5FDBA

Iron free rat cysteine dioxygenase r60qc164r variant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
b'TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTQNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTRHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron free rat cysteine dioxygenase R60QC164R variant
rcsb
molecule keywords Cysteine dioxygenase type 1
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fdbA00
3QOPA 4Z07A 3KMHA 3USSA 2QNKA 3WW1A 1YHFA 4AQ2A 2BYVE 4ONUA 1UIKA 4PIZA 1FT9A 4Q0VA 3I59B 3H1WA 1YLLA 2ATFA 3DL3A 4HSLA 1SFNA 2PA7A 3EJKA 1CAVA 4QGMA 4BHPA 4Q0PA 5BUVA 4IEQA 3IIAA 1CGPA 4NVPA 2F4PA 2Q0AA 3RDIA 4P9GA 1TQ5A 1LRHA 3EQEA 3I7DA 2MPFA 5JSOA 4GULA 1YFXA 4IEWA 4QGNA 3ZDSA 3PLQA 4E2QA 3O14A 1CAVB 4WBBA 2IXHA 4JTNA 3RYKA 4IEZA 3JZVA 2PFWA 3DV8A 5F1RA 4WVZA 1ZX5A 1OMIA 1ZRRA 2UYAA 3NSTA 3SCFA 2XLAA 1EP0A 5KHGA 3GYDA 4PJYA 3OCPA 1WGPA 5CVRA 2XL7A 2Q1ZB 2CAUA 3G7DA 3HIFA 3CLPA 2K0GA 3H50A 2IC1A 1LKNA 2GC3A 4KL1A 4KWKA 2GC0A 4XEZA 3ES4A 2Y0OA 1ZRFA 3OD0A 4XFFA 5KHKA 1O3SA 1I5ZA 4IEOA 2IXIA 1X8MA 3M70A 1UW8A 1ZZ6A 1PMIA 4L11A 5I8TA 2Z2SB 4F8AA 5JR7B 3S7IA 5KHIA 3KSCA 2MHFA 5JAXA 2OZJA 4D7SA 2P17A 1UCXA 2UY8A 4IEUA 1CAUB 2QCSB 3FE5A 1QY4A 4IERA 2BEOA 3NKTA 4WZCA 4PIXA 1OFNA 4HMZA 4AVBA 5KBFA 1O7FA 2PHDA 2ETEA 1RTVA 4FAGA 2DCTA 4Z82A 3I54A 1VJ2A 1J3RA 4UBGA 4AQ6A 1ZZ9A 5FLJA 4HN1A 1YFYA 1FI2A 1RUNA 3SCGA 2D5FA 3CL1A 1OD5A 3IBMA 1YFUA 5FCCA 4JTOA 3ETQA 1Y3TA 1NE6A 5FPZA 2I45A 2CGPA 4R52A 5I0SA 4I09A 2XLFA 3PVBB 2OYZA 1ZZ7A 1J58A 4ZU4A 3H8UA 3C3VA 3D82A 3MDPA 2V09A 2IXKA 4HLTA 4MGKE 4META 4EV0A 2O1QA 2H6CA 2D40A 1WA4A 3E5UA 3KGLA 2E9QA 3FZ3A 4PIYA 4UXAA 5I93A 5FLHA 3UKTA 2QVSB 2H0VA 2CAVA 3BALA 1RUOA 2PAKA 3H9AA 4AVAA 3TNPB 3LZZA 4HVQA 3ACLA 4QXKA 4D7TA 1RL3A 1QXJA 4XF3A 4IESA 5I91A 3SXWA 2FQPA 1O3QA 5I0UA 1Q3EA 3U11A 4DINB 3L2HA 4ZU5A 2PYTA 5J3UA 4OLLA 1YFWA 1O3TA 1ZVFA 2CV6A 3TNQA 5LEJA 4QMAA 3OF1A 1RGSA 4HVRA 1DZRA 1SQ4A 3OGJA 4LA3A 4X6QB 4OFGA 4YARA 3BU7A 3ROUA 4JV4A 2XKOA 1H1IA 4ORFA 3H3UA 4O9GA 2GAUA 1H1MA 4B29A 4QM8A 2PTMA 2GC1A 4JVAA 4N9IA 4EWAA 5C8WA 3FHIB 4AVCA 1J59A 2O8QA 3FX3A 2ET1A 2Q4SA 3H1YA 2IXCA 3E6BA 3ES1A 3IWZA 1EYBA 2BNOA 2ZCWA 1ZREA 2IXLA 5I0TA 1DZTA 4Q29A 2KXLA 2EVXA 4I3PA 1LB2A 1CAWA 3M3IA 4EWDA 3CF6E 1SEFA 1Q5OA 2H6BA 1EPZA 5EFUA 4ZU7A 2UY9A 3N4MA 4MX3A 1O3RA 2XHKA 5FQ0A 5C6CA 2B9UA 4IEYA 4XETA 2K9ZA 4I0BA 3H7JA 1CAWB 1NZCA 2GC2A 3SMHA 1V70A 2C0ZA 3MPBA 3SCHA 3EO6A 3NW4A 3RZZA 5FQ0B 5EZWA 4XFBA 5K8SA 4I01A 5E1RA 1GQHA 3E6CC 1DGWA 3RYPA 4R8HA 3MYXA 4CYDA 5I0RA 1J3PA 2GZWA 1YWKA 3ST7A 1U12A 3D0SA 2WFPA 1J3QA 3S0MA 2OA2A 4BH9A 4AXOA 2OPKA 2XL9A 5BV6A 3LA7A 4I02A 1L3JA 3CJXA 1NYWA 2PQQA 4FT8A 4BIFA 5HI0A 2MNGA 3H7YA 4QX5A 3UKVA 4HSJA 3LAGA 3HT1A 1VR3A 1X7NA 1ZNPA 2HKXA 3NJZA 2XGXA 2ET7A 5BXXA 3WW3A 3IDBB 5J48A 5I8YA 4IEXA 4XFIA 3KCCA 4IEPA 3I59A 3B02A 1O5UA 3E5XA 3R6SA 5AVPA 4EROA 4HZFA 4E2SA 1CX4A 2Z69A 3PNAA 3U0ZA 2B5HA 5CADA 5BPXA 4I2OA 4O9EA 5FPXA 1I6XA 3NL1A 3LOIA 3NVCA 4KU8A 4I0AA 5LRRA 3S7EA 3RPQA 4H7LA 3HQXA 3QACA 3H3ZA 2VQAA 2N7GA 2QDRA 4FBFA 5LRSA 3CEWA 5E16A 1PM7A 4UBHA 2UYBA 4XFAA 4FAHA 5JCTA 3IDCB 1ZZBA 4YSFA 4LUKA 4L2NA 4YNIA 1ZZ8A 2XKPA 4K8FA 5KHJA 3FWEA 4MGYE 2PAMA 3FFQA 4KWJA 1ZRDA 1XE7A 3LWCA 5KHHA 4F7ZA 1RC6A 4QM9A 3RYRA 4IEVA 4J1WA 2D93A 5LEKA 1NXMA 1EY2A 2XLGA 1O5LA 3DKWA 1ZZCA 3H1MA 3OTFA 4LUMA 1X8EA 4XF9A 1O4TA 4TLFA 3DN7A 4Q0QA 5BY5A 5FDBA 4KWLA 1VP6A 4YYOA 3GBFA 1XE8A 1X82A 5J7MA 4XFCA 5T3NA 2D5HA 4E2GA 2BNMA 2Q30A 5I8SA 4XF4A 2EA7A 1QXRA 3E97A 4YRDA 4EWEA 3SHRA 3LA3A 5D1IA 3HT2A 4X6RB 5JSRA 2EAAA 3BPZA 2WC2A 1CAUA 2OZ6A 5FLIA 1G6NA 1QWRA 1DGRA 4MGIE 2BGCA 1UPIA 1IPKA 3LA2A 1UD1A 3D0JA 4BYYA 2QJVA 3WW4A 4J1XA 2GU9A 4XFHA 4A2UA 1XRUA 2GH2A 4HBNA 4LA2A 1Q43A 4LULA 4XFGA 4HVOA 1UIJA 1YUDA 1J1LA 2PHLA 3CO2A 1GQGA 2HJIA 4HN0A 2B8MA 4MUVA 1JUHA 4QGLA 1ZRCA 4Q0SA 2ZKLA 2IXJA 3RNSA 1Y9QA 2VECA 3MZHA 1CAXA 1FXZA 4KU7A 3ELNA 4MGZE 1NE4A 4LLOA 4XF0A 3BCWA 3WW2A 4Q0UA 3UKNA 2VPVA 4LTAA 1IPJA 1WLTA 3E5QA 3E6DA 2PAEA 3VHRA 3EBRA 3U10A 4IETA 4XF1A 3FJSA 2FMYA 3EHKA 3KGZA 1CAXB 4MZUA 4RD7A 4N9HA 5CU1A 1HW5A 2BNNA 5JSPA 1OI6A 3BB6A 4LEJA 4MH0E 1LR5A 4MV2A
chains in the Genus database with same CATH superfamily
1MZEA 2C24A 2NPIA 3IAPA 4Z07A 1WMFA 3JUUA 3KMHA 2O14A 1YJLA 5DDJ3 5ACA3 1ENSA 3PVNA 1YHFA 4ARXA 4AQ2A 2BYVE 4FSJA 2PHFA 3K3NA 4JC1A 5DABA 2FZ2A 1FT9A 4C91A 3LOBA 3I59B 3TBDA 1ULCA 4QPGA 1YLLA 1FMD1 1RUC3 5L7OA 3AL6A 4BISA 5GZCA 1G9FA 3DPRC 1NCRC 3POWA 4INDA 4IEQA 1LJ7A 2LTNA 5GKAC 3VZOA 3W21A 4N90A 2ZX2A 3WDVA 2XJUA 1PGW1 2YFZA 5T55A 3SNMA 5CG8A 2Q0AA 4Q4V3 4QB6A 2YPJA 1UMIA 4Y22A 3EQEA 1IS3A 1H2NA 2R30A 3TEZA 1EV12 4P5HA 3GHNA 4GULA 2ORXA 4IEWA 4QPGB 4UF0A 4UI9L 5CIRA 5FXWA 3ZDSA 5L7OB 4LHSA 2PXJA 3VBSC 2J1SA 3O14A 3RMYA 4COZA 5GLUA 2R1BA 5J98B 2G9FA 3NV3A 3RYKA 3JZVA 4YZ1A 4QKBA 1MS3A 2P3KA 1D4M2 1W6PB 2VVEA 3CNAA 4Y22B 4BQYA 2D97A 1DQ5A 2X5IA 5IW0A 3L9JT 4OI4A 4XXAA 3RI8A 1WKYA 2FDKA 3VZLA 4NN0A 4Q1PA 4BA6A 3D3AA 1W6OA 3WY6A 3POFA 5GJ6A 4TTGA 5LB6A 4JDOA 2CAUA 2ZXQA 5FK7A 5A6XA 1MQTA 3NJYA 2BVBA 5IVVA 2A71A 4UW3A 3T08A 1HLCA 2YU1A 2K0GA 2R0HA 3H50A 4XHXA 4QX0A 1LKNA 4FQZA 2GC0A 2ARAA 5L9VA 4AVTA 3ES4A 3ZYBA 1C28A 2XG3A 1YEWA 2FBEA 2X5IB 4QPIB 2ZGLA 3KQRA 4FPGA 1RJ7A 4AI9A 5ANQA 5L19A 5LY1A 1O3SA 1JW6A 4IEOA 1KGYA 2ZX3A 1SLAA 1PMIA 1V9U3 1COV1 1QMJA 2C4XA 1HXS1 4MGTA 5KHIA 2RV9A 2CNAA 2BFUL 4B4QA 2P37A 3BOPA 3C2UA 3WNNA 2OZJA 2GN7A 1OA3A 5FZ6A 3BUCA 4O61A 5F3EA 1JN2P 2XHNA 3FHAA 3ETPA 1O6UA 3ZXFA 4L0PA 1Z7S1 3MW3A 2GALA 1CAUB 3ZN4A 1VPHA 2VC9A 4PLNA 4CVUA 3N9PA 2BEOA 4IERA 4K1YA 3AKTA 1WLDA 4PIXA 2VBBA 2WWSA 5CFCA 1JYVA 3S6PA 2VO5A 4LKFA 3UT0A 4MVTA 2ZTNA 3VD9A 5LASA 4IE7A 1QJEA 1HQNA 4MHUA 2GN3A 1ZZ9A 5FLJA 1ASJ2 2ZAHA 1FI2A 1KDKA 1F15A 1BEV2 3SCGA 2VUAA 2XVKA 3CL1A 5A6QA 4Q26A 5F3GA 1WCQA 1LNSA 4NRQA 2DU0A 3IBMA 3AXEA 3ETQA 3GZAA 4LPLA 5CISA 1V6JA 3DYMA 5CFCB 4Q4X1 2VOTA 3SLIA 4N43A 5JOZA 5FZAA 1VAMA 3WNPA 5LBFA 4Q4Y1 3J7LA 1ZZ7A 5HCAA 4JKMA 4ZS2A 4ZU4A 2W94A 3AP5A 3HMYA 2XJSA 3C3VA 3DCQA 4FOYA 2YZ4A 3MDPA 3FLPA 4R4XA 1WWYA 4ZXEA 2VD7A 4HLTA 4LE4A 4BJ0A 4EV0A 2B45X 2AREA 2QQKA 2AYHA 4LXLA 2D40A 1WA4A 1B35A 1AUYA 1UYYA 2VM9A 3INAA 1SCRA 2E9QA 3PURA 4IV1A 4FP3A 4DEQA 5C7GA 1AR73 4N43B 1SLBA 2HBTA 1IKQA 1DQ0A 4FQ4A 3O12A 1LECA 1UXXX 4LKDA 4ES9A 3WP6A 4RGGA 2QVSB 2VTFA 2H0VA 3OD4A 2DF7A 2CAVA 2HWC1 4XYXA 5BNQA 3A0KA 3POIA 1N47A 1Y43B 4KG0A 4LBQB 3H9AA 5IVBA 1CPMA 2A6YA 2BFUS 2ENRA 2W46A 1OSGA 3BTZA 3MFCA 3ACLA 4IV1B 3B9IA 3I4IA 4CP9A 1YIPA 3NQHA 3WUDA 5BNNC 3LSEA 3E1F1 4KMQA 2Y6JA 2IVIB 4FPYA 2WLPA 3B00A 1O3QA 2WNUA 1A6CA 1OQDA 2R1DA 5I0UA 5ANNA 3C7OA 4E27A 1W39A 1AYM2 3VB9A 4FP2A 4DINB 3L2HA 4ZU5A 1W9WA 5F2WA 5J3UA 4OLLA 1W8WA 3P3PA 1VLNA 3EYPA 3KT4A 3V64A 1I9RA 3GNEA 4ARYA 2RVAA 4A3XA 3EB7A 3LPFA 4LO6B 5GZGA 1VMHA 3OF1A 4KI5M 4CP9B 1G9DA 3IT8A 3ECQA 4N8MA 3AJYA 4A42A 1DZRA 2W91A 3OGJA 3LE0A 5C3QA 1O8PA 3PU3A 2WNUB 4PI2A 2D6LX 4JV4A 1BQPA 5IK8A 2XKOA 1JYTA 3Q8FA 4NHKA 1PZ9A 3I3DA 4IE6A 4M3CF 5C3PA 2QFEA 1ND2A 3WG4A 5FPAA 2PTMA 4PLOA 4AF9A 2AEZA 4GMP1 2D6OX 3W59A 4N9IA 2ZEWA 1RUD1 3ASIA 4DRRA 1R091 3HD8B 3FX3A 2ET1A 3LDBA 1HB3A 2WBKA 2IXCA 2UWBA 4CCLA 1XQNA 2PHTA 1HB4A 4HONA 1EYBA 4NR1A 3R4DB 4DQAA 5FP9A 5L73A 3A22A 4DOUA 1JUIA 1VBE2 4YW1A 2ZCWA 5FKBA 1XU2A 3ZXGA 2JG9A 2VGDA 1GZTA 1W2AX 5I0TA 2KXLA 2P4EA 2YBPA 4YW4A 1H6XA 1JXNA 3CF6E 1YQ8A 1AR82 2P6HA 5F8PA 4XJUA 1D0GA 4ZU7A 4MX3A 2XOMA 1RUH3 3ZVXA 1X33A 1ND3A 4IE4A 5C6CA 1YJKA 3TN92 2OVUA 4RQPA 3ZN6B 2JE9A 4FFGA 4Y5Z0 1AR91 1NZIA 3MW4A 1N1SA 2JG9B 3VBOA 1SLLA 5A33A 1SLTA 2GSYA 5FWJA 3C7GA 5EHDA 3ZYFA 1JTZX 1WD4A 3CQOA 4MHRA 3CIHA 1LEMA 1NZCA 2WZR2 3WF3A 1ZBE1 2VOKA 1DHKB 1YIFA 3KV6A 3OJBA 3PUHA 3RZZA 5C5UA 1FPN3 2JEMA 3I3BA 3M4FA 4FO9A 1WCKA 5CG9A 1GQHA 5F3IA 4RQPB 5T54A 4YZ3A 1A8DA 2XPJA 4ZZ8A 1REDA 2HWF2 2WLQA 1OD3A 3C8XA 4D94A 3VBHA 1J3PA 2Y6LA 3C7FA 5A33B 5HBAA 5LZ6A 1U12A 5DAWA 5GZDA 3D0SA 3L2YA 5FYBA 1OF3A 2PHRA 2WFPA 4N53A 5A70A 4Y4RA 4BH9A 3BIEA 2B9VA 2CDPA 2DVGA 1VRH1 3LA7A 3B69A 1POV3 4I02A 1ZBA3 2RJKA 1RUJ2 3GDBA 4IGQA 2HWB1 3AX4A 4IW3A 3LQCA 3OGGA 2W87A 1C5HA 1V6KA 4GWMA 3RWNA 5IAXA 5GLWA 1DYOA 5AFEA 3VBHB 3SC7X 4XABA 2RS13 1JZ4A 3H7YA 3UKVA 2Z79A 4TYSA 4YVSA 4QKDA 4XW3A 2WFF3 1X7NA 1XSRA 4K6BA 3LCPA 4N53B 3WINE 1YRZA 3NKGA 4IXLA 4AGGA 2WRAA 1NOVA 2JB4A 2QQWA 2VQTA 4P08A 3WDXA 5I8YA 3WXPA 5FP3A 5LRSA 2R042 2VXJA 3RRDA 1SACA 3B02A 3MW2A 4AVSA 1NLRA 3JQXA 5CKNA 1L7LA 3TYJA 1US2A 3NJXA 5D21A 3A23A 4QDQA 1VALA 1PGL2 3UNPA 4DY5A 1VBC3 1MVEA 3NAPC 4HL0A 5JUVA 3O1PA 1ULDA 3AYDA 1SZBA 4E2SA 2W92A 4YVSB 1MS8A 5KC5A 2Z69A 2WR9A 1CX1A 2WSVA 5JPMB 1R1A1 3BTAA 4UWDA 1WA6X 2DBIA 2XDVA 2CL2A 1W8TA 3URFA 1UKGA 1RUI1 1AXKA 1FYUA 1PIV2 1RMU1 4I2OA 3RI9A 2AH2A 3DXUA 4XOGA 5CFDA 3UGHA 4CEWC 5A7PA 3LOIA 3ZIWA 3PDQA 3PMEA 1VBA3 1X9PA 1XYPA 2JIGA 3ZXAC 4QQPA 4NIAA 2ADDA 3NNGA 4D7YA 2GNDA 4G4FA 4ES8A 2Y33A 5LRRA 1KRIA 1EAH1 4UW5A 3QACA 5FPVA 1STMA 2E32A 1P8JA 2BERA 1WMXA 2X8KA 5FREA 2RJLA 5C70A 3B7MA 4HANA 5E16A 4AK3A 1PM7A 1KFXL 1E5IA 1US3A 3IDCB 4BCUA 4CDXC 4XJWA 1AYN1 5CFDB 1ZZBA 4Y5TA 4YSFA 2W0XA 4JRAA 4L2NA 3LIGA 1ZZ8A 2RM21 3VL8A 5C5TA 4K8FA 5KHJA 1U5IA 2PAMA 2WS93 2FHRA 4XIOA 1N3QA 5E8AA 5GM0A 4H55A 2W39A 4CEYC 2KR2A 4DXRA 1XE7A 3N7LA 4AQSA 5FO9B 1FOD1 1PO23 5EPAA 5K9YA 4BQWA 2D93A 4GD4A 3O1MA 1PO12 4XE9A 1XPWA 4EQVA 5A1LA 4YVWA 1EY2A 4CDUA 5C9AA 4W4ZA 3H1MA 1ZZCA 3I8TA 5F32A 1CJDA 1O4TA 1OOPA 2CWMA 2B46X 4Q0QA 2ZMNA 5BY5A 5L36A 4PF5A 5APAA 4DB5A 4KWLA 4CU8A 1PMJX 3N9OA 2KD7A 4JGYC 1OF4A 3MO4A 2YYOA 2VZ3A 2VTXJ 3N36A 1W99A 2IUWA 1XNDA 4WVVA 3FHQA 1S2BA 1QJY3 1W05A 1JODA 3WVJA 4CPBA 2JX9A 5JR2A 3DECA 3OBZA 4C1XA 4A7YA 3WQ7A 3FMGA 4LO5B 4CPBD 5C9AB 5JIUA 4LK7A 3WHTA 4OI0A 2WA4A 3ABZA 5FYUA 5BNPA 5D1IA 4ZHNA 4A6SA 5JSRA 4ET7A 2R063 1QDCA 3FBMA 3W9AA 5FLIA 2XBO3 4M4RA 2BGCA 1NLSA 3AMHA 3LA2A 2QQJA 1UD1A 3D0JA 1UO9A 2FDHA 1BBT2 2LUWA 3LSDA 2YBKA 3I49A 2EF6A 1NKGA 2PLV2 4CDWB 3RG0A 2VE1A 1QEXA 5BNOA 1SPPA 2JG8C 2ZAAA 4QB1A 2RR13 5FMCA 2W2IA 3T4VA 5FR3A 5FZMA 1W6QA 2JDUA 1GP4A 1R082 3SH3A 5BNPB 1J1LA 2PHLA 3Q8BA 4YW3A 3VBFA 3WD5A 3SH5A 1ZYBA 2WO1A 1C8M1 1SFPA 2JDNA 3CU7A 4MUVA 1RUG1 1WCDJ 3AVRA 2VW1A 3KWVA 3POJA 4QGLA 5FPBA 2JXAA 1VB2A 2XWBB 1AL21 3M8LA 5DG1A 3RNSA 3ZMNA 1Y9QA 5BNOB 2PHXA 2VNGA 4GJYA 1SPPB 4AR2A 1NCQB 1V6MA 2RHPA 2OUHA 4KU7A 1W6QB 4TZDA 1NE4A 3R05A 4LLOA 3WQBA 1XNCA 1OBNA 1QXPA 1T6GC 3VBFB 1HX6A 2VPVA 2D6MA 2Y6GA 3LEKA 1IPJA 3O7OA 3A21A 4FPHA 2ZGRA 3V0BA 1XNAA 3RMXA 5IK4A 1DDLA 2FDJA 3U1XA 3VHRA 5T52A 3EBRA 2OIIA 2MEV2 3JB4C 2HWE1 1POV0 2VMEA 5LY2A 2Y6HA 1BMV1 3AYEA 2G1MA 1UMZA 5DZFA 1NQDA 2WZEA 3WNXA 4QPWA 2WT1A 1OI6A 3AVSA 4DXSA 5D2AA 2A75A 2HBUA 5EJZB 1D2SA 1VAVA 4DUVA 3J8F1 5FY7A 1XE0A 2RMU1 2YU2A 1W9FA 4P14A 2HLEA 3AKQA 1VBC2 2RS32 1Q56A 3JBG2 3WW1A 4QHZA 1DBNA 1GSLA 3NJVA 1UIKA 5DZGA 4JKKA 4HT1T 4C8DA 1UZVA 3MF6A 4MOAA 4OUEA 4Q0VA 3AP7A 1DLLA 4PF1A 1XXNA 1RUF2 3SEEA 4HSLA 1SFNA 2V4VA 1MEC2 3EJKA 4QGMA 2SBAA 4NPRA 1RHI1 4QPGC 5L7OC 5CEHA 2OPWA 4S2GA 2WN3A 2F4PA 2E31A 3J9SA 1B09A 3NRUA 1XB9A 1EV13 3ZSKA 4A6OA 3FUOA 3K2OA 2OW4A 1LRHA 2DVFA 3HVDA 1N3PA 1TMF1 2MPFA 1YI7A 5JSOA 1QQP1 2EIEA 3D5OA 3DKQA 3K3OA 1MZ5A 1DZQA 4H7MA 3ZXEA 4BDVB 1GOGA 4RR3A 2VNRA 2DTWA 3C7EA 4K20A 2IXHA 1IS6A 3I2DA 2ZGNA 4OI1A 1UOBA 2QQVA 1D4M3 2DFCA 2QQLA 2A3YA 5FMOL 1GANA 2NN8A 4QKFA 4SBVA 3VKOA 5F1RA 5K0UA 1Z78A 4WVZA 2OX0A 3KVBA 4K3UA 4ZXKA 5A80A 4CP2A 3LEIA 3AZYA 1UU6A 3GYDA 3ZYGA 3CZUA 4FOWA 2A6XA 5CVRA 1NA1A 4RR3B 2VBPA 4QPIC 3SKVA 2OQ7A 3W5NA 1IGOA 4CCJA 4FPKA 1VB4A 2FZ1A 3J4UH 1GR3A 1OH4A 3RZMA 1H2MA 2IC1A 2GC3A 1VBB1 4C90A 5AVAA 2W95A 5K0UB 1BHGA 3I2GA 5JOWA 1PVC1 1LENA 1C3HA 2Y0OA 1GNZA 3OD0A 5FZ7A 2VW2A 5FOBB 5HXMA 5KHKA 1JYXA 4RA0A 5G05L 3UV9A 1UW8A 1RXGA 1NA1B 2C9KA 4JDMA 4L11A 1HRV1 3DXTA 2E33A 2A7AA 4NHYA 4F8AA 1OC1A 1QJU2 3IDAA 3MEPA 4XBQA 3VDDB 4AEDB 1JYIA 4AFBA 2WKKA 3KSCA 3PL0A 2VR4A 5CKQA 5JAXA 2HEYF 4D7SA 1QIQA 2DVDA 1RVF1 2P17A 2W1QA 3PJYA 3ZMOA 4EN8B 1WZXA 5JZGB 3T0BA 2UY8A 4KWUA 4CCMA 3PTYA 1UMHA 2A5ZA 1W2OA 2GH8A 3ZDVA 3RVHA 4K1ZA 1R64A 2DU1A 4QPYA 4MXVA 3FFZA 5IVJA 3BKZA 1AVBA 1C5IA 4ZKTB 1QJFA 3NKTA 1YQ5A 5G04L 1HRI1 1OFNA 4FPJA 5KBFA 1CN1A 5A6YA 3OPTA 1QOTA 1S0CA 1QNWA 2PHDA 2VAUA 3KHBA 1RTVA 3MICA 4R4ZA 5A7QA 1BZWA 1ASJ3 3WQ0A 2DCTA 5CFCC 3NV4A 4PLMA 4UBGA 4FPLA 4MYEA 5FZHA 5SV5A 2IWGB 3ZOIA 4LBNA 2D3RA 3W5MA 4BQ1A 1FMD2 4M3CA 1W8ZA 1LAJA 1XJAA 1UYZA 1IHMA 5IYYA 2JKXA 1YFUA 3AKRA 1NQJA 2J1TA 2WNVB 5FY1A 3G6JB 1Q8QA 5FMOS 3RWKX 3WF2A 3ENRA 4GWJA 2R071 4U36A 1PGW2 2ZZQA 1HKDA 3WQ1A 1ZA7A 2CGPA 4R52A 5I0SA 5DXDA 4I09A 4TXWA 1W6NB 3S57A 3CBNA 4U2AA 4OMCA 4N43C 4BXFA 2UU8A 3J7NA 1S0JA 2FCUA 3ITQA 3KT7A 1G8WA 4M3CB 5IK7A 2A1XA 5FK8A 5GLZA 1W9YA 4V2VA 1YYNA 4QXHA 1Z0HA 3AFKA 3Q8EA 4HPKA 3KGLA 1Y7BA 4UXAA 4E4HA 5HCBA 4A3ZA 4H3WA 4B4PA 5CB7A 3ZR5A 1VMJA 4IV1C 1UY0A 5I93A 5FLHA 1VBD1 2YPDA 4XAAA 2FCVA 1UZ0A 2JD9A 1RJ8A 3PVOA 1SCSA 2D3SA 5FZ9A 1U5YA 5EYXA 4C1WA 2ZEXA 1TME1 1GICA 3IPVA 3B93A 3UGGA 5H9PA 1MS1A 5F39A 4ASKA 4HVQA 4ZZ5A 3ZFEA 4HPKB 4Y3OA 1S0GA 2VZQA 3MUY1 4UFHA 1DG6A 2YMZA 4FVVA 3FBYA 1I5PA 4X8NA 4IESA 3WP3A 4QHBA 2GNBA 1AYM3 5LCWL 2EXIA 2OXBA 2WSUA 5DAVA 2F6BA 4PDWA 4AI3A 3MHZA 3WR0A 1UX6A 4QU1A 2WNUC 4ZONA 1CVNA 3GF6A 1YFWA 4NUBA 4LORA 5GZFA 1COV2 3ZFEB 4CXYA 1HXS2 3VHOA 5LEJA 1UZYA 1QH7A 1WW6A 3M7AA 4CU6A 1RGSA 3ZM8A 1SQ4A 1ULFA 1YO8A 2LM3A 3HN1A 4LA3A 2SLIA 3VV1A 4OFGA 5CYYA 4YARA 4UF0B 3GZUC 1PGSA 1XNBA 1OXCA 2VBDA 3NNJA 4PDWB 1Z7S2 1W28A 2GAUA 2A70A 5D8AA 2GC1A 4JVAA 1E57A 1DF0A 1ZBE3 3OGSA 4EWAA 3FHIB 2YGLA 2W68A 1QNYA 1AX1A 1LODA 2VUDA 3JXSA 4XUPA 4AVCA 3OYWA 1J59A 2HYXA 2VZRA 5DAPA 3UETA 4IE5A 2E6VA 1H9WA 3VN4A 1VBE3 4JRLA 2R16A 3IWZA 2ZACA 5FZ8A 4RYDA 1MS5A 1W6OB 3PJQA 5JXJA 5IK5A 1JBCA 1MQTB 1XC6A 1ZREA 4NRMA 4BLIA 3VL9A 5D8AB 1AR83 1EPWA 4I3PA 4Q4X2 2CYFA 1QU0A 1CAWA 4X8PA 1SEFA 2ZGQA 1S0FA 2JG9C 4Q4Y2 3OYWB 3HBZA 3TN93 1CD3G 2UY9A 5FPLA 3J7HA 3O1OA 1WW7A 2R0FA 2V4AA 3O1VA 4HXCA 5FZ1A 1W3XA 4BQ2A 4RGAA 4IEYA 1JYNA 4XJ8A 5C3RA 1G9BA 4WZFA 1QJZA 4XETA 4I0BA 1LU1A 3OBRA 5FZ3A 1JYWA 4P9WA 4BLJA 2QE3A 3D4KA 3I2IA 2WZR3 3H7JA 4Q4W1 4RQPC 4Y1ZA 2RDSA 3TRSB 4LBMA 1XBFA 1CAWB 3WP5A 1AR61 1J1TA 4EJRA 2GC2A 1DP0A 1V70A 4ATFA 2P5BA 2ZGPA 2C0ZA 3POBA 1LESA 2BOJA 1EUUA 3EO6A 4HKWA 3DYOA 5EZWA 1OPMA 2HWF3 2HWC2 4I01A 5E1RA 3RYPA 2B7YA 3N3HA 5HCHA 4D6SA 4CYDA 1ZM1A 2XJVA 5C8CA 2WN2A 1UKRA 4TWTA 3ST7A 4H2AA 1K5MA 3O1RA 2UURA 4DO0A 5B2GB 3KS7A 2ILMA 2VZVA 3PIJA 4DXTA 3THCA 3VBHC 3MGUA 2OA2A 2E63A 2WIIB 3NV1A 5FXXA 1RUJ3 4AXOA 5JI9A 1JZ7A 1FV3A 3HAGA 5T5JA 1W8UA 5EXOA 5LA9A 2Q1FA 4N53C 4LK6A 2PQQA 1VAKA 4NAOA 2R32A 4DNYA 5A1FA 4FT8A 5FIXA 1PNFA 1H8VA 5FTTC 4AOCA 1W9TA 2KA3A 4FCAA 1PX4A 3MF9A 4WVWA 1OUSA 2DVAA 4QX5A 4BE3A 4GALA 1K5MB 4HSJA 4NWWA 3HT1A 4R9CA 1VR3A 2D6PA 5T5LA 2DCZA 2YBSA 1LOFC 1Q8PA 3SISA 2R043 4LKEA 2HKXA 2XGXA 3NJZA 2CHHA 4CCDA 2ET7A 5BXXA 3IDBB 4LR4A 3ZPYA 4XFIA 1DCSA 5FZ0A 2RM23 3KCCA 3K4DA 4IEPA 4MO3M 3T2QA 4DY3A 1QJX1 3J26N 4URAA 4NAMA 4WM7A 1MACA 2PMWB 1OVSA 3IKWA 4ZPIA 1BVP1 1FOD3 3R4SA 3R6SA 5AVPA 4GB31 1B35B 2FDFA 2NM1A 3JD71 4AL9A 3WNLA 5F7UA 3AYCA 1PIV3 1J83A 4EN7B 3LD8A 3OPWA 3PTRB 2B5HA 3T0AA 1RUD2 4M01A 3DGTA 5A3UA 1R092 2RS51 4O9EA 4OCTA 4GMP0 4IQPA 3HJRA 5FPXA 1H4HA 3DPRA 1NCRA 4WM7B 4YG6A 4KU8A 4BPZA 3I97A 5C3SA 5CFDC 2C9AA 4XQDA 3RPQA 3QD6A 1DIWA 4H7LA 3MBWA 3ZYHA 2VQAA 4BK5A 3VBRA 2WNOA 3GCWA 4E4ZA 1E5RA 1XSQA 2Y26A 5JCTA 3M3EA 2ZMLA 1PVXA 2K46A 3POSA 2VXRA 4L8QA 3THTA 3VBSA 2JDZA 2ZGKA 2F4LA 2WT2A 4V2WA 4LUKA 3DPRB 1NCRB 2ZKNA 1CIWA 1DYPA 2BGPA 4NO4A 2OKXA 1AR92 5SV8A 3KD4A 3T09A 1ZRDA 1PO13 1ACCA 3WDTA 3RYRA 5GLVA 1KS4A 3AXDA 5IFPA 5HXVA 3U78A 3VBRB 4ATEA 4JDNA 1JMUB 4FI9A 1ZBE2 4XXPA 5J96B 2YXSA 3IIIA 5DDJ1 5ACA1 3OTFA 4LUMA 5IWFA 5E6HA 1OLRA 2AACA 4RS5A 4TLFA 4JGZA 1C8M3 3I3EA 5FDBA 2FD8A 5ERLA 2CGNA 3K75B 1ND2B 4UFJA 1NXD1 3WNOA 4OVEA 3AMQA 1RUC1 2ZJCA 3VD7A 1ZRIA 1W90A 4XUQA 3RSJA 1X82A 2RDRA 1LHUA 2QQNA 3MFAA 5J7MA 1S4CA 5DG2A 3U4XA 4HKLA 3ILNA 3OOXA 3GGLA 2Q30A 2AZ5A 4S2HA 4AGVA 2EA7A 1S1AA 3E97A 4D3WA 4CUGA 1OT5A 4Q4V1 4E4DX 2ZABA 3LA3A 4RS5B 4JGZB 2Q8CA 2VZPA 1SG3A 2YB7A 2HWB2 3EMRA 2QUOA 3HT2A 2OZ6A 2JDAA 5A7WA 1PHMA 1BBT3 4AAXA 4A7KA 1DGRA 5BNPC 3I2HA 4MGIE 4RFRB 1UPIA 2PLV3 2K2SA 3N9NA 3WP4A 3MLKA 1EUTA 3KF3A 2DVBA 2GU9A 3VD3A 5J36A 1R083 3OG2A 4FOQA 4CTEA 1S0DA 4HBNA 3RS6A 1Q43A 3WV6A 1ND3B 4JCKA 4XFGA 5IFTA 1A3KA 3VZNA 1UIJA 4N7IA 1BVVA 5BNOC 3WUCA 4HK9A 4AI2A 3DUIA 1NCQC 3KB5A 1G86A 1GQGA 2HJIA 5DN2A 4V1PA 3MV01 3PIGA 3VBOB 2JJ6A 3VBFC 1KITA 5JMCA 2IXJA 1R1A2 3R4UA 1K42A 1JOPA 1Y9GA 3O0VA 1CAXA 4DIQA 5KXCA 1RUI2 4LIVA 2ADEA 1GP6A 1RMU2 2VZ1A 4MGZE 1IG0A 3T1LA 3UJOA 3WF1A 1POQA 2VOXA 1SMVA 3T30A 5FXZA 4AEJA 4XF0A 4BM8A 2E7AA 3S5AA 1JHNA 3LGRA 1AX2A 2GNMA 3WW2A 3UKNA 2WAAA 2D3PA 1GUIA 3QBQA 4CCEA 3OUJA 1KEXA 3MIDA 1LHOA 2MEV3 3HOBA 4AE2A 1D0HA 1EAH2 1SLCA 1VIWB 1XNKA 2PAEA 1WBFA 2WYSA 2XQXA 4XURA 4Z2AA 4QX2A 1V9U1 3U10A 4IETA 2E26A 5IVFA 1H8TA 1YXWA 2XWJB 4AI8A 4LHNA 4EZ4A 4RL7A 2WAOA 2YC0A 3KGZA 1CAXB 4XCBA 4B1MA 1W3VA 4WVMA 5FY9A 3WG1A 1GOFA 1UF2C 1HW5A 1AYN2 3AZXA 1QHDA 3CMGA 1RXFA 4COUA 3VDBA 2VW0A 2RM22 4H14A 4LEJA 4DPNA 1CIYA 1LR5A 1C1LA 2RS33 4MV2A 5T5OA 3JBG3 4M0NA 4EN9B 1ENXA 1FOD2 1W0OA 3B01A 1UNBA 5DQ0A 1H8TB 3WNMA 3GBWA 3USSA 5FZLA 1GKBA 5FYCA 4YM0A 4DXZA 2YROA 4QD2A 1RUF3 2RDNA 4ONUA 4WVMB 4PCRA 5FJHA 4LHKA 1QH6A 1MEC3 3AK0A 5FMDA 3NNMA 2ATFA 2W3JA 4CA9A 3DL3A 5A3TA 4AEKA 3CDZB 1PM4A 3KLSA 5K7PA 2PA7A 4BU2A 2FCTA 4Q0PA 4XJZA 2ZA9A 4WM8C 5BNNA 1JOBA 3IIAA 2P34A 4NVPA 2A6ZA 5I0DA 3TOJA 1RINA 1T2XA 3RZJA 5A3LA 2E7QA 3ZXJA 4P9GA 2OUJA 1TQ5A 2Z5WA 3BIWE 5AC91 3I7DA 3FLTA 3ZX7A 2J1RA 4XTPA 5HV0A 1JZ6A 1YFXA 4XACA 4YGEA 4QGNA 2A6WA 3NWKA 2Q8OA 1QGLA 4E2QA 1RYYA 3HPNA 4XTMA 2OT7A 3F95A 3RZLA 1ST8A 5BNNB 4BOWA 2HWD3 4CUCA 1GZWA 4NJ4A 4RN5A 4JZRA 4K7JA 4RR3C 4B3NA 2P1BA 4IEZA 4O65A 2F17A 1GWLA 4YGCA 3B5LB 3TAYA 3KQ4B 4Y26A 1K45A 3USUA 1AR71 5C3OA 3BOWA 1HN1A 1ZRRA 3NSTA 3SCFA 4HK8A 1IG3A 1EP0A 2C6SA 5F5CA 4E9KA 3OCPA 4KGGA 1WGPA 3WEZA 3WDWA 3IMNA 3KV5A 1C8M2 2EXHA 4NIDA 3F2ZA 1RUG2 4DS0A 1WLWA 1H30A 1ONAA 1GZWB 1RUE1 2WO7A 3G7DA 3HIFA 4OHVA 4XMAA 3UESA 2HYKA 4UT5A 1AL22 3IDEA 3ZYPA 1F2NA 4MG2A 4DRVA 4KL1A 4YVWB 4CDUB 5F5AA 3VDDC 4AEDC 4LO7A 2TBVA 5FXVA 4PT6A 1ZRFA 4QB2A 1OOPB 3SQOA 5FP4A 5GLTA 3JU9A 2IXIA 1QJU3 5FZGA 1ZZ6A 5JZGC 4W65A 2VCMA 3MI8A 1C1FA 5FZIA 3OY8A 1BCXA 3S7IA 5FYYA 2A3XA 4OQ9A 1JS9A 2XH6A 2P3YA 5C4WA 3HN3A 2HWE2 1SLIA 2YC4A 4K21A 1JU4A 2PQSA 1GMMA 1UCXA 3AP4A 1BKZA 5EJ3A 4IL7A 1NUKA 4DFSA 2DYCA 3LFIA 1U0AA 4IEUA 3FL7A 4SLIA 2ID4A 1FATA 2ZS6B 3JCIA 4XCAA 3FE5A 4BZ4A 3ILFA 3J8F2 4IV3A 3OY8B 5FZ4A 2RMU2 1KD7A 1F4HA 5C4WB 4KBZA 2CU5A 4AVBA 4RHV1 1BXHA 2WNVC 5F6LB 1MS0A 1Y4WA 2E53A 4GJZA 5ISLA 1YQ2A 1FMD3 3CKHA 2JDPA 1VJ2A 2IFRA 3I54A 4AQ6A 2R6QA 3BN6A 4CRQA 2YY1A 4RSUA 4DUXA 3RZHA 4XQWA 4B7EA 1A34A 4UAPA 5LWBA 1OD5A 2YFUA 4IV3B 3A0NA 4JTOA 1CZTA 5E89A 1RHI2 2Y6KA 2VU9A 2VTXA 4LO8A 1QF3A 4NHMA 1WMEA 3K4ZA 4P9YA 3U75A 3VKMA 5FPZA 4E8CA 4GWIA 3HNMA 5LA2A 1HDKA 3D8CA 2VCCA 2XLFA 3PVBB 3T4HB 4KNCA 3POEA 3RQ0A 5H9SA 1UOGA 4UFKA 1J58A 4XUTA 1TMF2 4HKOA 1OA4A 1QQP2 4QAWA 1V00A 3ACHA 4PQQA 2ZPXA 1RUH1 4QKNA 3RGBA 2LRPA 5FZKA 2IXKA 5KXBA 5FAXA 4MGKE 1YQCA 3V0BB 1GOHA 1WCUA 2O1QA 3APBA 3LPGA 1FNYA 1V0AA 3E5UA 4NOTA 4URTA 4CXXA 3ZKYA 5FOJB 4PIYA 5FYHA 4XUOA 3LDRA 2VMCA 2EAKA 3GJBA 2JE7A 5H9RA 1HQLA 2I74A 3WDYA 1DU3D 1SHWB 2ARCA 2ERFA 1T6BX 3H8OA 2EIBA 4L99A 1WW5A 3VZMA 1BK1A 1UZWA 2BBVA 1LGNA 4QDSA 4XHBA 2AGSA 2XJTA 3BALA 1FPN1 1PK6A 2Y64A 2PAKA 3K48A 3N7JA 4AVAA 2TUNA 1S2EA 1KXGA 3TNPB 3I2JA 4PHZA 2X10A 2J1UA 3LKJA 5IVYA 5JPNB 1GQPA 1NY71 4QXKA 4D7TA 3ZFGA 4AFAA 4CEWA 2BV4A 1VBB2 4XF3A 3ZFEC 4DUWA 1TNRA 2Z4FA 5I91A 3SXWA 2VG9A 2FQPA 2BWCA 1PVC2 2VL4A 4QHOA 5A32A 2J42A 5LBEA 4XAEA 1UX7A 1Q3EA 1D2QA 3OSDA 4MGQA 2GP3A 4PBPA 3U11A 1HB2A 1COV3 1PK6B 1HXS3 2PYTA 1POV1 5J37A 1HRV2 2P6CA 4FPOB 1ZBA1 1JZ3A 1ZVFA 4YW2A 1UY2A 2OQ6A 3V56A 2NMOA 5JOYA 2BRTA 4PDWC 4QMAA 4S2FA 2HWD2 1XYOA 4HVRA 2RS11 3ZFGB 3CZJA 1RVF2 4JHZA 1OVPA 2WFF1 4W6WA 2ZHMA 1IS4A 3WG2A 3T3YA 4KH9A 1Z7S3 4X6QB 5A32B 3BU7A 1W9SA 1NT0A 3ROUA 1Q8OA 1UZZA 1H1IA 1HQWA 1QDOA 3QH7A 3ZSJA 4CEYA 4O9GA 4BIOA 2X5IC 1I3HA 4ASMB 3THDA 1H1MA 1WCSA 2JB8A 2ZOEB 3P1IA 4NPLA 4QM8A 2L9LA 4MADA 1L7RA 2YG0A 3T1MA 4FTBA 1AR63 4P9JA 5A3MA 1G9AA 1HRI2 3N9LA 3A4UA 5C8WA 4LITA 5CKMA 1VBC1 4W6YA 1MQTC 3OUIA 1BLZA 5D8AC 1VE0A 2Q4SA 3ZN5A 3FLRA 2W5FA 1F9KA 3ES1A 5DPNA 3Q9OA 1OH3A 3U4SA 1XYNA 4JGYA 3W20A 4CEYB 5A6ZA 3V0AA 2D6NA 2DCKA 5JXHA 1OHFA 2BNOA 1LEDA 4NE9A 2NP0A 4Q4X3 1H6YA 1N1YA 1VBA1 1R1ZA 1V6LA 3I2KA 5FZOA 1CWPA 1W2NA 4Q29A 2VMDA 3MIGA 4Q4Y3 2R072 4NHLA 4YFWA 5EWSA 2EALA 5FBZA 5LW9A 5GZEA 3M3IA 3ZSMA 2VMHA 4P5YA 3KV4A 5EFUA 5FP7A 1KFUL 3N4MA 2XHKA 5KXDA 3BU0A 4ASLA 2B9UA 4AHYA 2EXJA 4QU2A 3V0AB 1GFF2 3NNFA 1SBEA 4MLOA 1TEIA 4QQHA 2Y34A 2WYFA 1DQ1A 1UAIA 2K9ZA 2FDIA 1F5FA 2VCBA 4AFCA 5HCFA 2XUEA 5FZOB 3U07A 4CCKA 5FO7B 3ATGA 2WS91 1G9CA 3AC0A 4XMIA 1PO21 2RJ2A 1IS5A 2HWC3 3SCHA 1VBD2 3SH4A 5LBBA 2JDMA 4BQ5A 5KXEA 2P2KA 3WT3A 4D0QA 1REEA 3ZFFA 4LQRA 3E6CC 3BI3A 4EE2A 1TME2 2ZX4A 3WCSA 4R8HA 4XDQA 1CESA 1FV2A 5I0RA 3AL5A 4CUAA 2CTVA 2GZWA 3ZXKA 3VLBB 3BYWA 1F4AA 1WBLA 1SDWA 2NMNA 1LOGA 1ULGA 1F35A 3WOGA 2Y60A 3J7MA 1OLQA 4CSWA 1QOOA 2CSGA 1QJY1 1K5MC 5LBCA 1PNGA 1NLQA 2XL9A 4M0HA 4GH4A 5EYYA 3O0WA 4AVVA 5IJRA 3ZFFB 1NYWA 5FO8B 4GKXA 2JWPA 3T2PA 2X53S 4BIFA 5HI0A 3R0RA 2DCJA 2JECA 2EIGA 4K9SA 4KQ7A 5FKCA 3U37A 1DYKA 3KM5A 3K77A 3KT1A 1GU3A 2R061 3I2FA 2VUJA 1RITA 2XBO1 4Q8LA 3UJQA 2LW8A 2Y6FA 3PUQA 1B35C 2GMEA 1C57A 2QBXA 3WW3A 4QQLA 5J48A 4FOVA 4IGPA 5FUPA 2W47A 4AHWA 4GH4B 3I59A 2VY0A 2RR11 4JKLA 4M00A 3E5XA 3T2TA 4GMP3 1W8HA 3CJIA 4EROA 2ZX1A 1RUD3 1KS5A 1R093 3KHCA 3PNAA 4JAAA 3U0ZA 2ES3A 2ZGSA 3ZSLA 5JXGA 3O5SA 2KM2A 4W8JA 3IAQA 3IM0A 1AJOA 1I6XA 3NVCA 3IPVB 5DMYA 1LCLA 4L97A 4ITCA 1U5XA 1UL9A 4FFHA 3S7EA 4LO4B 3CJIB 3AZWA 3HQXA 5DAQA 5FZEA 2JIJA 3H3ZA 4YFZA 2AEYA 5CAZA 2N7GA 5HPOA 2YGMA 5C71A 5EIYB 3WZ1A 1X36A 4KBBA 1VRBA 3FC0A 2UYBA 4XFAA 4NIGA 4FAHA 4MXWA 2D44A 1W6PA 3VBRC 2G9ZA 2GDFA 3GHMA 3TEXA 4QXCA 1PX3A 2WZ8A 2QQPA 4TLGA 4AFDA 1AR93 5M0TA 4LBJA 4YNIA 5BYNA 2IFWA 2XKPA 1OUXA 3BTXA 4MGYE 5EV7A 3AYAA 1AL0G 4A44A 2J22A 2P3JA 3FFQA 2WDBA 2VNVA 3T2OA 4F7ZA 1RC6A 4Q4W2 2W1UA 4BXSV 1ND2C 3ALQA 5A3WA 1NXMA 4YM1A 1AR62 4A4AA 4FXKB 4MXWB 4F83A 3DKWA 2O8OA 4PQ9A 1AXZA 4YLZA 3SKJE 4CDQA 4YM2A 1J84A 1X8EA 2JICA 3POYA 4QPIA 4XF9A 4YZ5A 3I2OA 2AC1A 2NYYA 5J1XA 5HV4A 4L9BA 1VP6A 4YYOA 1LGCA 5KC6A 4Q8KA 4RS5C 1XE8A 3NNLA 4JGZC 3KCXA 2G4IA 4MGSA 2PHUA 5FYZA 2XQRA 4XFCA 1JZ5A 5T3NA 3AFGA 2EICA 1W04A 2I2SA 3ON7A 4FFFA 4I0WB 2BNMA 3RJ2X 5FY5A 1OKQA 1VRH3 3VBUA 4C0HA 3AJZA 4CCOA 1PMHX 2HWB3 1HV0A 4CDQB 1F8VA 1EV11 4Y1UA 3EXUA 1S2KA 2W1WA 2EAAA 3VHNA 2WC2A 1CAUA 1OA2A 2D7FA 1ND3C 2VJXA 1KQRA 5FRAA 1G6NA 3VZKA 1BK0A 1UY1A 4BWOA 3WG3A 4NIHA 1IPKA 4F3JA 4W6XA 4OQ8A 3HEIA 1GZ9A 2QJVA 3GZTB 3TEYA 3WW4A 4J1XA 4UFLA 3VBOC 3VBUB 4A2UA 1D4M1 1XRUA 4FPCA 2GH2A 2G9GA 2J1EA 4LULA 2WWJA 2A3WA 4HVOA 1QJX2 4EN0A 1YUDA 4J25A 4NPMA 5A3NA 5ABJA 3M3QA 5FYMA 1U5ZA 3BPSA 2B8MA 4XDPA 4Y20A 4GB32 1R1A3 1ODNA 3JD72 5DAXA 1GWKA 1ZRCA 4OHZA 1FNZA 1RUI3 2ZKLA 5K4LA 1RMU3 4D6QA 4Z1VA 3H3LA 2VECA 1SBFA 3MZHA 3ACFA 3WCRA 4K40A 2Z42A 3K46A 2RS52 2V5YA 2BBAA 4LIUA 3THPA 3AZVA 2XJRA 2QQOA 2XR4A 3BCWA 3VD4A 1EAH3 4QX8A 5ABJB 1XOYA 2HH9A 3I3MA 3M2MA 1XNTA 2OS2A 4LTAA 1N3OA 4Y20B 5C8CB 1AHSA 2WUHA 3IN9A 4P9LA 1W8OA 3E6DA 1PZ8A 1F5JA 1O8SA 1JZ8A 2EXKA 2WABA 5FYTA 4GWNA 3M3OA 4JHTA 2VZOA 5A3PA 3OPZA 2VMFA 1AYN3 1OQ1A 3EHKA 5AC93 1CPNA 2QQMA 4YVSC 2D98A 3AMNA 1LHWA 5CU1A 4CP0A 1H8TC 4R9BA 1OLME 1GZCA 2DUQA 3UGFA 3BB6A 3QCWA 3HQUA 4CE8A 1X50A 5DUWA 4LKSA 4UYBA 4CCNA 4K8RB 4LBQA 2R49A 2WNEA 4LBQD 5JLVA 2QTWB 1OPOA 4JX0A 5FUNA 3POGA 4CZSA 3QOPA 2J1AA 2WWUA 4LE3A 1A78A 2QQIA 2B42B 5FJKA 3GJAA 2QNKA 3RFRA 1OKOA 3HNYM 4PIZA 3VKLA 5DDJ2 5ACA2 3VKFC 4AFMA 3H1WA 4YW6A 1ASJ1 2GMMA 2FDGA 1BEV1 5F9TA 2QZ2A 2XJQA 4HOOA 3ZXDA 1RUE3 2YC2A 2DWRA 1CAVA 4BHPA 4E8DA 5BUVA 1RUC2 1SFYA 2FMDA 4TN7A 1CGPA 4B7KA 4LBOA 1S0IA 4AI0A 2XVGA 2V72A 1MS4A 2BVVA 1OFSA 1W0NA 1H2KA 3N35A 3NMBA 4A45A 4DZGA 3RDIA 1UU4A 1YI9A 1URXA 4Q4V2 1DGWX 2XMLA 3PMSA 4CP1A 3ZSEA 3WX5A 4Y24A 3ZYIB 1APNA 3PLQA 4D69A 2BWAA 4I30A 4YG0A 2J1VA 1CAVB 1JH5A 4WBBA 3WSOA 3JQWA 2LALA 4JTNA 4XZPA 1JOJA 3BTYA 4QWNA 1MZFA 1O4ZA 1YC61 5FP8A 4G9SB 2WA3A 2PFWA 3DV8A 4JQRA 4IE0A 3ILRA 5FFOC 3S30A 3ZIXA 1C4RA 1ZX5A 4GQ7A 3VBSB 1OMIA 2JE8A 2UYAA 2VUCA 1KDMA 2XLAA 4LNVA 5FUIA 5KHGA 4YVWC 4CDUC 1PZ7A 4PJYA 4A41A 5C9AC 4L92A 1RUG3 3V65A 3MIHA 1TZOA 2XL7A 3N9QA 4NMIA 4LHLA 4XQ4A 2ZEZA 1OOPC 2CGOA 1AL23 2Q1ZB 2WO2A 4HETA 1CQ9A 4CCCA 3M1HA 4PBOA 4RHV3 2ZHKA 2W1SA 3CLPA 5E88A 4FBFA 4AQTA 1UWWA 4KWKA 5FPUA 1D4VB 2EIDA 1M06G 1S0EA 3BVCA 4XEZA 4BK4A 4BQ4A 1VRH2 5IUQA 4M3CE 1S0BA 1M4WA 4XFFA 5A7SA 3WDUA 1GP5A 1I5ZA 3AB0A 1AYM1 2W52A 1X8MA 3ACIA 3M70A 4N7UA 3ZN6A 5I8TA 2QZ3A 4YW5A 2Z2SB 2HWE3 5JR7B 3OEAA 4QX7A 4HFSA 2MHFA 1V9U2 2JDYA 4XILA 1UYPA 1YQ6A 2UWAA 4BB3A 5IHRA 2PHWA 3WF0A 4YW7A 3VUOA 5C4WC 3O0XA 3X29B 3MPPG 5IAVA 3J8F3 1GWMA 1NG0A 3OBAA 2X05A 2RMU3 2XVLA 5A7WB 3P5BA 2QCSB 3K4AA 1UQXA 4OHWA 1QY4A 5EJ1B 1UYXA 3PUSA 1DFQA 2Q8DA 3N9MA 4WZCA 3B94A 5J09A 4HMZA 1MVQA 4O7XA 2VZTA 2R7EB 4IV3C 3W58A 1O7FA 1JU3A 2VZSA 1BJQA 2ETEA 4UW6A 2DCYA 2WO3A 4FAGA 1O59A 4Z82A 3OGVA 5LATA 2DUOA 1J3RA 1AZDA 3ZYRA 4AYUA 2ZMKA 3N7KA 2DDUA 4GAZA 4HN1A 1GBGA 3WNKA 1YFYA 2YDEA 1RUNA 1RHI3 3LB9A 2D5FA 3M3CA 2VH9A 3VHPA 2D6KA 1VBE1 4JQTA 1Q8VA 5FCCA 5FWEA 2X09A 1Y3TA 3H8XA 4LOSA 4XPVA 1NE6A 2J7MA 3LEMA 2CY6A 2I45A 3ME2A 2VVDA 1TMF3 1AR81 2BP6A 4LMFA 1QQP3 2OYZA 5IVCA 4OI2A 5FY8A 4YZ2A 3H8UA 1GNYA 5AC92 2QKDA 3D82A 3TN91 4J6GA 1N1TA 5H9QA 4AEMA 2V09A 4NIIA 3ZYJB 3TEWA 2BDRA 4META 2H6CA 1IZ3A 1V6IA 3MIEA 1LOFA 3AKSA 4M4PA 2O0OA 3FZ3A 4OHYA 2ZHLA 4AGRA 1W8NA 1DGRN 2C26A 3GALA 2WZR1 1X9TA 2ZGTA 3AP6A 3BGAA 1AR72 1NAEA 2B4KA 3UKTA 2I07B 2QDNA 2BTVC 2LS6A 1K5JA 1K12A 1RUOA 4MSVA 4XIKA 1VMFA 2JDKA 2V5DA 3MV11 2HWF1 1FX5A 3LZZA 4UFMA 4Y5SA 1RUE2 1VBB3 5JDBA 1PK6C 2HEVF 4CU9A 1RL3A 1PVC3 1QXJA 4R9AA 1BYHA 2X29A 2VMGA 3I3QA 1IOAA 3PUIA 2Y8KA 2VVFA 3TB0A 1UY3A 1MR5A 4QQOA 3ZFGC 3ZPOA 1HRV3 3LEGA 4EZHA 1RUJ1 2CDOA 1CZVA 3NO8A 1OURA 1ULPA 3T0DA 1O3TA 1IPSA 1H9PA 2CV6A 2B39A 2GP5A 3TNQA 1RVF3 5F5IA 4EN6B 4Q1RA 3PHMA 3OB8A 4Z8BA 4OUMA 1LHVA 4CXWA 4FFIA 4OUSA 4YG3A 4AZZA 2W9XA 4YWAA 4AHZA 4PI0A 3DEMA 2R041 3O1SA 4BMBA 5K0UC 2VCAA 4ORFA 5JXIA 3H3UA 3NV2A 2VZUA 3IZOA 1HRI3 1LOBA 4FPFA 1PGL1 5FYVA 4B29A 2ARBA 4CUBA 5F37A 5IATA 1MS9A 3H0OA 1NA1C 2BW8A 2JD4A 2VQUA 2Q8EA 3VZJA 1CONA 1ODMA 5FBJA 1KJLA 3VDCA 2WQ4A 4RHV2 4XUNA 3USUB 1V6OA 2O8QA 1PIV1 2G19A 3H1YA 1N1VA 3GM8A 3QLQA 3E6BA 4Q2FA 2A73B 4UW4A 4Y4YA 5F5QA 4AAPA 2RG4A 5LA0A 1AXYA 4XC9A 2WQ8A 4LJHA 2BGOA 3GCXA 2R073 1AX0A 2VMIA 5CNAA 4KGQA 1UY4A 1H0BA 5LK7B 2IXLA 4LOTA 3HBKA 1DZTA 2EVXA 1LB2A 2ZZJA 1BMV2 2BPA2 4XVHA 4EWDA 4QXBA 4BQ3A 2NQYA 1Q5OA 1WLCA 2H6BA 3OBTA 1EPZA 2Y0IA 2LROA 3A7QA 4ZY9A 4AHXA 4CDWA 1O3RA 4FXGB 1AF9A 5CZKA 3PUAA 5FQ0A 3KZ4C 2ZHNA 1IQDC 3OGRA 1NX9A 2WJSA 3VDAA 4D6RA 4LT5A 5A3OA 4W50A 5TSWA 5B4NA 1RUH2 4FTSA 5DUVA 4XBNA 3MLJA 5F6KA 2JDHA 4GKYA 2DV9A 4AI1A 4XJ9A 3OEBA 5FMBA 3WHUA 5DUUA 1LOCA 4XBLA 5FZBA 1LU2A 1VBD3 1PO11 2AR6A 3AMMA 1Y9MA 3SMHA 5FY4A 1W0PA 3MPBA 3NW4A 1NCQA 1TME3 1V6NA 1WMDA 3LF7A 5FQ0B 5FZFA 1W6MA 4XFBA 5K8SA 5L9BA 2AENA 4AWDA 1HJFA 1DGWA 1FPN2 4ZS3A 3N7MA 2WINB 3HNBM 3MYXA 3HQRA 1O4YA 1KJRA 2P3IA 3OUHA 3ZFFC 4Y33A 1YWKA 5T5PA 2VULA 5GALA 2E7TA 1LHNA 1NY72 4B8EA 1GYKA 1J3QA 2TEPA 4IDZA 3WLUA 3S0MA 5IT6A 1UOFA 1HN0A 4LLFA 4COYA 3LIHA 4B1LA 2OPKA 4P9XA 5BV6A 3P3NA 4S2DA 1W03A 5F3CA 1W6MB 1IQAA 1H2LA 1L3JA 1O91A 1W2UA 3CJXA 4RFT0 3O1TA 1TE1B 5JIAA 4OMDA 3ACGA 2JENA 4LBLA 1C8NA 3HR9A 4GH4C 1ZBA2 5CBLA 2XB6C 2DBNA 3AP9A 1LGBA 4YM3A 5T50A 1ENQA 2MNGA 3VGIA 2CWSA 1BBT1 3LAGA 4NWVA 4QX1A 4QDRA 4COWA 4COVA 5FZDA 2ZX0A 2PLV1 1WD3A 2RS12 1ZNPA 3ORJA 3ZKUA 2DURA 4QQ2A 2WFF2 3B3QE 2VQ0A 1MPXA 1W2TA 4IEXA 1UOJA 2ZGMA 1LOAA 2NZ9A 2VNOA 1R081 1JHJA 1CR7A 1HV1A 3GZEA 3B9CA 3NAPA 4YGDA 5IVEA 2WQZC 1O5UA 3AMPA 2V73A 4BMEA 2IZWA 4HZFA 2YHJA 1GV9A 3D6EA 1K3IA 1CX4A 1TVGA 1TNFA 1SDDB 5DUXA 1IKPA 2C1FA 4E4SA 5CADA 2XONA 1SBDA 3CJIC 5BPXA 4I3GA 5KWRA 1UPSA 2H0BA 5FZCA 5LK5A 2NLRA 2PELA 4LBKA 3ZLIA 4GXLA 2ARXA 1LOEA 3NL1A 2ORZA 2BJSA 3NAPB 4GZ9A 5FY0A 1TG7A 3VD5A 2W08A 4WM8A 3WF4A 4EYUA 4Q27A 4Z92B 4I0AA 1VBA2 3BODA 3H42B 3KV9A 4P02B 2QDRA 2ZGUA 4CDXA 4NHXA 1UU5A 2MEV1 5F2SA 5EQUA 1HIXA 1GLHA 3CEWA 3PVEA 3Q8CA 4XDOA 4KG8A 4CEWB 4YPJA 4UBHA 4QT6A 1A8MA 4Y1XA 4UOJA 3IMMA 4P00B 2Q1MA 1I1EA 1H1AA 3FUQA 4WM8B 5CA6A 3S5QA 4QX3A 1OLMA 3FWEA 2E51A 2JKBA 4Q4W3 4KWJA 4GIQA 3TWIA 1DGLA 2GMPA 3LDKA 3LWCA 4UFIA 3DYPA 5KHHA 3ZO0B 4AW7A 2VOWA 1DQ2A 1ZA4A 4QM9A 4IEVA 2A6VA 2WS92 4IGOA 2RS31 2Y38A 4J1WA 4CDXB 5LEKA 3JBG1 1F31A 2ZBJA 5JWPA 1PO22 1E5HA 2DUPA 2RDQA 1ULOA 5A7NA 2XLGA 4CDWC 1O5LA 2DTYA 4FPEA 2BZDA 1QOSA 3MIFA 3VKNA 1RUF1 3DN7A 3AM2A 1DLCA 4Y1VA 1MEC1 4CDQC 4CU7A 4WV8A 1JYCA 3GBFA 4NRPA 2DFBA 3VDDA 4G3YC 4AEDA 2WL1A 1ALYA 5A1AA 2ZEYA 2D5HA 2UWCA 2YUEA 3P6BA 4E2GA 1GNHA 5I8SA 4XF4A 4FTEA 3QH6A 4Q5OA 3PU8A 1QJY2 1QXRA 2ZGOA 2C5DA 4HG6B 4YRDA 1LULA 2WT0A 5FV3A 1CJPA 4C0BA 4EWEA 5JZGA 4OYUA 3SHRA 4JGYB 5LA1A 2BU9A 3VBUC 1ULEA 3AZZA 5EP9A 1FAYA 4X6RB 4GA9A 3UK9A 3BPZA 5JMOA 2XXZA 4ISRA 1QWRA 4B4RA 1AJKA 3ZR6A 1OQEA 2R062 1S55A 2BOIA 1RB8G 4YGBA 2JG8A 3MLLA 2XBO2 4OZXA 4YZ4A 4BYYA 5C33A 3HWJA 5FYSA 5JVVA 2HWD1 3K51A 1UN1A 4ISQA 4XFHA 1QJX3 4DMIA 1CZSA 1MZ6A 4LA2A 3H8RA 1JI6A 1QKQA 1WUVA 5B4XA 1UXZA 3UYJA 4A7ZA 2RR12 3DF0A 1L7QA 3MUZ1 4GB33 1D7PM 3MIBA 1RIRA 3CO2A 2Q5TA 1E5SA 3JD73 4R9DA 2WZPP 4HN0A 3RJRA 3FN9A 5DZEA 1JUHA 1DQ4A 2WNVA 1LTEA 4DEVA 2JG8B 5ABJC 4XZUG 4Q0SA 2XJPA 5AFBA 2RS53 5C8CC 4TSVA 4Z2WA 5JOXA 2HEWF 4NROA 1W6NA 2BUKA 3AKPA 5A7OA 3SEPA 4XJAA 1FXZA 2XUMA 3ELNA 1BEV3 1DQ6A 3KCYA 3UL2A 1ENRA 4RGKA 2RE9A 4Q0UA 4OULA 2GNTA 2AUYA 1HB1A 4OZOA 5JI7A 3LFMA 4AG4A 1W8FA 3RZKA 1QJU1 1WLTA 3E5QA 3GBGA 4Y1YA 1XU1A 5FYIA 1REFA 1Q8SA 3Q8AA 1G7YA 1H4GA 4XF1A 3SITA 2TNFA 3U14A 3ZXLA 3FJSA 4OHXA 3RZGA 2FMYA 3KVAA 2BQPA 4MZUA 4RD7A 1W06A 4N9HA 2QQUA 1YNAA 2D43A 3KF5A 2BNNA 2PN5A 5JSPA 1JZ2A 4BQXA 1WW4A 1HJGA 3C7HA 3JB8A 3O1UA 3GXUA 2VOVA 4MH0E 1YCIA 4P9IA 3IB3A 2YV8A 5L9RA 2IVJA 3CHXA 4IUGA 5KR7A 4WM7C 4D8MA
chains in the Genus database with same CATH topology
1MZEA 2NPIA 4Z07A 1WMFA 3JUUA 3KMHA 1YJLA 5DDJ3 5ACA3 1ENSA 3PVNA 1YHFA 4AQ2A 2BYVE 4FSJA 2PHFA 4JC1A 2FZ2A 1FT9A 4C91A 3LOBA 3I59B 3TBDA 1ULCA 4QPGA 1YLLA 1FMD1 1RUC3 5L7OA 5GZCA 1G9FA 3DPRC 1NCRC 3POWA 4INDA 4IEQA 1LJ7A 2LTNA 5GKAC 3VZOA 4N90A 2ZX2A 3WDVA 2XJUA 1PGW1 5T55A 3SNMA 5CG8A 2Q0AA 4Q4V3 2YPJA 4Y22A 3EQEA 1IS3A 1H2NA 2R30A 1EV12 4P5HA 3GHNA 4GULA 4IEWA 4QPGB 3ZDSA 5CIRA 5L7OB 3VBSC 3O14A 3RMYA 4COZA 5GLUA 2R1BA 5J98B 2G9FA 3NV3A 3RYKA 3JZVA 4YZ1A 1MS3A 2P3KA 1D4M2 1W6PB 2VVEA 3CNAA 4Y22B 2D97A 1DQ5A 2X5IA 3L9JT 4OI4A 4XXAA 3RI8A 3VZLA 4NN0A 4Q1PA 4BA6A 1W6OA 3WY6A 5GJ6A 4JDOA 2CAUA 1MQTA 2BVBA 2A71A 4UW3A 1HLCA 2K0GA 2R0HA 3H50A 4XHXA 1LKNA 4FQZA 2GC0A 4AVTA 3ES4A 1C28A 2XG3A 2FBEA 2X5IB 1G9CA 4QPIB 2ZGLA 3KQRA 4FPGA 1RJ7A 5L19A 1O3SA 1JW6A 4IEOA 2ZX3A 1SLAA 1PMIA 1V9U3 1COV1 1QMJA 1HXS1 5KHIA 2CNAA 2BFUL 4B4QA 2P37A 3BOPA 3C2UA 2OZJA 2GN7A 1OA3A 1JN2P 3ZXFA 1Z7S1 3MW3A 2GALA 1CAUB 3ZN4A 4PLNA 4IERA 2BEOA 4K1YA 3AKTA 1WLDA 4PIXA 5CFCA 2WWSA 3S6PA 4MVTA 2ZTNA 1HQNA 2GN3A 1ZZ9A 5FLJA 1ASJ2 2ZAHA 1FI2A 1KDKA 1BEV2 3SCGA 2VUAA 2XVKA 3CL1A 4Q26A 2DU0A 3IBMA 3AXEA 3ETQA 3GZAA 1V6JA 5CFCB 4Q4X1 3SLIA 4N43A 5JOZA 1VAMA 4Q4Y1 1ZZ7A 5HCAA 4ZU4A 3AP5A 3HMYA 2XJSA 3C3VA 4FOYA 2YZ4A 3MDPA 3FLPA 4R4XA 4HLTA 4LE4A 4EV0A 2B45X 2AREA 2AYHA 2D40A 1WA4A 1B35A 1AUYA 3INAA 4IV1A 1SCRA 2E9QA 4FP3A 1AR73 4N43B 1SLBA 1IKQA 1DQ0A 4FQ4A 3O12A 1LECA 4ES9A 3WP6A 4RGGA 2QVSB 2H0VA 3OD4A 2DF7A 2CAVA 2HWC1 4XYXA 5BNQA 3A0KA 1N47A 1Y43B 4KG0A 4LBQB 3H9AA 1CPMA 2A6YA 2BFUS 2ENRA 1OSGA 3MFCA 3ACLA 4IV1B 3B9IA 3I4IA 1YIPA 5BNNC 3WUDA 3LSEA 4FPYA 2WLPA 3B00A 1O3QA 2WNUA 1A6CA 1OQDA 2R1DA 5I0UA 4E27A 1W39A 1AYM2 4FP2A 4DINB 3L2HA 4ZU5A 5J3UA 4OLLA 3P3PA 1VLNA 3KT4A 3V64A 1I9RA 3GNEA 4A3XA 4LO6B 5GZGA 3OF1A 1G9DA 3IT8A 3ECQA 3AJYA 1DZRA 3OGJA 2WNUB 2D6LX 4JV4A 1BQPA 5IK8A 2XKOA 4NHKA 1PZ9A 4M3CF 2QFEA 1ND2A 3WG4A 2PTMA 4PLOA 4AF9A 4GMP1 2D6OX 3W59A 4N9IA 1RUD1 3ASIA 4DRRA 1R091 3HD8B 3FX3A 2ET1A 2IXCA 2UWBA 1XQNA 2PHTA 1EYBA 4NR1A 3R4DB 4DQAA 5L73A 4DOUA 1JUIA 1VBE2 4YW1A 2ZCWA 1XU2A 3ZXGA 2JG9A 2VGDA 5I0TA 2KXLA 4YW4A 1JXNA 3CF6E 1AR82 4XJUA 1D0GA 4ZU7A 4MX3A 1RUH3 3ZVXA 1X33A 1ND3A 5C6CA 1YJKA 3TN92 2OVUA 4RQPA 3ZN6B 2JE9A 4Y5Z0 1AR91 3MW4A 1N1SA 2JG9B 3VBOA 1SLLA 5A33A 1SLTA 2GSYA 1JTZX 1WD4A 1LEMA 1NZCA 2WZR2 1ZBE1 2VOKA 1DHKB 1YIFA 3OJBA 3RZZA 1FPN3 2JEMA 3M4FA 4FO9A 1WCKA 5CG9A 1GQHA 4RQPB 5T54A 4YZ3A 1A8DA 2XPJA 1REDA 2HWF2 2WLQA 4D94A 3VBHA 1J3PA 5A33B 5HBAA 1U12A 5GZDA 3D0SA 3L2YA 2PHRA 2WFPA 4N53A 4BH9A 2DVGA 3LA7A 1VRH1 4I02A 3B69A 1POV3 1ZBA3 2RJKA 1RUJ2 2HWB1 3AX4A 3OGGA 3RWNA 1C5HA 1V6KA 4GWMA 5GLWA 5AFEA 3VBHB 2RS13 3H7YA 3UKVA 2Z79A 4TYSA 4YVSA 4XW3A 2WFF3 1X7NA 4K6BA 3LCPA 4N53B 3WINE 1YRZA 3NKGA 4IXLA 4AGGA 1NOVA 3WDXA 5I8YA 3WXPA 2R042 3RRDA 1SACA 3B02A 3MW2A 4AVSA 1NLRA 3JQXA 3TYJA 1VALA 1PGL2 4DY5A 1VBC3 1MVEA 3NAPC 4HL0A 1ULDA 3AYDA 4E2SA 4YVSB 1MS8A 5KC5A 2Z69A 2WSVA 5JPMB 1R1A1 3BTAA 2CL2A 3URFA 1UKGA 1RUI1 1AXKA 1FYUA 1PIV2 1RMU1 4I2OA 3RI9A 2AH2A 4XOGA 5CFDA 4CEWC 3LOIA 3ZIWA 3PMEA 1VBA3 1XYPA 3ZXAC 4QQPA 4D7YA 4ES8A 2GNDA 4G4FA 1KRIA 5LRRA 1EAH1 4UW5A 3QACA 2X8KA 5FREA 2RJLA 3B7MA 4HANA 5E16A 4AK3A 1PM7A 1KFXL 4BCUA 3IDCB 4CDXC 4XJWA 1AYN1 5CFDB 1ZZBA 4YSFA 2W0XA 4JRAA 4L2NA 1ZZ8A 2RM21 3VL8A 4K8FA 5KHJA 1U5IA 2PAMA 2WS93 2FHRA 4XIOA 1N3QA 5E8AA 5GM0A 4H55A 2W39A 4CEYC 5K9YA 1XE7A 3N7LA 4AQSA 5FO9B 1FOD1 1PO23 2D93A 1PO12 4XE9A 4YVWA 1EY2A 4CDUA 5C9AA 3H1MA 1ZZCA 3I8TA 1CJDA 1O4TA 1OOPA 2CWMA 2B46X 4Q0QA 2ZMNA 5BY5A 5L36A 4PF5A 4DB5A 4KWLA 4JGYC 2YYOA 3N36A 4WVVA 1XNDA 1S2BA 1QJY3 3WVJA 2JX9A 5C9AB 4C1XA 5JIUA 4A7YA 3WQ7A 3FMGA 4LO5B 3WHTA 4OI0A 2WA4A 5BNPA 5D1IA 5JSRA 2R063 1QDCA 3FBMA 3W9AA 5FLIA 2XBO3 2BGCA 1NLSA 3AMHA 3LA2A 1UD1A 3D0JA 1BBT2 2LUWA 3LSDA 2EF6A 2PLV2 4CDWB 3RG0A 5BNOA 2JG8C 2ZAAA 2RR13 1W6QA 1R082 5BNPB 3SH3A 1J1LA 2PHLA 4YW3A 3VBFA 3WD5A 3SH5A 1ZYBA 1C8M1 3CU7A 4MUVA 1RUG1 1WCDJ 2VW1A 4QGLA 2JXAA 1VB2A 2XWBB 1AL21 3M8LA 5DG1A 3RNSA 3ZMNA 1Y9QA 5BNOB 2PHXA 2VNGA 1NCQB 1V6MA 2RHPA 2OUHA 4KU7A 1W6QB 4TZDA 1NE4A 3R05A 4LLOA 1XNCA 1QXPA 3VBFB 1T6GC 1HX6A 2VPVA 2D6MA 3V0BA 1IPJA 3O7OA 4FPHA 2ZGRA 3RMXA 5IK4A 1DDLA 3VHRA 5T52A 3EBRA 2OIIA 2MEV2 3JB4C 2HWE1 1POV0 1BMV1 3AYEA 1UMZA 5DZFA 1NQDA 3WNXA 2WT1A 1OI6A 2A75A 1D2SA 1VAVA 3J8F1 2RMU1 4P14A 3AKQA 1VBC2 2RS32 1Q56A 3JBG2 3WW1A 1DBNA 1GSLA 1UIKA 5DZGA 4HT1T 4Q0VA 3MF6A 3AP7A 1DLLA 1XXNA 1RUF2 4HSLA 1SFNA 1MEC2 3EJKA 4QGMA 2SBAA 4NPRA 1RHI1 4QPGC 5L7OC 4S2GA 2F4PA 3J9SA 1B09A 1EV13 3ZSKA 3FUOA 2OW4A 1LRHA 2DVFA 1N3PA 1TMF1 2MPFA 1YI7A 5JSOA 1QQP1 3D5OA 1MZ5A 1DZQA 4H7MA 3ZXEA 4RR3A 2VNRA 2DTWA 4K20A 2IXHA 1IS6A 3I2DA 2ZGNA 4OI1A 1D4M3 2DFCA 2A3YA 5FMOL 1GANA 2NN8A 4SBVA 3VKOA 5F1RA 5K0UA 1Z78A 4WVZA 4K3UA 4ZXKA 4CP2A 3AZYA 1UU6A 3GYDA 3ZYGA 4FOWA 2A6XA 5CVRA 1NA1A 4RR3B 4QPIC 1IGOA 4FPKA 1VB4A 2FZ1A 3J4UH 1GR3A 1H2MA 2IC1A 2GC3A 1VBB1 4C90A 5AVAA 5K0UB 5JOWA 1PVC1 1LENA 1C3HA 2Y0OA 1GNZA 3OD0A 5KHKA 2VW2A 5FOBB 4RA0A 3UV9A 1UW8A 1NA1B 4JDMA 4L11A 1HRV1 2A7AA 4F8AA 1QJU2 4XBQA 3MEPA 3VDDB 1JYIA 4AEDB 4AFBA 2WKKA 3KSCA 5JAXA 2HEYF 4D7SA 2DVDA 1RVF1 2P17A 3PJYA 3ZMOA 4EN8B 5JZGB 2UY8A 3PTYA 2A5ZA 2GH8A 4K1ZA 2DU1A 4QPYA 4MXVA 3FFZA 1AVBA 1C5IA 4ZKTB 3NKTA 1HRI1 1OFNA 4FPJA 5KBFA 1CN1A 1QOTA 1S0CA 1QNWA 2PHDA 1RTVA 3MICA 4R4ZA 1BZWA 1ASJ3 3WQ0A 2DCTA 5CFCC 3NV4A 4PLMA 4UBGA 4FPLA 4MYEA 5SV5A 2IWGB 4LBNA 2D3RA 4BQ1A 1FMD2 4M3CA 1IHMA 1YFUA 3AKRA 1NQJA 2WNVB 3G6JB 1Q8QA 5FMOS 3ENRA 2R071 4U36A 1PGW2 2ZZQA 1HKDA 3WQ1A 2CGPA 4R52A 5I0SA 5DXDA 4I09A 1W6NB 4U2AA 4N43C 2UU8A 1S0JA 3KT7A 1G8WA 4M3CB 5IK7A 5GLZA 1YYNA 1Z0HA 3AFKA 4HPKA 3KGLA 1Y7BA 4UXAA 5HCBA 4B4PA 4H3WA 5CB7A 4IV1C 5I93A 5FLHA 1VBD1 1RJ8A 3PVOA 1SCSA 2D3SA 1U5YA 5EYXA 4C1WA 1TME1 1GICA 3IPVA 3B93A 5H9PA 1MS1A 4HVQA 3ZFEA 4HPKB 1S0GA 1DG6A 2YMZA 4FVVA 3FBYA 4X8NA 4IESA 3WP3A 4QHBA 2GNBA 1AYM3 2EXIA 2WSUA 2F6BA 4PDWA 4AI3A 3WR0A 1UX6A 2WNUC 1CVNA 3GF6A 1YFWA 5GZFA 1COV2 3ZFEB 1HXS2 3VHOA 5LEJA 1UZYA 1QH7A 1WW6A 3M7AA 1RGSA 1SQ4A 1ULFA 1YO8A 2LM3A 3HN1A 4LA3A 2SLIA 3VV1A 4OFGA 4YARA 3GZUC 1PGSA 1XNBA 4PDWB 1Z7S2 2GAUA 2A70A 5D8AA 2GC1A 4JVAA 1E57A 1DF0A 1ZBE3 4EWAA 3FHIB 2YGLA 2W68A 1QNYA 1AX1A 1LODA 4AVCA 3OYWA 1J59A 2E6VA 1H9WA 3VN4A 1VBE3 4JRLA 2R16A 3IWZA 2ZACA 1MS5A 1W6OB 3PJQA 5IK5A 1JBCA 1MQTB 1ZREA 4BLIA 3VL9A 5D8AB 1AR83 1EPWA 4I3PA 4Q4X2 2CYFA 1QU0A 1CAWA 4X8PA 1SEFA 2ZGQA 1S0FA 2JG9C 4Q4Y2 3OYWB 3HBZA 3TN93 1CD3G 2UY9A 1WW7A 2R0FA 4RGAA 4IEYA 4XJ8A 1G9BA 4WZFA 1QJZA 4XETA 4I0BA 1LU1A 3OBRA 4P9WA 4BLJA 2QE3A 3D4KA 2WZR3 3H7JA 4Q4W1 4RQPC 4Y1ZA 3TRSB 4LBMA 1CAWB 3WP5A 1AR61 1J1TA 4EJRA 2GC2A 1V70A 4ATFA 2ZGPA 2C0ZA 1LESA 3EO6A 4HKWA 5EZWA 1OPMA 2HWF3 2HWC2 4I01A 5E1RA 3RYPA 2B7YA 3N3HA 4CYDA 1ZM1A 2XJVA 5C8CA 1UKRA 4TWTA 3ST7A 1K5MA 2UURA 5B2GB 3KS7A 2ILMA 3VBHC 3MGUA 2OA2A 2E63A 2WIIB 3NV1A 4AXOA 1RUJ3 5JI9A 1FV3A 3HAGA 5T5JA 5EXOA 4N53C 2PQQA 1VAKA 4DNYA 2R32A 4FT8A 1PNFA 1H8VA 5FTTC 2KA3A 4FCAA 3MF9A 4WVWA 4QX5A 2DVAA 4BE3A 4GALA 1K5MB 4HSJA 4NWWA 3HT1A 4R9CA 1VR3A 2D6PA 5T5LA 2DCZA 1LOFC 1Q8PA 3SISA 2R043 2HKXA 2XGXA 3NJZA 2ET7A 5BXXA 3IDBB 4LR4A 3ZPYA 4XFIA 2RM23 3KCCA 4IEPA 4DY3A 1QJX1 3J26N 4WM7A 1MACA 3IKWA 1BVP1 1FOD3 3R4SA 3R6SA 5AVPA 4GB31 1B35B 2NM1A 3JD71 3AYCA 1PIV3 4EN7B 2B5HA 1RUD2 4M01A 3DGTA 1R092 2RS51 4O9EA 4GMP0 4IQPA 5FPXA 1H4HA 3DPRA 1NCRA 4WM7B 4YG6A 4KU8A 4BPZA 5CFDC 2C9AA 4XQDA 3RPQA 3QD6A 1DIWA 4H7LA 2VQAA 3VBRA 4E4ZA 2Y26A 5JCTA 3M3EA 2ZMLA 1PVXA 3POSA 2VXRA 4L8QA 3THTA 3VBSA 2JDZA 2ZGKA 2WT2A 4LUKA 3DPRB 1NCRB 2ZKNA 1CIWA 1DYPA 4NO4A 1AR92 5SV8A 3KD4A 1ZRDA 1PO13 3WDTA 3RYRA 5GLVA 1KS4A 3AXDA 5HXVA 3VBRB 4ATEA 4JDNA 1ZBE2 4XXPA 5J96B 2YXSA 5DDJ1 5ACA1 3OTFA 4LUMA 1OLRA 4RS5A 4TLFA 4JGZA 1C8M3 5FDBA 2CGNA 1ND2B 1NXD1 4OVEA 3AMQA 1RUC1 2ZJCA 3RSJA 1X82A 3MFAA 1LHUA 5J7MA 3U4XA 5DG2A 4HKLA 3ILNA 2Q30A 2AZ5A 4S2HA 4AGVA 2EA7A 1S1AA 3E97A 4D3WA 4Q4V1 4E4DX 2ZABA 3LA3A 4RS5B 4JGZB 4CDWC 2HWB2 3HT2A 2QUOA 2OZ6A 1PHMA 1BBT3 4A7KA 1DGRA 5BNPC 4MGIE 1UPIA 2PLV3 2K2SA 3WP4A 3MLKA 2DVBA 2GU9A 5J36A 1R083 4FOQA 4CTEA 1S0DA 4HBNA 3RS6A 1Q43A 3WV6A 1ND3B 4JCKA 4XFGA 1A3KA 3VZNA 1UIJA 4N7IA 1BVVA 5BNOC 3WUCA 4HK9A 4AI2A 3DUIA 1NCQC 3KB5A 1G86A 1GQGA 2HJIA 4V1PA 3VBOB 2JJ6A 3VBFC 1KITA 5JMCA 2IXJA 1R1A2 3R4UA 3O0VA 1CAXA 5KXCA 1RUI2 1RMU2 4MGZE 3UJOA 3T1LA 2VOXA 4AEJA 1SMVA 4BM8A 4XF0A 2E7AA 1JHNA 3LGRA 1AX2A 2GNMA 3WW2A 3UKNA 2D3PA 3QBQA 3MIDA 1LHOA 2MEV3 4AE2A 1D0HA 1EAH2 1SLCA 1VIWB 1XNKA 2PAEA 1WBFA 3U10A 1V9U1 4IETA 1H8TA 1YXWA 2XWJB 4AI8A 4LHNA 4RL7A 2YC0A 3KGZA 1CAXB 4WVMA 3WG1A 1UF2C 1HW5A 1AYN2 3AZXA 1QHDA 4COUA 2VW0A 2RM22 4H14A 4LEJA 4DPNA 1LR5A 1C1LA 2RS33 4MV2A 5T5OA 3JBG3 4M0NA 4EN9B 1ENXA 1FOD2 1W0OA 3B01A 1H8TB 3GBWA 3USSA 1GKBA 4YM0A 4DXZA 2YROA 4QD2A 1RUF3 4ONUA 4WVMB 4PCRA 4LHKA 1QH6A 1MEC3 3AK0A 2ATFA 3DL3A 4AEKA 3KLSA 5K7PA 2PA7A 4Q0PA 4XJZA 2ZA9A 4WM8C 5BNNA 3IIAA 2P34A 4NVPA 2A6ZA 3TOJA 1RINA 5A3LA 2E7QA 3ZXJA 4P9GA 2OUJA 1TQ5A 2Z5WA 3BIWE 5AC91 3I7DA 3FLTA 3ZX7A 4XTPA 1YFXA 4YGEA 4QGNA 2A6WA 3NWKA 2Q8OA 1QGLA 4E2QA 4XTMA 5BNNB 4BOWA 2HWD3 1GZWA 4K7JA 4RR3C 4B3NA 4IEZA 4YGCA 3B5LB 3TAYA 4Y26A 3USUA 1AR71 3BOWA 1ZRRA 3NSTA 3SCFA 4HK8A 1EP0A 4E9KA 3OCPA 4KGGA 1WGPA 3WDWA 3IMNA 1C8M2 2EXHA 1RUG2 4DS0A 1WLWA 1H30A 1ONAA 1GZWB 1RUE1 3G7DA 3HIFA 4OHVA 4XMAA 2HYKA 1AL22 3IDEA 3ZYPA 1F2NA 4DRVA 4KL1A 4YVWB 4CDUB 3VDDC 4AEDC 4LO7A 2TBVA 1ZRFA 1OOPB 5GLTA 3JU9A 2IXIA 1QJU3 1ZZ6A 5JZGC 4W65A 3MI8A 1C1FA 3OY8A 1BCXA 3S7IA 2A3XA 2XH6A 5C4WA 2HWE2 1SLIA 4K21A 1UCXA 3AP4A 1BKZA 5EJ3A 4IL7A 4DFSA 2DYCA 1U0AA 4IEUA 4SLIA 1FATA 2ZS6B 3JCIA 3FE5A 4BZ4A 3ILFA 3J8F2 4IV3A 3OY8B 2RMU2 1KD7A 5C4WB 4AVBA 4RHV1 1BXHA 2WNVC 5F6LB 1MS0A 2E53A 1FMD3 1VJ2A 2IFRA 3I54A 4AQ6A 2R6QA 4CRQA 2YY1A 4RSUA 4XQWA 4B7EA 1OD5A 4IV3B 3A0NA 4JTOA 5E89A 1RHI2 4NHMA 2VU9A 4LO8A 4P9YA 1QF3A 1WMEA 3VKMA 5FPZA 1HDKA 3D8CA 2XLFA 3PVBB 4KNCA 3RQ0A 5H9SA 1J58A 1TMF2 4HKOA 1OA4A 1QQP2 1V00A 2ZPXA 1RUH1 5KXBA 2IXKA 5FAXA 4MGKE 3V0BB 2O1QA 3APBA 1FNYA 4NOTA 3E5UA 4URTA 5FOJB 4PIYA 2EAKA 2JE7A 5H9RA 1HQLA 2I74A 3WDYA