOJA 5A6YA 1HDKA 4LHNA 3E1F1 1JUHA 2ET7A 4HVRA 3ILFA 2R063 4MHUA 4Y20B 3J7LA 2F4PA 5FYSA 4UI9L 1EPWA 4AG4A 5CADA 1M4WA 1AYM1 2D98A 2XKPA 3NQHA 1H8TA 2VY0A 2D6PA 1IKPA 5FZ8A 2VBDA 4MGIE 5FFOC 4RHV2 2D93A 1KD7A 1OUXA 2PFWA 5F2SA 1UF2C 2JG8B 2JDAA 4XFIA 1CQ9A 3WNPA 1CAVA 3ZN6A 4QQHA 4IEPA 1PNFA 1RUH1 1VAMA 5BNPB 1V6OA 2ZHMA 3KLSA 3RQ0A 1OUSA 1RUH2 3HQXA 4MXVA 4XHXA 1K3IA 1UYXA 3KQ4B 3LIGA 3MW3A 2YUEA 5SV5A 1JYWA 4RD7A 1GFF2 2Z69A 3IIIA 4QM8A 3SEPA 1DYOA 1NA1B 3UKNA 4E4DX 1POQA 3KWVA 1WLCA 3BCWA 2IXLA 4F83A 4BK5A 1KFUL 5JZGB 1DQ0A 4Q8KA 5FZLA 1DQ1A 4MOAA 5DDJ1 1PZ8A 2W1WA 5KHHA 1LOCA 4C0HA 4LQRA 1F5JA 1J84A 3OUJA 1C1LA 2KD7A 3P5BA 2OYZA 4A3ZA 2PTMA 1ODNA 2WNOA 4LUKA 4N43B 4XE9A 5T54A 2BWCA 4JGZB 1VBB2 4D7TA 4KQ7A 1WW7A 1DP0A 4M0HA 3WG4A 2FBEA 3SH3A 2CYFA 1VBB1 5JXIA 2E33A 4R9BA 3RYKA 4CDWB 4XZUG 2ZGLA 3BU0A 5JLVA 1OH4A 2QVSB 2WYFA 3VBHB 2HWC3 4F7ZA 3RSJA 2NYYA 3ZO0B 2TEPA 3ZLIA 1SLAA 1LEMA 2RM23 4PBPA 1Z0HA 4D6QA 3S30A 1BVP1 2V4AA 1UXZA 2ZX4A 1LHUA 3E6DA 2OS2A 3LGRA 2WZR3 2HWE1 3DKWA 1ULDA 5FZBA 1LB2A 3GNEA 1V6IA 3J26N 4IDZA 3IN9A 2D5FA 3VBSA 4AYUA 4CU9A 3HOBA 1UZ0A 1ZBA2 3VN4A 2BNOA 3ZFGC 1JW6A 4CRQA 4ES9A 3OGSA 1ZBA1 1AR91 3PTYA 3VDDC 3EQEA 3LD8A 5FUNA 4LBQB 3GHNA 5DDJ3 2O1QA 3V0BB 5A33A 5FPUA 4Q4X1 1RTVA 3R4DB 3E5UA 1ULEA 2PQSA 4YW2A 1I1EA 3JUUA 4Q4X2 1VBD1 2JD9A 4XZPA 3DV8A 3WD5A 3H8XA 4CU6A 3WG1A 2DFBA 5IAVA 2BGPA 1AL22 2VBPA 5C71A 3O1SA 3VB9A 3ES4A 3I3BA 1YFWA 1CPMA 3MIGA 3THTA 1X7NA 2D5HA 2VMGA 3GZEA 3KV5A 1ZBA3 4LBMA 4QX8A 1QJX1 2JIJA 1CESA 1TMF1 3T3YA 4RS5B 5HV4A 5FJKA 1QJX2 1QJFA 5I0RA 5JSOA 4XEZA 4CCCA 4W6YA 5JOYA 2XUEA 1GNHA 1D4VB 3M3EA 5CB7A 5K8SA 4R9CA 4CCEA 2UYAA 3MUZ1 2YBSA 3K3NA 4LHSA 2WNVA 5JZGC 4WV8A 5LASA 2D6LX 2CAUA 4NJ4A 1NQJA 5TSWA 5DABA 1BBT1 1W39A 3KGLA 4G4FA 4ITCA 1F2NA 5AVPA 4QKDA 1OVPA 3KT4A 4CXXA 2VVFA 1ULPA 3GDBA 4LJHA 1DGRA 2LTNA 4XF0A 3TRSB 1LODA 2GU9A 4RQPB 2IXHA 1KGYA 4GH4A 4AFMA 1OI6A 2VZQA 2AENA 2W92A 4U2AA 5FP9A 2F6BA 1DGWA 4L2NA 3RVHA 1RJ7A 3VHNA 4XCAA 2B8MA 2VQUA 2R042 2HEWF 4JHTA 4E27A 3BI3A 4LPLA 5LBBA 5JDBA 4KL1A 1CAUA 2HH9A 3VBHC 1S0BA 2QQOA 5CZKA 2ZZJA 3ZYIB 3POJA 2OA2A 3O0XA 1H1MA 2H0BA 4FFFA 4JDMA 5C5UA 4LOTA 4FPFA 4QB2A 1Y4WA 4Z8BA 4ET7A 1LAJA 4XFHA 4NWVA 5C9AC 3AC0A 2ZBJA 3VBRC 1GANA 1LOFA 3ROUA 1VBC3 2CNAA 2DCTA 1ULOA 4TN7A 4UW4A 5FP3A 3OEBA 4LHLA 4TYSA 1JZ6A 1YJLA 1WZXA 2ADDA 3RRDA 2GH8A 3VDDB 4AI2A 1S2EA 4LK6A 5FPZA 1BBT3 1QH7A 2VQTA 3SCFA 2ZGKA 4XJWA 2ARXA 2R32A 4A7KA 4CZSA 4G9SB 3AKQA 3UJQA 3J9SA 4BQ3A 3K4AA 1F15A 2CWMA 3M3QA 2WKKA 4QX0A 3ATGA 5A80A 2CWSA 3SNMA 1VMHA 4TLGA 4XFBA 3VBUC 4UBHA 4MO3M 2JD4A 4ZXEA 1VBA2 1RUI3 1FXZA 4EZ4A 5GZCA 1Y43B 3WG2A 3ZSJA 1J83A 1H0BA 2XDVA 4QGMA 4KWUA 5BNQA 5C4WB 1SBEA 5CFDA 1QJZA 3S5QA 4DXSA 4LBQD 3BGAA 2AYHA 3WHTA 1PX3A 1VBC1 4CCNA 3VHPA 3HAGA 4LIUA 1Z7S1 2AZ5A 2WQ4A 1W2TA 4DUXA 3O1OA 5T5PA 1ND2A 1WLTA 2WNVC 2XJPA 1JXNA 4FI9A 5LK5A 1N1YA 3AP9A 3EBRA 2W39A 3KV9A 3U14A 1SPPB 1G9FA 2WA3A 2VW2A 5D8AB 1ND3A 3CF6E 1OT5A 5T55A 1N47A 5F2WA 5ANQA 4J6GA 4LA3A 4CTEA 3AVSA 4WM8C 2BNMA 2C0ZA 2OQ7A 3E6CC 4P9WA 2DCYA 2XL7A 1S0EA 1Z7S3 2GNDA 2MPFA 2Q30A 3KZ4C 3ILNA 3DPRA 3VZNA 3ZXDA 2OX0A 3U4SA 2HWE2 3E6BA 5DPNA 3K2OA 1B35C 4HKOA 2FMDA 1US3A 5KHKA 4NUBA 3AMQA 3SISA 2VMFA 4YW6A 2ZGTA 3I2OA 4RQPA 3WP4A 3HMYA 4DB5A 3C3VA 4HKLA 5A1LA 3SLIA 4MV2A 3ZDVA 3ZFGA 2K0GA 2HBUA 2BOJA 4Y22A 4W6XA 1JMUB 1Y7BA 3AYDA 5IK7A 5F3CA 2VZTA 2EIEA 1RC6A 1HV1A 2ZKNA 3JQXA 2B39A 2UWBA 4XDOA 1NOVA 3BIEA 1NG0A 4WBBA 5AFEA 1N1SA 2JDMA 1QJU3 3WXPA 1AXZA 5FYVA 4XAAA 5DZFA 4XJZA 4X8PA 2PAEA 5GLVA 3S7IA 3IKWA 3KS7A 1NXMA 3CJXA 4KBBA 1QOTA 1OOPC 1BEV3 5FO9B 2P37A 3PJYA 2JB8A 1YNAA 2HWF1 3P1IA 2DVAA 4M3CA 2VZRA 5EFUA 1TME2 4KNCA 5J48A 1N1VA 3FL7A 4GMP0 2XBO3 4LBLA 4NN0A 2RDRA 4CPBD 1TME1 2VCBA 2VNGA 1CZSA 4PDWC 1QU0A 1NAEA 1RGSA 1FATA 3B69A 3OGGA 2VUAA 1FPN2 5FY8A 1W0NA 3ZXKA 4AAPA 2XJUA 1G9BA 1PMIA 2SLIA 4AXOA 1ZNPA 3DPRB 2VM9A 3MYXA 3OF1A 1HB4A 2AREA 2JDPA 4XUNA 1Q8SA 4K3UA 3WCSA 3WEZA 4KGGA 4JDNA 2C26A 2CGPA 4RL7A 2WS92 4BQWA 4QD2A 5FQ0A 3KF5A 4FFIA 4CEWC 2WS91 2YYOA 3ZXLA 1CX1A 5A3OA 5G05L 4B1MA 1ND3B 2WR9A 2Q8OA 5L7OC 1C8NA 3UYJA 3MGUA 5FY1A 3CQOA 1I3HA 1XYPA 2EXHA 4AEJA 3HJRA 1SFYA 1G9DA 1LCLA 3IWZA 1N3OA 1W6QB 4QX1A 3B9CA 5CEHA 2FDKA 4Q27A 4FP2A 3VKFC 1UY3A 2VL4A 5C33A 5T5JA 1FI2A 1AR63 3FUOA 3IMMA 1YQCA 1MS8A 3T0BA 1EPZA 4ATFA 3RZHA 4J1WA 1F5FA 4FFGA 1O59A 1JYCA 2JDUA 4P00B 1HQWA 1W04A 2WSVA 2GN7A 1KITA 4N43A 5A7QA 2WL1A 2NPIA 4K8FA 1QXRA 4LBKA 3HIFA 4NE9A 4MG2A 2H6BA 3NV3A 2WRAA 4Q0SA 1SZBA 1CWPA 3G6JB 3K75B 1K12A 2HWD2 2W46A 2VZOA 1OA2A 1W8ZA 2XJVA 4NPMA 5FZGA 5LBFA 3ZX7A 4NWWA 3AFKA 4YM0A 3MLKA 1JI6A 4OUEA 3O1VA 2WNEA 2QQIA 1J59A 1OH3A 5L73A 4NIDA 1PIV1 3PUHA 1WWYA 1XSQA 1DGLA 4XCBA 1RUG3 2PA7A 2X53S 2IFRA 2ZEXA 5A7SA 3ZSEA 3WR0A 4A45A 3RZGA 2XVLA 3AL5A 2ZXQA 3VUOA 3LA7A 1UCXA 2B4KA 3LEIA 5LBEA 2Y0IA 3ZYHA 1HN1A 5B2GB 4AFDA 2AH2A 5GM0A 3WP3A 4C8DA 2PHUA 4LEJA 4J25A 4WVWA 3AP5A 2XL9A 2XR4A 3B00A 5DUUA 3I3EA 3T1LA 3WNOA 3H8OA 1AX2A 4LITA 3RPQA 4LE4A 4H55A 1M06G 2HLEA 4MUVA 3VDAA 2YMZA 3DEMA 1D0HA 4XPVA 3RZZA 1E5SA 1QIQA 4Y26A 2OVUA 1NXD1 1W8UA 2RV9A 2Y60A 2WQ8A 1GOFA 3DXUA 3KQRA 4GWMA 4IGPA 5F32A 3W58A 4D8MA 1U5ZA 5JMOA 3OD0A 5HXVA 3RMYA 5FYHA 1QJU2 2YFUA 4Q4Y3 2JXAA 5FJHA 5KC6A 1ZZ7A 4H2AA 2VAUA 2X29A 4QU2A 3J4UH 5A6ZA 5FMCA 2KA3A 5FP4A 2IXCA 4QAWA 4BDVB 4Y1VA 5F3GA 3IZOA 4CP9B 5FLHA 4AHZA 1VR3A 4D69A 2YZ4A 4N7UA 1AYN1 4HXCA 3M1HA 3JD73 4AGGA 5H9SA 2ZGUA 2BWAA 5SV8A 4QDSA 4CU7A 3NV2A 1X9PA 1PNGA 1D7PM 4YLZA 3W5MA 4A4AA 1YO8A 4DIQA 5D2AA 3NJZA 3BKZA 3ZFFA 2WQZC 1AYM3 1BQPA 1ULCA 5DDJ2 3VL8A 4HPKB 1UOBA 4CCDA 4MLOA 1PO23 5C7GA 3V0BA 4NHMA 1JYTA 4PF5A 1ENRA 3KHBA 5L9VA 2PHXA 4GMP1 5IT6A 3PMEA 3P3NA 2WZ8A 2HWF2 2D43A 2XWJB 3HQUA 4P9LA 5EJ3A 3LWCA 2WBKA 4Q4Y1 1GNYA 5APAA 1AL23 1YCIA 5I91A 2LALA 4UBGA 5LRSA 3IPVB 4N53B 4X6RB 2VZSA 3AZXA 1O4ZA 5FUPA 4ASLA 2Q1MA 3RGBA 3FC0A 2RVAA 3RG0A 1C4RA 1VP6A 2RR13 4O65A 3VZKA 2VMHA 1QOOA 1XYOA 4IV3A 3RYPA 3ZFEB 5BNOB 4YVSA 4OCTA 5I0TA 5CKNA 1LKNA 2RMU2 1KDMA 1JYVA 5GLUA 2W52A 4FOQA 2DDUA 3ZIWA 3FHIB 1EV13 1AVBA 2ADEA 5FXVA 4Y1XA 2XBO1 1L7LA 4YM1A 2DVBA 4JGZC 5ERLA 5FZFA 4H7MA 1RHI1 4EN0A 3BTYA 3K51A 3PUAA 2W1QA 5BY5A 3PU3A 3THPA 2VCCA 1QDCA 1W2AX 3ILRA 2KR2A 3OBRA 4XACA 4CDWC 3OYWB 5JMCA 3TNPB 3VKOA 4PLMA 2LUWA 1OLRA 1ULGA 3DYOA 4RSUA 3USUB 4HANA 2BVBA 2RMU3 3DGTA 2MNGA 4NO4A 3QLQA 4OZOA 3KB5A 2QQVA 1G9CA 2RM21 4K8RB 2HBTA 3HEIA 1XNCA 2Y6KA 3SMHA 1JH5A 3KVAA 3LIHA 1UX7A 4NRQA 3WF3A 3DF0A 1VBE2 3OEAA 1B09A 4PIXA 1XJAA 3ZFGB 1R081 4BOWA 1ZA4A 4B8EA 3FZ3A 4MGTA 4CP2A 5JPNB 4GZ9A 4P9YA 4LMFA 5J37A 1KS5A 1OLME 1PMJX 1ZRIA 3ACIA 1BBT2 1KJLA 3FFZA 1V70A 5G04L 4N8MA 4YGBA 2CSGA 3MF9A 3UL2A 4EN7B 1O8SA 5F37A 5F1RA 1H4GA 1QMJA 2UU8A 2V09A 5CIRA 1A3KA 4P9JA 2VUJA 4HT1T 3I2DA 4IGOA 2QQUA 3BN6A 1MPXA 3BTXA 4FQ4A 1SLLA 1O8PA 2W3JA 3AYAA 4Q4X3 3WT3A 3AZWA 1XRUA 2OUJA 3JD72 4CCOA 2Y6FA 5EWSA 4LBOA 4PLNA 3WCRA 4HPKA 2J1UA 2R30A 3WDYA 4CEWA 4YYOA 5IK8A 1NE6A 5KC5A 2BBVA 1R1ZA 3AZVA 3UKTA 5IVFA 2VQ0A 3N7KA 3LEMA 3CO2A 1W3XA 2EIBA 1FV2A 4IETA 5LEKA 3SH4A 4RGKA 5BNNC 1IOAA 4YG3A 3H50A 4A42A 2ZS6B 1H8VA 5GZFA 3W9AA 1XXNA 1S0CA 3IT8A 4O9EA 2RS13 2JG9C 3CEWA 3JQWA 5T5LA 4I3GA 2JB4A 3K46A 4JGZA 5EJ1B 3TBDA 1O3RA 1W2NA 4ZZ8A 2IVJA 4OI1A 4Q4V2 5FWJA 1OOPA 5CISA 2ZZQA 3OY8A 4P9XA 3VD9A 3I2HA 4K1YA 2VQAA 4NAOA 3NVCA 4AVBA 5C8WA 5HI0A 2IXIA 4N90A 3PVNA 1PO11 4MSVA 4AGRA 1JOPA 2R061 3S0MA 2QCSB 4H7LA 3ACLA 1YYNA 4LTAA 3WUCA 4WM7B 2DWRA 4YG6A 1J3RA 4QQLA 3MIBA 3PU8A 2Y64A 4OHXA 3WF1A 2FDIA 2JE8A 1PGW1 1QNWA 2Q8EA 1UL9A 1MVQA 1UWWA 2W87A 4JQTA 5DXDA 1UO9A 2Y6GA 2A6WA 3BOWA 4JQRA 4ATEA 2GNBA 1OLMA 2D97A 3UGGA 1PGL2 1DU3D 3U78A 2JDNA 1WA6X 3ST7A 3VBOA 1F31A 4MGZE 1GQGA 1ENQA 4LO6B 1GKBA 5FRAA 4C90A 4CEYC 1SCRA 3ZYFA 3JBG2 2PQQA 3D5OA 4X8NA 3VKLA 1LRHA 3TN92 3POIA 1G8WA 4FPHA 4V1PA 3N3HA 5JI7A 4EWDA 1X33A 4LOSA 4OFGA 3PDQA 2JIGA 3NV4A 1J1TA 2R071 2W9XA 4JHZA 3SC7X 4LORA 2W5FA 1QGLA 3C7EA 3H7YA 1J58A 3JCIA 5IVVA 5EYXA 2VULA 3ALQA 1WW5A 4IUGA 1NE4A 3ON7A 4HFSA 1W0PA 2WC2A 4IV1B 5FXXA 4I09A 1C5IA 3VZJA 3VDBA 4R52A 3V0AB 4FPYA 3TN93 3MIEA 4P02B 5FYCA 4XJUA 4RHV1 1IPKA 2WS93 3SH5A 1OKOA 4YFZA 4MGYE 1Q43A 4I0WB 2LM3A 5BV6A 2GZWA 1OD3A 4BYYA 5JUVA 4IGQA 1L7RA 2QQPA 1R092 3ZXEA 2FDFA 1SLCA 4V2VA 4FPCA 1AL0G 4IE7A 4YW7A 4A44A 2RM22 2PAMA 1ZREA 5ABJC 3WINE 1ZBE1 2EALA 3KF3A 2WABA 1BCXA 1JN2P 1WCSA 4Q0QA 5FWEA 2ZEWA 1TG7A 3T4VA 1A34A 5FZOA 1R082 2WAOA 1RXFA 4EQVA 1GQPA 2RE9A 1O4TA 2D44A 4FTBA 2GNTA 4I2OA 1A8DA 1JBCA 1X50A 4QPGA 5FZEA 3HBZA 1Q3EA 4MXWB 2EXKA 2QKDA 1XNKA 3EB7A 5DG1A 1S2BA 1FPN1 1XNDA 3D4KA 1WKYA 1H1AA 2P17A 2FHRA 2XJSA 3X29B 1QQP3 1CZVA 1FT9A 3K4DA 3BODA 1LULA 3NJXA 3NNMA 1WUVA 1W28A 1HRI3 4Q4V3 5CG9A 3SKJE 4JKLA 3MPBA 3AP4A 3RNSA 5CNAA 2ZGQA 3ACGA 4MGQA 4A6SA 2HWB1 5FYBA 1DYKA 2N7GA 2Q4SA 1NZCA 2W2IA 1PMHX 2YPJA 4LO8A 3OSDA 5FZ6A 5FKBA 2AEYA 4PT6A 4S2FA 5FOJB 1CAXB 4YVWC 5FTTC 1LHNA 3H42B 2X5IB 2XWBB 3NW4A 3OYWA 4IERA 4P9GA 5EP9A 2X05A 4AI9A 3AFGA 4RR3A 5JIAA 1QH6A 4CEYA 3RZLA 2MEV2 5BXXA 4QQOA 5FZHA 1UPIA 3CLPA 1Z78A 2MEV1 3I2JA 4MGKE 5FZ0A 5HBAA 3B7MA 5GALA 2VJXA 2WWUA 2ATFA 1PVXA 2ZJCA 5DMYA 1JOBA 3Q8CA 2VCMA 3VD7A 4FPLA 5A3LA 4GB31 3AMNA 1NY72 2VW0A 4WZCA 4Y5TA 2RS51 2XLGA 4HSLA 4L8QA 4UAPA 5FMBA 2ZACA 3I2IA 3GCXA 4YW3A 4QB1A 3U10A 1REEA 4BZ4A 1C8M1 5I93A 3POSA 2YC0A 3ETPA 4XHBA 4Y3OA 5A6QA 1VBE1 4DEQA 3KMHA 4JGYC 4QHBA 1GICA 3NV1A 2GALA 2ZHNA 4IL7A 2XMLA 5ISLA 4DNYA 2IUWA 1F8VA 4A7YA 4CCJA 5A3WA 1UY2A 1JYNA 3R05A 4ZONA 3ZFEA 4OUMA 4PDWA 2A6XA 1CPNA 3LE0A 3BIWE 1KQRA 3IDCB 4I3PA 1NCQA 2B7YA 5EJZB 2HJIA 1TEIA 3URFA 1GYKA 4UFHA 3LCPA 3MW2A 4N53A 3ZM8A 4I30A 3GALA 4CCMA 3EJKA 3LEGA 2J1VA 1POV1 3ES1A 1OVSA 3VBRB 1W90A 2B42B 3BYWA 1O3QA 3UJOA 1FX5A 4UW3A 4ORFA 3AP7A 1PVC1 4GJZA 3HQRA 3MV11 5T52A 5CFDB 5LWBA 2VZPA 2V73A 2ZX3A 4BWOA 4HVQA 2V5DA 3OGRA 1WCUA 2HWD3 4XC9A 4XOGA 1QJY3 1EAH3 1AX1A 2OQ6A 3GBFA 4B3NA 4DY5A 1WCKA 4LO7A 3ZFFB 2AGSA 3B02A 3J8F2 2JJ6A 2QDRA 2QJVA 2QZ2A 4IE4A 3WDTA 3IM0A 4XQWA 2VVEA 4QKNA 1C57A 2C4XA 1AF9A 2DURA 2BW8A 1RITA 4E9KA 5A3PA 2NMNA 1FNYA 2CAVA 5L36A 3VD4A 1YI7A 1RUJ1 2ZCWA 4W50A 3H0OA 1AR73 1QJY1 4XUOA 4B29A 4GWJA 1SCSA 5BNOC 1QJY2 1FAYA 1G86A 1ASJ2 1QXPA 5A3UA 1ASJ1 2CL2A 4NHLA 3N9PA 1HKDA 3UGFA 1UOJA 2DVDA 2XJQA 2BRTA 3S57A 1RUE1 4L99A 1AJKA 1OF4A 1WLDA 1ZBE2 3WDUA 4CA9A 1FV3A 1RUE2 4UF0B 3GZTB 1EYBA 2BJSA 3UGHA 1MZEA 1SFNA 5JXGA 4LIVA 2P5BA 2I45A 4DFSA 5FPVA 4QX3A 4DXTA 1MZ6A 4KMQA 2E9QA 3SEEA 4FAGA 2WLQA 4NPRA 1LGNA 1UY0A 3O12A 3POYA 4A7ZA 4FO9A 2WO1A 4XJAA 2RJ2A 2E6VA 4RGAA 5L9RA 4WVVA 3MFCA 1UKRA 3NKGA 3Q8AA 1W6MB 4HK8A 4JRLA 1YI9A 1MEC2 4OLLA 4S2HA 1YQ8A 3O1TA 1VRH1 4OHYA 1LECA 3A22A 1SDDB 2E7QA 1DBNA 1TMF3 4Z92B 2PHRA 3E97A 1AYN3 1YIPA 5T3NA 2RMU1 1LENA 2WN2A 1DIWA 4XDPA 5FIXA 4C91A 1UIKA 4BB3A 5HPOA 4KGQA 1VB2A 3ORJA 4YVSC 1DZQA 4CE8A 2VGDA 2ZEYA 1HN0A 3L9JT 3POEA 4XUTA 2WAAA 1IS5A 4WM7A 5CBLA 5CFCB 3BPSA 3BOPA 3WW3A 1RMU3 1GP4A 3O14A 4FFHA 2CGNA 2YB7A 1WLWA 4R4ZA 4UT5A 1SLIA 1OA3A 4EWEA 5AC92 1ENXA 3VBRA 2QZ3A 4I01A 5LY1A 4LLOA 2W47A 1LOGA 2YGLA 2ZGNA 4S2GA 3OG2A 3WV6A 5AC91 1RUI2 2ES3A 2IVIB 1EUTA 1PM7A 4C1WA 1NCQC 3FWEA 3PMSA 4LXLA 3PVBB 4XDQA 2JECA 1VBD2 4B4PA 2CV6A 1ZZ6A 2PYTA 2DTWA 3JB4C 1ZX5A 2DBNA 1GWMA 3A4UA 2RS52 4PIZA 4LHKA 4H14A 1XC6A 3N9LA 2XHNA 4XF9A 4IESA 2XLAA 5FMDA 1AUYA 5BYNA 5K0UB 1W8TA 1K5MA 4DUWA 1SHWB 4ZHNA 2VCAA 3WF4A 3A23A 3KT7A 3GXUA 1MS5A 1GOGA 1K45A 1IS3A 1O6UA 2IXJA 2VC9A 5FLIA 5FZKA 4CDXA 3CNAA 4CDQC 5FMOS 4BJ0A 2NP0A 3TEYA 4EE2A 4QMAA 1ND3C 2I2SA 1W0OA 4AI3A 1JZ7A 2VBBA 3QH7A 2UYBA 1MQTA 5FUIA 5FQ0B 5L9BA 5AFBA 4IE5A 3G7DA 4UXAA 1RUJ3 3Q9OA 4GULA 1GWKA 1REFA 1YQ5A 2VXRA 4FPEA 4YZ4A 1D2QA 1MQTC 1RIRA 4ONUA 5A7OA 4FBFA 4HSJA 4OI0A 2WN3A 4M3CB 5KR7A 4CDQA 3M3CA 4CDXC 4CUGA 2JX9A 1IGOA 3JD71 1R1A1 2BEOA 1FYUA 2X5IA 4K6BA 4YVWA 1LOAA 5FY4A 3WW1A 4QXCA 2J1EA 3OCPA 4LKFA 3DL3A 1S0FA 4AQTA 4HONA 5IW0A 3MFAA 2A6YA 4DPNA 2PLV2 1GP5A 1GSLA 1CAVB 5KXEA 2PLV1 5J1XA 2D7FA 2O8QA 2VUDA 2VOKA 1BLZA 4EN9B 2C6SA 5LZ6A 3JBG3 4ES8A 2BPA2 3NNLA 2VMIA 1RUD1 1QOSA 4P9IA 2X8KA 3T2QA 4QPIA 4BPZA 2ERFA 5FPLA 2A6VA 4QT6A 2E7AA 3VZOA 1DYPA 2DU1A 4QPGC 5F39A 5F5CA 1TQ5A 4GB32 3TAYA 4LR4A 5GZEA 4AQ6A 1NCRB 1SLBA 3D3AA 4B7KA 3VKNA 5JOXA 3ZPYA 2VECA 3H1MA 3CKHA 3I59B 3WVJA 1ZRDA 1YFXA 4LBJA 3N4MA 1TMF2 3CZUA 3OD4A 4PI0A 4QQPA 5JAXA 1DQ2A 5JPMB 1OLQA 3B94A 4MADA 1EY2A 5T5OA 4YWAA 2BGCA 3SITA 4AVAA 1Q8QA 1VBA1 3Q8EA 3AMMA 4N43C 4D6SA 4AK3A 1RL3A 3UT0A 3TNQA 3QOPA 3AKPA 1PGL1 2QBXA 1DQ4A 1H9WA 1I5ZA 2K46A 1AR93 4BISA 3PUIA 1P8JA 1I5PA 1KRIA 3TWIA 1CAWA 2W95A 4IEZA 2O14A 1S4CA 3RS6A 4RN5A 1REDA 4Z2AA 2GMPA 2VNOA 1Q8VA 1OKQA 5ABJB 1WMEA 3BVCA 2A3YA 3M4FA 1UU5A 1MEC1 4JTNA 5BUVA 2OUHA 2ETEA 2AACA 3C7FA 3WW2A 4AHWA 1NYWA 3N9OA 4DRVA 1C1FA 3IDBB 3AZYA 4P5YA 2Y26A 4JTOA 3HNYM 1RB8G 4IEWA 2RS32 4UW5A 5CKMA 3VV1A 3CZJA 2WINB 1CJDA 3CU7A 4LO5B 3UNPA 4FCAA 1MS9A 4AHYA 1HXS2 3USSA 1JU4A 3N7LA 4OQ9A 1X8MA 4IEOA 5I0SA 1V6JA 3A21A 4QDQA 4LA2A 5EIYB 4UWDA 2VOTA 4AEKA 1XB9A 3OB8A 3RMXA 5CA6A 1H8TC 2D3SA 3RFRA 3KD4A 4BH9A 4INDA 1RUG2 1RUJ2 5D1IA 1W99A 4JRAA 1CAUB 5LK7B 3VBOC 4AR2A 4V2WA 3VDDA 3DYPA 3TOJA 4OHZA 4EROA 5I8TA 1WBLA 2QQNA 2R073 3OBAA 1Y9MA 2D6MA 1NCQB 3ZOIA 4IEXA 3S6PA 1VAKA 3LA2A 3RJRA 3PNAA 4Q4W1 1HJFA 2GP5A 4C1XA 5CYYA 3V65A 1HB3A 3BTZA 4XBLA 2W94A 1H2KA 2YDEA 3OBZA 3QCWA 3QH6A 1VBC2 2AUYA 3OJBA 1N1TA 1WBFA 1XBFA 1F35A 1RUC1 2R49A 3BPZA 1RUH3 4RFT0 4CDQB 1UAIA 4FAHA 5JOWA 1YXWA 3H3ZA 4Q4Y2 2WWSA 1D4M2 1XQNA 4L11A 4NR1A 2PHDA 3M2MA 5K9YA 4DQAA 1RUD3 5KHIA 1QDOA 1UY1A 3RZMA 2E63A 3T2TA 1OFNA 4EV0A 3HD8B 4BIOA 3H3LA 5HCFA 2NM1A 2VW1A 2Z2SB 1W03A 2QQWA 4COUA 1SLTA 1S0DA 1G7YA 5H9RA 1W9TA 1UXXX 1GUIA 1R1A2 5LB6A 5GZGA 1XOYA 1CONA 4B4RA 4XXAA 2WLPA 4XFGA 3CL1A 4GKXA 3F2ZA 5JR2A 3FLPA 3AP6A 4XAEA 1MZFA 3VZLA 1UMZA 4CUCA 2VZ3A 2YU1A 1XE8A 1BHGA 2GNMA 5CFCA 4UFIA 1IQDC 1GLHA 4LKSA 1SBFA 1AR92 5FLJA 1GZ9A 5IVBA 4JAAA 3L2YA 2ZX0A 5DAWA 4HK9A 5CFDC 1R1A3 1TE1B 1Q8OA 3KV6A 2EIGA 5IVEA 1POV0 1LHVA 2C1FA 2HEYF 4FPJA 1WCQA 2LS6A 2V72A 1L7QA 2WO3A 1Y3TA 1U5YA 3A0KA 3JZVA 1AX0A 4MX3A 1QF3A 4LBQA 3VD5A 4Q0PA 1C8M2 1WMFA 3ECQA 1V6NA 2LROA 2VTXA 3I2FA 2HWD1 5FK8A 4XF4A 2GH2A 3BALA 3AL6A 4TZDA 5IJRA 1MR5A 4YZ2A 2CDPA 1NCRC 2VU9A 1COV1 2KM2A 1VMJA 2AC1A 2ENRA 3I3DA 1Y9QA 1VRH3 3LF7A 4XFFA 3RDIA 3ZYJB 5IK4A 5LA0A 2RS33 5E6HA 3MO4A 1UYYA 4YARA 4XYXA 1H6XA 1TNFA 3GM8A 2WZR1 4WVMB 1IKQA 4BQXA 5FV3A 4AF9A 2Y0OA 2BOIA 4PLOA 1GWLA 4LT5A 2VZUA 4QPYA 3ZR6A 5HCAA 4R9DA 4XMAA 2NQYA 2XG3A 4AEDC 1LOFC 5D8AC 2JE7A 4AGVA 5I8SA 4Q1RA 3GYDA 5A7NA 2OZJA 1XNAA 4UFMA 4XJ8A 3MI8A 5J98B 1UYZA 1VALA 4WM8B 5FZ4A 4N7IA 4HG6B 4Y33A 2YC4A 3P6BA 1RVF2 2JDHA 2Q5TA 3CBNA 3DKQA 2QQMA 1OA4A 3C2UA 2BUKA 3ZR5A 1W06A 2DVGA 4XQDA 5CVRA 3NRUA 3HN1A 4Y4RA 5ABJA 1CVNA 4Y5Z0 3KV4A 1BZWA 5LW9A 2R041 1D0GA 1W8HA 1APNA 4Y5SA 1JODA 1F4HA 3ZXAC 4DZGA 3LOBA 1OBNA 1OD5A 1CN1A 3O1MA 4Q29A 4IV3C 4ZU7A 2A5ZA 1SG3A 4AZZA 1W9FA 3WQBA 2RJLA 4DY3A 2IXKA 2OXBA 3HNBM 4BCUA 2W08A 2JICA 3C7HA 2G9FA 1AR81 3C7OA 3WW4A 3ITQA 3ASIA 3T4HB 4Y22B 5C8CB 5ACA3 4ZXKA 2BVVA 1IG0A 3HBKA 1SEFA 4M4PA 3V64A 1D4M3 1UPSA 5DUXA 4QHZA 3ZVXA 1E57A 1JU3A 4I02A 3NAPB 5FZAA 3LPFA 3MIHA 4JVAA 5DUWA 5FDBA 1UOGA 5IHRA 1OURA 4OMDA 5J3UA 2EVXA 3VBOB 3W20A 1PO12 2XLFA 3ZFFC 4F8AA 1UMHA 1RMU2 2IWGB 3UETA 2R0FA 2PXJA 4MHRA 2XJRA 5C8CA 2OT7A 1LOBA 5IWFA 4EN6B 1F9KA 1UZVA 3D8CA 1VAVA 2DU0A 4JDOA 5CU1A 1J1LA 1GOHA 3UKVA 2YGMA 3E5QA 1W6NB 4COZA 4AVTA 1UU4A 2VOVA 5JSRA 4NIGA 1Z7S2 3HVDA 3Q8FA 5JR7B 2W1UA 4DOUA 1AR83 2UURA 1V6MA 2UWAA 4JCKA 2JEMA 1IHMA 2GMMA 2Z42A 3MIDA 4YGCA 5D8AA 5E16A 4OZXA 4GIQA 1URXA 2XJTA 4A41A 4NHYA 1XNTA 1PZ7A 1U5IA 2D40A 1UIJA 4KG8A 1W3VA 4KU8A 5FKCA 3U37A 1PM4A 1QJEA 2ZX1A 2DCKA 3QACA 4CEWB 4XABA 4HZFA 1AR72 4Y24A 3R6SA 5A3NA 5K7PA 3THCA 4LUMA 1FNZA 4FXKB 1AR71 2A6ZA 3MPPG 2E51A 3TYJA 3WDVA 1X8EA 5A32B 4NIHA 4P14A 1C8M3 4WZFA 2JDZA 3SHRA 2WJSA 4E4ZA 1S0IA 4GWIA 3RZJA 2FCUA 5J36A 4YW1A 1HXS1 2C9AA 5C3PA 1QY4A 5FAXA 2GN3A 1R64A 2RDNA 3M70A 3ABZA 4URAA 1H30A 1ZRRA 4RR3B 4KU7A 4XIKA 5JXHA 4CCKA 4IW3A 4AOCA 3WZ1A 2A75A 3LA3A 3WF0A 2DFCA 4XIOA 1QNYA 3IB3A 4K7JA 2W1SA 4ZS3A 4E4SA 3TB0A 2HWB3 4ZU5A 1SBDA 4O61A 5FY7A 3SQOA 1OSGA 5BNNA 3WLUA 1HB2A 4META 4YNIA 2DUPA 2LW8A 5A7WA 2PLV3 1QKQA 4YVSB 4AVVA 3B3QE 5C3QA 4CEYB 1CJPA 3OBTA 5JI9A 4W4ZA 2ZAHA 1UKGA 4WVMA 4BE3A 1C5HA 4NHKA 3ZPOA 3NAPC 4OULA 4AVCA 1S55A 2D3PA 2IFWA 3ZXFA 3W5NA 1T2XA 5DAQA 3USUA 1T6BX 1AHSA 1HRI1 3FX3A 3I2KA 4QX7A 1OMIA 1J3QA 2J22A 3WQ0A 1ZM1A 3M7AA 3HN3A 3AKRA 2GMEA 5FBJA 1YC61 4COVA 1KJRA 4MZUA 4MXWA 4GB33 2MHFA 5A70A 1X9TA 2P3IA 4YVWB 5C70A 4DS0A 1IPSA 2EXIA 3WQ7A 4AAXA 2NZ9A 5IFPA 1I9RA 3U1XA 3AYCA 2ID4A 2WO7A 3GHMA 4Y1UA 2HYXA 5IFTA 2X09A 4IV1C 1S1AA 1U0AA 3AXDA 5A33B 2A71A 2F4LA 2OKXA 3D6EA 4YGDA 3MV01 3R4SA 5DG2A 4AEDB 3GBGA 3HWJA 1WD3A 4BA6A 2ZGRA 5FPAA 5J96B 1HLCA 1RVF1 2WNVB 1KFXL 2B46X 2G4IA 5KHGA 3VGIA 3OTFA 3OUHA 1XU1A 1N3PA 2E53A 5KHJA 4YZ3A 3T2OA 1PO13 4BQ5A 3DN7A 3H9AA 1CAXA 2XBO2 1WCDJ 1HV0A 4N9HA 4LO4B 2YC2A 1ST8A 2GC0A 1NT0A 1UN1A 1ZZ9A 4FPOB 4AVSA 1FOD3 4M3CF 2D6KA 4DXZA 2RJKA 3LB9A 2J1SA 1RUC3 3N9MA 3NSTA 2CY6A 4CDWA 3MF6A 2YXSA 5A7PA 1AJOA 1R083 1W9WA 1AR82 1WMDA 2CDOA 3POWA 1UD1A 3PJQA 3MICA 2L9LA 3N7JA 4GKYA 4MGSA 4NRMA 4OI4A 2O8OA 1RINA 2PELA 4GMP3 4EYUA 2B45X 1FMD3 3MIFA 2PAKA 5FREA 1NKGA 4K21A 5DZGA 2A1XA 2Q1ZB 3WQ1A 1MS0A 2GC1A 1JOJA 4F3JA 4ZS2A 2XVGA 1V9U3 1W2UA 2R062 4QKBA 4Y1ZA 1WD4A 2ZTNA 1VIWB 2D3RA 4CP0A 4N9IA 4BXFA 2JDYA 2GDFA 4HETA 3H8UA 2SBAA 4QKFA 1Q56A 5F8PA 2OZ6A 3EHKA 2Y6HA 4FPKA 4XVHA 1FMD1 2YY1A 3JXSA 3VBUB 3TEZA 2WA4A 2A3XA 1FMD2 3PVOA 1HRV2 2P3KA 5IK5A 5C4WC 1XSRA 2VOWA 3VBFB 4DO0A 3FBYA 5LEJA 4LKEA 2YFZA
chains in the Genus database with same CATH topology
2MEV3 3I54A 1NA1C 3RI8A 2D6OX 1B35A 1C28A 1DZTA 2OW4A 4K9SA 1BK1A 3W59A 3DPRC 4HN1A 4Y20A 3V56A 1PK6C 3RJ2X 4CYDA 3IIAA 1H2NA 4WM8A 4R9AA 2WZPP 1DGRN 1UZZA 1W6OA 2JG9B 4JGYB 4KG0A 4BHPA 4FOYA 3U11A 2JE9A 4OVEA 4URTA 5EZWA 4QPIC 1W6QA 1IS6A 3AMHA 4NVPA 2HKXA 1COV3 3ZYPA 3VLBB 1S2KA 1D2SA 3N35A 1ND2C 1GZWA 1TME3 3P3PA 1IPJA 5E89A 3D0JA 3HT1A 2JG8A 3KT1A 2D6NA 2CTVA 3I59A 2QNKA 2HWF3 3BTAA 1YFYA 4D7YA 1AYN2 4S2DA 2WFF1 1YHFA 4YW4A 5E88A 3FBMA 4XBQA 3N7MA 1UZYA 1KDKA 2YHJA 3D82A 1LGBA 4K20A 4PQ9A 4TWTA 2GAUA 4I0AA 4IEUA 1HIXA 4PJYA 4XTMA 2QE3A 4E2GA 2JG8C 1OQEA 3AYEA 1H4HA 1EAH2 4Z07A 1FOD2 4X6QB 1PGSA 3ZN5A 3UK9A 2JKBA 1AR61 2P2KA 4AEMA 3WOGA 3VBSB 4DMIA 4RHV3 1AR62 3U0ZA 1LEDA 2NMOA 5C9AA 1A78A 5KXCA 4D94A 1QJX3 1VRH2 3D0SA 2ZX2A 4L92A 4RS5C 4NOTA 1GR3A 3IDEA 2R072 1PO22 5A3MA 3VBHA 1BMV1 1YRZA 5BNNB 4GXLA 1PO21 1V00A 2WT1A 3ME2A 1BMV2 2ZPXA 5FPXA 1LESA 3T1MA 1ASJ3 1PK6B 4AW7A 2IZWA 1RHI2 4XW3A 2XB6C 3PLQA 4GH4C 4Q2FA 1IQAA 1CGPA 5L7OB 4IXLA 3ZMNA 2EF6A 4B4QA 2C5DA 3AK0A 3WP6A 5KXBA 4ASMB 4EN8B 4GA9A 4AI0A 4QPIB 1HRV3 3DUIA 2R043 3CJIC 2K9ZA 4YW5A 5F9TA 1X82A 4WM7C 3FMGA 1NY71 3IBMA 1MQTB 4HL0A 4YM2A 5L7OA 2VVDA 2HWC1 4FVVA 1EP0A 1RUF2 1YWKA 2HWC2 2R6QA 4ISQA 3N36A 4KH9A 4IV3B 3UV9A 4CDXB 4LNVA 1UX6A 4Q1PA 3B01A 2WZR2 1O5LA 1GV9A 4XMIA 2G9GA 2ZHKA 3H7JA 1H2LA 1S0GA 2QFEA 4Z1VA 4BMBA 5GLTA 2W0XA 1ZZCA 2WT2A 3AB0A 1RUOA 1MS1A 4R8HA 3IPVA 4XF3A 3WNXA 1YJKA 1VBE3 2WFF3 1V6LA 2WSUA 2ZGSA 4LLFA 5AC93 2FQPA 2RS12 3VBFC 4Q0UA 4AQ2A 3VBSC 2KXLA 1OHFA 1HQLA 2DF7A 2R1BA 3HR9A 3VZMA 3JU9A 4J1XA 1V9U1 2DCZA 3NL1A 1VBD3 4HBNA 5CAZA 1PIV3 4XFCA 5DUVA 5LRRA 3CJIA 4K1ZA 1OQ1A 1A8MA 2RS53 4H3WA 1QJU1 4IEQA 5FOBB 3V0AA 3FE5A 1ONAA 3FUQA 1LHWA 5A32A 2RR11 1SACA 2NN8A 1G6NA 4RQPC 4AQSA 3FJSA 5AVAA 1MS4A 2IC1A 5JWPA 3H1WA 3I4IA 4HKWA 1POV3 3FLRA 1XE7A 1OQDA 5JCTA 3L2HA 3B9IA 4XETA 1A6CA 1W6PA 2WNUC 4W6WA 1MZ5A 1YIFA 4Y1YA 1WW6A 3AJZA 3NAPA 1W6NA 2BFUS 1WW4A 2QDNA 2R0HA 1HXS3 1SQ4A 2B5HA 4XQ4A 4M0NA 1O3SA 3KM5A 1CIWA 3VBFA 3WY6A 4E2QA 1RJ8A 1RHI3 2DYCA 5ACA1 4CP1A 2I74A 1ZVFA 1HRV1 2ZGOA 4TLFA 1SDWA 2DUOA 4PBOA 2ZA9A 1I6XA 1H8TB 5FO7B 1LTEA 3KCCA 4Z82A 2VG9A 4BQ1A 2A73B 4XJ9A 3VBUA 3AZZA 2K2SA 1BEV2 3AKTA 2X5IC 5BNPC 1W6OB 4JGYA 1GQHA 1BEV1 1R093 1AZDA 1RUF3 3LSEA 3GBWA 3O0WA 4IEVA 2Y38A 4A2UA 2FMYA 1ZRCA 4DRRA 1BKZA 1U12A 4OI2A 1QWRA 4LE3A 4XFAA 3ZYGA 4FT8A 1V6KA 2HYKA 1KS4A 1NLRA 1JUIA 3SCHA 2XKOA 4KWKA 2A70A 3I8TA 4P5HA 1WA4A 2DV9A 3ZSMA 1ENSA 5FMOL 2ZKLA 1R091 4OHWA 2EA7A 2EAKA 4C0BA 4GWNA 3M3IA 1K5MC 2WFF2 4QQ2A 4EWAA 4YRDA 1QQP1 2DCJA 1UU6A 3WUDA 1LR5A 1RUF1 1XU2A 3AMPA 1BYHA 1QQP2 1QHDA 1HRI2 4Q4W2 3ELNA 1VJ2A 1O5UA 1ALYA 1ZYBA 2ARBA 3E5XA 2P3JA 4HN0A 4PIYA 3ZDSA 1EAH1 3ZIXA 3PVEA 2BTVC 3AM2A 4FQZA 5KXDA 1GBGA 5JZGA 2H6CA 1N3QA 2XUMA 2YV8A 2XPJA 3QD6A 5BPXA 2ZABA 4MH0E 4SLIA 4RA0A 5I8YA 1CD3G 4EJRA 3K48A 5BNPA 2OIIA 2WIIB 1XNBA 2PHTA 3BU7A 1G9AA 3ETQA 1VLNA 5EV7A 3FFQA 2FZ2A 1L3JA 4BM8A 1DQ6A 5KWRA 2DVFA 1GNZA 4AEDA 4D7SA 3WG3A 1MEC3 1ZZ8A 5FBZA 1RVF3 1FPN3 4MYEA 5K0UC 3LKJA 5JSPA 1AXYA 4IQPA 4FXGB 4Q0VA 4UW6A 4OHVA 4A3XA 4GALA 3WX5A 2ZMKA 3RWNA 5J7MA 4IEYA 3B93A 4QM9A 2A7AA 1O3TA 5L19A 2UY8A 4AFBA 1O91A 2PHLA 1K5MB 5FCCA 4LT5A 2BFUL 3B5LB 1COV2 4FTEA 2WNUA 1KXGA 2TUNA 4YG0A 1HX6A 1ULFA 4IV1A 1ND2B 1Q8PA 3BB6A 3ENRA 4COWA 2UY9A 2QUOA 4XF1A 1OFSA 5BNOA 5ACA2 1LGCA 1BVVA 4LULA 2GSYA 4QGNA 2B9UA 2ZMNA 5C9AB 1IS4A 3LOIA 5E8AA 2Z5WA 4OUSA 1PVC2 2RS11 4AI8A 3GZAA 3TN91 2XHKA 5F6KA 4CDUB 4RGGA 1DFQA 4CDUA 3ZSKA 4YM3A 1V9U2 3KCYA 1CR7A 1O7FA 4ISRA 2EXJA 1MS3A 2RS31 3NWKA 1DLLA 1CX4A 2XGXA 3H3UA 4Q4W3 3ZMOA 2RHPA 3NKTA 3GZUC 4M3CE 3ZSLA 4N53C 2JENA 4JC1A 1YFUA 2RR12 3MDPA 2WT0A 5JIUA 1ZZBA 5GLWA 1LHOA 4WVZA 1S0JA 3R0RA 1GZCA 3AX4A 1RUG1 3ZFEC 3ZYRA 1DZRA 4L9BA 3VHOA 4D3WA 3O7OA 3IMNA 2VH9A 3MEPA 1HW5A 1EV12 3AJYA 3VKMA 1U5XA 1DQ5A 1EV11 1MVEA 2ZMLA 5EYYA 2XVKA 5C6CA 4GH4B 5IUQA 1PGW2 3WP5A 4BMEA 1JTZX 2HWE3 5GKAC 4Y4YA 4PCRA 3U07A 3S7EA 4FTSA 4R4XA 4BLIA 4GQ7A 5J09A 2W68A 3MLLA 3M8LA 1W6PB 3CJIB 1FOD1 4FOVA 4YZ5A 3OY8B 4L97A 2XH6A 4YSFA 1B35B 3ZXGA 4RR3C 4AWDA 1SMVA 4U36A 3JBG1 1NLSA 1UW8A 1RUE3 5C8CC 3WDWA 5GJ6A 4O9GA 3APBA 4BIFA 1AXKA 3AXEA 4M00A 4K40A 1IZ3A 3MLJA 3RYRA 2ZGPA 3INAA 4Z2WA 4BLJA 2AR6A 4RS5A 4CDUC 4Q26A 3ZN4A 4ZKTB 3O0VA 1YUDA 4XILA 4QX5A 1AYM2 1OPMA 3U4XA 4AFAA 1H1IA 4HVOA 4XBNA 3LZZA 4QPGB 3OGJA 4AHXA 3ZXKA 1QXJA 1VBA3 2BYVE 1OOPB 2E7TA 1NQDA 2WFPA 3LAGA 1LOEA 4G3YC 5GLZA 1RUI1 1LJ7A 5F6LB 5H9QA 4XXPA 1BXHA 4YFWA 3FLTA 4PDWB 3O5SA 3VL9A 1PZ9A 3MZHA 1J3PA 2ILMA 2OPKA 4FOWA 3KGZA 1ZRFA 1PVC3 2YROA 2ZOEB 2FZ1A 1DDLA 3SXWA 2V5YA 4W65A 4Q8LA 1JHNA 2TBVA 3I7DA 2GC3A 4I0BA 5K0UA 1H2MA 1Q5OA 3J8F3 1DF0A 1RUC2 2R16A 4M01A 3EXUA 1DGWX 1D4M1 1T6GC 3EO6A 3SCGA 3LSDA 3QBQA 4JV4A 1WGPA 3RI9A 5EXOA 2PHWA 2ZHLA 2PN5A 5JVVA 1C3HA 4FP3A 3MW4A 5I0UA 2Z79A 3HT2A 4YZ1A 1VB4A 2HWB2 2ZAAA 5JOZA 1PK6A 5KBFA 1XYNA 1X36A 2ZGMA 2BNNA 5DZEA 3VHRA 2R1DA 2TNFA 5E1RA 2H0VA 1ZBE3 4AFCA 2VNRA 1NA1A 2VOXA 4COYA 3J8F1 5T50A 2HEVF 4DINB 2Q0AA 4QGLA 5C4WA 1MACA 2VPVA 1VBB3 4ZU4A 5CFCC 3JB8A 2ET1A 1RUD2 5CG8A 2BQPA 5HCBA 4Q4V1 1W6MA 4AI1A 2EAAA 3OPZA 2A3WA 1TNRA 1RUNA 4FPGA 1AL21 2DUQA 3NO8A 3WDXA 1JYIA 1RMU1 1LU1A 4KWJA 1GZWB 1OPOA 2NLRA 3ZXJA 3AKSA 4LBNA 4XTPA 1PIV2 3KCXA 1O4YA 2CGOA 2UWCA 3GF6A 3M3OA 4MVTA 4E2SA 2JG9A 4B7EA 2P34A 2I07B 1BJQA 4FSJA 3A0NA 4HLTA 2WNUB 3KSCA 4YGEA 5GZDA 3ZN6B 2GC2A 3H1YA 4KWLA 1H9PA 4TSVA 1CAWB 3WHUA 4AE2A 1LU2A 1YLLA 3PHMA 5FO8B 2DTYA 1DHKB 1PHMA 1DG6A 4HMZA 1NCRA 4QXKA 1HQNA 2PHFA 3R4UA 5H9PA 4SBVA 5F5QA 2O0OA 1HDKA 4LHNA 1JUHA 2ET7A 4HVRA 3ILFA 2R063 4Y20B 2F4PA 1EPWA 4AG4A 5CADA 1M4WA 1AYM1 2D98A 2XKPA 1H8TA 2VY0A 2D6PA 1IKPA 5FFOC 4MGIE 4RHV2 2D93A 1KD7A 2PFWA 1UF2C 2JG8B 4XFIA 1CQ9A 3ZN6A 1CAVA 4QQHA 4IEPA 1PNFA 1RUH1 1VAMA 5BNPB 1V6OA 2ZHMA 3KLSA 3RQ0A 3HQXA 1RUH2 4MXVA 4XHXA 3MW3A 2YUEA 5SV5A 4RD7A 1GFF2 2Z69A 4QM8A 1NA1B 3UKNA 4E4DX 1WLCA 3BCWA 2IXLA 4F83A 5JZGB 1KFUL 1DQ0A 4Q8KA 1DQ1A 4C0HA 5DDJ1 1PZ8A 5KHHA 1LOCA 1F5JA 1C1LA 2OYZA 2PTMA 4LUKA 4N43B 4XE9A 5T54A 2BWCA 4JGZB 1VBB2 4D7TA 4KQ7A 1WW7A 3WG4A 4M0HA 2FBEA 3SH3A 2CYFA 1VBB1 3RYKA 4R9BA 4CDWB 2ZGLA 5JLVA 2QVSB 3VBHB 2HWC3 4F7ZA 3RSJA 2NYYA 3ZO0B 2TEPA 1SLAA 1LEMA 2RM23 4PBPA 1Z0HA 3S30A 1BVP1 2ZX4A 1LHUA 3E6DA 3LGRA 2WZR3 2HWE1 3DKWA 1ULDA 1LB2A 3GNEA 1V6IA 3J26N 4AYUA 3IN9A 2D5FA 3VBSA 1ZBA2 3VN4A 4ES9A 2BNOA 3ZFGC 1JW6A 4CRQA 1ZBA1 1AR91 3PTYA 3VDDC 3EQEA 4LBQB 3GHNA 5DDJ3 2O1QA 3V0BB 5A33A 4Q4X1 1RTVA 3R4DB 3E5UA 1ULEA 4YW2A 1I1EA 3JUUA 4Q4X2 1VBD1 4XZPA 3DV8A 3WG1A 2DFBA 1AL22 3ES4A 1YFWA 1CPMA 3MIGA 3THTA 1X7NA 2D5HA 2VMGA 1ZBA3 4LBMA 1QJX1 1CESA 1TMF1 4RS5B 1QJX2 5I0RA 5JSOA 4XEZA 4W6YA 5JOYA 1GNHA 1D4VB 3M3EA 5CB7A 5K8SA 4R9CA 2UYAA 5JZGC 2WNVA 4WV8A 2D6LX 2CAUA 1NQJA 5TSWA 1BBT1 1W39A 3KGLA 4G4FA 4ITCA 1F2NA 5AVPA 3KT4A 2VVFA 1DGRA 2LTNA 4XF0A 3TRSB 1LODA 2GU9A 4RQPB 2IXHA 4GH4A 4AFMA 1OI6A 2AENA 4U2AA 2F6BA 1DGWA 4L2NA 1RJ7A 3VHNA 2B8MA 4E27A 2R042 2HEWF 5JDBA 4KL1A 1CAUA 3VBHC 1S0BA 2ZZJA 3ZYIB 2OA2A 3O0XA 1H1MA 2H0BA 4JDMA 4FPFA 4Z8BA 4XFHA 4NWVA 5C9AC 2ZBJA 3VBRC 1GANA 1LOFA 3ROUA 1VBC3 2CNAA 2DCTA 4UW4A 4LHLA 4TYSA 1YJLA 3RRDA 2GH8A 3VDDB 4AI2A 5FPZA 1BBT3 1QH7A 3SCFA 2ZGKA 4XJWA 2ARXA 2R32A 4A7KA 4CZSA 4G9SB 3AKQA 3UJQA 3J9SA 2CWMA 3M3QA 2WKKA 3ATGA 2CWSA 3SNMA 4XFBA 3VBUC 4UBHA 2JD4A 1VBA2 1RUI3 1FXZA 5GZCA 1Y43B 3WG2A 3ZSJA 1H0BA 4QGMA 5BNQA 5C4WB 1SBEA 5CFDA 1QJZA 4LBQD 2AYHA 3WHTA 1VBC1 3VHPA 3HAGA 1Z7S1 2AZ5A 2WQ4A 5T5PA 1ND2A 1WLTA 2WNVC 2XJPA 1JXNA 5LK5A 1N1YA 3AP9A 3EBRA 2W39A 1G9FA 2WA3A 2VW2A 5D8AB 1ND3A 3CF6E 5T55A 1N47A 4J6GA 4LA3A 4CTEA 4WM8C 2BNMA 2C0ZA 3E6CC 4P9WA 2DCYA 2XL7A 1S0EA 1Z7S3 2GNDA 2MPFA 2Q30A 3KZ4C 3ILNA 3DPRA 3VZNA 3ZXDA 2HWE2 3E6BA 1B35C 4HKOA 2FMDA 5KHKA 3AMQA 3SISA 2ZGTA 4RQPA 3WP4A 3HMYA 4DB5A 3C3VA 4HKLA 3SLIA 4MV2A 3ZFGA 2K0GA 4Y22A 4W6XA 1Y7BA 3AYDA 5IK7A 3JQXA 1RC6A 1HV1A 2ZKNA 2B39A 2UWBA 1NOVA 1NG0A 4WBBA 5AFEA 1N1SA 1QJU3 3WXPA 1AXZA 5DZFA 4XJZA 4X8PA 2PAEA 5GLVA 3S7IA 3IKWA 3KS7A 1NXMA 3CJXA 4KBBA 1QOTA 1OOPC 1BEV3 5FO9B 2P37A 3PJYA 1YNAA 2HWF1 2DVAA 4M3CA 5EFUA 1TME2 4KNCA 5J48A 1N1VA 4GMP0 2XBO3 4LBLA 4NN0A 1TME1 2VNGA 4PDWC 1QU0A 3B69A 1RGSA 1FATA 3OGGA 3RNSA 2VUAA 1FPN2 1G9BA 2XJUA 1PMIA 2SLIA 4AXOA 1ZNPA 3DPRB 3MYXA 3OF1A 2AREA 1Q8SA 4K3UA 3WCSA 4KGGA 4JDNA 2CGPA 4RL7A 2WS92 4QD2A 5FQ0A 4CEWC 2WS91 2YYOA 3ZXLA 1ND3B 2Q8OA 5L7OC 1C8NA 3MGUA 1I3HA 1XYPA 2EXHA 4AEJA 1SFYA 1G9DA 1LCLA 3IWZA 1N3OA 1W6QB 3B9CA 4Q27A 4FP2A 3VKFC 5C33A 5T5JA 1FI2A 1AR63 3FUOA 1MS8A 4ATFA 1EPZA 4J1WA 1F5FA 1JYCA 1HQWA 2WSVA 1KITA 2GN7A 4N43A 2WL1A 2NPIA 4K8FA 1QXRA 4LBKA 3HIFA 2H6BA 3NV3A 4Q0SA 3G6JB 2HWD2 2XJVA 1OA2A 3ZX7A 4NWWA 3AFKA 4YM0A 3MLKA 2WNEA 1J59A 5L73A 1PIV1 1DGLA 1RUG3 2PA7A 2X53S 2IFRA 3ZSEA 3WR0A 2XVLA 3VUOA 3LA7A 1UCXA 2Y0IA 5B2GB 4AFDA 2AH2A 5GM0A 3WP3A 2PHUA 4LEJA 4WVWA 3AP5A 2XL9A 3B00A 5DUUA 3T1LA 1AX2A 3RPQA 4LE4A 4H55A 1M06G 4MUVA 2YMZA 1D0HA 4XPVA 3RZZA 4Y26A 2OVUA 1NXD1 3KQRA 4GWMA 4KGQA 3W58A 1U5ZA 3OD0A 5HXVA 3RMYA 1QJU2 4Q4Y3 2JXAA 5KC6A 1ZZ7A 2X29A 4QU2A 3J4UH 2KA3A 2IXCA 4Y1VA 5FLHA 4AHZA 1VR3A 4D69A 2YZ4A 4N7UA 1AYN1 3M1HA 3JD73 4AGGA 5H9SA 2ZGUA 2BWAA 5SV8A 3NV2A 1PNGA 4YLZA 1YO8A 3NJZA 3ZFFA 2WQZC 1AYM3 1BQPA 1ULCA 5DDJ2 3VL8A 4HPKB 4MLOA 1PO23 3V0BA 4NHMA 4PF5A 1ENRA 2PHXA 4GMP1 5IT6A 3PMEA 3P3NA 2XWJB 2HWF2 2D43A 4P9LA 5EJ3A 3LWCA 4Q4Y1 1AL23 1YCIA 5I91A 2LALA 4UBGA 5LRSA 3IPVB 4N53B 4X6RB 3AZXA 1O4ZA 4ASLA 2Q1MA 3FC0A 3RG0A 1C4RA 1VP6A 2RR13 3VZKA 2VMHA 1QOOA 1XYOA 4IV3A 3RYPA 3ZFEB 5BNOB 4YVSA 5I0TA 1LKNA 2RMU2 1KDMA 5GLUA 2W52A 4FOQA 3ZIWA 3FHIB 1EV13 1AVBA 4Y1XA 2XBO1 4YM1A 2DVBA 4JGZC 4H7MA 1RHI1 4EN0A 3K51A 5BY5A 3THPA 1QDCA 3ILRA 4CDWC 3OBRA 3OYWB 5JMCA 3TNPB 3VKOA 4PLMA 2LUWA 1OLRA 1ULGA 3USUB 4RSUA 4HANA 2BVBA 2RMU3 3DGTA 2MNGA 4NO4A 3QLQA 3KB5A 1G9CA 2RM21 1XNCA 3SMHA 1JH5A 3DF0A 1VBE2 1B09A 4PIXA 3ZFGB 1R081 4BOWA 1ZA4A 4B8EA 3FZ3A 4CP2A 5JPNB 4P9YA 5J37A 1KS5A 1BBT2 1KJLA 3FFZA 1V70A 4YGBA 3MF9A 3UL2A 4EN7B 5F1RA 1H4GA 1QMJA 2UU8A 2V09A 5CIRA 1A3KA 4P9JA 2VUJA 4HT1T 3I2DA 4FQ4A 1SLLA 4Q4X3