5FDBA

Iron free rat cysteine dioxygenase r60qc164r variant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
b'TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTQNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTRHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Iron free rat cysteine dioxygenase R60QC164R variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fdbA00
1CX4A 4CYDA 4LUMA 3FWEA 1UIKA 4IEXA 3C3VA 1XE7A 3CEWA 3MDPA 3H9AA 3WW3A 1RC6A 4META 1OFNA 2HKXA 5JSPA 1EPZA 3KMHA 4A2UA 2OZJA 3E5UA 3KGLA 5I0RA 1NE6A 3UKTA 5BUVA 4HLTA 3IIAA 3H3ZA 3HT1A 4HN1A 3EO6A 4DINB 4LULA 2PHDA 3CF6E 2XL7A 1UCXA 4D7TA 4EWEA 2Q4SA 5CVRA 2CGPA 1X7NA 1CAVB 4JVAA 1ZZ7A 4MX3A 4FAGA 5C6CA 2CAUA 4QGNA 2UY8A 1UIJA 3ES4A 4P9GA 4MGZE 4UBGA 2Q1ZB 1TQ5A 1ZX5A 4JTOA 1ZVFA 5J48A 4IEPA 1DGWA 4IEUA 3B02A 3MZHA 4XF9A 4GULA 4E2GA 3FJSA 5EZWA 4Q0QA 2PFWA 3BCWA 2GC3A 3H1YA 3ROUA 4HVRA 2C0ZA 3CJXA 3EJKA 3PVBB 3D0SA 2XGXA 4Q0VA 2EVXA 1FI2A 2MPFA 2XL9A 4I0BA 2QDRA 1CAXA 2VPVA 4RD7A 2QJVA 1CAUA 3E5QA 3KGZA 4QM8A 1WLTA 3LA2A 3NSTA 2EA7A 3E6DA 5JAXA 3LOIA 3OD0A 3S7EA 1UW8A 2P17A 1RTVA 4YSFA 1I5ZA 5I8YA 1O3QA 4IEYA 1VJ2A 1UPIA 4XFBA 3OF1A 5J3UA 2XKOA 3MYXA 4XFFA 4B29A 1PM7A 3TNPB 1OI6A 1NZCA 3I59B 5KHIA 4KU7A 4MGIE 1LRHA 4X6QB 3IWZA 4IESA 5F1RA 4QXKA 3CO2A 4EWAA 4AQ6A 4N9IA 5CU1A 2EAAA 1SFNA 1RUNA 4Q0SA 3DL3A 4EV0A 1Q43A 3UKNA 4LA3A 2OPKA 4TLFA 4KWJA 4MGYE 2IXCA 4ORFA 4QGMA 5JSOA 5LRRA 4I02A 3NKTA 3S0MA 2B9UA 4YYOA 4XF0A 3NW4A 5LEJA 5E1RA 3LWCA 1Y3TA 2FMYA 1YFXA 2IC1A 4XF1A 2K0GA 1YWKA 4D7SA 3H50A 1J1LA 2XHKA 2QCSB 3H7YA 5E16A 2GZWA 4MUVA 4QM9A 3L2HA 4FAHA 2BEOA 1O4TA 4UXAA 2Q0AA 4QGLA 1ZZ8A 2ZKLA 3M70A 2H0VA 1ZZ9A 2GH2A 1OD5A 3SHRA 5FPZA 5T3NA 1X8MA 4L11A 4J1WA 1CAVA 2FQPA 3KSCA 3QOPA 4IEVA 4WBBA 5LRSA 3ETQA 2PAMA 3DN7A 4Q0UA 2IXIA 1YFUA 2UYBA 4E2SA 3IBMA 4AXOA 3DKWA 2XLAA 3E6BA 2IXHA 5I8SA 4BH9A 2GC1A 2BGCA 3FZ3A 1GQGA 1J58A 3RDIA 4Z07A 1H1IA 4I0AA 3HT2A 1ZRCA 3UKVA 1EP0A 3OCPA 5C8WA 3SCFA 5KHKA 4YNIA 3TNQA 2BNOA 5FLIA 4Z82A 4LA2A 3SCGA 3VHRA 4HSLA 5FDBA 4QX5A 1G6NA 5KHGA 2UYAA 4JV4A 4MZUA 3NVCA 4HZFA 4XETA 4I01A 1LB2A 1HW5A 4AVBA 2GU9A 1DGRA 5BXXA 1YFWA 2VECA 3ELNA 3I59A 4HBNA 4X6RB 5CADA 3LZZA 4O9GA 5FQ0B 2Y0OA 3EBRA 3HQXA 3D82A 1YFYA 3EHKA 4ZU5A 4XFCA 4F7ZA 1O3SA 2H6BA 4LTAA 4XFHA 3RZZA 1RGSA 3OTFA 4ZU7A 4HN0A 4KWLA 4I09A 3RPQA 4AVAA 4XFAA 1V70A 3D0JA 1DZTA 1CAWA 3O14A 4H7LA 2OZ6A 1QWRA 1DZRA 4I3PA 1H1MA 5I8TA 4KU8A 4PIYA 5I91A 4JTNA 4MGKE 5I0UA 2K9ZA 1XE8A 2UY9A 4IEZA 3IDCB 1FXZA 5FLHA 2ET1A 3ST7A 1IPKA 1CAWB 1O7FA 3FE5A 2V09A 1ZNPA 2ATFA 5HI0A 1U12A 3PNAA 5KHJA 4KL1A 4MH0E 1VR3A 2IXKA 3BPZA 3G7DA 3DV8A 3ES1A 5J7MA 2GC2A 2Z69A 3RYKA 2MNGA 1SQ4A 2WFPA 2GAUA 4BHPA 3USSA 1IPJA 4HVQA 3R6SA 2OYZA 1ZZCA 3FFQA 4LEJA 1Q5OA 3RNSA 1WGPA 1PMIA 1RUOA 4ONUA 1X82A 2GC0A 4XF4A 4I2OA 5I0SA 3H8UA 2PAKA 4FBFA 1ZRRA 3KCCA 3LA7A 3PLQA 4IEWA 1ZREA 4UBHA 3WW4A 3I54A 3NJZA 2PHLA 2XKPA 3H7JA 4J1XA 1YUDA 1OMIA 3M3IA 2BYVE 3BALA 4F8AA 1YHFA 3BU7A 4XFGA 4BYYA 1RL3A 3HIFA 4AQ2A 3RYPA 3I7DA 2D5FA 5BY5A 2B8MA 3CL1A 4PIZA 4WVZA 3WW1A 5AVPA 4Q29A 2F4PA 1J3RA 1SEFA 1ZRFA 1LR5A 5BPXA 1NXMA 5BV6A 2HJIA 1J3PA 4HMZA 2IXJA 4K8FA 2ET7A 5FLJA 3SXWA 1WA4A 4R8HA 4NVPA 2E9QA 2PTMA 3SCHA 3ACLA 1I6XA 2QVSB 3FX3A 3CLPA 4Q0PA 3H1MA 4R52A 3IDBB 4LUKA 2D40A 5LEKA 5JSRA 4LLOA 3NL1A 2IXLA 2XLGA 5FCCA 3S7IA 5KBFA 5FQ0A 1ZZ6A 3RYRA 1UD1A 4IEOA 1QXRA 2PQQA 4OLLA 4XFIA 4PIXA 3H3UA 2PAEA 2CAVA 2ETEA 1EYBA 1CGPA 4PJYA 2O8QA 2N7GA 3E5XA 3SMHA 1VP6A 3U10A 1EY2A 5EFUA 1XRUA 5I0TA 3MPBA 1O3RA 4YARA 1NYWA 1O5LA 4QMAA 3EQEA 4KWKA 2B5HA 2Z2SB 3GBFA 2CV6A 1O3TA 3OGJA 1NE4A 5D1IA 5FPXA 1O5UA 5JCTA 4OFGA 4EROA 4IETA 1LKNA 3WW2A 2ZCWA 4MV2A 2PYTA 3LA3A 1CAXB 4WZCA 2MHFA 4BIFA 2Q30A 2D93A 3ZDSA 2DCTA 4AVCA 1CAUB 3U11A 2KXLA 3JZVA 2O1QA 1Q3EA 1QXJA 1J3QA 4HVOA 2WC2A 3H1WA 4FT8A 2OA2A 3QACA 4XF3A 3E97A 1QY4A 1FT9A 1JUHA 4XEZA 4IERA 4O9EA 2XLFA 2QNKA 1X8EA 1ZZBA 2I45A 2BNMA 4EWDA 4IEQA 3U0ZA 2VQAA 3N4MA 4L2NA 4E2QA 3E6CC 1YLLA 3BB6A 3FHIB 1L3JA 2PA7A 1GQHA 2H6CA 3GYDA 2D5HA 5JR7B 2BNNA 4N9HA 5I93A 4ZU4A 5K8SA 3LAGA 1J59A 4YRDA 4HSJA 5KHHA 1ZRDA 1Y9QA
chains in the Genus database with same CATH superfamily
5A6ZA 3WDYA 1CX4A 4KQ7A 3AYDA 3O1TA 4XUPA 3ENRA 1DHKB 1OPMA 3GCXA 4OMCA 1BJQA 1QGLA 1K42A 4UFHA 2WSUA 4HONA 4V1PA 2JDUA 2VOVA 4CCNA 2R061 1N47A 4R4XA 3PUAA 3ZN4A 1IS5A 3CEWA 3MDPA 5CNAA 4O65A 1RUD3 4Q4W1 3WW3A 2VG9A 2YHJA 3GHMA 3JQXA 1RC6A 5JPNB 1MZFA 4META 2GP3A 1OFNA 3RJ2X 4Z2WA 4ZPIA 2D6OX 5ABJB 2WQ4A 1IGOA 4JX0A 1ND2A 1QKQA 4A2UA 1HXS1 1UY2A 5JPMB 1CJDA 4KH9A 1JOPA 1YI9A 2ZGMA 5FO9B 5I0RA 3UKTA 4IV1C 3LD8A 3ZLIA 2FD8A 4NIGA 4LO4B 3ZO0B 3Q8CA 1TME3 5JZGC 4INDA 4JRLA 1RUJ3 1OSGA 2ZGSA 4GAZA 4RHV1 3EXUA 3LQCA 4A45A 5F5AA 3LB9A 4QQLA 2FMDA 2W95A 5KXEA 2XL7A 1G8WA 1GANA 5FYYA 1VBE2 2W1QA 4EWEA 3CHXA 4GXLA 3VL8A 4YW2A 2RDNA 2GN7A 2NP0A 1X7NA 1CAVB 4MX3A 1ZZ7A 4COWA 4GIQA 5CA6A 2R042 4BQ4A 2RJLA 1B35C 3BODA 5CISA 5K0UC 1OA2A 2QZ3A 2ZGOA 1PO21 3KT4A 1AJKA 2NYYA 4GA9A 4MGZE 4UBGA 3PURA 2DDUA 2Q1ZB 4EN6B 2NN8A 1W6PA 1FMD1 5KC5A 1W6MA 5L9VA 4WM8C 4XDOA 2DCJA 1ZVFA 1AL22 3TAYA 4IEUA 1JUIA 1GWKA 4PHZA 4ATEA 4GULA 3K3NA 4MLOA 1LESA 4GH4A 1QHDA 3FJSA 3PVEA 4DEVA 4QQHA 1SLIA 4WVWA 3VB9A 2WSVA 3ROUA 4YW4A 4BPZA 3H8RA 1N1SA 1NT0A 4QB1A 4FPGA 3QBQA 3D0SA 4MVTA 5ACA3 2VNRA 4Q0VA 1VPHA 3MIEA 3W21A 2EVXA 1U5IA 2CDOA 2O0OA 2MPFA 2JEMA 1QOOA 2XL9A 3R05A 1QJX3 4LT5A 3AL6A 5FYCA 4HFSA 1S0EA 5A7WB 3RQ0A 2VPVA 1VBA1 3WQ0A 5IK8A 1Z7S1 2YGMA 3O7OA 4M0NA 3E5QA 2W91A 2D43A 2AUYA 2E7TA 2XQRA 1O3QA 2P17A 1RTVA 1S4CA 2ZZJA 3AKRA 1FAYA 2VVDA 1CZSA 1QMJA 1VJ2A 5F3CA 1UPIA 2VAUA 1L7QA 2WFF3 2LM3A 2ZBJA 2XKOA 2QQJA 3VZMA 3MYXA 4XFFA 3VBUB 4P9LA 1D7PM 1PM7A 3DXUA 3VDDA 2E26A 1ZA7A 5C4WA 1Q8SA 5JIAA 1AYM1 1OI6A 2D6LX 3LPGA 1ND3B 3I59B 4LLFA 2A6WA 3ZYGA 4LE3A 4X6QB 1NKGA 1TME2 2BV4A 2P6HA 4QKBA 3TN91 3PUHA 5C9AA 5JOWA 2DF7A 3WT3A 1RUJ2 1UYYA 4R4ZA 3H8XA 4D6RA 4H7MA 3AL5A 2CY6A 4DXTA 2EAAA 1RUNA 3DL3A 1NLSA 2R0HA 3ZFFA 5HV4A 2RVAA 3A21A 4Y22A 4FO9A 2BQPA 4LO8A 5APAA 1OT5A 4MGYE 4XAEA 3GDBA 5FPVA 1PX4A 2EIBA 1BKZA 4ITCA 2OVUA 2YY1A 4I02A 5C3PA 4IV3B 1UXXX 4XUTA 2G9ZA 3GJAA 5FY5A 3LWCA 4QX1A 2X5IC 1QIQA 4CUCA 4BU2A 3VD9A 1Y3TA 3ZXFA 4P9WA 2QZ2A 4XUQA 4UOJA 3K4DA 4YM0A 3T2PA 3O1UA 4ASKA 1HRI3 2IC1A 3AJZA 1OF4A 1H2MA 4D7SA 1AYN2 3ZVXA 4CP0A 4XBNA 3H7YA 2YFZA 3HNYM 3LDBA 4TYSA 5C33A 5IVBA 5ACA2 2DVBA 4COYA 4BXSV 5FZOA 1WCQA 4E27A 2KM2A 1WLWA 3APBA 3D5OA 4FFGA 3L2HA 3WSOA 2BJSA 1QJX2 2F6BA 4FAHA 4MXWA 1D4VB 1W6QB 2QQNA 5CEHA 4BZ4A 4UXAA 4QX0A 5KXDA 1BK1A 3MIFA 4BCUA 3KCYA 1SLBA 5FZ8A 4NR1A 1W39A 2ZKLA 4HKLA 2ZGLA 3M70A 1EAH1 3W9AA 1ZZ9A 4AEJA 2GH2A 1W2TA 2V72A 5HBAA 2C9KA 4J6GA 3PJQA 1KJLA 5AC91 4Y5SA 4OHYA 1H6YA 1O4YA 2L9LA 1OPOA 2V4AA 2Y6HA 5GZGA 1ND3C 1QJY1 4FCAA 4WBBA 3KHCA 1WMDA 1Y7BA 4CEYB 4AG4A 1DLCA 3DN7A 3N35A 4P08A 1AX1A 2HWC1 4Q0UA 2VW1A 1OLME 1R082 3MLJA 1NLQA 3NO8A 3O0VA 4QKFA 4UW5A 5LA2A 5HCAA 2Z42A 1HB3A 4N53B 4E2SA 2JXAA 4K40A 4AXOA 1WW6A 1BXHA 4LPLA 1QDCA 1JZ6A 2DURA 3VZOA 1EUTA 2GC1A 4AR2A 4BH9A 1P8JA 3WQ7A 3IIIA 1QNWA 3N9QA 3F2ZA 4Y1ZA 2UWCA 4BWOA 1L7LA 5ANNA 4KMQA 3OEBA 3SH5A 4I0AA 4QD2A 1HLCA 3KQRA 3HT2A 4QX7A 3NQHA 3C7HA 3ZIWA 5LA9A 4DRVA 3OCPA 2DCKA 3IPVA 3MLLA 3UETA 2ZA9A 2X10A 4OQ9A 5FLIA 4DQAA 1BZWA 1K45A 4XIKA 2A73B 3KV4A 4QQ2A 4Z82A 1F4AA 4LA2A 3R4DB 3KT7A 2OUHA 4PDWB 1G6NA 1WCKA 1UWWA 4MZUA 1IKQA 4DB5A 4QPGB 1CQ9A 4LBMA 4LNVA 4XJWA 4YW7A 4HKOA 3ILNA 3VBSB 2VE1A 3VHPA 1UZYA 5A3TA 1HW5A 3VD4A 1VRBA 4JGZC 1XNTA 1UQXA 2XJRA 4CCJA 3ZFEA 3WP4A 3ZXLA 1HRI2 5M0TA 2RM23 3NJXA 5BNNB 4L97A 1QJZA 4GB32 3IDEA 3ZYJB 2WINB 3OPZA 1DGRA 1KGYA 3OGSA 1WMXA 2G19A 5K7PA 1SLLA 2XDVA 2PHRA 4X6RB 2CGNA 2MEV2 5FMCA 4QPWA 3ZDVA 2PXJA 4M3CF 1ONAA 2Y0OA 3HQXA 1AR83 3D82A 2Z4FA 4I3GA 5IK4A 2ARAA 3PUIA 4CU9A 4RQPA 4JHZA 5DUUA 1SZBA 3DPRA 3PDQA 3R0RA 2H6BA 3RS6A 3WCSA 3SQOA 5HXMA 4XFHA 3RZZA 4YVSC 4ZU7A 1UMIA 5GLWA 5LK5A 3JU9A 4KGGA 4KWLA 4I09A 3OYWA 3AYEA 5FXZA 5F5IA 3D0JA 4AEMA 3O14A 4H7LA 4S2FA 1SPPB 2VZTA 2VMDA 3MV11 5I8TA 1H1MA 2JICA 5E8AA 4MOAA 2A7AA 5A3NA 1C1LA 1W2OA 4FQ4A 4PT6A 1W8NA 3OBRA 4AI1A 3POYA 4GJZA 3HMYA 4XURA 1GUIA 1XE8A 2JE9A 3D4KA 1DYOA 1IQAA 1DQ5A 3IT8A 4Q4Y3 3ST7A 3WNLA 2WKKA 3LF7A 2V09A 4OYUA 1PGSA 2ZMLA 4IUGA 5IAVA 1B35A 2YPDA 5FUPA 1POV0 5A6YA 1GQPA 2D97A 1RUH2 5L9BA 1VR3A 4N43A 3VDBA 3BPZA 2JJ6A 1HQLA 2JG9B 4PDWC 4RR3C 2Z69A 4PLNA 5C8CB 4OHWA 1GWMA 5JI9A 3MUZ1 1JBCA 2RHPA 1E5SA 3L2YA 4OI4A 4ARXA 2MNGA 2VTXJ 3SEEA 1SQ4A 3UGHA 1UMHA 3LEMA 3WG4A 4BHPA 5ERLA 3VZNA 1PK6A 1R093 3R6SA 5CFCA 1ZZCA 3FFQA 4LEJA 2XH6A 3ZIXA 3RSJA 2YXSA 1HB4A 3B01A 5A1FA 1WD3A 3WINE 1RUC3 4AAPA 1GU3A 3KV9A 1RUE3 5FREA 3V0AA 1HX6A 4I2OA 1UYXA 1V6MA 5I0SA 2OT7A 3H8UA 2PAKA 3I3QA 4V2VA 4IXLA 4FBFA 1W9SA 3WP5A 3LA7A 3PLQA 3R4SA 1IQDC 1TMF3 5DUWA 3WW4A 3I54A 5T54A 4CRQA 3F95A 4C8DA 3H7JA 4J1XA 4UF0A 1VRH1 2QFEA 1F35A 3M3IA 1F5FA 3OGVA 1APNA 5KXBA 1YHFA 4NMIA 1AR82 1MR5A 2W46A 3AFGA 4XFGA 1YRZA 3D3AA 3ORJA 4YW5A 5GALA 3SH4A 5SV5A 1RVF3 2VQ0A 2WWSA 4XDQA 4OI1A 1HRV3 5FXWA 3WDWA 2PMWB 1PZ7A 2C6SA 3RWNA 2WLQA 2X29A 3ZYHA 3ZFGA 3JXSA 4HT1T 4DFSA 1TG7A 4TXWA 2A71A 4PQ9A 2BWCA 5DZFA 1YIFA 5GLTA 3SXWA 2K46A 2JDPA 1WA4A 2VUAA 4P5YA 3WG3A 1J1TA 3TRSB 4IE7A 3RZGA 2YV8A 1ND2B 2DTYA 3NJYA 4Y1XA 3PHMA 1JS9A 5BNOC 2PTMA 4AI8A 3M1HA 3GM8A 1POV3 4ISRA 3QH6A 2JG9C 1XJAA 1GZCA 3BUCA 4R52A 4PBOA 1RINA 5KXCA 1DQ4A 1CD3G 4WM7C 4D3WA 3BPSA 3K77A 4KNCA 4LLOA 4ASLA 5F5QA 2IXLA 2XLGA 5FCCA 1V9U1 4AI9A 2UURA 3LE0A 3ZPOA 4BQ5A 5KBFA 2ZHMA 3W59A 4AYUA 2BVBA 2AACA 2JKXA 3FUQA 4YG0A 1E57A 1QJU1 1XNDA 2ZGUA 3RYRA 4D69A 1JHNA 2A3YA 4DXZA 2C1FA 1AR63 4TN7A 5A3MA 5DAQA 1R092 2CAVA 3OEAA 1XNCA 1RUF3 4XBLA 2ETEA 1C8M1 5JOXA 2WLPA 2VNVA 4OUMA 1W28A 1REFA 4XJZA 5FFOC 1VP6A 1ASJ3 2A6XA 4CXXA 4GD4A 4MO3M 1RUE2 1BEV3 3M3CA 1NYWA 3N7JA 1ODNA 3VGIA 3V0BA 2OS2A 4BA6A 4BQXA 5T50A 1PVXA 1W2UA 4FOQA 4QAWA 1TMF2 1WCUA 4KWKA 4YLZA 5D1IA 3W58A 1UXZA 1JN2P 4XJ8A 4XYXA 2ZZQA 3VZKA 3CNAA 4BK5A 1S0IA 3LPFA 3K48A 3HJRA 2HWE1 3AKTA 3AMMA 5A7PA 3O12A 1LU1A 5FZ3A 4NUBA 1D4M1 2ZCWA 3U07A 2PYTA 5ISLA 1XXNA 4NO4A 1PVC3 2HWF2 4LIVA 1RVF2 2JDAA 2R6QA 4YWAA 4AVCA 1IZ3A 1WUVA 4QPIA 2RS31 3Q9OA 2KXLA 3ALQA 3NAPB 1Q3EA 1QXJA 4B4PA 1J3QA 2CNAA 4M4RA 4QX8A 2WC2A 3RZLA 4XF3A 2WNUA 2QQOA 2XG3A 4XCAA 2EXKA 2DTWA 2EXIA 5FOJB 1JZ7A 3BGAA 1BYHA 2HYXA 3CDZB 2J1AA 2SBAA 1JZ8A 5CAZA 4LHKA 2OXBA 2DYCA 4LK6A 1U5ZA 2WO1A 1ZZBA 2G9FA 3KVAA 5FZCA 3VDDB 3ECQA 2DVDA 1PIV3 2FZ2A 2LRPA 3SKJE 4BQYA 2J1RA 5HXVA 2BGPA 2YUEA 5BYNA 1YI7A 3HBKA 4ZZ8A 1RUG3 1L3JA 1AX2A 2WS91 5DAVA 1GQHA 3WF4A 2BOIA 1F2NA 2BNNA 2PN5A 1MEC1 3LAGA 5IT6A 4COZA 2WNEA 1HJFA 1VBB3 3BN6A 2RJKA 4OCTA 3I49A 2BFUL 3GBGA 1ST8A 3ZFFB 1COV3 1JMUB 1OD3A 1H6XA 4Q4X1 5GKAC 1AR62 3J7NA 4UI9L 5FZKA 2YG0A 1QXPA 1RUF2 1YJLA 3JBG1 1CJPA 5IVFA 5H9QA 4YM1A 1JZ3A 5A33A 1REEA 3C3VA 2X53S 1G86A 3PMEA 1F5JA 2JG8B 3H9AA 1BEV2 3KLSA 4JDNA 4ZONA 1YQ6A 5GM0A 3ZKYA 2W1UA 5IVVA 1KS5A 2HKXA 2X8KA 4Y26A 5FK7A 4QX3A 1FPN3 3KMHA 5F3IA 4EQVA 3GZEA 3K46A 2OQ7A 3FHQA 3KGLA 4LO6B 1AR73 2W1SA 3MICA 3V65A 5E88A 5FYVA 3ATGA 1PGL1 3LSEA 2VL4A 1ZBA1 2EICA 2HWB3 3WDTA 3KWVA 3B7MA 3WDXA 4LULA 1TZOA 2XONA 1I5PA 3BIEA 3CF6E 4MGTA 4W6WA 1H30A 1US3A 4XDPA 4D7TA 2Y60A 1GP5A 2Q4SA 4UT5A 4CDQC 4OQ8A 1XU2A 4FQZA 4NWVA 3POEA 5CVRA 2VZ1A 5C5TA 5C6CA 4H3WA 1LGBA 5FZLA 2E53A 2VCAA 3H42B 1YIPA 4QGNA 4XJAA 3POJA 2UY8A 1PNGA 1C5HA 1OLRA 3JD73 3IAQA 3PJYA 5LASA 1W0OA 4XXAA 2W3JA 3JCIA 4OZXA 2WZ8A 4AFDA 4OI2A 1L7RA 4DUWA 2ADDA 1VALA 4R9BA 2FCUA 4JQRA 4JKLA 4XJ9A 1W0NA 1W6NA 2VBDA 2WUHA 4EYUA 1SBFA 4GMP3 4DNYA 5J48A 2ZHLA 1LEDA 1DGWA 4N7IA 3ZYBA 4BE3A 1LULA 2P2KA 2V5DA 5LY2A 4E2GA 1F9KA 3VBFC 3NNMA 4JDMA 4Q0QA 2GC3A 4NAOA 4JCKA 2V73A 5FP9A 1VBB2 2C0ZA 2WL1A 3CJXA 4XJUA 5IYYA 1KQRA 1F31A 1COV2 1S0JA 3ON7A 1MQTA 5GLUA 1SLCA 4CEWA 2EALA 1ULCA 4F83A 3RZHA 3WHTA 1GBGA 2KA3A 1WW5A 3IPVB 1DQ0A 2VZOA 3ILFA 4ZS2A 3BOPA 2R1BA 3N7MA 4RD7A 2FDGA 2EAKA 4DMIA 3PMSA 3KGZA 4QM8A 2BW8A 3SNMA 1WLTA 3T1LA 1DLLA 3NSTA 3VBHB 5AFBA 2F17A 4MGQA 2W1WA 3LOIA 4Y3OA 1MS1A 3S7EA 1UW8A 1VBE1 4A44A 1FOD3 1I5ZA 1Z0HA 1EPWA 1AL0G 3MGUA 3EYPA 3OD4A 5FMOL 4CDUB 1ULEA 2XUEA 4JAAA 2JD4A 3OF1A 2WNVB 3ZFEB 1U5XA 2EXJA 2R041 3ZSLA 4JGYC 3TNPB 2D44A 2VZQA 3FBYA 2B4KA 3LEIA 3ZR6A 1A3KA 3T4VA 5CFDB 1AR72 1EV12 2BVVA 4YVWB 5KHIA 2EIEA 3RG0A 3VBRA 4YFZA 4LKEA 1VMHA 4FOYA 1LOFA 1V6NA 1AL21 4IESA 4U2AA 3CO2A 1RHI3 3I3DA 4XQ4A 5GZEA 5LCWL 1ENQA 1SFPA 4L9BA 3DEMA 3FBMA 3DPRB 4J25A 2ZS6B 4BQ2A 1SFNA 5DXDA 4QWNA 5A3PA 5BNOA 5F37A 5EP9A 3AMQA 3QD6A 4Q0SA 4RGGA 1LOEA 2VMCA 1LHOA 2E32A 4NPRA 1T6GC 2ZPXA 2WZR3 3WP6A 1KEXA 1PO13 2P3IA 5IFTA 2Y0IA 4SBVA 2IXCA 1LGNA 2XVGA 4QB2A 4WM7A 2VXRA 4Y33A 2JKBA 4FFFA 4XILA 4QGMA 3RZKA 5J36A 5JSOA 4K9SA 3KF3A 4LBQA 2GALA 3MF9A 2ZX0A 4ASMB 1V6IA 2RMU2 3Q8AA 2Q1MA 5FP7A 2EXHA 1OFSA 2YFUA 4N90A 5E1RA 1I1EA 3M8LA 4XE9A 3TBDA 1PMJX 2FMYA 1N1TA 4XAAA 1MVQA 1PHMA 4FP2A 4XF1A 3FMGA 4NWWA 1VBD3 4TSVA 3H50A 4XTMA 3POIA 4QU1A 5T5PA 4CDXC 3J4UH 1JYCA 2XBO1 4LK7A 1OLQA 1TNFA 4KWUA 5DDJ3 5DG1A 3VBOC 4RN5A 1MS5A 1O4TA 1LENA 1E5IA 1LU2A 1TME1 2Q0AA 4PI0A 2NMNA 2D98A 1ZZ8A 1PK6B 4CDUC 1H8TB 2VC9A 1Q8QA 1RUJ1 5CFCB 2W0XA 1OD5A 1QQP3 4OHVA 5LBCA 2VMHA 2JDZA 4M0HA 1MZ6A 1X8MA 2ARBA 4H55A 1FOD2 4L11A 2PLV3 5T3NA 2X09A 3UGFA 3HNBM 1ACCA 4CCLA 3MW3A 3QOPA 4IEVA 3KQ4B 3R4UA 5EJ3A 3V0AB 1UOFA 4PCRA 1DYPA 2ZHNA 2PAMA 3ETQA 4HETA 1BVP1 4Q4V3 1DQ6A 3PIJA 2W94A 1CN1A 1YFUA 2G9GA 4AAXA 3VDAA 4G4FA 2GNDA 2R063 3UL2A 3AC0A 1ZM1A 1XBFA 4Q4W3 2FBEA 1S0DA 3I8TA 4IE6A 1K12A 2WO3A 5IUQA 1QOTA 3ZMNA 4FPFA 1RHI2 1C5IA 1GZ9A 3AP4A 1RYYA 4Z07A 4TLGA 3O1VA 1AYN1 1HXS3 3BU0A 4RGAA 5ACA1 1BVVA 3UKVA 1MS4A 3ZFGB 2ILMA 2XWBB 4XZUG 1XSRA 1NCQB 1KDKA 4CDWC 1C3HA 1RUI2 2BGOA 3M3OA 4WVMB 3B94A 2VNOA 4ISQA 3IAPA 2YBSA 3VHRA 4QX5A 4YZ2A 3RWKX 5KHGA 2UYAA 3POSA 4Q1PA 4Q4Y2 2JE8A 1O8PA 5L7OB 3UNPA 1CVNA 2BBAA 4XETA 5DAPA 2AREA 1X36A 2XB6C 2D3RA 5DABA 5FXVA 3RFRA 4EN7B 1BLZA 3HOBA 4YW1A 5GJ6A 1BBT3 1KXGA 1W8TA 4NIDA 4OUSA 4P14A 4AVBA 3KS7A 5JXHA 3FHAA 2XJVA 2Y6GA 1UKRA 1WBFA 2GU9A 1VBD2 2WWUA 4A6SA 2AC1A 3MLKA 2YBKA 1R081 3AP6A 4L99A 5FYBA 5ABJC 1PO23 4AEDA 1ODMA 1YFWA 1AHSA 2PQSA 2VECA 5TSWA 1RUD2 4A7KA 1FMD3 2J22A 4O9GA 3HVDA 4RS5A 3T09A 3POBA 4OULA 2VNGA 1OBNA 2VQTA 5DDJ2 2P3KA 3AB0A 1YO8A 3VKFC 3DF0A 3EHKA 5LK7B 4W4ZA 1ULDA 1KD7A 2F4LA 1XYPA 2QBXA 4XIOA 1QQP2 4LTAA 4BJ0A 3BTZA 2R49A 1WCSA 4XQDA 4AVAA 2PLV2 4XFAA 1CPNA 3FL7A 3IDAA 4N8MA 1CAWA 3TEXA 2XUMA 3FUOA 3IMNA 1ULGA 4D94A 1DZRA 4M3CA 3VV1A 3AJYA 4YGBA 4Q4V2 1JHJA 1NA1A 5D8AA 3WX5A 1VBA3 1XYNA 3LIHA 1FYUA 3HWJA 3THCA 5C3QA 2HBTA 1Z7S3 1S55A 1JI6A 3VHOA 1H8VA 1HB2A 4FPLA 5A32B 4C1WA 4CDQA 3TEWA 1WWYA 3TB0A 1IS3A 4IEZA 1Q56A 1DDLA 1TEIA 5FLHA 5GLZA 4E4HA 3VKOA 1IPKA 3A0NA 3ZYFA 1NCRB 1ZNPA 2ATFA 4LR4A 2QTWB 3PNAA 2RV9A 3N7KA 4FFIA 4MH0E 3BTXA 1XYOA 3Q8EA 1W03A 3OGRA 4GB31 2J1UA 4C1XA 2HBUA 2BUKA 1AYM3 4RA0A 1WMFA 4OZOA 5DMYA 5FY0A 5J7MA 1W0PA 1CWPA 3CJIA 3UV9A 3LEGA 2MEV1 1YNAA 2WNUB 4MSVA 1W6OB 4UFKA 3VD3A 2WFPA 4XUOA 4ZZ5A 2GAUA 3TN93 3USSA 2JENA 3VBFA 3IKWA 1UX7A 4CXWA 4A6OA 2OYZA 1ZRIA 4GWNA 2HYKA 2VQUA 4QDQA 1OA4A 4E8DA 2WAAA 4YVSB 3ZSJA 2VH9A 1YC61 3VLBB 2ORXA 2OKXA 1OC1A 1QH7A 4D7YA 5A6XA 2QQLA 1RUOA 1OOPA 1BBT2 4KGQA 2XJPA 3AXDA 2BPA2 1AXZA 3WG1A 2D6MA 2V5YA 4BQ1A 4IW3A 4COUA 3GNEA 1O8SA 2WZEA 5H9SA 1ZREA 2A3XA 3T2TA 1JZ2A 3VBUC 1GKBA 1LOAA 2PHLA 2XKPA 1YUDA 1JYWA 4AGRA 2DCYA 5BNPA 3AP5A 4FPHA 2D6PA 3U78A 3BALA 3JB4C 5KWRA 2WFF2 3BU7A 1SHWB 2DVGA 5FTTC 5A7NA 4NHXA 5D21A 1REDA 2XVKA 4AQ2A 2WIIB 3MBWA 1OUXA 3KF5A 2I07B 2IUWA 4IQPA 2W2IA 4FOWA 1RUH1 2ZABA 4E4DX 5F5CA 1OH4A 2ZACA 1JOJA 2B7YA 2ZX3A 3D8CA 4PIZA 5A33B 4Q5OA 2R071 2F4PA 1K3IA 2XQXA 4H2AA 1SEFA 5IK7A 4AFCA 1NXMA 1Y4WA 2HJIA 4NAMA 3OUHA 3UESA 3RRDA 3A22A 5T5OA 5C3RA 1XNKA 1JZ5A 5FLJA 2XHNA 1PGW2 1WW7A 5JLVA 4B8EA 1TE1B 3S57A 2RS11 4K7JA 4A7ZA 5DAWA 2D7FA 4EN0A 1JXNA 1XE0A 3U4SA 2VCMA 4LHNA 3BKZA 3HN1A 3ACLA 1I6XA 4IV3C 3RJRA 5LATA 1UY1A 3ZN6A 5AC93 2Y26A 2CSGA 2VD7A 2AGSA 4XC9A 2GP5A 3U75A 2RS53 3IDBB 1QJY3 4LUKA 2Z5WA 1AR93 2HWC3 2ZGRA 4B4RA 1H1AA 1RMU1 1RXFA 4QXHA 3HD8B 3E1F1 1K5MB 1JOBA 5FO8B 1CZTA 5FQ0A 1JYXA 3VKNA 1A8MA 3MO4A 4Q1RA 4IEOA 5EYYA 1O4ZA 1QXRA 3URFA 4CSWA 4DRRA 4XFIA 2BP6A 4PLOA 1VB4A 2A6VA 4OHZA 1LOCA 1QJFA 1VE0A 3JUUA 4FI9A 4LIUA 1OVPA 1CGPA 4EZHA 3E5XA 4QHOA 3SMHA 2ZTNA 4JKMA 3HEIA 1ZBE3 2VOWA 1XRUA 3MPBA 3ACIA 3WVJA 4YARA 1O3RA 4LKFA 2W9XA 1GYKA 1NAEA 2K2SA 3OJBA 2XPJA 4C0HA 1HQNA 2DBIA 3AKQA 5JWPA 2WQZC 3T08A 3HQRA 2B5HA 4CEYC 1AX0A 1OVSA 2CV6A 3MUY1 3OGJA 5F6KA 2G1MA 2HEVF 4DY5A 2VTFA 4PF1A 1GOHA 4IV1A 4ES9A 4OFGA 1LEMA 3MFCA 4FVVA 4N53C 3TWIA 4I0WB 4CP9A 4K20A 1MQTB 3IMMA 3RZJA 5JZGA 4CEWB 3AX4A 3GZAA 4P9IA 2MHFA 4NN0A 3PUQA 2TNFA 3M7AA 5EV7A 4QX2A 2WO2A 2ZAHA 3LSDA 4PF5A 4XW3A 5IVEA 3DCQA 3U11A 2ZGTA 2R16A 4P02B 1DGWX 1VLNA 1Y9GA 2JD9A 3L9JT 4YZ5A 4HPKA 4AK3A 5HCBA 1GNHA 3DUIA 5K0UA 4IE0A 2Y64A 3AZYA 4GWJA 1X8EA 3KT1A 2LROA 4S2GA 2ES3A 4NHLA 4MXVA 3WF1A 3K4ZA 4P00B 4WM8A 4NIAA 4ES8A 3UT0A 4L2NA 3N4MA 2Y34A 3AXEA 5AC92 4QPGC 3ZSMA 4CDWA 4XCBA 3E6CC 2VMIA 4UYBA 3VBSC 2RS52 2XWJB 4HXCA 1QJY2 2PA7A 3GYDA 1D2QA 1GP4A 1SBDA 1AR92 4NHYA 1LCLA 3CMGA 2CWMA 1TMF1 1QDOA 4X8NA 3W20A 5BNNC 1V6LA 2P4EA 5AFEA 1J59A 2DCZA 1KITA 2BRTA 4AHYA 2DFCA 1GNZA 1FV2A 1UPSA 3C7EA 2C4XA 4M00A 1SMVA 2RM22 1YCIA 2DU1A 2VOXA 4AEKA 3AKSA 4LUMA 1G9AA 5LA0A 3MIHA 5F9TA 4U36A 2HWF1 2QKDA 1RVF1 1MS0A 2HWD1 4UFMA 1YEWA 3W5MA 4NPLA 3U4XA 5JOYA 1JYTA 1H2NA 1DCSA 1UIKA 2Y6KA 1V6KA 1ZBE2 4IEXA 5FBZA 1XE7A 3AZVA 3RMXA 3VL9A 2HH9A 1RB8G 4WZFA 5K9YA 1A6CA 2VMEA 2VUDA 5HPOA 4V2WA 1OF3A 4QPYA 5DG2A 5JSPA 2ZX4A 4O61A 1UNBA 1N3PA 1OH3A 1UU6A 3E5UA 5IJRA 1V6JA 2P37A 2J1SA 1NE6A 5BUVA 3WCRA 4LOTA 5F8PA 4AVTA 4HLTA 1POV1 5EPAA 2Q8CA 1YQ2A 3J8F1 3IIAA 4HN1A 2E31A 1SDWA 2R32A 3HT1A 3OBAA 4RGKA 5JXIA 1DGLA 2RDSA 4CE8A 5DN2A 4DINB 1S2BA 2PHDA 3N9OA 3I2IA 4X8PA 1W90A 2XJUA 4XMAA 1VRH3 1AXKA 3HBZA 2CGPA 4BISA 2YPJA 2A75A 3AVSA 3EB7A 3JB8A 5DZGA 5C8CC 5A7SA 3O5SA 4Z2AA 3LDKA 4YGDA 3ZXGA 4DY3A 1UYPA 4P9GA 2CYFA 2BFUS 3T0DA 1W9YA 2C26A 2X5IA 1G9CA 3B3QE 3I2OA 4AE2A 4LBKA 2BERA 4TZDA 4OMDA 3THPA 1MVEA 1O59A 3BVCA 2NMOA 4YZ1A 1MS8A 1QOSA 4KBBA 5FAXA 4IEPA 5T5LA 3S30A 4AVVA 3KZ4C 2VMGA 2ORZA 4CCMA 2A1XA 2GMPA 1MS3A 2FDJA 1XU1A 3MZHA 2NM1A 2JIJA 5LBEA 4UAPA 3BCWA 3NMBA 4JZRA 4HVRA 3PVBB 1W6PB 3EJKA 1G7YA 1RUC2 3ITQA 1W6MB 2XGXA 1O6UA 3FLTA 3GZTB 1LNSA 2J1EA 2Y6JA 4I0BA 1VAVA 1CAXA 5FUIA 1T2XA 3B93A 2P3JA 4GH4B 4CCOA 4CZSA 5JMOA 4FTBA 3BIWE 5A70A 3PTRB 4Y20A 1A8DA 3VBUA 3SKVA 3I4IA 3P3PA 1D2SA 2PHWA 3E6DA 2JE7A 5EYXA 3OBZA 5E89A 5JAXA 5JXJA 3OD0A 1ND3A 2VUCA 4YSFA 5I8YA 5FZAA 2ZGPA 1QJU3 4PQQA 3ZYPA 1D0GA 1HRV2 4Y24A 4XFBA 5J3UA 1E5HA 1M06G 3WUCA 5FYHA 1VBC3 4IE4A 2ZKNA 4DUXA 1LHVA 3LDRA 1KFUL 4W6YA 4BXFA 1HN1A 2ID4A 4AEDB 1NZCA 2Q5TA 3DGTA 3MI8A 1ND2C 1V0AA 4LHLA 1VAMA 2VU9A 3WNKA 4MGIE 4RS5B 1UO9A 2D6NA 3ZYRA 2R1DA 5FIXA 1GLHA 3IWZA 1IHMA 3RZMA 1JTZX 1S2KA 4D8MA 5F1RA 4ZY9A 4QXKA 5H9RA 1JU3A 3HR9A 5E6HA 4N9IA 2EIGA 5C4WB 5FJHA 4ZXEA 3PU8A 4NRMA 2FZ1A 2YYOA 5FYMA 1ULOA 4IV3A 4EV0A 1Q43A 4LA3A 2OPKA 2HWE3 3ACHA 1COV1 1IS4A 1BMV2 3POFA 5C9AB 4Z1VA 1A78A 4GMP0 4M3CB 2RE9A 4BDVB 1M4WA 1NA1B 2XJQA 2WT2A 2W87A 5LRRA 1UOGA 3NKTA 2C5DA 3WOGA 5HV0A 4KI5M 3S0MA 4YYOA 4XF0A 3NW4A 4JGZA 1F8VA 4Y22B 2BZDA 1RITA 4LBQD 3H0OA 2WA3A 2JWPA 3A23A 2WYFA 4AFBA 1HN0A 3NNGA 1W6QA 1U0AA 5CYYA 5EWSA 4BLJA 2W92A 2K0GA 3WF2A 4BIOA 1YWKA 1W8WA 3BI3A 1CPMA 1CZVA 1VB2A 4R9DA 3I2FA 1DYKA 1ASJ2 1NUKA 3ZXEA 2GZWA 1AXYA 4LQRA 4QM9A 1OXCA 4IE5A 5FZDA 3N9MA 5FMOS 3LOBA 2VBPA 1AR71 1EV11 3CJIB 3OPWA 4QXCA 4B1LA 1GV9A 4P9XA 2RR13 4G9SB 2WS93 1X33A 1N3QA 4CEYA 4QB6A 1LTEA 4YVSA 4FSJA 4LBJA 1MEC3 2ZJCA 3RI9A 1OQDA 5FZOB 4N53A 5KC6A 3MF6A 5FPZA 3NAPC 2BTVC 1QJU2 1H2KA 2FQPA 1PVC2 4MXWB 3CZJA 1OOPB 5DQ0A 3O1MA 3BTYA 5LRSA 4ET7A 2VZSA 3TOJA 1NQDA 3WF3A 2GN3A 1VBC2 1LAJA 3JBG3 3WDVA 5A1LA 1W3XA 3GZUC 2ARXA 4XPVA 1CIWA 3IBMA 2GMMA 3DXTA 3VDDC 2RMU1 3DKWA 3LGRA 5FZBA 4A7YA 5BNPB 1DBNA 1V00A 5FR3A 5FZIA 5FYZA 2P5BA 2Q1FA 3C2UA 2Y6FA 3FZ3A 1GQGA 3VDCA 3FC0A 1J58A 2IZWA 4XACA 4CCDA 1PIV2 3HAGA 4FPJA 4PDWA 3RDIA 5IAXA 1H1IA 1SG3A 4FPYA 1JODA 1U5YA 1VMJA 3KV5A 4RR3A 4QPGA 4CVUA 5CKQA 4PLMA 1RUG2 1EP0A 5IVCA 2HWE2 3OGGA 2AYHA 1IS6A 3VBSA 3SCFA 5F7UA 3ZFFC 3TNQA 3UGGA 1NY72 5FKBA 3ETPA 3LCPA 4YW6A 4C91A 1UZ0A 3OY8A 1BQPA 3AK0A 3WQBA 4AHWA 4LO7A 3WD5A 5BNNA 1N1YA 1HKDA 2VZRA 2W5FA 2ZMNA 4RFT0 5FZ1A 5FZHA 3AZXA 1PMHX 1DZQA 1YYNA 1OKOA 2CDPA 3NVCA 3HNMA 1H9PA 1W06A 2PELA 4I01A 2YB7A 1FOD1 4L92A 4UFIA 1LB2A 2PHFA 1DQ2A 1JYIA 1STMA 2JG8C 2XOMA 3WDUA 4NE9A 5JI7A 2ZAAA 3FLRA 1SCSA 1R1A3 5CZKA 5EXOA 3SH3A 2OX0A 4XVHA 4HK8A 1HV1A 5BXXA 1FNZA 5CB7A 1J84A 1WKYA 3ELNA 5IATA 2DFBA 2WBKA 4HBNA 3U37A 4PBPA 1NLRA 3LZZA 2VM9A 4G3YC 5FQ0B 2RR12 4GALA 1UX6A 2Q8DA 2WZPP 2YROA 1YFYA 2WS92 3EMRA 5EHDA 5J96B 4AW7A 5HCFA 4AGVA 5IVYA 5FK8A 1OQEA 1FPN2 4Y1YA 3X29B 4EN8B 1H4HA 2FDFA 3A7QA 5FXXA 1TVGA 1UY4A 5FZFA 2ZGNA 3B69A 3LIGA 1RGSA 2VBBA 2W47A 1DGRN 3AMNA 5IFPA 1V70A 1SDDB 1DZTA 2HWB2 4R9CA 1JYNA 3W5NA 2OZ6A 4URTA 1QWRA 4RQPB 3LEKA 1LOGA 1RUI1 4YPJA 1HV0A 4Q26A 5EIYB 2VZUA 4KU8A 2DU0A 2FDHA 3JBG2 5I91A 2FHRA 3AP9A 4IV1B 1PNFA 2GNBA 1ENRA 2JG9A 3OYWB 1V6OA 4Q4Y1 1FXZA 2ET1A 2OIIA 1VBE3 4CP9B 5C8CA 3FE5A 2CL2A 2WQ8A 3KM5A 3VHNA 5HI0A 3WR0A 5JZGB 1U12A 5FZEA 3OUIA 1XC6A 3JD72 3VD7A 2R7EB 3BYWA 5FYSA 5FY8A 2R043 2IXKA 1VBD1 2JDYA 4CCKA 1N3OA 4HL0A 4NHKA 3ES1A 3VKMA 3CQOA 3MHZA 4GKYA 4LKSA 5L9RA 5C7GA 1H9WA 1Q8VA 1RUD1 3GCWA 4XUNA 4HPKB 2B39A 2VMFA 1B35B 5GZFA 4IGPA 1AL23 2XVLA 1FV3A 4N43B 3DYPA 4HKWA 1W2NA 3Q8BA 1BHGA 5T52A 4WM8B 4DEQA 1WGPA 2VO5A 1X82A 2VJXA 3VBHC 2GC0A 2QQWA 4XF4A 2RJ2A 3TEZA 3VN4A 3A4UA 2WAOA 3BTAA 3KCCA 4D6SA 1SLAA 4IEWA 1R1A2 1ULPA 4Q4V1 4W8JA 2WNVC 3I97A 4UBHA 3TYJA 3I3BA 4K21A 3ZFEC 2Q8EA 4CU8A 3NJZA 3S5AA 1UF2C 3AM2A 3ABZA 5F32A 4DXRA 1IKPA 5IW0A 2QDNA 2BYVE 2QQMA 4XXPA 3OUJA 5CFDC 2UWAA 5IVJA 1CR7A 3NV3A 2ADEA 4Y5Z0 4YVWC 3WZ1A 4BYYA 3WP3A 4Z8BA 5FKCA 1N1VA 2ZEZA 4XMIA 5CIRA 5A6QA 2WDBA 3C7FA 4D6QA 2CU5A 3RVHA 1SFYA 3RYPA 4HOOA 1GZWA 3I7DA 4RQPC 4CCCA 2D5FA 2BWAA 4UF0B 2B8MA 2QQPA 3CL1A 1EUUA 4FXGB 3WW1A 3DPRC 5AVPA 1J3RA 2CGOA 5A7QA 3MV01 2IFRA 1ZRFA 1LR5A 3K3OA 2XBO3 1AUYA 4JQTA 1J3PA 4HMZA 4Y4YA 3I2JA 2IXJA 2ET7A 4B3NA 4EE2A 2LTNA 2YDEA 2B42B 4R8HA 1OUSA 3UJQA 4NVPA 2E9QA 4QU2A 4MADA 1JZ4A 1NZIA 4OVEA 2GH8A 2WZR2 3SCHA 2BU9A 5C3SA 1PO12 3FX3A 1DF0A 1UN1A 2QVSB 1RJ8A 1QJX1 3CLPA 4AL9A 4QHBA 5EJ1B 3H1MA 5GZDA 1DG6A 1BBT1 2D40A 1VAKA 4RHV3 1Q8PA 1JW6A 4B1MA 4EZ4A 1QNYA 3NL1A 3C7OA 4YM3A 1UMZA 2AEYA 2ZHKA 3J7LA 4N43C 3ZXJA 4LOSA 4Q8KA 2UWBA 3N7LA 3P5BA 3G6JB 4UW6A 2PQQA 4OLLA 4EN9B 2WYSA 1SBEA 4PIXA 2WFF1 2VCCA 5EQUA 2W52A 2C9AA 3H3UA 3T2QA 5FO7B 1OQ1A 3WQ1A 3OSDA 1CESA 1EYBA 2IVIB 3HN3A 3MIBA 4PJYA 1UZWA 1PK6C 2O8QA 1H8TC 1UZZA 1VMFA 1AYN3 2WT1A 2X5IB 4K8RB 4Q2FA 3U10A 1EY2A 5FZ7A 5CFCC 5LW9A 3OG2A 1YQ5A 1PZ8A 4AQTA 1G9FA 3AMHA 4RL7A 4NROA 4CCEA 1O5LA 1US2A 3N9PA 3NRUA 5LWBA 1D0HA 2A70A 2B45X 2O14A 3AFKA 3EQEA 5DUXA 4BM8A 3DYOA 3KVBA 5CG9A 3GBFA 4CU7A 1PGW1 5FZMA 2QE3A 4URAA 1NE4A 2JB4A 4TWTA 1E5RA 2VULA 4E8CA 3NAPA 5FP8A 1W8OA 2IFWA 4AWDA 1G9DA 1LKNA 2J7MA 4K1ZA 4W6XA 1XPWA 3N3HA 3T0BA 1OLMA 3WV6A 5BNQA 3V0BB 2I74A 3SEPA 3I3EA 3LA3A 5FY1A 1CAXB 4WZCA 4A3XA 2VGDA 3ZDSA 2DCTA 5K4LA 2ZX1A 2XR4A 4QDRA 5CG8A 1W8UA 4Y20B 1R083 3NKGA 4N7UA 2R062 3NNLA 1GMMA 2O1QA 2YBPA 2EF6A 4HVOA 5LA1A 2WWJA 1BK0A 1Q8OA 1WCDJ 2OA2A 2YZ4A 3H1WA 3E97A 4FT8A 2XBO2 4Q4W2 2ZEXA 4W65A 2FDKA 1NOVA 4UWDA 3T2OA 3ZFGC 3CU7A 1CIYA 2WN2A 1NCQC 4LKDA 4ZKTB 2WABA 1S1AA 1HRI1 4O9EA 2XLFA 4ATFA 2TBVA 4BQWA 1YQ8A 2BNMA 4QPIB 1HXS2 1ENXA 1UKGA 1WW4A 2VQAA 2DV9A 3T1MA 4CUBA 4DXSA 2ZEYA 2JB8A 4E2QA 2W39A 4WVVA 5L7OC 4CXYA 1YQCA 4YZ3A 4LXLA 2VZVA 4M01A 2OPWA 4RFRB 2H6CA 2D5HA 4RHV2 1KJRA 3GALA 1FNYA 1C57A 2HEWF 3LFMA 4N9HA 5I0DA 5K8SA 4JC1A 1ULFA 3RMYA 4HSJA 1ALYA 1ZRDA 3WXPA 2A5ZA 4GKXA 2JG8A 1MS9A 1XNBA 4CYDA 2QQVA 1LJ7A 4DUVA 4AHXA 4FPCA 2NPIA 3M3QA 4CP2A 3O0WA 2E51A 5HCHA 4BMEA 4BOWA 1PO22 4K3UA 3FWEA 4GB33 2R0FA 1FMD2 1AF9A 3LFIA 1S0CA 1DFQA 5FYUA 4JKKA 2GSYA 4JGZB 2J1TA 2MEV3 2GNMA 4QHZA 1S0FA 3ZN5A 5F2WA 1LOBA 4E4SA 2A3WA 4JGYA 1JU4A 5LZ6A 1F4HA 4XQWA 3VZLA 5JUVA 1UZVA 3O1OA 1EPZA 4QQOA 1GZTA 1W04A 2P3YA 2XMLA 2OZJA 1C28A 4GZ9A 1W8ZA 4XBQA 4Y1VA 1RXGA 2ZMKA 3NV1A 2XJTA 3M2MA 3BOWA 3K51A 4K1YA 4FOVA 4Y5TA 4AVSA 4AI0A 4CU6A 1VBA2 1NCRC 1HQWA 1UOBA 2RS51 1Z7S2 2YMZA 3H3ZA 1K5JA 3EO6A 1AR91 1EAH3 1S0BA 4KG8A 4LBOA 4LORA 4M3CE 1YJKA 1YXWA 2Y33A 3THDA 3ZKUA 1UCXA 1LHNA 4QPIC 3SITA 4QQPA 2ARCA 5DUVA 4JVAA 1LHWA 4FAGA 2DUPA 2WNUC 1HIXA 2CAUA 5B4XA 2RM21 3C8XA 3T4HB 4AI2A 2NQYA 1UIJA 3ES4A 3J7MA 4YW3A 5C70A 4BK4A 3USUA 1AYM2 4JRAA 3WLUA 1RUH3 2E33A 2NLRA 2QQUA 1TQ5A 1ZBE1 1ZX5A 2R073 4JTOA 1KS4A 2WRAA 1OKQA 4Y4RA 4YGEA 3KV6A 5FPAA 1AR81 5LBFA 2WO7A 2VW0A 3TN92 3WNMA 3B02A 1WLCA 4XF9A 3THTA 2HLEA 1POQA 3ZM8A 3GHNA 2CTVA 4DPNA 5EZWA 4NIIA 4E4ZA 5IHRA 2PFWA 3H1YA 4CDXA 3OPTA 2RS13 4CP1A 4RR3B 5D2AA 5FOBB 1AVBA 1NXD1 3VBOA 4YG6A 3VBHA 1HB1A 1W6NB 4LMFA 2C24A 3MW4A 2JDHA 1FI2A 4QKDA 4LITA 4LHSA 1RJ7A 4B7EA 4CDUA 3WEZA 2QDRA 3OY8B 2WJSA 4BB3A 1SACA 2QJVA 2WNVA 2VOTA 5F39A 1ENSA 5CKMA 1CAUA 2TEPA 1NQJA 1ZA4A 2D3PA 3AYAA 4F3JA 1RMU3 3LA2A 4RYDA 2EA7A 4DIQA 3UYJA 5L36A 1AZDA 5CFDA 2OW4A 3AZWA 4YVWA 2Y6LA 1LODA 2D3SA 4IEYA 4EJRA 3IZOA 3A0KA 2R30A 1F15A 4BLIA 4Q8LA 4B29A 5JDBA 3GXUA 4UFLA 3OBTA 3I2HA 4PI2A 4DO0A 2HEYF 1X9PA 1W9TA 2AH2A 2FCTA 4YM2A 2VUJA 1QF3A 1R64A 2W68A 2Y38A 4KU7A 1LRHA 2ZOEB 4YZ4A 1QH6A 1R091 1UY0A 5J98B 1AJOA 1EAH2 4EWAA 4OHXA 1LECA 4TTGA 1CONA 4AQ6A 2H0BA 5CU1A 1PZ9A 1FATA 3DKQA 5FY7A 4MGSA 1C1FA 3UKNA 1RUC1 1UL9A 2V4VA 4OUEA 2VVFA 3P3NA 3AMPA 1H0BA 1RUE1 4TLFA 3VBRB 1K5MC 1W9FA 1SLTA 1XOYA 3NWKA 4KWJA 4LJHA 1A34A 2HWC2 3WNNA 1DQ1A 2IWGB 3PVOA 1UYZA 4ORFA 2WNOA 4CTEA 1WLDA 5FZ4A 1W8FA 3KD4A 3B5LB 5BNOB 3WHUA 2B9UA 5LEJA 2B46X 5A3WA 2JX9A 2R072 5G04L 4NIHA 4NHMA 1NG0A 2VTXA 3M3EA 4DS0A 4WM7B 1YFXA 1PM4A 2OUJA 5ABJA 2YC0A 1HRV1 2B9VA 4LBQB 3AVRA 4UW4A 5FPLA 3U1XA 2ZX2A 3S5QA 3VD5A 1J1LA 1H8TA 1W99A 2RS12 2QCSB 2XHKA 3AKPA 3PUSA 2DVAA 2QQIA 3DYMA 5E16A 4NPMA 3MW2A 4MUVA 4P9YA 3SLIA 3LKJA 1GSLA 5ANQA 3OB8A 4GJYA 4FP3A 4HANA 4UW3A 1ZYBA 5FP3A 3V56A 2BEOA 4CA9A 1MQTC 5EJZB 5FYTA 4IGOA 4CEWC 1GOGA 4QGLA 2GDFA 5DZEA 1MZ5A 2JDNA 2H0VA 4ZS3A 1RMU2 1UOJA 3SHRA 4A42A 1NX9A 3QCWA 2VW2A 5FJKA 1X9TA 5F6LB 5KR7A 4J1WA 3GJBA 1CAVA 5AVAA 3KSCA 4B7KA 2JIGA 4UFJA 2AR6A 2KR2A 1BMV1 2I2SA 2PHXA 3H8OA 3INAA 2IXIA 1URXA 4D0QA 4XHBA 3ACFA 2HWF3 4ARYA 2ERFA 3PL0A 4MG2A 2E7QA 2HWD3 4HK9A 2UYBA 4GWMA 4XHXA 4JDOA 3MIDA 1W9WA 3ILRA 2Q8OA 5FZ0A 2XLAA 1IG0A 2ZGKA 3E6BA 2IXHA 3UK9A 1NCQA 5I8SA 3ZSEA 2WT0A 2BGCA 2DBNA 1AR61 3V64A 4WVMA 3VBRC 4Y1UA 3B9IA 1RUF1 2JDMA 1LOFC 3RGBA 4NRPA 1GZWB 4YG3A 4MHRA 5A80A 5IK5A 1ASJ1 1GR3A 1ZRCA 2GMEA 5L7OA 4AHZA 1BEV1 5C8WA 5A7OA 5KHKA 5JMCA 2LUWA 4YNIA 4OI0A 2BNOA 4CUAA 3J26N 5A7WA 3J8F3 3J7HA 3QH7A 4FPEA 3WNOA 1WA6X 4LO5B 2UU8A 4HSLA 5FY4A 3SCGA 2VCBA 3T3YA 3ZXDA 5FDBA 5FPUA 4QKNA 4JV4A 1QJEA 4NJ4A 4HZFA 3N9NA 2KD7A 3I2GA 5F3GA 5FBJA 2AZ5A 3WNPA 3GBWA 3TEYA 3DECA 1PVC1 2LALA 4WV8A 1WZXA 1W2AX 3P1IA 5GLVA 4AOCA 3MIGA 1VBC1 2QUOA 1V9U3 1BCXA 4C90A 2Z79A 3KCXA 3I59A 3CZUA 5IWFA 5CADA 2BBVA 4L0PA 4I30A 2DVFA 3HPNA 1R1ZA 1IOAA 3EBRA 4XABA 3ME2A 4CPBD 1OHFA 4AFMA 4L8QA 4ZU5A 4XFCA 1C8M3 3MFAA 3IN9A 4F7ZA 1O3SA 3N9LA 1PIV1 2VY0A 4MYEA 5DPNA 3OTFA 3VUOA 5A32A 4HN0A 4JHTA 4NOTA 3RPQA 3IB3A 2SLIA 4AI3A 4FXKB 5L73A 1RUG1 3S6PA 5FWEA 1NCRA 1UY3A 2P6CA 4LE4A 1CX1A 2P34A 4I3PA 1NY71 3B00A 4H14A 2ZXQA 3SC7X 1HJGA 2WA4A 3ZYIB 4PIYA 3GGLA 4COVA 2HWD2 3D6EA 3WY6A 5B4NA 1VBB1 4JTNA 3WF0A 1MACA 1VRH2 2ZGQA 2WN3A 4MGKE 5I0UA 2K9ZA 2UY9A 1VIWB 4BQ3A 3IDCB 4BMBA 2RG4A 1D4M3 4AFAA 1CAWB 1O7FA 2YC2A 3ASIA 1GP6A 3FFZA 1W05A 2W08A 3IM0A 4RSUA 4LBLA 1T6BX 1W6OA 2EIDA 2NZ9A 3KHBA 4XTPA 4YGCA 5JVVA 3O1SA 1H4GA 5D8AB 4IDZA 5CBLA 5KHJA 4KL1A 4KG0A 5F3EA 4K6BA 4MHUA 3NNFA 1GICA 2RS33 3AZZA 1C4RA 3G7DA 5FZGA 4CDQB 3O1PA 3DV8A 3WG2A 2G4IA 3POGA 1S0GA 3QLQA 3J9SA 2GC2A 4DZGA 4AF9A 3RYKA 1LHUA 4KBZA 4GQ7A 3J8F2 1LGCA 1X50A 2J1VA 2DUOA 2RR11 3CKHA 5FUNA 3WNXA 1GFF2 3P6BA 1KRIA 5F2SA 1JYVA 1IPJA 4B4QA 4HVQA 4GH4C 2AEZA 1FPN1 2X05A 1Q5OA 2VVEA 3AYCA 3I2DA 3RNSA 4LBNA 3ZXAC 1PMIA 3AP7A 4ONUA 5SV8A 2XJSA 3ACGA 1B09A 2HWB1 5GZCA 3VBFB 4AQSA 5A3UA 1SCRA 1WMEA 1QEXA 1ZRRA 5FWJA 2VZPA 3FN9A 1O91A 3HQUA 4XOGA 5FZ6A 1V9U2 5CKNA 4S2DA 2RDQA 4IL7A 4A3ZA 1GWLA 3VKLA 1DP0A 2VZ3A 2IVJA 1OMIA 1OA3A 5FMBA 3Q8FA 2TUNA 5B2GB 5LB6A 4AEDC 4ZHNA 5FYIA 4Z92B 2E7AA 4Q4X3 4F8AA 3RI8A 3C7GA 4RS5C 1G9BA 1RL3A 3HIFA 4IGQA 3K75B 1XQNA 5J1XA 1C8M2 2AENA 3JD71 3NV4A 3ZOIA 3T0AA 4A41A 5FP4A 3SISA 1GNYA 1XB9A 5BY5A 3H3LA 3I2KA 5C4WC 4WVZA 3ZX7A 3KB5A 4Q29A 5A3OA 2GNTA 4ZXKA 1I9RA 3UJOA 2A6YA 1EV13 2PHUA 4GMP1 5BPXA 5BV6A 3PU3A 5FPBA 4K8FA 4FFHA 1S2EA 3K2OA 3N36A 4JGYB 5A3LA 5C9AC 3ZMOA 2J42A 1NA1C 2YU1A 5D8AC 3T30A 3VZJA 3NV2A 5C71A 5JXGA 2VOKA 4S2HA 1D4M2 5LBBA 1H2LA 1K5MA 2BDRA 4CUGA 2RDRA 4Q0PA 1HDKA 1XNAA 1ZBA3 4R9AA 3ZXKA 2YU2A 2E6VA 4E9KA 3ZPYA 4AZZA 1C8NA 3ZSKA 5LEKA 5FRAA 3ZR5A 1WD4A 2LW8A 2RS32 5JSRA 1R1A1 2WR9A 1IG3A 4XZPA 2QQKA 3S7IA 5C5UA 4P9JA 4FPKA 2RMU3 1ZZ6A 3M4FA 4NRQA 2XXZA 3ZN6B 5C3OA 1UD1A 5FY9A 3JQWA 2ZEWA 3CJIC 4QDSA 2CHHA 2PAEA 4GWIA 2JECA 2DUQA 4FTSA 3NNJA 4CPBA 1I3HA 3USUB 5JIUA 2N7GA 5H9PA 1W3VA 3I3MA 5JR2A 2ENRA 5EFUA 5T5JA 5I0TA 1SPPA 3OOXA 4QMAA 2OQ6A 2O8OA 2D6KA 4M4PA 1RHI1 1OOPC 4C0BA 1MEC2 5G05L 2E63A 2Z2SB 4Q27A 1O3TA 5FV3A 4CDXB 5FPXA 3U14A 1O5UA 2VR4A 1QU0A 4EROA 3CBNA 5JCTA 1KFXL 3GF6A 4AGGA 5L19A 4IETA 3VBOB 1UU4A 1UAIA 2WZR1 3WW2A 4DOUA 1PO11 4Q4X2 4MV2A 3PTYA 4QT6A 5BNPC 2YC4A 1GOFA 1KDMA 1W8HA 2PHTA 4FTEA 1UU5A 4BIFA 2Q30A 2D93A 3B9CA 1MZEA 2YGLA 3O0XA 4HG6B 1CAUB 2LS6A 3O1RA 2FCVA 2VXJA 1FX5A 3JZVA 5FZ9A 5T55A 1J83A 3QACA 1QY4A 5A1AA 1FT9A 1JUHA 1Y9MA 4XEZA 4W50A 1JH5A 3MEPA 3NJVA 2FDIA 2P1BA 4P5HA 4IERA 2QNKA 2I45A 1Y43B 1DIWA 3FLPA 4EWDA 4IEQA 1IPSA 4FPOB 3U0ZA 5DAXA 3POWA 2A6ZA 3MPPG 5LY1A 1TNRA 2BOJA 5DDJ1 1YLLA 3WUDA 1PGL2 1ZBA2 3BB6A 3FHIB 5K0UB 4SLIA 4YFWA 4QXBA 1Z78A 5JR7B 1RUI3 5J37A 3K4AA 2JDKA 1RIRA 1MPXA 4ZU4A 5I93A 1XSQA 1DU3D 1QQP1 4O7XA 5JOZA 2CWSA 4A4AA 5J09A 4YRDA 1OURA 5KHHA 1PX3A 3CIHA 2DWRA 2PLV1 3PVNA 1WBLA 3PIGA 5FMDA 1Y9QA 4CDWB 2Y8KA
chains in the Genus database with same CATH topology
3WDYA 1CX4A 4KQ7A 3AYDA 3ENRA 1DHKB 1OPMA 1BJQA 1QGLA 2WSUA 4V1PA 2VOVA 2R061 1N47A 4R4XA 3ZN4A 1IS5A 3CEWA 3MDPA 5CNAA 1RUD3 4Q4W1 3WW3A 2VG9A 2YHJA 3GHMA 3JQXA 1RC6A 5JPNB 1MZFA 4META 1OFNA 3RJ2X 4Z2WA 2D6OX 5ABJB 2WQ4A 1IGOA 1ND2A 1QKQA 4A2UA 1HXS1 5JPMB 1CJDA 4KH9A 1YI9A 2ZGMA 5FO9B 5I0RA 3UKTA 4IV1C 4LO4B 3ZO0B 1TME3 5JZGC 4INDA 4JRLA 1RUJ3 1OSGA 2ZGSA 4RHV1 3EXUA 3LB9A 4QQLA 2FMDA 5KXEA 2XL7A 1G8WA 1GANA 1VBE2 4EWEA 4GXLA 3VL8A 4YW2A 2GN7A 2NP0A 1X7NA 1CAVB 4MX3A 1ZZ7A 4COWA 4GIQA 5CA6A 2R042 2RJLA 1B35C 3BODA 5K0UC 1OA2A 2QZ3A 2ZGOA 1PO21 3KT4A 1AJKA 2NYYA 4GA9A 4MGZE 4UBGA 2Q1ZB 4EN6B 2NN8A 1W6PA 1FMD1 5KC5A 1W6MA 4WM8C 2DCJA 1ZVFA 1AL22 3TAYA 4IEUA 1JUIA 4ATEA 4GULA 4MLOA 1LESA 4GH4A 1QHDA 3FJSA 3PVEA 4QQHA 1SLIA 4WVWA 2WSVA 3ROUA 4YW4A 4BPZA 1N1SA 4FPGA 3QBQA 3D0SA 4MVTA 5ACA3 2VNRA 4Q0VA 3MIEA 2EVXA 1U5IA 2O0OA 2MPFA 2JEMA 1QOOA 2XL9A 3R05A 1QJX3 4LT5A 4HFSA 1S0EA 3RQ0A 2VPVA 1VBA1 3WQ0A 1Z7S1 2YGMA 3O7OA 4M0NA 3E5QA 2D43A 2AUYA 2E7TA 1O3QA 2P17A 1RTVA 2ZZJA 3AKRA 1FAYA 2VVDA 1QMJA 1VJ2A 1UPIA 2WFF3 2LM3A 2ZBJA 2XKOA 3VZMA 3MYXA 4XFFA 3VBUB 4P9LA 1PM7A 3VDDA 5C4WA 1Q8SA 5JIAA 1AYM1 1OI6A 2D6LX 4LLFA 1ND3B 3I59B 2A6WA 3ZYGA 4LE3A 4X6QB 1TME2 3TN91 5C9AA 5JOWA 2DF7A 3WT3A 1RUJ2 4R4ZA 4H7MA 2CY6A 2EAAA 1RUNA 3DL3A 1NLSA 2R0HA 3ZFFA 4Y22A 4FO9A 2BQPA 4LO8A 4MGYE 1BKZA 4ITCA 2OVUA 2YY1A 4I02A 4IV3B 3LWCA 2X5IC 1Y3TA 3ZXFA 4P9WA 2QZ2A 4YM0A 1HRI3 2IC1A 3AJZA 1H2MA 4D7SA 1AYN2 3ZVXA 4CP0A 4XBNA 3H7YA 5C33A 4TYSA 5ACA2 2DVBA 4COYA 4E27A 2KM2A 1WLWA 3APBA 3D5OA 3L2HA 1QJX2 2F6BA 4FAHA 4MXWA 1D4VB 1W6QB 4UXAA 5KXDA 1BK1A 3MIFA 4BCUA 3KCYA 1SLBA 4NR1A 1W39A 2ZKLA 4HKLA 2ZGLA 3M70A 1EAH1 3W9AA 1ZZ9A 4AEJA 2GH2A 5HBAA 4J6GA 3PJQA 1KJLA 5AC91 4OHYA 1O4YA 1OPOA 5GZGA 1ND3C 1QJY1 4FCAA 4WBBA 1WMDA 1Y7BA 4CEYB 4AG4A 3DN7A 3N35A 1AX1A 2HWC1 4Q0UA 2VW1A 4UW5A 1R082 3MLJA 3NO8A 3O0VA 4YVSB 5HCAA 2Z42A 4N53B 4E2SA 2JXAA 4K40A 4AXOA 1WW6A 1BXHA 1QDCA 2DURA 3VZOA 4BH9A 2GC1A 3WQ7A 1QNWA 4Y1ZA 2UWCA 4BWOA 3SH5A 4I0AA 4QD2A 1HLCA 3KQRA 3HT2A 3ZIWA 4DRVA 3OCPA 2DCKA 3IPVA 3MLLA 2ZA9A 5FLIA 4DQAA 1BZWA 4XIKA 2A73B 4QQ2A 4Z82A 4LA2A 4PDWB 3R4DB 3KT7A 2OUHA 1G6NA 1WCKA 4MZUA 1IKQA 4DB5A 4QPGB 1CQ9A 4LBMA 4LNVA 4XJWA 4HKOA 3ILNA 3VBSB 3VHPA 1UZYA 1HW5A 4JGZC 2XJRA 3ZFEA 3WP4A 3ZXLA 1HRI2 2RM23 5BNNB 4L97A 1QJZA 4GB32 3IDEA 3ZYJB 2WINB 3OPZA 1DGRA 5K7PA 1SLLA 4X6RB 2PHRA 2CGNA 2MEV2 4M3CF 1ONAA 2Y0OA 3HQXA 1AR83 3D82A 4I3GA 5IK4A 4RQPA 5DUUA 3DPRA 3RS6A 3R0RA 2H6BA 3WCSA 4XFHA 3RZZA 4YVSC 4ZU7A 5GLWA 5LK5A 3JU9A 4KGGA 4KWLA 4I09A 3OYWA 3AYEA 4AEMA 3D0JA 3O14A 4H7LA 4S2FA 5I8TA 1H1MA 2JICA 5E8AA 2A7AA 1C1LA 4FQ4A 4AI1A 3OBRA 3POYA 3HMYA 1XE8A 2JE9A 3D4KA 1IQAA 1DQ5A 3IT8A 4Q4Y3 3ST7A 2WKKA 2V09A 1PGSA 2ZMLA 1B35A 1POV0 2D97A 1RUH2 1VR3A 4N43A 3BPZA 2JJ6A 1HQLA 2JG9B 4PDWC 4RR3C 2Z69A 4PLNA 5C8CB 4OHWA 5JI9A 1JBCA 2RHPA 3L2YA 4OI4A 2MNGA 3WG4A 1SQ4A 4BHPA 3VZNA 1PK6A 1R093 3R6SA 5CFCA 1ZZCA 3FFQA 4LEJA 2XH6A 3ZIXA 3RSJA 2YXSA 3B01A 1WD3A 3WINE 1RUC3 1RUE3 5FREA 3V0AA 1HX6A 4I2OA 1V6MA 5I0SA 3H8UA 2PAKA 4IXLA 4FBFA 3WP5A 3LA7A 3PLQA 3R4SA 1TMF3 5DUWA 3WW4A 3I54A 5T54A 4CRQA 3H7JA 4J1XA 1VRH1 2QFEA 3M3IA 1F5FA 1APNA 5KXBA 1YHFA 1AR82 1MR5A 3AFGA 4XFGA 4YW5A 1YRZA 5GALA 3SH4A 5SV5A 1RVF3 2VQ0A 2WWSA 4XDQA 4OI1A 1HRV3 3WDWA 1PZ7A 3RWNA 2WLQA 2X29A 3ZFGA 4HT1T 4DFSA 2A71A 4PQ9A 2BWCA 5DZFA 1YIFA 5GLTA 3SXWA 1WA4A 2VUAA 3WG3A 1J1TA 3TRSB 2YV8A 1ND2B 2DTYA 4Y1XA 3PHMA 5BNOC 2PTMA 4AI8A 3M1HA 1POV3 4ISRA 3QH6A 2JG9C 1GZCA 4R52A 4PBOA 1RINA 5KXCA 1DQ4A 1CD3G 4WM7C 4D3WA 4KNCA 4LLOA 4ASLA 5F5QA 2IXLA 2XLGA 5FCCA 1V9U1 2UURA 5KBFA 2ZHMA 3W59A 4AYUA 2BVBA 3FUQA 4YG0A 3RYRA 1E57A 1QJU1 1XNDA 2ZGUA 4D69A 1JHNA 2A3YA 4DXZA 2C1FA 1AR63 5A3MA 1R092 2CAVA 1XNCA 1RUF3 4XBLA 2ETEA 1C8M1 5JOXA 2WLPA 4OUMA 1REFA 4XJZA 5FFOC 1VP6A 1ASJ3 2A6XA 1RUE2 1BEV3 3M3CA 1NYWA 3N7JA 3VGIA 3V0BA 4BA6A 5T50A 1PVXA 1W2UA 4FOQA 1TMF2 4KWKA 4YLZA 5D1IA 3W58A 1JN2P 4XJ8A 4XYXA 2ZZQA 3VZKA 3CNAA 1S0IA 3K48A 2HWE1 3AKTA 3AMMA 3O12A 1LU1A 1D4M1 2ZCWA 3U07A 2PYTA 1XXNA 4NO4A 1PVC3 2HWF2 1RVF2 2R6QA 4AVCA 1IZ3A 1WUVA 4QPIA 2RS31 3Q9OA 2KXLA 3ALQA 3NAPB 1Q3EA 1QXJA 4B4PA 1J3QA 2CNAA 2WC2A 4XF3A 2WNUA 2XG3A 5FOJB 2EXKA 2DTWA 2EXIA 1BYHA 2SBAA 5CAZA 4LHKA 2DYCA 1U5ZA 1ZZBA 2G9FA 3VDDB 3ECQA 2DVDA 1PIV3 2FZ2A 5HXVA 2YUEA 5BYNA 1YI7A 1RUG3 1L3JA 1AX2A 2WS91 1GQHA 1F2NA 2BNNA 2PN5A 1MEC1 3LAGA 5IT6A 4COZA 2WNEA 1VBB3 2RJKA 2BFUL 3GBGA 3ZFFB 1COV3 4Q4X1 5GKAC 1AR62 1QXPA 1RUF2 1YJLA 3JBG1 1CJPA 5H9QA 4YM1A 5A33A 1REEA 3C3VA 2X53S 1G86A 3PMEA 1F5JA 2JG8B 3H9AA 1BEV2 3KLSA 4JDNA 5GM0A 1KS5A 2HKXA 2X8KA 4Y26A 1FPN3 3KMHA 3KGLA 1AR73 3MICA 3V65A 5E88A 3ATGA 1PGL1 3LSEA 1ZBA1 2HWB3 3WDTA 3B7MA 3WDXA 4LULA 3CF6E 4W6WA 1H30A 4D7TA 2Q4SA 4CDQC 1XU2A 4FQZA 4NWVA 5CVRA 5C6CA 4H3WA 1LGBA 2E53A 1YIPA 4QGNA 4XJAA 2UY8A 1PNGA 1C5HA 1OLRA 3JD73 3PJYA 1W0OA 4XXAA 3JCIA 4OZXA 4AFDA 4OI2A 1VALA 4R9BA 4JQRA 4XJ9A 1W6NA 1SBFA 4GMP3 4DNYA 5J48A 2ZHLA 1LEDA 1DGWA 4N7IA 4BE3A 1LULA 2P2KA 4E2GA 1F9KA 3VBFC 4JDMA 4Q0QA 2GC3A 4JCKA 2V73A 1VBB2 2C0ZA 2WL1A 3CJXA 4XJUA 1KQRA 1F31A 1COV2 1S0JA 5GLUA 1MQTA 1SLCA 4CEWA 2EALA 1ULCA 4F83A 3WHTA 1GBGA 2KA3A 1WW5A 3IPVB 1DQ0A 3ILFA 3BOPA 2R1BA 3N7MA 4RD7A 2EAKA 4DMIA 3PMSA 3KGZA 4QM8A 2BW8A 3SNMA 1WLTA 3T1LA 1DLLA 3NSTA 3VBHB 5AFBA 3LOIA 1MS1A 3S7EA 1UW8A 1VBE1 1FOD3 1I5ZA 1Z0HA 1EPWA 1AL0G 3MGUA 3OD4A 5FMOL 4CDUB 1ULEA 4JAAA 2JD4A 3OF1A 2WNVB 3ZFEB 1U5XA 2EXJA 2R041 3ZSLA 4JGYC 3TNPB 2D44A 3FBYA 1A3KA 5CFDB 1AR72 1EV12 2BVVA 4YVWB 5KHIA 3RG0A 3VBRA 4YFZA 4FOYA 1LOFA 1V6NA 1AL21 4IESA 4U2AA 3CO2A 1RHI3 4XQ4A 5GZEA 1ENQA 4L9BA 3FBMA 3DPRB 2ZS6B 1SFNA 5DXDA 5BNOA 3AMQA 3QD6A 4Q0SA 4RGGA 1LOEA 1LHOA 4NPRA 1T6GC 2ZPXA 2WZR3 3WP6A 2P3IA 1PO13 2Y0IA 4SBVA 2IXCA 1LGNA 2XVGA 4WM7A 2VXRA 2JKBA 4XILA 4QGMA 5J36A 5JSOA 4K9SA 4LBQA 2GALA 3MF9A 2ZX0A 4ASMB 1V6IA 2RMU2 2Q1MA 2EXHA 1OFSA 4N90A 5E1RA 1I1EA 3M8LA 4XE9A 3TBDA 2FMYA 1N1TA 1MVQA 1PHMA 4FP2A 4XF1A 3FMGA 4NWWA 1VBD3 4TSVA 3H50A 4XTMA 5T5PA 4CDXC 3J4UH 1JYCA 2XBO1 1OLQA 1TNFA 3VBOC 5DDJ3 5DG1A 1MS5A 1O4TA 1LENA 1LU2A 2Q0AA 1TME1 2NMNA 2D98A 1ZZ8A 1PK6B 4CDUC 1H8TB 1Q8QA 1RUJ1 5CFCB 2W0XA 1OD5A 1QQP3 4OHVA 2VMHA 2JDZA 4M0HA 1MZ6A 1X8MA 2ARBA 4H55A 1FOD2 4L11A 2PLV3 5T3NA 3MW3A 3QOPA 4IEVA 3R4UA 5EJ3A 3V0AB 4PCRA 1DYPA 2ZHNA 2PAMA 3ETQA 4HETA 1BVP1 4Q4V3 1DQ6A 1CN1A 1YFUA 2G9GA 4G4FA 2GNDA 2R063 3UL2A 1ZM1A 4Q4W3 2FBEA 1S0DA 3I8TA 3ZMNA 5IUQA 1QOTA 4FPFA 1RHI2 1C5IA 1GZ9A 3AP4A 4Z07A 1AYN1 1HXS3 4RGAA 5ACA1 1BVVA 3UKVA 1MS4A 3ZFGB 2ILMA 2XWBB 1NCQB 1KDKA 4CDWC 1C3HA 1RUI2 3M3OA 4WVMB 3B94A 2VNOA 4ISQA 3VHRA 4QX5A 4YZ2A 5KHGA 2UYAA 3POSA 4Q1PA 4Q4Y2 5L7OB 1CVNA 4XETA 2AREA 1X36A 2XB6C 2D3RA 4EN7B 5GJ6A 4YW1A 1BBT3 1KXGA 4OUSA 4P14A 4AVBA 3KS7A 2XJVA 1UKRA 1WBFA 2GU9A 1VBD2 3MLKA 4L99A 1R081 3AP6A 5ABJC 1PO23 4AEDA 1YFWA 2VECA 1AHSA 5TSWA 1RUD2 4A7KA 1FMD3 4O9GA 4RS5A 4OULA 2VNGA 5DDJ2 2P3KA 3AB0A 1YO8A 3VKFC 3DF0A 3EHKA 5LK7B 1ULDA 1KD7A 1XYPA 4XIOA 1QQP2 4LTAA 2R49A 1WCSA 4XQDA 4AVAA 2PLV2 4XFAA 1CPNA 1CAWA 2XUMA 3FUOA 3IMNA 1ULGA 4D94A 1DZRA 4M3CA 3VV1A 3AJYA 4YGBA 4Q4V2 1NA1A 3WX5A 5D8AA 1VBA3 1XYNA 1FYUA 3HWJA 1Z7S3 1S55A 3VHOA 1H8VA 4FPLA 5A32B 4C1WA 4CDQA 3TB0A 1IS3A 4IEZA 1Q56A 1DDLA 1TEIA 5FLHA 5GLZA 3VKOA 1IPKA 3A0NA 1NCRB 1ZNPA 2ATFA 4LR4A 3PNAA 3N7KA 4MH0E 1XYOA 4GB31 4C1XA 2BUKA 1AYM3 4RA0A 1WMFA 5J7MA 1W0PA 3CJIA 3UV9A 2MEV1 1YNAA 2WNUB 4MSVA 1W6OB 2WFPA 2GAUA 3TN93 3USSA 2JENA 3VBFA 3IKWA 2OYZA 4GWNA 2HYKA 1OA4A 3ZSJA 2VH9A 3VLBB 1QH7A 4D7YA 1RUOA 1OOPA 1BBT2 4KGQA 2XJPA 3AXDA 2BPA2 1AXZA 3WG1A 2D6MA 2V5YA 4BQ1A 4COUA 3GNEA 5H9SA 1ZREA 2A3XA 3T2TA 3VBUC 1GKBA 1LOAA 2PHLA 2XKPA 1YUDA 4AGRA 2DCYA 5BNPA 3AP5A 4FPHA 2D6PA 3BALA 3JB4C 5KWRA 2WFF2 3BU7A 5FTTC 2DVGA 1REDA 2XVKA 4AQ2A 2WIIB 2I07B 4IQPA 4FOWA 1RUH1 2ZABA 4E4DX 2ZACA 1JOJA 2B7YA 2ZX3A 3D8CA 4PIZA 5A33B 2R071 2F4PA 1SEFA 5IK7A 4AFCA 1NXMA 2HJIA 3RRDA 5T5OA 1XNKA 5FLJA 1PGW2 1WW7A 5JLVA 4B8EA 1TE1B 2RS11 4K7JA 4A7ZA 2D7FA 4EN0A 1JXNA 4LHNA 3HN1A 3ACLA 1I6XA 4IV3C 3RJRA 5AC93 3ZN6A 2Y26A 2AGSA 2RS53 3IDBB 1QJY3 4LUKA 2Z5WA 1AR93 2HWC3 2ZGRA 4B4RA 1H1AA 1RMU1 3HD8B 1K5MB 5FO8B 5FQ0A 3VKNA 1A8MA 4Q1RA 4IEOA 5EYYA 1O4ZA 1QXRA 3URFA 4DRRA 4XFIA 4PLOA 1VB4A 2A6VA 4OHZA 1LOCA 3JUUA 1CGPA 3E5XA 3SMHA 2ZTNA 1ZBE3 2VOWA 1XRUA 3MPBA 1O3RA 3WVJA 4YARA 1GYKA 2K2SA 3OJBA 2XPJA 4C0HA 1HQNA 3AKQA 5JWPA 2WQZC 2B5HA 4CEYC 1AX0A 2CV6A 3OGJA 5F6KA 4DY5A 2HEVF 4IV1A 4ES9A 4OFGA 1LEMA 3MFCA 4FVVA 4N53C 3TWIA 4I0WB 4K20A 1MQTB 5JZGA 4CEWB 3AX4A 3GZAA 4P9IA 2MHFA 4NN0A 2TNFA 3M7AA 5EV7A 4PF5A 2ZAHA 3LSDA 4XW3A 3U11A 2ZGTA 2R16A 1DGWX 1VLNA 3L9JT 4YZ5A 4HPKA 4AK3A 5HCBA 1GNHA 3DUIA 5K0UA 3AZYA 1X8EA 3KT1A 4S2GA 2ES3A 4NHLA 4MXVA 4WM8A 4ES8A 3N4MA 4L2NA 3AXEA 5AC92 4QPGC 3ZSMA 4CDWA 3E6CC 2VMIA 3VBSC 2RS52 2XWJB 1QJY2 2PA7A 3GYDA 1D2QA 1SBDA 1AR92 1LCLA 2CWMA 1TMF1 1QDOA 4X8NA 5BNNC 1V6LA 5AFEA 1J59A 2DCZA 1KITA 4AHYA 2DFCA 1GNZA 1FV2A 1UPSA 4M00A 1SMVA 2RM22 1YCIA 2DU1A 2VOXA 4AEKA 3AKSA 4LUMA 1G9AA 3MIHA 5F9TA 4U36A 2HWF1 2QKDA 1RVF1 1MS0A 2HWD1 3U4XA 5JOYA 1H2NA 1UIKA 4IEXA 5FBZA 1V6KA 1ZBE2 3RMXA 3VL9A 1XE7A 3AZVA 1RB8G 4WZFA 5K9YA 1A6CA 4QPYA 5DG2A 5JSPA 2ZX4A 1N3PA 1UU6A 3E5UA 1V6JA 2P37A 1NE6A 5BUVA 3WCRA 4AVTA 4HLTA 1POV1 3J8F1 3IIAA 4HN1A 3HT1A 1SDWA 2R32A 1DGLA 4DINB 1S2BA 2PHDA 4X8PA 2XJUA 4XMAA 1VRH3 1AXKA 3HBZA 2CGPA 2YPJA 2A75A 3JB8A 5DZGA 5C8CC 3O5SA 4YGDA 3ZXGA 4DY3A 4P9GA 2CYFA 2BFUS 2X5IA 1G9CA 3B3QE 4AE2A 4LBKA 4TZDA 3THPA 1MVEA 2NMOA 4YZ1A 1MS8A 1QOSA 4KBBA 5FAXA 4IEPA 5T5LA 3S30A 4AVVA 3KZ4C 2VMGA 3MZHA 2GMPA 1MS3A 1XU1A 2NM1A 3BCWA 4HVRA 3PVBB 1W6PB 3EJKA 1G7YA 1RUC2 1W6MB 2XGXA 3FLTA 3GZTB 4I0BA 1VAVA 1CAXA 4GH4B 3B93A 2P3JA 4CZSA 4FTBA 3BIWE 4Y20A 1A8DA 3VBUA 3I4IA 3P3PA 1D2SA 2PHWA 3E6DA 2JE7A 5EYXA 5E89A 5JAXA 3OD0A 1ND3A 4YSFA 5I8YA 3ZYPA 2ZGPA 1QJU3 1D0GA 1HRV2 4Y24A 4XFBA 5J3UA 1M06G 3WUCA 1VBC3 2ZKNA 1LHVA 1KFUL 4W6YA 4AEDB 1NZCA 2Q5TA 3DGTA 3MI8A 1ND2C 4LHLA 1VAMA 2VU9A 4MGIE 4RS5B 2D6NA 3ZYRA 2R1DA 1GLHA 3IWZA 1IHMA 1JTZX 1S2KA 5F1RA 4QXKA 5H9RA 3HR9A 4N9IA 2EIGA