5FDFA

Crystal structure of the monoclinic form of thermotoga maritima acetyl esterase tm0077 (apo structure) at 1.76 angstrom resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
total genus 124
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fdfA00
1G4HA 3ANTA 1A8QA 1HDEA 2QOEA 3O95A 4MWTA 4J0DA 1Y7HA 5D3KA 5A7GA 1NU6A 1QGED 2B4KA 3IB3A 1OXMA 3R3VA 4WDRA 1J2EA 2BGRA 5ALPA 1K6EA 4K6HA 1P0PA 3F9CA 3WL7A 4RE5A 1HQDA 1EDDA 4PO3X 5AIBA 1F6WA 5DYWA 1SCIA 2GZSA 5K3BA 5CMLA 3WJ2A 2XQFA 4G1FA 2E3JA 3ILSA 4XX1A 3V48A 1WM1A 1XROA 5DNWA 5DTJA 7YASA 3PF8A 5CT5A 4NMWA 5FUMA 2ECFA 3WWCA 1HL7A 1CUGA 1UKAA 3O9VA 3C5WP 5EFZA 5LKRA 2WHRA 3AJAA 4X93A 4FBLA 4H35A 4IO0A 3SC2A 4FDMA 4W1PA 2Y6VA 2FJPA 2XQIA 3O4GA 4JYMA 4HRXA 4FOLA 3PFBA 4X94A 5JALA 4XJVA 3WIBA 2WJ4A 3ZWQA 1LGYA 4KAFA 1CUDA 2VT6A 5EIEA 1EX9A 5T4FA 2WFLB 4MWSA 1BN7A 2BFNA 3QMVA 1SOMA 1MT3A 4L3WA 3K9BA 1R9MA 1JJIA 3FLAA 3BXPA 2ZVDA 5ALUA 4BCCA 4PF1A 5DWDA 1FFCA 1W4LA 4Y2VA 1K8QA 1FFEA 1U8EA 3QPDA 5ALLA 5EHZA 2ZYRA 5LLSA 4XVCA 2CJPA 4ZRDA 4B84A 1VZ2A 4K2AA 1DQZA 4GBGA 3G9UA 5ALFA 4WFJA 3FYUB 4ZGBA 1GPLA 4B9EA 3MGAA 3WK7A 4EY8A 2B61A 3I1YA 3C8DA 4IH9A 2XQGA 5FKJA 2O2IA 3G8YA 5SYNA 3NGMA 1LZKA 4C01A 4EY7A 1IZ7A 1QFSA 4P08A 4FLFA 4KE7A 4YK7A 4L9AA 1DINA 2PBLA 2Z3ZA 2OGZA 4FMPA 4BRSA 4ETWA 4DLNA 3VDXA 3DD5A 4MJ3A 4BP8A 3FNBA 3HYSA 3WK4A 1FFAA 4GWLA 4X90A 4CG3A 3WA7A 1CUBA 5HCUA 1ZD3A 5F4ZA 4C6HA 1XRQA 1Z68A 2VA9A 3STTA 5HK9A 3B5EA 1R1DA 5T4EA 2C0PA 4UHCA 3QITA 4RPCA 4OPMA 3WKAA 1X2BA 1G66A 1EK1A 1LPPA 5EGNA 4MEAA 3C6BA 5AI9A 2QJWA 1BN6A 3FVRA 2GBGA 2DQYA 1YS1X 2AJ8A 4ROTA 4N5HX 5CH8A 5FP0A 4BTLA 1IUNA 3S2ZA 2VJBA 2P8SA 3R3WA 2RGUA 3OTQA 2HFKA 2QMQA 4LXIA 4Y2SA 3CN7A 1L7RA 1EINA 1AURA 2X5XA 2Y2VA 1QIEA 2BUCA 4UBKA 2PU7A 1AX9A 2XB6A 3MVEA 3DYVA 3RM3A 5ALKA 5HF8A 5EHXA 4W1QA 4B0PA 1CUUA 4BVLA 5JZ9A 3WL6A 3G7NA 3QBJA 4LHEA 4P93A 3G9ZA 4CCYB 3EQ7A 5AICA 5ALIA 2PSHA 4HTAA 4KACA 2RIPA 3IURA 5JARA 1MNQA 2WUFA 2G4LA 4B0OA 3EQ8A 3FWHA 4UHHA 1ZD2P 2IIVA 2PUJA 1J07A 1G42A 3W05A 1MO2A 2OQIA 2R8BA 4Y2TA 3STYA 2RONA 4OU5A 1UKBA 4BYMA 2WIKA 2WHPB 1TIBA 1E66A 1J1IA 5CW2A 2QT9A 4DMHA 1K4YA 4F0JA 3C6YA 4RE6A 5JD4A 1GQRA 1MAHA 3GUUA 3K2IA 3IUNA 2RHTA 2H7XA 3ICWA 2WTNA 3H2KA 5JAOA 2YYSA 3K6KA 3AIKA 1ORVA 3F67A 1LPMA 5AKIA 4QLOA 3BL8A 2HA7A 1P0IA 3H0CA 4G4JA 4QLAA 3M81A 3T52A 3DEAA 1JU3A 5C81A 5JZBA 4M0MA 4QDXA 3ANSA 5JAPA 1EDBA 4BBZA 5DYTA 1NU8A 1LPNA 3SX4A 2XMGA 2HRQA 4HS9A 4Q1VA 2XMSA 5AIAA 4B82A 2OAGA 4G4IA 5BWCA 3HC7A 3DNMA 1FFBA 3AIMA 1WB4A 2NW6A 1UOOA 5CT8A 5AKLA 4AZ3A 4HXGA 1XRMA 5AOAA 3W04A 1BRTA 3MUOA 3A6ZA 3WZMA 5AKEA 2OCIA 5A7HA 4EY5A 4N8DA 4L72A 1XZMA 4JYPA 4ZV9A 3AZOA 4AQDA 3NUZA 2WIFA 3QVMA 4KE8A 3OOSA 1BCRA 4UBMA 3STUA 1PFQA 4QWMA 3X3HA 4J3JA 3STWA 4MQMA 1MAAA 1W1IA 3F97A 5CXUA 2I03A 1ACJA 1DU4A 4GI1A 4Y2JA 1EXWA 5C8VA 2GYUA 4JUIA 5LKAA 4N8EA 1CV2A 4HZGA 3FCXA 4EY4A 2D5LA 4G9GA 1USWA 3GELA 4H7JA 5FV4A 5AKXA 1EVQA 5AM4A 1W6RA 3VVMA 4MYDA 1MU0A 3DCNA 1E8NA 2H7YA 4JEIA 1UK6A 2Z8XA 4Y2YA 3KXPA 2YASA 2IITA 4NS4A 1EH5A 4ZWNA 3C6XA 3E0XA 2DR0A 1CUJA 3BF7A 3TGLA 4GXNA 2HADA 4QDUA 4C4ZA 1LPSA 4H18A 4U2GA 5FRDA 4UBLA 2ZYIA 4CIAA 2CB9A 1RP1A 3FVTA 2XE4A 3A70A 1IMJA 3M83A 1CUVA 2FUKA 1LLFA 5ESRA 5AHXA 4AMYA 3WA6A 3AZPA 3GBSA 4TVKA 4Q3KA 4H7IA 5K3FA 3G0GA 4CG1A 4LIPD 1GKKA 4RGYA 3LS2A 4Q82A 1CVLA 3CCCA 2AJDA 1W52X 2I3ZA 1E8DA 1XLUA 5D3ZA 4Y7DA 4B6GA 5EIAA 4KRXA 4HVTA 4J0KA 3QM1A 1UOQA 3P2MA 2QJRA 2HFJA 5T4HA 1GGVA 2DHEA 2V98A 4MYSA 1YB6A 2B20A 4W1SA 1A88A 5ALJA 2CKMA 3WK9A 1CQWA 3D7RA 2XI4A 3I28A 4KRYA 2DFPA 5CT4A 1ZOIA 2XUHA 4WY8A 2VJAA 3ESDA 4G8BA 4W9RA 2C5FA 3QPAA 4KJXA 1DQYA 3D2BA 5E4YA 4O08A 5ALOA 4KEAA 1XZKA 3H17A 2XMRA 1HKHA 4J7AA 3RLIA 5LZ7A 1TAHA 5FXMA 2O7RA 2HA6A 1FFDA 1BU8A 1SFRA 3FYTA 4UFNA 4BZWA 1HPLA 2X8BA 1EA5A 4F5ZA 1YAJA 1ODSA 3QYJA 4AMZA 4G8CA 1Y7IA 2WJ6A 3HRHA 1VKHA 3IULA 1UT6A 3MUNA 1QZ3A 3W9BA 4H77A 1WHTA 1XQVA 4DNFA 4KAAA 4MXDA 5HF6A 2DSNA 3TRDA 1YCDA 1ZJ5A 1ZGCA 3FSGD 4K6KA 4X97A 5DTIA 1MNAA 5HQ3B 4J0JA 1QIIA 5ALQA 2XUPA 2PUHA 3DJYA 1OILA 3ZPXA 5HFNA 4BP9A 5EIHA 3V9AA 5I7UA 5ALTA 2ZJ7A 4AN0A 5JD6A 1VXRA 1WB5A 4U2FA 1M33A 2JGFA 3BJMA 1QOZA 5K3EA 4CIBA 5ALNA 2OQVA 3FBWA 3WL5A 4E14A 1R9NA 1UXOA 1LZLA 1XFDA 4C88A 1P0MA 1KU0A 2XQKA 2ACEA 2RHWA 1CUXA 3EBLA 5JZSA 1DT3A 5CT6A 2RAUA 1LBSA 2XUGA 3C5VA 1ETHA 1QONA 2WUGA 3WWOA 4L0CA 1ZI9A 4OCZA 4AB1A 5ALEA 3G9XA 3PDCA 4X3CA 2H1IA 1ORWA 2J3DA 3PUIA 1R50A 1XZJA 2O7VA 3S8YA 4CCYA 5EHQA 3LCRA 1CUEA 5JYCA 4J0HA 5HFAA 1UFOA 2I78A 4INZA 4X71A 3BF8A 4I19A 4X91A 2H9YA 5FPPA 4UHEA 2XUQA 4MEBA 2QUAA 1WHSA 4BCDA 1U65A 1MJ5A 1F8UA 2VT7A 4G4GA 5AKJA 4X6XA 1TK3A 1CRLA 5D7BA 1A7UA 2WHPA 2WIDA 4Q3OA 3ED1A 1Y37A 3H2GA 4CG2A 4DYHA 3O4IA 5DNVA 5FDFA 2PSJA 4UFOA 2XUKA 2YH2A 1CUFA 1CFJA 2HA3A 5ALDA 2WTMA 1T4MA 3VXKA 4PSDA 4CCWA 1E8MA 3A2MA 2WIGA 1Q84A 5AKHA 4EA6A 1AZWA 2WJ3A 4X7BA 1UOPA 1EK2A 3I2HA 1TRHA 4FNGA 4C4XA 3W06A 4WJLA 4LXHA 5IKXA 2PKYX 1AKNA 5AI5A 2GBCA 4LYEA 3PICA 3I2GA 3WK5A 4GLBA 4B83A 3ZLTA 1VJ5A 3DQZA 2XMBA 5AK5A 2GBFA 4KYVA 3WZLA 3F8SA 4AN1A 3PF9A 3ZI7A 2XUAA 1W76A 1ZI6A 1H2XA 2OCGA 1TCBA 3I2IA 2QM0A 4N5IX 1ZGBA 2ONCA 3WK8A 6YASA 4H7KA 3ESBA 3G0BA 2VEOA 5ALZA 4DM7A 2Z3WA 2HL6A 4XWGA 2JGLA 3I6MA 1CUYA 3WMRA 2WFMA 2VSQA 1UK9A 5BOVA 2HA2A 5DYYA 5C8ZA 2BAGA 1HBJA 3V1MA 5BWBA 3KSRA 1E5TA 4UBIA 5KWIA 1ZD4A 4F60A 4BE4A 2OAEA 1XZIA 1O6FA 1A8SA 1JJBA 3IIIA 2PPLA 3QMMA 2VATA 1XQWA 4BCBA 3DL4A 2WFLA 2V9ZA 4FLEA 1VA5A 4P92A 3ZV7A 1UWCA 4EUSA 1Q83A 5A62A 3D3NA 4ARBA 3SWWA 3A2LA 3HXKA 5K3DA 4Y2RA 5K5EA 2C7BA 4DMFA 5LZ8A 1QIHA 3G02A 3VJLA 1FJ2A 1E3QA 3BJRA 2GBIA 1IZ8A 3BWXA 3R41A 3G0DA 2XT0A 1X70A 1QTIA 4DNQA 4J03A 2PSFA 2HRRA 4HXFB 4U2BA 5ALWA 4ZXFA 2JF0A 2WUEA 3H1BA 5DNUA 2HU8A 3D2AA 2HDWA 4PSCA 1THGA 3LP5A 1CIJA 3C45A 3LIIA 4CI9A 3I6YA 4OB6A 4H7FA 1WPXA 4V2IA 4Q34A 2ZJ6A 5AO9A 4QDOA 2HU7A 2VAXA 1C7JA 5LP1A 1QE3A 3H18A 1VLQA 4P9NA 4U2EA 1SCKA 1IVYA 5CRIA 4PQEA 4BVKA 1GKLA 1XZCA 2WM2A 2QVBA 1QO9A 3IA2A 3I1IA 5SYMA 2AJLI 1DX4A 3IUJA 4QDTA 2XUFA 3HLKA 3C6ZA 2WFZA 3D4LA 3W2TA 5LZ5A 1TCCA 1LPBB 2W6CX 1MX1A 2AJBA 3O9MA 4QDZA 5A7FA 3H19A 2OCLA 3PUHA 1VOTA 1B6GA 5ALMA 4FWBA 2ROQA 2WILA 1EVEA 4X92A 1BEEA 4G9EA 3TJMA 5CBKA 4HAIA 3R3ZA 3KWFA 4OYLA 2WLSA 4BE9A 2BJHA 2EDAA 1QIDA 2HU5A 1JFRA 2J4FA 2VJCA 5CXXA 1XRNA 4B80A 2OGSA 3OURA 2PSDA 1DX6A 4B85A 3R0VA 2WKWA 1ACLA 2CEKA 1E89A 1TKRA 1JT2A 1JU4A 5ALHA 1XLVA 2PL5A 2G5TA 3R3UA 1PJAA 2EEPA 4OU4A 5BV7A 5IH7A 1L7QA 4B81A 3DOHA 2DQZA 2BKLA 2XLCA 3ESAA 2RI6A 2C58A 5CURA 3VJMA 5DJ5A 1BEZA 3WIOA 2C0QA 2VAVA 4BB0A 2PM8A 4Y2UA 4AX4A 3DLTA 5JATA 4YPVA 2WSLA 5C7YA 2C4HA 4HRYA 4BVJA 4C87A 1A8UA 4ZV7A 1J06A 2BUAA 3WKDA 3FCYA 2QRUA 5YASA 3E1GA 4Q3LA 3V1KA 2J4CA 2CUTA 4IH4A 1YA4A 5E2IA 3DKRA 4IQ4A 4TPKA 3PI6A 4KAJA 3DKKA 1VXOA 3PE6A 2OLEA 4DIUA 3VJKA 1VA4A 5C8XA 2JGJA 5E4JA 3UUFA 3RARA 4AZ0A 3G0IA 4K6GA 1H2WA 3RKSA 1R88A 4J0CA 1Q0ZA 4UFPA 5HKAA 2JGEA 2Q0XA 1DT5A 3WI7A 5AK3A 5KWJA 3R40A 4FFVA 2ZSIA 3D2CA 2IX9A 5CH3A 1KEZA 3H1AA 4KR0A 3KWJA 4DMCA 1CUIA 5A2GA 4PSUA 5HKBA 4CFSA 2H7CA 3DOIA 3E4DA 4YASA 2JIDA 2R11A 1F0PA 2ORYA 2J3QA 3HEAA 3ICVA 3QMWA 4FNMA 4X00A 2ES4A 2GZRA 1AC5A 2JEYA 1S8OA 1SC9A 4Y2PA 4Y9SA 2VJDA 2PX6A 3QPCA 4MQLA 4NZZA 3FAKA 1K63A 4BC1A 1D07A 1CUSA 2G5PA 1ZIXA 2GYVA 1T2NA 5T4BA 5ALSA 4M0EA 4U2CA 3JWEA 3IUQA 4G5XA 4YX9A 1WPRA 3DDUA 3L1IA 2WG2A 4DGQA 2JGIA 2VQ6A 4EY6A 1ODCA 4D9JA 3D5EA 3D0KA 3PFCA 4ARAA 5AM5A 4Q05A 3OPMA 3M3DA 3VISA 1AMNA 3HSSA 1IUPA 5LZ4A 1BE0A 4K5QA 1DWQA 4J0IA 3V1NA 5AI0A 3NWOA 4BC0A 4DNOA 3IDAA 4N8SA 2PVSA 2VF2A 1CUWA 3CCBA 5ALYA 1YB7A 2JGKA 3F98A 5D6OA 4TGLA 3E3AA 4BDSA 1XZAA 1VZ3A 2G63A 5E4TA 1KU6A 5LIPA 2JBWA 4C89A 3JW8A 4ZI5A 5FLKA 3U1TA 3EQ9A 1CPYA 5HF9A 1Q0RA 2O2GA 1YAHA 4LYDA 1XQYA 1QFMA 1CUCA 4WFIA 1TQHA 1N1MA 1AQLA 1VE7A 2WG0A 5AI6A 1UK7A 3WWDA 2AXEA 2PU5A 1VE6A 2QTBA 4EZIA 3D59A 1EI9A 1F0NA 4U2DA 1UK8A 2K2QB 2XMQA 2CZQA 5CT9A 4FFWA 3V1LA 1BROA 1FSSA 1YA8A 4PW0A 2OCKA 1GPKA 4LXGA 5K3CA 1LPOA 3F96A 1GXSA 2AJCA 2Y1KA 1JMKC 4X6UA 3GA7A 1WCYA 5EHNA 2XMCA 4JH0A 3ZLVA 3WQHA 2HA5A 4BTVA 5J3JA 2GYWA 1XZGA 5ALXA 2X76A 4FBMA 1JKMA 1MTZA 1EB9A 1XZFA 1R4ZA 2OXEA 2XDWA 4NVRA 4DTCA 1R3DA 3LIPA 5HK8A 4BZZA 4UPDA 3WJ1A 4AO7A 4DNPA 1EHYA 5AM2A 1PV1A 5JAHA 4BAGA 3STVA 4QZVA 1RWQA 3IUMA 3DYIA 1N8SA 1RYYA 4G8DA 5IVIA 5LZ9A 1AUOA 1DTEA 3WL8A 4H7HA 2WU4A 1JJFA 3B3QA 1YASA 1L7AA 2I3DA 3NOXA 2ZYHA 3AZQA 4AXBA 2V97A 1XZBA 1XZDA 3U0VA 5ISMA 1THTA 5AM3A 2XMDA 1O6GA 4Y2QA 2PSEA 5I8PA 5AKZA 4OYYA 2BGNA 2XUIA 4FHZA 1LBTA 4OB8A 2XUDA 1GQSA 4UBNA 3HJUA 4QWWA 2ZJFA 5EI5A 3TEJA 2HHAA 1QIMA 5AM1A 3QH4A 5CH5A 4RNCA 5FOQA 3IBTA 4GECA 4BRZA 1UZAA 1QIGA 3WWPA 3H2JA 1BCSA 4DMKA 2FJ0A 2EDCA 4AO8A 2XLBA 2XUJA 4OB7A 5IVKA 3WKCA 1QTRA 5H3HA 3GFFA 2LIPA 1OCEA 1CUAA 5AKYA 1N5RA 5K3AA 4M0FA 2DHCA 3LLCA 4W63A 4QE3A 4FTWA 5KBYA 4X95A 1UKCA 5AK4A 1HLGA 1WB6A 3WKBA 3FSGA 1H23A 4OSEA 2ZSHA 3CXUA 3EF3A 4UBOA 1QIFA 4A16A 3VKFA 1ODTC 5LZ2A 2V96A 4A23A 1JI3A 4LKOA 3IVMA 3GZJA 2WIJA 3G9TA 1H2ZA 1XZHA 3KDAA 2CBGA 1ISPA 3OG9A 3WWEA 4QA9A 1CUHA 1QLWA 1U2EA 2JGMA 2ACKA 3N0TA 4H7EA 5AKKA 1B41A 4EBBA 1P0QA 2QZPA 2DHDA 2W22A 4ZREA 2O2HA 3BE8A 2FX5A 5I9IA 1XKLA 1I6WA 1ZICA 4EB0A 3KOOA 4AO6A 1QIJA 4JNCA 2QKYA 3AUKA 3FOBA 2OGTA 1XKTA 4KE6A 4A5SA 1H2YA 4BAZA 2QS9A 5HF5A 5AM0A 2CMFA 1GT6A 1CR6A 3H2HA 1CLEA 5AP9A 3DL7A 2BCEA 1MX9A 5JASA 3YASA 1TCAA 4WCVA 4UBJA 5ALVA 4E46A 2OG1A 4X85A 1MX5A 1QIKA 5HZGA 2WHQA 1YSCA 3Q0TA 3RK4A 3JYHA 1ZD5A 1ZI8A 4E11A 1U4NA 5JANA 1XRLA 2C5GA 3WYDA 1G5FA 1WOMA 5LYYA 1ZJ4A 3C87A 4IHAA 4B9AA 3I6ZA 3AINA 4GHWA 3BIWA 5A71A 3B12A 4DSZA 5DLPA 4UUQA 3AIOA 4QEKA 3O0DA 3R3XA 4WFKA 1YR2A 3BDIA 2YXPX 5AI8A 3BIXA 2QXTA 1CQZA 3C8HA 5AKGA 1YS2X 2D0DA 1IUOA 5AOCA 3CN9A 3STXA 4BAUA 1LNSA 4I3FA 3H2IA 4XIIA 4PNZA 3WK6A 4UHDA 3OM8A 5JD5A 1XRPA 2WQZA 3VVLA 5KREA 4DSAA 5JIBA 3M82A 3I2FA 3WLAA 1JMYA 2Y2UA 2VTVA 1LPAB 3UUEA 3N2ZB 1CEXA 3HZOA 4FKBA 4Y2XA 1C4XA 3I2JA 2WU3A 5AI4A 1QO7A 3EIOA 3GROA 1DWPA 3W9UA 3SK0A 2WUDA 1CUZA 2QR5A 3HI4A 4WDQA 4QNNA 3AFIA 4UHFA 2QUBA 5AK6A 4C4YA 1W75A 1AGYA 1XQXA 3WYNA 4HXEB 4ITVA 4X6YA 5IVHA 4H7DA 3R3YA 3FLEA 5FPQA 5HQ3A 5ALRA 3ZLUA 4H0CA 3BDVA 2B9VA 2HA0A 5ALGA 3FYUC 3O4HA 4GDMA 1MN6A 3ESCA 4UHBA 1ZIYA 1GPNA 1XZEA 2XQJA 3L1JA 1GZ7A 4PV7A 3G0CA 3WKEA 4Z49A 2HM7A 5IVDA 2Z5GA 3UMJA 3C70A 1H22A 2HIHA 1EDEA 4GW3A 1DWOA 4F21A 3T4UA 1XLWA 3O4JA 5AOBA 4OD0A 2BUBA 3HACA 5CTAA 3Q8WA 4KE9A 2Y6UA 4I4CA 2DCMA 5K3FB 1NX9A 3FYUA 4B7ZA 1MPXA 3DS8A 4GEGA 4J0GA 1N5MA 3I2KA 2UZ0A 3A2NA 3H04A 2Z8ZA 4IH1A 4BDTA 5AJHA 2QXUA 2WG1A 2HA4A 3L1HA 2XMZA 4W1RA 1QJ4A 3FLBA 1XZLA 1X2EA 2OPHA 4WY5A 1SCQA 3C43A 5JAUA 4OUKX 1EB8A 1BS9A 1XRRA 3OC0A 4E15A 2JEZA 3QZUA 1C7IA 5A6VA 1K5PA 4S0XA 3AILA 3HABA 2XUOA 3KD2A 4FLMA 4EHBA 5AH0A 2ZYSA 5JADA 4BATA
chains in the Genus database with same CATH superfamily
3IGFA 2F17A 3A1SA 1SXPA 1CC1S 3K5WA 4KI0A 4N0QA 3MS7A 4Q3DA 2DJIA 2C9BA 1EUCA 3VGJA 3M9WA 3UCEA 4OOFA 1CZHA 2EBUA 3HCEA 1U0FA 2H00A 5JJLA 4LCEA 5IBQA 5LWHA 3DQQA 5CLLA 3WLMA 4AJOA 2Q0HA 3RSZA 4LMPA 3V2HA 1MABB 4Z4HA 1G0NA 2JNWA 5ALPA 2VYFA 1BE1A 2VUUA 3FG9A 3GJQA 3O75A 4N3NA 5DYNA 1P0PA 3WY9A 2C83A 1HLPA 1BYIA 3FCOA 3H11A 4JXJA 3MERA 3SZLA 1UBLS 1JKIA 3DLPX 3MRXA 4RE5A 3ZZ0A 5ITZB 3UEOA 3VH4A 1Q3TA 2C61A 3TLZA 1BDJA 1EDDA 1XI2A 4QXMA 4R2IA 3Q0EA 2H07A 2C29D 1QE0A 3CRW1 3QUSA 4OO3A 4S12A 3I01A 1JJ7A 2GGSA 1AF4A 1ZM9A 2BELA 2IPAB 3K1AB 1UP7A 4ZALA 5IDYA 4K6MA 4CMCA 3W34A 4RMIA 4F4JA 5M2QA 1PQWA 2Y1CA 5GY7A 1YJ8A 4G0OA 3V2IA 4GO1A 2GZSA 1R6XA 2C57A 4JEMA 1FQKA 3R9WA 5KCMA 5CMLA 4GZ6A 2FPPA 4TQUS 1JLKA 3G2LA 4GGPA 4O2AF 3DBOB 1X1SA 4J2HA 2J3LA 4AUNA 4XX1A 1YVRA 4NBKA 2VQ3A 2XDAA 2C7QA 1M1NB 2H3EA 5DTJA 3CKMA 7YASA 2AHRA 1P4GA 1PJCA 3CIOA 1C3EA 3PF8A 5EUMA 1SU6A 1R5NA 4PBSA 1ISGA 1OA1A 2IP4A 2J45A 4NMWA 1D8TA 4GVXA 5CT5A 5IBPA 1X19A 2IHKA 4CM8B 3KQYA 3AU8A 5EZQA 3WWCA 5BSGA 4JI8B 1HL7A 4H1TA 2AXQA 5DB4A 1LV8A 1GLNA 3LBYA 3O7WA 2EFCB 3R5HA 2R00A 4FFOA 5LKRA 1ELOA 1WA5A 4FB5A 4EW6A 3DAOA 3CMMA 4S1PA 1VBNA 1ML3A 1WJGA 3KC2A 2PGOA 4R1UA 3QE0A 5FV7A 1Z82A 2GKOA 3SYRA 4MB2A 3TFWA 2FFBA 5JS6A 3GZNB 1XDBA 3II6X 1W5TA 1PR2A 4YPFA 2LTAA 3AFNA 3VZPA 2XQIA 4ACAA 3GR6A 3O4GA 2LPMA 4W5WA 4JYMA 3EZXA 2JFGA 1WEKA 1NV9A 2WW8A 3BYZA 1H3NA 4M0LA 3LXXA 2MSDB 4KQWA 4X94A 5C2JB 3N8HA 4S3MA 5DX8A 4A10A 1RACA 5A0FA 2AIRA 5IZ4A 4N54A 1TVCA 1BQ3A 5HM8A 5DP2A 1G8GA 1I4DD 3QKUA 3AJEA 3I0ZA 4CV3A 3MQ4A 3D6MA 1VLZA 1CUDA 1TGVA 3L3BA 3QVJA 4R83A 1Q1GA 4UXJA 3BIJA 3F3KA 1AHIA 2BEWB 4AW9A 4PQFA 2B2NA 3PNPA 2IYSA 2RB4A 3A1FA 3LCVB 2JLZA 3E9CA 4PU0A 2R25B 2WFLB 4MWSA 1PV2A 2NACA 2QVGA 3D6FA 3E84A 2XTNA 2GCGA 2ZIEA 3FRHA 3NCTA 4DRXA 1C80A 3QMVA 4L4SA 2ZSKA 4E7OA 2C2GA 2W5UA 3PD7A 1N2EA 1MO6A 3IHLA 4LVOA 1NW6A 4TUYF 3E5MA 3ZCXA 5C8DA 1E1LA 3K9BA 3DZGA 1JNYA 3ROFA 1JJIA 4ODIA 2PBRA 3KT8A 1H8HA 3BXPA 5HIIA 2C88A 3CB4A 2AQHA 4BCCA 3OF2A 4TMTA 1OQAA 1SHLA 2J5BA 2AUTA 3WBKA 2QY9A 1US8A 2CCJA 1ZU5A 3KVNA 4NATA 1K88A 1DIOB 4GEKA 2CMKA 2FSFA 4HLCA 5B58T 1U8EA 1BGXT 5CB4B 1C9MA 1NBAA 2MMCA 3P9QA 1N5JA 2YYZA 1UDRA 3ONVA 3QPDA 1IWOA 4N49A 4RV5A 5EHZA 1Z7BA 2QD5A 3MJFA 4MYTA 5JTUA 2QNIA 2EU8A 4FD2A 2IKQA 1R0BA 3PU6A 4O4IA 4KREA 4FNAA 1H4VB 1L5YA 4B84A 2HCFA 5C52B 1VKOA 1NXSA 3HP1A 4NU8X 4FYYA 4TMKA 4F9GA 4WFJA 4ZOLB 3FYUB 3C15C 3DLCA 3OICA 1YOBA 1OKKD 1PNOA 3Q5DA 4EY8A 2CL6X 4GPD1 4CL2A 4F4FA 2LGJA 3GNSA 4XJXA 4FE4A 3HKEB 1WL8A 3ZWVA 3A4MA 2D7DA 2XQGA 3M6MD 2ZRMA 3RS0A 4KHZA 1VYVA 4MTLA 2XIQA 4E51A 1A9YA 3R5KA 1FYWA 4WCDA 2WVAA 2RK6A 5TC4A 2ZJ2A 4A0QA 4I9GA 3LUKA 5ADUS 4YMVA 2HK6A 2K7FA 3TIXB 3DD1A 4MMYB 1FVOA 4RTPA 4KGVA 3E9ZA 3S70A 1ZMXA 3VKGA 1W4BA 1SUFA 1PNVA 4N47A 3QKWA 4F6CA 1Z5OA 5A3QA 1M34B 1SA0A 2VA8A 3PRJA 4KE7A 2YHIB 3GRZA 4YK7A 3ROPA 5CBPA 5LLTA 1WZ2A 2PX8A 2PBLA 4TXJA 4B3FX 1NR7A 4YRSA 2HNBA 2FPMA 3KLMX 2CHFA 4TM8A 4BO2A 1IEWA 4BRSA 2QHXA 4ZRNA 3UWSA 1D9XA 4FZ5A 1RWVA 1GTRA 1T26A 1PWXA 4GP9A 4O4LF 4RJIA 1FUKA 3L8HA 1CU1A 3GN2A 5BSTA 3ZS8A 1J7JA 4MJ3A 1WXQA 3FF1A 3UICA 4EY6A 4PC6A 4GZLA 4R54A 4G1BA 4FB4A 5A5GA 5JZOA 2DKFA 2HLDD 4X90A 4CG3A 4O4HF 1SZDA 3EPRA 4R2KA 1NQUA 1Q0UA 4FGSA 3B7GA 2DUMA 1F17A 1MJGM 1Z5GA 5HCUA 4E12A 3ORYA 2PX2A 1X1RA 3OZDA 5HQJA 1D2GA 3DR3A 2FRXA 3QE2A 3B5EA 1SC4A 5CYOA 1R1DA 4RH0A 5T4EA 2C0PA 1YRQA 2XWQA 1XWIA 3GRVA 3UMRA 1NVTA 3WYFA 4DARA 2WAAA 3L7OA 5AESA 4NG4A 3BWYA 4AF7A 4EFMA 3VRHA 4O4JA 3L1KA 1Y42X 1GGKA 2BKAA 4RJLA 5LC1A 1E77A 4EARA 1G21B 4O2AB 1SKQA 2NGRA 4FJ0A 2DR2A 3C6BA 4R05A 2KS6A 2L18A 1E2FA 1DBRA 3EFOB 2R6FA 2PGLA 2CSUA 1YIDA 1C3VA 4RSMA 3LT4A 3ZCQA 4GBED 1ODIA 3EPPA 5E7JA 1QKKA 1W48A 2RB5A 1QGYA 3ZD7A 1ML4A 3AY3A 3IIJA 4LOKA 4PIVA 4ZEWA 4CDMA 5BR7A 4BLSA 3RYTC 3F73A 1U0LA 2UYGA 2GBGA 4LTDA 3TAUA 2AJ8A 2JI6A 2IZ5A 4MUAA 2HO5A 2QSUA 2JEOA 4OFXA 1PNQA 4JB0A 5CH8A 5DX1A 5DBIA 4G5FA 2XVYA 2FYTA 2GASA 4UM9D 5DBFA 5DOVA 3S2ZA 2VJBA 4EHIA 5KNLA 4ID3A 2VVTA 5KOYA 1NNLA 3LSTA 1ZJZA 4RBNA 4X8LA 2QMQA 2FG5A 1R0LA 2E49A 2X9NA 4Y2SA 2FWPA 4MUYA 2DBZA 3ZK9A 1WXHA 1KE2A 1IZZA 1AURA 3H8SA 1YE8A 5EZYF 4UBKA 1IMOA 1FPMA 2ORVA 2JCSA 3I32A 1WP4A 2XB6A 4IX9A 4UUBA 2IYOA 1Y6GA 4LDRA 3TNFA 2ZRDA 3TM5A 1DG1G 3VZCA 5ALKA 2HOQA 3FX2A 3AUAA 5HF8A 2BGWA 4GM1A 3IKTA 1AUPA 2IIBA 3LXMA 5G1NA 2VHZA 4W1QA 1Y4AE 2P62A 4BKRA 3IKMB 4U02A 2JFQA 1SUWA 3TLKA 4D8YA 5JZ9A 2PS9A 2Z04A 2O59A 3G7NA 2MWMA 2QYTA 1P4HA 2BHTA 3BMCB 4LHEA 3D6UA 3KUCA 1CZRA 1CJBA 2Z6VA 2O0LA 3G9ZA 3AERB 1CTQA 3TW6A 4CCYB 3EQ7A 2I0FA 3RYCB 3OIDA 1F3LA 1NVVQ 5CHEA 1DRWA 4LJ9A 2RIPA 3V46A 3G5MA 1LDBA 1DKLA 5JARA 5IYZB 2GTIA 2O5VA 1H94A 4EGQA 1K75A 4LMAA 3FPAA 3IR6A 3ELDA 2YQ5A 4TXNA 1VLLA 1VM6A 1ZLXA 3RSCA 1WXIA 1DFIA 3FWHA 3P2JA 4RHUA 2H17A 1AH2A 4JVLA 4R1SA 2N1MA 4UHHA 4YAWA 1ZD2P 5E1DA 5BN3A 1J07A 4Y6GB 1G42A 1JQEA 3CF2A 3KUKA 3ZR4B 2JZNA 1MO2A 4UM5A 3VV3A 3N05A 5B53A 3PPIA 2R79A 2YN4A 3IDOA 4Y2TA 5AD1A 2C84A 2JA2A 1EGHA 4ZZ1A 1UKBA 1XC7A 2FPIA 2WHPB 2ZCVA 2I6UA 3H3JA 1CF4A 3ASVA 3KETA 1G2IA 4OEHA 1J1IA 2FX2A 1XJQA 4KOEC 5AHRA 5MN5A 4F0JA 1W4CA 1A77A 3WHLA 4CM4A 1JZSA 4QO8A 1HM5A 4BWGA 3TL3A 1GQRA 1OZHA 2YZGA 4D4KA 3HBMA 2VAMA 2JFBA 5G0SA 2SKDA 3K2IA 4ZQIA 4P5EA 3OFJA 2VTDA 1U31A 1P7VA 3MCWA 4LTNA 4E2YA 2RHTA 2IWHA 3WQRA 4KDFA 2GAJA 3MTBA 2OV6A 4IXMA 5FPTA 1PG2A 4RW0A 2Q7OE 4L9SA 2QUHA 4M7RA 1OXBB 3OHSX 4M4SA 5KDDA 4AC9A 1E9AA 1ORVA 4CI0B 2OQRA 4YUAA 3UGJA 1EWRA 1Y7PA 2E21A 4FYWA 3L0DA 4YJGA 4M76B 4NBRA 5DN6A 4I6GA 3ZQJA 4D57A 4DCVA 5TJ9A 1OWPA 2NXWA 4EVQA 4B6RA 1WV1A 1I4OA 3BL8A 1U8TA 2IHUA 3L8DA 2WTUA 4OI2A 3M5WA 2AYXA 5DHQA 3M81A 4ZEOA 4DM4A 2XSZD 3ZE9A 1NVXQ 1CQXA 3E15A 4HZUA 4RZHA 1PX2A 4GP6A 2H5EA 3AJDA 3F2VA 3VSDA 2GTHA 2CNBA 4OKSA 1RQ7A 3DZFA 3P9ZA 4GKBA 4P7KA 5HDBB 3OD1A 1DIHA 3PNBA 2WWYA 1QHIA 4CUZA 3N2GB 4OJQA 3UK7A 2ZANA 1WZUA 4RKEA 5EINA 1T9BA 4O1IA 2Q1XA 4ZTZB 1I2MA 1K7YA 4JUDX 2CF5A 4QDXA 5KVCA 3BPSA 1R8XA 3FI9A 3H1FA 1EIZA 2QRNA 4JBYA 5G4KA 1U6IA 3OZWA 4C4PA 3UB4A 3KHSA 2GM9A 3W8DA 4EZEA 2C9MA 3LBFA 4GNRA 4I5FA 1MQSA 3OM9A 2ZROA 1GEGA 1CR2A 3HO8A 1KMCA 4F5DA 5JROA 1YR1A 2XMGA 1FW8A 3VU3A 4CEIA 1XT6A 2HRQA 1TQDA 2RGGA 4Q1VA 1PE0A 1ZY2A 2I4LA 1LJUA 3BWMA 1NMZA 2B78A 4NQRA 4Y7CA 2C9CA 2WDPA 4B47A 1QB7A 2OAGA 2X7JA 3O84A 3RK1A 1DIAA 3DNMA 3OEHD 3K53A 3CUTA 5I01A 1WG8A 1WB4A 2X3FA 5F5NA 1UWKA 1TIKA 2EXXA 2I4TA 2NW6A 4GPIB 5IUJC 3RI3A 2Z0MA 3MTEA 5CT8A 4DANA 3DDWA 3PL1A 5KTNA 4H3KB 2E6KA 3BRQA 1L5MA 3KAPA 4D82A 3NYQA 1FP4B 1V47A 1WEHA 2H2AA 3A6ZA 2QN8A 3U4MA 2I2BA 3DQPA 1SHUX 2PWYA 3ZNQA 1J9ZA 2PS1A 1SKUA 1KMQA 3OEEA 4TMVA 1HE5A 1URPA 3GFSA 4UE3S 4JYPA 1WP9A 5CX1A 5DISB 3QFSA 5EN4A 5TRTA 3OLVA 4DLTA 3F5MA 4ZO4A 3ZNNA 2GEVA 2OFFA 2O3RA 1DIGA 4KK4A 4EYEA 2IQIA 3NNNA 3G68A 4Q4HA 4ENTA 4RUKA 4C0SA 3IEPA 2WIFA 3GLTA 3QVMA 4KE8A 1AN0A 3EFOA 2PXXA 1OPXA 1QB8A 2ST1A 3IE0A 2OBYA 2QMEA 4JBXA 4JUFA 3KHKA 5GADl 1YBVA 3RAEC 2GCEA 2ANBA 1MAAA 1W1IA 4PZPA 5CVEA 5GJCA 5CXUA 2DWOA 1ACJA 1K86A 1RRCA 4EJSB 4Y2JA 1GP2A 2ZKIA 1PR4A 4QYWA 1Z5WA 3N75A 5FO0A 3HP7A 3GT4A 2DXIA 4ZMSA 4O4LA 1GY8A 2QMYA 2Z5LA 3F47A 3E8SA 3NGLA 1GA4A 1X7ZA 5E6SA 5SZIA 4DV6B 3S44A 3TKAA 4G09A 4EY4A 1E4VA 1FS5A 4NZYA 3HCWA 4MRPA 3ZLJA 3GELA 3D6AA 5FOUA 1UMBB 3ZHUA 4JJAA 5AKXA 4PWYA 1T10A 1QU2A 1R8JA 5EXPA 1EVQA 1FJHA 3CNEA 3TUIC 3QEAZ 1XEAA 2O8VA 3VNAA 3TVTA 5F33A 2VPWA 4BVGA 4EGFA 2IH5A 1PYDA 2QE6A 3OZUA 1U7OA 4MYDA 1TJYA 4HK4A 1CY1A 1XVAA 2AL7A 3W5SA 4H17A 3L0OA 5HCIA 5DM2A 1GIAA 4JEIA 3VO2A 2Z8XA 4QL3A 5CYFA 1U2GA 2GEBA 1L5VA 3VR3A 3BTUA 1YK0A 1O7JA 4NS4A 4LFCB 2PKEA 4HP8A 1GHTA 4KN9S 4NTZA 2H08A 4JB2A 4Q4JA 3TOSA 3CH7A 1NM5C 1RC1A 3K1YA 4GXNA 1KAEA 4GWKA 4QDUA 1V39A 4C4ZA 4D9CA 1LPSA 1XXHE 1RM4A 3EEOA 4WUTA 4ZEVA 4IDFA 2QE7D 3AUXA 4N7JA 1M2KA 2VF7A 5KJFA 4A2CA 3PDJA 2OGUA 5CVVA 3R7BA 4EB6A 2OWEA 1EXMA 3GW8A 1I01A 1SHTX 1WIWA 1E5DA 1Q7TA 1U7UA 3BH7A 1TMOA 1EWVA 1ZINA 2YMLA 3RTGA 4AJNA 3ZU3A 1IMJA 2OBXA 3M83A 2J9YB 4ZOLA 1CUVA 2FUKA 3TR0A 5LR6A 1PDOA 4AMYA 3F6EX 1IOVA 4HDNA 1BS2A 1XDUA 2BC9A 1QP0A 4M7PA 5K6RA 1I7SB 4BO6A 2AH5A 4TVKA 4Q7LA 4Q3KA 4XYLA 4H7IA 4RORA 2FQYA 3P9IA 4JL8A 5K3FA 4Z3OA 4PO9A 3PJRA 1BHSA 4JLVA 5IDWA 2J30A 1QV7A 2JCBA 1FDIA 5C5EA 2A9KA 1UC8A 4RGYA 2ZWIA 1T25A 1NN0A 4M37A 2ORIA 4EK9A 1E9DA 4WGFA 3CUYA 3LS2A 1YDWA 3NKVA 3IPAA 3CCCA 1TM7E 3KIPA 4WMLA 1LK0A 4FT4A 1Y3IA 1FX1A 3UOWA 1B42A 3OFSA 2AI3A 3WFIA 5I3ZA 1W5BA 1LA2A 1B8UA 2QY6A 4LBYA 4PG5A 3V4ZA 3D54D 1OLXB 3D3WA 1TX4B 3L4SO 3OESA 1R6DA 4CKZA 4KRXA 4AKIA 1ONPA 5HR5A 1YB2A 1ZCAA 3GAZA 3N7AA 4DLKA 1F2VA 2RARA 1MZPA 3QM1A 3P2MA 1BHQ1 4OJNA 3RASA 4DADA 5B57C 2XB2A 1P9WA 1J0CA 1K5DA 1DTWB 1Z2OX 2GD1O 2IYYA 2XB9A 5IASA 2H29A 4GOOD 3A1VA 2V98A 5HNKA 1UR5A 1WWKA 2C1ZA 1C9JA 1MC4A 1TT7A 2FEAA 2OD2A 2PTHA 2XF2A 3LGXA 4FWIB 2P5SA 3U3KA 1JFFB 2GEJA 1PQUA 3S8MA 1A88A 4WGGA 2QAIA 1MA0A 1UMCB 4AM8A 1U2DC 4MYUA 1AQ6A 1Q1ZA 3HVHA 1J00A 5ALJA 3ZDCA 4DCOA 1GRNA 5KYXA 3OOWA 4ALKA 4UM9B 3D8BA 4KRYA 1YBHA 2C07A 4HNHA 2OZKA 3A0RB 3ILVA 3B36A 3ZIDA 2VJAA 3JVEA 4EECA 4UM8B 3WDLA 1E9EA 3CU5A 3CW9A 3ZXUB 3KKQA 2BF7A 4B8WA 1RE1A 4D45A 4PR3A 5GVRA 3PYLA 4G8BA 5HJEA 3RADC 3M4ZA 1M7BA 1GPWB 4BLTA 5MN6A 1KPGA 3K0FB 4JBIA 4XLLA 1BYUA 3VTKA 3ONFA 5ARBA 3QRWA 4KJXA 3HXTA 1SC3A 1C9DB 1M2EA 3BWVA 4DLXA 5E4YA 4V39A 3R7SA 2K6GA 4J94A 1XZKA 1MQ8B 5DSTA 5B3LA 4BQSA 3HM9A 2KE5A 4HAXA 4HAYA 4JDUA 1X7GA 5BV2P 1O94D 1JSXA 2GF2A 3CZAA 3N6RA 1TF7A 1OXUA 2WVHA 5FPHA 3TSYA 3IL2A 4GOKA 1VIVA 1DIBA 2ZT5A 4N0EA 3T3OA 5FXMA 2FP4A 1NQAO 3U7FB 3EFBA 2YNMD 2FPLA 3TOZA 1WD5A 4LY6A 1HPLA 5DIZA 1HMYA 2FPPB 5BUSA 2R4QA 2X8BA 5BMOA 4IZIA 4MS3A 1ZGAA 3GO4A 5AXCA 2O3UA 3WGZA 1PGJA 4HQ0A 4EEXA 1KQGA 4TLAA 3QYJA 1VDMA 4AMZA 2G40A 1Y7IA 3GLRA 4OATA 2B4AA 1Z2DA 2ZUWA 2IZ1A 5TS3A 4BN0A 3A25A 3KSZO 2BTOA 3EWIA 4WNYA 4YCNA 1F5SA 2I4OA 3ZDQA 4CE6A 2XRFA 2W2QA 1EQUA 4L02A 3N8DA 2D0IA 1XIVA 4ZGWA 2E4WA 1RRFA 4ZI7B 3MHTA 2VTKA 2C3OA 1EM8A 4HWPA 1L5HA 4Q7JB 4DNFA 2ZB4A 3PDIA 1QYRA 3CQ9A 3TRDA 1RWOA 4LJ7A 4MI1A 3VR4D 2PZFA 3I34X 2X1HA 3KKLA 3FSGD 3FDJA 4G07A 4G2NA 2GZAA 2ZDQA 3UQZA 3M33A 4EW2A 2I66A 2PTGA 1PK7A 3UK0A 5DTIA 4B3IA 3P4YA 1MNAA 4NESA 2A84A 3P1JA 2JL1A 3L7KA 3ZK8A 4WBNB 5KUTA 2OWDA 4IDPA 4IP0A 3IOBA 1G2PA 1UDBA 4J0JA 1DXHA 3ROZA 1QIIA 3D4PA 1GAQA 5ALQA 4EPTA 4ETMA 2PZ8A 3T1QA 1TTTA 2AC2A 2FW1A 1OILA 4FYVA 4DR7B 4R0VA 1XA0A 2NT4A 1HF3A 4HH0A 5EIBD 3WWYA 4BJHB 4M1YA 5H3LA 1Z07A 1O2DA 2ECQA 2NWQA 2OZPA 2WJYA 5EIHA 1A8PA 4WKOA 3RNLA 1JFTA 1LJLA 2X0DA 1E3TA 3WO0A 5WRFA 3MPOA 5FWXA 2QZZA 1JRLA 2V7WA 3EODA 3L05A 1UT5A 4FYIA 3S5JA 1FP6A 1F9AA 4DA9A 4NZPA 3BFKA 2JCVA 1OROA 2ZJ7A 3E70C 3FUCA 2BFEA 2PRYA 3H2BA 1QYWA 4O1HA 3WOVA 4ESHA 1ADCA 1NJ2A 2FUG1 1D4ZA 2NUBA 4TKMA 4DWJA 3VAZA 3IT0A 4IMIB 4Y9DA 4ESEA 3OKPA 4P8RA 1LQUA 2GAOA 1MO4A 3LPLA 4WLOA 3IMEA 4D2IA 4LYJA 3MINA 4I1SA 2ZIAA 4UC0A 4A6DA 1M33A 1KRWA 4ABYA 3BJMA 3GFVA 4HFRA 5HGXA 4QYMA 5AVWA 1UBMS 2ZWPA 2X86A 1TYCA 3RPEA 4C0AC 1A4XA 4FFDA 3PEFA 4I8DA 4KRFA 2VWHA 2VPQA 2O5CA 1ZNWA 1RCTE 1ULUA 2H4FA 1RXWA 4EGAA 2EQAA 3LQ4A 2WU0A 3CZCA 4M54A 4DV4B 1XFDA 4KYTA 4C88A 2R5WA 2ACEA 4XDYA 1IY2A 2RK3A 4AJJA 3I6BA 5JZSA 3UCXA 2GF9A 2IGTA 1HG1A 1UC4B 2XXBA 3ICQB 2WNHA 1J70A 2R1TB 1AD2A 1I7LA 2NNWB 1UZLA 1LBSA 2FFQA 1UXKA 4QAJA 4R8VA 1HLDA 4B2YA 5K2OA 1FSZA 1M5UA 2O8FB 1GPH1 3C5VA 3IUEA 4DR2B 4RMNA 3SVLA 5KVQA 2AW5A 4Q9LA 1M72A 1QONA 1SO8A 5EJ4A 2I8CA 3RG2A 2WKQA 5ITWA 1C14A 1PTJC 2WUGA 3GEPA 4XGNA 5JWOA 4EW3A 3NBMA 1ZI9A 3PKZA 2V7XA 5T67A 1RJWA 2D5AA 4FQ7A 4ON9A 5ALEA 4WXPA 1X1CA 2FPUA 2V6FA 3UCFA 3A1NA 3ASZA 2J0EA 2H1IA 3OLQA 2RHMA 1ORWA 4B74A 3BZUA 1S0UA 1V6CA 3C4QA 5P21A 3SXUA 2V7QA 1O96A 4E3ZA 4DR4B 3U80A 3VKVA 1F8GA 5KYNA 1T5LA 2BMAA 4F04A 1N32B 1XZJA 2BI8A 2BZ1A 1MOQA 2DWUA 2QRKA 3P9YA 1EE2A 2AFIE 2O7VA 4YT4A 2AKEA 3FMIA 1EZZA 2JZOA 1EM6A 1NBMA 3EA4A 3B9BA 1JHQA 3VZDA 1Z15A 3GEGA 4IDOA 3TSCA 5JYCA 4WUVA 2XZTA 3FUTA 4GMHA 5HFAA 2XWPA 1E63A 1V3QE 4R1LA 4INZA 5CIQA 3PHIA 4D3XA 3VYUB 4BECA 2H9YA 2XY4A 2YMMA 1JVSA 2GPTA 3DE4X 5FTLA 2XUQA 4MJLA 5JS8A 1PQ4A 1WHSA 5FUBA 2CJXA 4LFBB 3DTTA 4M8NE 4X20A 2FWJA 1DNPA 3TJZA 3TQRA 2L17A 2EJBA 4EABA 2B34A 1L5QA 4ZOEA 2A1TR 1MJ5A 2VT7A 3IAXA 4X6XA 4WOPA 1P29A 1QVAA 2CXNA 2QU7A 1Y3BE 4YJ2A 3EARA 1JA0A 1VPEA 1UCFA 4AZ0B 1Z0AA 1T0IA 1PHRA 4UULA 4BYGA 1NM5A 2BMWA 2YR0A 1XZNA 1A7UA 2LP4Y 4C3OB 3TRJA 1CDEA 1P72A 4NMHA 1APBA 1ZH8A 1V26A 2QQEA 4J1TA 1K7XB 1SPXA 9LDTA 5DNVA 4BVBA 4QXRA 5FDFA 1G7SA 1XVUA 2F3SA 2K4MA 2YJ6A 4W8GA 4KN6A 4KLAA 4BFCA 1KNQA 1GQ2A 1TTQB 1YVUA 1CUFA 1Q2XA 4KMOA 2HA3A 3NRJA 5D7NA 4Q12A 1RMQA 2RI0A 5E3JA 3OU7A 1E2LA 2IUTA 4XDZA 2CYAA 1TPZA 3KCNA 4N5DA 1IJFA 4IDHA 3OWXA 3VXKA 2W83A 5DV9A 1E9RA 2P4EA 1J1ZA 3FFBA 1E8MA 3CZ5A 5IJAA 1HNZB 3AUUA 3UJ3X 2HTFA 2PS3A 1KEVA 4O4HA 3W79A 1B8VA 3GY0A 3SDSA 4EJSA 1ZHHA 3TTWA 4UPEA 4IKPA 4QGFA 3X2SA 4ND6A 4IXWA 4FNGA 2WV7A 5D84A 3RYHB 2AOUB 3W06A 2EIXA 5ELLA 3VR4H 3NGXA 5GINE 2GBCA 4RY8A 2HPAA 3FDXA 2P2NA 2MDTA 5DBHX 3HH8A 5E6UA 4CL8A 3NQ41 2JHCA 3S55A 3WK5A 2G82A 3IV7A 2CF6A 3PE3A 2KBEA 4GLBA 2J07A 4L76A 3QVWA 1KMIY 3HO1A 1VIDA 1PSDA 1SXJC 3TR5A 1C4OA 2MU1A 3LC1O 1T36B 1XMVA 4FE3A 4LY3A 4MDYA 4NFLA 5AK5A 1U0RA 5HUHA 3RYFA 1V16A 4KYVA 1NNI1 4JIGA 3K5PA 3FYHA 2XNHA 2Y71A 1IHOA 2SBTA 3L6BA 4MMXB 5K8IA 5CP8A 3ETHA 1I0LA 1HXHA 1G6HA 1P3JA 3L0PA 1K7SN 4IFEA 1JP7A 4V0NA 3RRXA 4TZ0A 1ZK0A 2JLYA 1FUIA 3C7DB 4BNIA 2VRNA 2XUAA 4MGIR 4G36A 1EFUA 1PWYE 1V7ZA 1VHQA 4CLRB 3LYUA 1V41E 3BL5A 1Z0UA 3HWX1 3I53A 1ZWLA 4LE0A 5FAXA 3UV6A 1NHGA 1ZI6A 3LXUX 1WUHS 4HWKA 3QMPA 3R7FA 3SLRA 5J9FA 3R74A 6AT1A 5IWCA 1XPOA 4UREA 2CV2A 2XJ4A 3ZQ4A 3S4YA 5JXGA 3QVXA 4ISBA 5AW7A 1K8XB 4LC9A 3DP9A 3EUWA 3HQ4O 5HJ7A 3VR2D 1AN9A 4TMZA 4W6QA 4BNUA 3A2KA 4ARUA 1T2CA 4E13A 3G0BA 3GRUA 4PYOA 2NU8B 1EFCA 3D8UA 2HSGA 1LC0A 4R0NA 1EMDA 1KI7A 2Z3WA 1U0GA 4MYHA 4UCQA 2PWAA 2ZR7A 4GKJB 1OH5A 4KBFA 2AG8A 2OQ2A 4BLOA 3JAKB 1DJLA 1KOFA 1E79A 2VZ9A 4JJKA 3ZCPA 4BKPA 2ZRBA 2UUAB 1DJQA 1NOKA 4BFZA 4YAGA 3EGWA 1V35A 1CY6A 1S7CA 3BAZA 1FRFS 1ULTA 1WZCA 4AICA 1POXA 1XTVA 3N2GA 1EGVB 3WMRA 3PVZA 3IT3A 2WFMA 2HWYA 3ZX4A 1MVNA 2JFWA 4ZTUB 2FLKA 4PLCA 3ZU4A 1Z8DA 2I1LA 4KQCA 4EG5A 1JF8A 1TKCA 1V4BA 1KSJA 1R7RA 2P2LA 2CLLB 1O95D 2ISQA 3CEHA 3DLAA 3MTGA 1B73A 2PMCA 4P80A 3HXLA 4RANA 3VSEA 1V7CA 3GCDA 1P77A 4OHOA 4GP7A 5DK6A 3KOMA 4DQLA 4EMBA 1GZ3A 3QVGA 4QUEA 2PGIA 4GOLD 4TL9A 3A7DA 3QTLA 1O97C 3Q98A 3I5AA 3L04A 4OK6A 5DHSA 1DRKA 4BGEA 4P83A 5LB2A 2I29A 3UJCA 3A10A 3LT5A 4RMHA 4XLZA 4GU5A 5EZSA 5GTDA 4A9AA 3CWCA 3ESYA 3IBGA 5JR3A 1ODJA 3DSRA 2WAYA 4N39A 2WF8A 1U8AA 2H2DA 1H2FA 4YBRA 5HXAA 4PYIA 5L95A 3QVSA 2BFCA 2VATA 3GQBB 4FEYA 3QX9A 4JWKA 3TPCA 4KMSA 1EFHA 4BCBA 1AZLA 4XFKA 5EJ2A 4I1RA 4AY6A 1JTVA 4CIDA 5BXYA 1K7CA 4A8PA 4P4UA 4GGMX 2QIPA 1VA5A 2AX4A 3RR2A 3WAKA 4BFLA 1JBKA 4DA7A 3PHGA 4DC9A 4ETNA 5COBA 1G3IA 2G09A 3ZGLA 5MHTA 2Q6KA 3RHZA 2HSWA 4Q3EA 1JECA 1T5IA 1PQYA 1Q83A 3EGCA 3ENKA 4M9XA 4NFYA 3F6RA 4GI5A 3D3NA 4BNKA 4ARBA 5A62A 5TMPA 3SWWA 3WFZA 2LKDA 3VO1A 1HE2A 3HXKA 3CPJB 3SEFA 1U0EA 4HMPA 1CY8A 1CLUA 4Y2RA 4XGKA 5CK4A 1LX7A 2C7BA 4Y6OA 4KFRA 3EQ2A 1DEXA 2A0FA 4JOBA 3ZQKA 5BN3B 2P2CA 5J4VA 1K5GA 1MT0A 4DMFA 3HGMA 2QI9C 3DE1X 3N58A 5LZ8A 1QIHA 3EW9A 5JY6A 1Q7GA 2C42A 4MVJF 1TO1E 3FDZA 4QDJA 1QMGA 4CUJA 3ABSB 3NW9A 4CKYA 4LOAA 4J3FA 2UYOA 4Z86A 5T6BA 4EJMA 1ENZA 1OI4A 3BK1A 1SH7A 3OCXA 3M4NA 4M0KA 1ZJJA 3UIEA 4FYHA 4P3PA 3G0DA 2OM2A 3KZNA 4X84A 4CMBA 4X1KB 2AN4A 2DKOA 2EWMA 2P9YA 1NRJB 3H4IA 5CXSA 4B3BA 2QUKA 1OH6A 1AXRA 1QTIA 4G89A 4YRJA 3QFHA 1SD5A 4TLLB 2Q1WA 1L6IA 3OZAA 5ALWA 3TQOA 2WUEA 4FMCF 5IJWA 1GD1O 2Y0CA 4LJSA 4KR2A 2ZP1A 5B7NA 5DZSA 1SR8A 4BMXA 3D2AA 2GCOB 3DZDA 1ZR2A 1THGA 5JS1A 4CF7A 3NTLA 1IWBB 3LP5A 3CTPA 2V8OA 1TAUA 4M53A 1K0UA 1TUGA 3HU3A 1NNEA 4F6RB 4OB6A 1Z7EA 2UVQA 3PFWO 4MUMA 2ZUBA 4II3A 5SY4A 4V2IA 1TF5A 5AYVA 1LKZA 4D74A 5I7EA 2C9YA 1Z08A 4P3XA 4ZAVA 5KVAA 2ZJ6A 521PA 1L5LA 3L6RA 1VKNA 1VKJA 1B2LA 3OMXA 5LIRA 3H5TA 2OESA 4E5UA 1OASA 2J46A 1C7JA 2QM3A 4KLNA 2O8NA 1NVVR 1P0FA 1VLQA 2ZYAA 1NDQA 3W0LB 3MGKA 1MXHA 2A35A 5ICSA 1I5RA 1ESNA 2H5IA 4P9NA 2DH6A 3H4TA 2IOHA 2FZ5A 1FTSA 1YE5A 3K32A 3PS9A 4PQEA 1OFGA 1RWNA 3DBHB 1GKLA 1T13A 1L8LA 2QVBA 4UAJA 1HY3A 4YBZA 3RABA 4YALA 2D8AA 5KDLA 3O7MA 3P27A 1O8BA 1NPYA 1KY3A 2R6AA 2G0NA 4RTQA 4LF9B 3I1IA 1Y8ZA 2DVMA 1EZ1A 5SYMA 5ESWA 2R7KA 2GETA 3N2NA 4C0LA 3KQTA 1N6OA 4ENVA 3O4FA 2VF8A 1XN4A 2CYBA 2NV0A 1Y63A 2OCDA 3I64A 3IUJA 4JYCA 3AWDA 4NCBA 2O8DB 5ERYA 4EHLA 2I67A 3AEKB 2IV2X 2F62A 5EL0A 2B98A 4B46A 3GWGA 2PANA 2VP5A 1U1CA 1NKTA 2HSEA 3F78A 4GKVA 3W2TA 4M6WA 3A26A 3I39X 2QTCA 4G0ZA 2W6CX 2YFHA 1MX1A 1P2VA 3E9YA 3LY5A 4PLYA 4DDKA 4RTLA 4QGGA 3SS8A 4HFNA 4CQJA 3KOUA 4QU9A 2AN9A 1JIIA 3OJLA 5JSHA 5K01A 1B6GA 2QG6A 5ALMA 3OIGA 1H93A 3SPXA 3L7NA 4FWBA 1FIUA 2ROQA 4V24A 3EXEB 4DXDA 1Y48E 1I2DA 4BFWA 1ZG3A 2XOEA 1BEEA 4E7PA 3PXDA 3TJMA 3GCXA 2XCUA 5CBKA 3W8FA 4IVRA 4EHHA 4R6WA 1QVRA 3T34A 5F3DA 5H4HA 3KWFA 4H08A 1FUYB 1YS4A 4QOSA 4V0LA 5GZ3A 2C1EA 3UAVA 4YFYA 1IBKB 1EPUA 1Y8RB 3IERA 1J8VA 2EP7A 4PN7A 1ONBA 1JFRA 4GRDA 1T35A 4QVIA 2R0QC 1ZN9A 2MYNA 4Q4LA 1QGUA 3OURA 3H1GA 1N3YA 3D6VA 1QBGA 2CEAA 5E9AA 4PC2A 3QFCA 2OYCA 1JR4A 3IAUA 4PHTA 4WADA 2XZLA 2UUBB 1MOPA 4TWAA 3PZRA 5L3SA 3IOEA 2BP7A 1NF9A 4YP9A 5A1JA 3HWWA 4IWNA 4JJ8A 2XRZA 2Z6QA 1ACLA 2HXGA 4UDXX 4OI1A 3VH1A 1NAIA 4M0CA 5DT9A 3JAWA 5I9SA 4MZXA 1H65A 1PL6A 4WZAA 2X0EA 4AIRA 1IBSA 1JU4A 1Y5NA 3K0BA 1F4LA 1OFTA 4TLCA 1XLVA 5ALHA 4ZKEA 2D3TA 2ZJAA 1P8JA 4HQ6A 2HBYA 3R3UA 4L3OA 2A88A 3SSNA 4R2LA 1L7QA 3LWDA 1GTL1 2X0JA 4EG4A 2XCSB 2C7OA 2FR0A 4UCXA 4R2HA 2X4DA 2IU3A 2RMKA 2A4MA 3OJXA 4XX0A 3JD3A 3H0EA 1ZRSA 1ENPA 2DPYA 4DT1B 1IQ0A 5KYVA 3JVIA 3UZUA 2FEOA 2GVDC 4OGWA 4BNNA 2DECA 1LNQA 3QFTA 4ND8A 4TQ9A 2Z9CA 3L77A 2JAHA 2GILA 1MFZA 2WSBA 3AETB 2WRZA 2RHGB 3QKSA 2D00A 2C58A 2R7AA 4LN1A 4X1IA 4TRNA 3BTVA 2AMYA 3EBPA 1ZONA 2QRQA 5CURA 4AZTA 3VJMA 4B6QA 4BWFB 4UATA 1BJRE 4ERXA 2BGTA 4O2RA 3AUYA 3MJ4A 1HE3A 2JA1A 2Q8QA 2RGXA 2X0NA 2BL4A 3IP8A 3PC3A 2MHCA 4DG8A 4L5BA 5JNRA 2H2WA 4ZZ2A 1C7QA 2NYRA 3OHPA 5EYPB 2VAVA 5E0KB 1W85A 3OX3A 2ZM6B 2PM8A 3SZUA 3GGCA 5CB8A 2IS4A 5ICFA 3SZMA 5DT2A 1H6AA 1P80A 4TMXA 1M5TA 3OWOA 2P40A 4P3NA 4DE5A 4TKZA 4RYLA 1ZPDA 2IF2A 4EF5A 5KHLB 3ML1A 1EJBA 1NWCA 5EQJB 2HHCA 5JATA 5JVDF 1ETUA 3O4VA 4JX8A 3GRRA 3TFOA 3T7CA 2C4HA 4HRYA 4MPPA 1QWOA 1MV8A 2V5VA 3NANA 2XNSA 4YYEA 5G02A 1P2UA 4G67A 1AUQA 3KLOA 5JSKA 1KBQA 3SN6A 4GAEA 1QHXA 1NW9B 3C3KA 3FRIA 2COEA 4C5CA 4ZV7A 3LX6A 1F0KA 2OXCA 1KARA 1FXSA 1MC8A 2ZBUA 2YVAA 4ZAGA 3NHZA 2VPYA 2CJFA 3L92A 3RRMA 2Z3VA 2RG7A 3NOQA 1ZL2A 4AZSA 1PR6A 4XDGA 2VNJA 1WY7A 3ILYA 2PD4A 1A9ZA 1OY1A 2JCGA 5BRJA 3GQVA 1YIOA 4D56A 1PGQA 3R9XA 4ZVLA 2CJWA 2ONJA 4FHEA 3A06A 1W9MA 5M7EA 2ZTSA 3BKWA 1ID8A 4O4JF 4WCFC 1XV5A 2OO5C 1C9NA 4GWGA 3DC7A 4RK6A 2H2FA 3M4JA 3DMRA 1P73A 2LBPA 2R7MA 1RI5A 1XTKA 4MV4A 1VXOA 2OLEA 1OX5A 5EPEA 1J4AA 3VJKA 5C32A 5C8XA 1XQ6A 4D3ZA 2VOJA 4EMUA 2QN9A 1ZNYA 3SYNA 1S4QA 1M66A 2V6GA 1H9AA 4E0BA 2Z57A 1FP1D 4K6GA 3PTZA 1UWVA 2W6NA 3NT2A 2FAXA 1RHKA 4QBHA 4ZQCB 5ES3A 5L3ZA 1A3CA 3UT5B 1C0PA 3ROGA 3KRTA 1GZSA 1EFKA 4PZLA 1GNVA 1R88A 1Q0ZA 2RGBA 2RGWA 2VXOA 2Q2OA 3NIFB 3PC4A 4EOGA 4FFBA 4DKXA 3TIVA 2WYHA 2ZIFA 5AK3A 4MUHA 1PX0A 2BHSA 1RCUA 3R40A 4TL8A 3I12A 2XXAB 4XASA 3LCMA 4FFVA 4E32A 2PT7A 3D2CA 5J40A 1I0IA 3LD9A 1T5HX 4RTOA 4XKJA 1DAEA 2GZMA 3FGZA 2A7QA 4N82A 3T5MA 1YFZA 4UCFA 2X2PA 3R4VA 4J3NA 1WKBA 5BRNA 1EUZA 1Y33E 1EVJA 2GTPA 5PNTA 4UQLA 2HKIA 4NDAA 6ABPA 3INGA 3V42A 4MWOA 1QH1A 1GUFA 2PQ2A 3PQ2A 5IT0A 4LGYA 2J7PA 1ESMA 1MJGA 1XCPA 2JIDA 4TL7A 5DI3B 4XR4A 2SKEA 4WZAB 2P9HA 2VYQA 3RK0A 3I9FA 4JJZA 1QDEA 5ITSA 5DHPA 2VPZA 4X00A 1FDTA 1O54A 3IAAA 1UPBA 1S2NA 4OXKA 1E6MA 5JXHA 1EUCB 5M34A 1AC5A 3LFTA 1QHGA 5KYYA 3FZQA 4WXMA 4RGQA 1VPWA 4IJWA 3M6AA 4GMFA 5JXJA 3LQ2A 4LC1A 2C92A 1X1EA 4B6SA 5IHXA 5IW8A 3QPCA 4L5YA 1J24A 1YK1A 1ZUNA 3NHLA 3KJIA 4EX7A 1E60A 3OKAA 2Z2XA 3WLHA 4QGSA 5HYVA 2MYUA 5C1OA 1H2HA 1A98A 1C8KA 1T8YA 2HGZA 4AJKA 4D5GA 1UPXA 1D07A 2ISCA 3SR4A 1NL3A 2CFSA 4BV9A 1CUSA 2BM9A 5LQMA 3ECAA 2QVXX 3VPGA 4YI3A 3JZDA 4OX9Y 2GYVA 1XD2A 1BD4A 2PH3A 3AESA 2X9QA 5ALSA 3DXZA 1D2CA 4M0EA 3JVVA 4J90A 4V0KA 5KSZA 3ZCVA 1EHIA 1R2QA 4ZPXA 1R6VA 3AUFA 3JWEA 4L0MA 1MB9A 2IYXA 3SHQA 1O94C 2B1JA 5KU1A 5T7BA 3PNMA 4IOJA 3P9RA 3FYCA 4ZQBA 2Z2KA 5G53C 2BM0A 3DDUA 1K1EA 1JAZA 3L1IA 1CWUA 2W6IA 3OTOB 4GL2A 2JGIA 2VHEA 5TT0A 4EUNA 2OL4A 4H1UA 3WLQA 1TLLA 3M4XA 3C0KA 2I7VA 3D5EA 4G63A 4MMZB 4FR0A 2P65A 1D6MA 3SBXA 1W73A 4JVNA 4LY0A 2C7RA 3ZTTA 4V02A 1TZJA 2DM6A 1IY1A 2A9QA 1KMHB 3A4VA 3BMNB 3LOQA 1E2GA 4Q05A 3ROEA 3M3DA 2BFPA 2GD6A 5IC4A 1GTG1 3KU4A 1EP9A 2G25A 2AFIA 4FR5A 3HSSA 8GPBA 2ZQ5A 2MR6A 5EMLA 2P2GA 1IUPA 1TUBA 4D8WA 4HDCA 3AP2A 5KNBH 2IX3A 1BE0A 3RC2A 1SK8A 1PT9A 1SVIA 3L0BA 2J0SA 1FBTA 2CZCA 1QH0A 2G0TA 2P77A 2IPMA 2QX6A 5AI0A 4BC0A 1MKYA 1WPQA 2HYIC 5L3SB 1CVIA 4YR7A 2VF2A 1CUWA 3ADPA 3S1LA 3QLVC 1ZD9A 2DPHA 3AJRA 3ORFA 3HN6A 5TQVA 2IBTA 1T6BY 2J59A 1E5QA 3D8HA 5A3VA 4TGLA 2HEIA 4EPWA 2Z9BA 2X15A 2O06A 3L2OB 3LZDA 4KWIA 1JDBB 4R7TA 1W8IA 2DH5A 2G63A 5E4TA 1RKBA 4J29A 4P4SA 4H6XA 5LIPA 4RZUA 1Z2CA 1JHXA 1WQ3A 5KYKA 1RHQA 4Q02A 2QP9X 3ZWPA 1B93A 3CVUA 4LFAB 3FGOA 2Q5JA 3EUEA 4PAWA 1P1BA 4Z9FA 3U1TA 4JC0A 3EGDB 1NVKA 5IXJA 5KKNB 1KQOA 5BSEA 2G8NA 1EX7A 1WSAA 2JANA 1Z6PA 1L2TA 4HRAA 4L27A 2OFWA 4M1KA 3QEMA 3U39A 1CPYA 1LFAA 3PL5A 3GLGE 1Q0RA 4KPEC 2HRDA 4LOJA 5AVVA 2R5FA 1AA9A 1XQYA 3QHQA 2XA9A 2L2QA 3RFXA 4EHKA 4WFIA 1TQHA 1EVKA 3RAFC 1N1MA 1X7WB 1RS0A 2YWDA 3D0OA 5GJWC 4AK9A 4GZMA 3PEUA 3WOHA 4EWLA 5JZVA 4RCYA 2CXXA 5AI6A 3SS7X 3EIFA 3WWDA 3ZWXA 4DLBA 5BW8A 3BSWA 4NWIA 3I9V1 2WPDD 3NFRA 1NP7A 3P4UA 1AZTA 3IESA 3MTDA 2RI1A 2PU5A 4D44A 4R68A 1WKVA 4ZYUA 3G0HA 2FFAA 2VIIA 1EI9A 3O73A 4G84A 2O7NA 4ZAWA 4TTVA 1J0XO 1Z2EA 2N75A 4X1KA 4YJFA 1AMNA 3PEWA 4Z3DA 1Y4UA 3GPCA 2QTNA 4OQMA 3U40A 3GLQA 5H7XA 1SULA 1BROA 3RKRA 1BQEA 1UH5A 2Y93A 2GJ4A 4HI0E 4AURA 4PIPA 4PW0A 4X1OA 2QTFA 2QNBA 1QHHB 4PTZA 5AW2A 4ZZIA 3HL0A 2DRIA 2VRBA 4C05A 5IK2A 4BQRA 3MYYA 2WK1A 3MJCA 1K66A 1LPOA 3P0HA 3S68A 4MQFA 1BMQA 3NHRA 3WNQA 1W46A 2Y1KA 5GV8A 1CQJA 1H4TA 2AG6A 3LG2A 4U8HA 3PGJA 2IIQA 3WLNA 5LQDA 3PIDA 1YZHA 1S1CA 2Z4SA 5CA0F 3EIEA 3GA7A 1AGXA 1WCYA 4XVQA 4E2ZA 1LDGA 1A2BA 4YUWA 2ESRA 2L0XA 3PT5A 2BI4A 1XJCA 2IK8A 4GIBA 4UHKA 5CVUA 2UZ3A 3FFTA 3IA7A 2FN7A 4XJSA 4CT5A 3WNVA 4WKPA 2ZCUA 1P75A 4PY2A 3TI9A 3B51X 1Z4QA 1S1MA 1DG9A 1NDHA 1R0KA 2CHGA 3E9RA 5JCXA 4AJ4A 4DW8A 2X76A 3MELA 2XEXA 3LE8A 4ENUA 2B7LA 2W0MA 3OZ7A 4Z4EA 1KBZA 1CIVA 2BFFB 1XZFA 3OE5A 2R7NA 1R4ZA 4QYIB 3T54A 3UC5A 2XHZA 3VNSA 2JLQA 5KQRA 2ZI5A 1O3YA 3M8KA 2I5PO 3LGSA 4YV0A 2VAWA 3A31A 4OREX 3B52X 4PVCA 3S2IA 3RFTA 5HK8A 4DAEA 4YAUA 3IMKA 5LDHA 5AWFC 2ID8A 4AY3A 3N7TA 1QR6A 5FFMA 3JYOA 2QUIA 3ZEAA 2QB5A 4C0KA 2PGJA 4EY3A 2D7CA 2V3VA 1WUIS 3DMNA 1RWQA 2WAOA 1NE2A 4NSNA 3DYIA 4BIMA 2O2DA 1REQB 4K86A 4JI3B 1NMEA 4MGHA 1GCAA 4QT4A 1O6BA 1WB9A 2C5BA 4FN4A 2R44A 4NYIQ 5TX7A 5I7FA 3NX4A 1PZMA 2A5JA 2WM9B 4M2LA 5IVIA 5TGDA 1AUOA 1NI5A 4ZAZA 3ZE7A 3WL8A 3C3XA 4H7HA 2WU4A 3O8CA 1D4FA 4CTJA 3B3QA 2ZPAA 1YASA 1L7AA 4XWAA 5ANRB 3NOXA 3PQ8A 2JH9A 4OJKA 1M54A 4WL0A 4B33A 3HK2A 3NHBA 2FPRA 4KXUA 1E3WB 2AD5A 3U0VA 5ISMA 1AZSC 1THTA 2NZWA 3ANYB 2XMDA 3JASA 4KO8A 4PIMA 1Z6QA 4Y2QA 4YTEA 3V4FA 5AM3A 1MEOA 3H5AA 4D81A 1EXVA 2BEVA 3K70C 3RQSA 1CE8A 4CEHB 1I8TA 3FIUA 4IIFA 5DM4A 3TZHA 2NX2A 2H4ZA 2HXYA 2XUIA 5A05A 2Y68A 2RK4A 2D54A 4KQXA 1JXOA 3S7ZA 3LAWA 3IJ5A 1IOZA 1TGYA 3OQBA 2FDXA 2X6QA 4HH3C 4K9OA 4LJ4A 4PGFA 1K3TA 3WDSA 1TW2A 1U28C 2C4TA 2J4DA 3BSFA 1GQSA 4UBNA 3HJUA 3PQ5A 1H5QA 4J7UA 1C8BA 2OOSA 3HWSA 4BP1A 1KMHA 3BMNA 3ABOB 1JQJC 3VH2A 2ZVPX 2CHEA 4PC1A 5AW1A 5EXXA 3MMPA 2ZJYA 4RNCA 3MCAA 4RD3A 5FOQA 4WK6A 2D0OB 4FN5A 4K9NA 1NMQA 4I4IA 4IDGA 2A8YA 1EVZA 4P31A 3CV3A 5GPBA 5CFOA 4F93B 3FY4A 4OLHA 1E4EB 3DEJA 1IULA 4OM8A 3SBOA 4BRZA 5IZCA 3NBFA 2ZUEA 1AS3A 3AF3A 3NO4A 1KNXA 1VMDA 3OIUA 1BCSA 1NIPA 1LRKA 1Z75A 3G2JA 2BDTA 3O1HB 2NUAB 3T5TA 3ZKWB 4DMKA 1A9OA 1DLJA 5IDXA 4I4TF 5LU8A 1HV8A 4UMDA 5ICEA 3VSCA 1KZYC 3U5TA 2NAPA 4JUAA 1UOEA 2WSIA 4KNVA 4PZ9A 3V8BA 4U0JA 1E1YA 4U8GA 5IVKA 1R4MA 2VNHA 3JD1A 3KSAC 2Q5LA 3GFFA 3MMXA 4PGMA 5DW3A 2LIPA 2TMKA 2Y1GA 1WSDA 3IAM6 3IP6A 4LAFA 3V2UA 4C07A 1WW2A 1P1FA 3GN1A 2BIFA 3L0SA 4G5QA 5D87A 2WICA 1N5RA 3AVPA 4LXXA 4M0FA 2PQMA 2OM6A 1VJGA 5FB3A 3OCUA 2ODNA 1YRLA 4MWZA 4FTWA 4L78A 2O0JA 5FWYA 2G7MC 2HWUA 5IN5A 1IM2A 1KK2A 1YKSA 2YOHA 5ENZA 3H9QA 1C0LA 3RUHA 5D5QA 1CRZA 3U26A 2NXEA 4YLEA 2RH9B 3HPQA 1QRAA 3MQ2A 4X95A 3T9CA 3FOZA 2IH2A 2RGNA 4N0MA 5C3UA 3WKBA 2FETA 1RQRA 2Z09A 3ETJA 2EGUA 3KM0A 4RFLA 2FEMA 2PMFA 5J4YA 1ODTC 3G82C 4QUAA 2NQ8A 5LZ2A 3VZBA 3EH2A 4LDPA 1COZA 4WA8A 5FO1A 2F3UA 3SKVA 1BGVA 1GSIA 4TZKA 5IAOA 2H92A 2JIBA 1N36B 1G8HA 1RAHA 4LKOA 1JB1A 3DAFA 3NASA 2HSDA 1SPBS 1IK6A 1AJEA 3SLGA 3G9TA 1AGRA 3L4BA 2VLBA 3NBYC 4IDAA 3U9LA 4Z51A 4MULA 1FNNA 1RVDA 5M04A 1JEQA 1T24A 1PVVA 4BO7A 4EITA 1W7AA 2CBGA 2V7TA 4ALLA 3E3MA 1ISPA 4K87A 5EJAA 4F11A 3PXXA 1QC5B 3LYLA 1JAHA 2VHXA 4LZWA 3LLVA 4QA9A 3WWEA 1M0WA 3TD9A 4W5TA 2P1DA 4XOUA 2IWRA 3FXAA 4PBRA 1NULA 3UH0A 4YRZA 1QLWA 2WV9A 3ENNA 4HWRA 2C4WA 5BW5A 5IT5A 5CLHA 2H2HA 1LVGA 1RAAA 5KOHB 2P41A 4PLZA 4YRFA 4IWYA 4PNEA 2P6UA 1XEWY 3TJRA 2M32A 4MV0A 3QPUA 1KYXA 1NQTA 1Y3FE 3T4XA 1OHHD 2R6DA 2QZPA 4K9QA 4QOGA 3JWPA 3KXDA 4B75A 4ZPJA 2RD2A 1G0OA 2AJTA 1GRVA 3I4FA 4Q66C 1CRPA 4G23A 2PRIA 5FNVA 4GICA 3VKWA 4ZREA 1NVEA 2O2HA 4TS3A 1N2GA 3JQDA 1JQKA 1DC7A 4KI7A 4LYGA 2BY4A 3PC8C 4OP2A 1TVKB 3IPYA 1GKIA 1LXCA 2NSLA 3OCJA 1SOWA 3R7LA 3WBFA 1XEXB 3VYWA 2VDMB 3A4IA 3OE4A 4YGXB 1IM8A 2FX5A 4QELA 4WCFB 4MPTA 2PQ0A 1YZUA 4AZWA 4JODA 2YHAA 1M1XB 1M8GA 1QDUA 1JT9A 1N9KA 2R6ZA 1GNPA 3EIWA 4JNCA 5TB5A 2IY7A 1A5BB 3BUSA 5LQRA 1FUEA 4BKUA 1XFAA 2GX6A 2YDXA 4UD6A 5IKMA 1MUUA 3F90A 3JWHA 2OGTA 1G6KA 1J25A 4PRZA 1YZLA 5DWVA 4A5SA 2H52A 1D7AA 1TI7A 3KPUA 4Q7EA 4HEHA 2XR1A 4RVOA 4XUEA 1NPDA 5FUXA 4O2BA 4A2WA 4BAZA 5HX7A 3L40A 5CLGA 3O8DA 1FNDA 3B1XA 1WR8A 4YRKA 1NQ5A 1P9RA 1GOTA 5KC8A 1QRDA 2H1HA 1GT6A 1CR6A 3H2HA 4G56A 1MIOB 4MRMA 1ZRNA 5ILGA 3SOZA 3ETLA 2IPXA 2PV0A 3S5UA 1OXSC 3DTVD 3F5QA 3WGTA 5AVRA 2BSQA 1MX9A 1KL7A 2C5AA 1T8TA 3TUZC 4CMHA 2UDPA 1FX0B 1TCAA 1Z06A 2WYUA 3G2NA 1TAQA 2NNLD 5KOJA 1MVLA 1NF3A 2I55A 2R1VB 4G1VA 4TX1A 1YQUA 1FVHA 4E5NA 3LQQA 1U2SA 3Q3IA 2IDMA 1RRPA 3HE3A 4NOLA 3K72B 3KVYA 4A8HA 5JBNA 4DY6A 4U7WA 1U6JA 2DULA 5HZGA 2EZ4A 2VH2A 2CLIB 2WHQA 4LY9A 4LQ4A 1C2TA 4BRUA 4UZSA 2VDWA 4HZIA 5L40A 2FPSA 1H1TA 4FFRA 3SXPA 4CKBA 1ZD5A 1U4NA 1M8KA 5EE1A 1UZUA 4GVPA 1V37A 3SSMA 4ENQA 1DRUA 2PA0A 3IC5A 2ZBGA 3LGAA 3N2EA 4JLPA 2ZVQX 5KO2A 4R71A 1ZJ4A 3C87A 4MYSA 3NPMA 4QM7A 3PRKE 1IG0A 3R3JA 4KFSA 4CL0A 5FWXB 4ZC1A 1XKXA 3D3EA 4RTMA 1XPUA 3OLCX 4IHAA 3SBEA 3JAWB 3IKJA 4ZK6A 5F1YA 4GHWA 3ICEA 2NM0A 3V80A 3NBZC 4GLLA 4BQEA 3C41J 1P2SA 1SWVA 1IYZA 2NO1A 4X5OA 3FD8A 3L7MA 1U28A 5JC1A 1Y5RA 1V96A 2QTHA 3SAJA 4C2BA 5HEKA 1EBBA 3R3XA 1PNTA 2CFRA 2RHOA 3BDIA 3PC7A 1PGOA 4YJ2F 3F74A 3BIXA 4S2EA 1Q2UA 2AOTB 2QXTA 1IXYA 5AJVB 4LKRA 2XW6A 1RZ3A 1VJRA 2R8XA 2R1TA 1IUOA 3G17A 3GPDG 3MBIA 4OLFA 5AOCA 3E3LA 2AEJA 1XB2A 4BAUA 4DL9A 5ADHA 1DDIA 1LNSA 2GZ2A 4I3FA 4X0EA 2HV9A 5AJYA 5JZMA 1NFQA 4XGIA 3CBQA 2QTTA 1U02A 3OETA 3QEOA 3RS8A 3T7KA 1Z36A 3WK6A 2H6EA 5JD5A 2O1SA 3LHIA 2UYCA 1NRIA 5JJIA 2WQZA 2XE7A 5EMJA 3PHLA 2AK2A 2EWVA 1E6UA 4HD8A 4MAMA 1JHAA 1HDXA 3RGGA 1N6RA 3AI1A 5KREA 3TSZA 1IBCA 3G3EA 3WLAA 3GEMA 1JMYA 2OTCA 4TVBA 4EUFA 2QD3A 1G98A 2UYQA 2Y2UA 4IGFA 1J5PA 3HDVA 3IAEA 1PQPA 3SMQA 3COVA 3N2ZB 4Z4CA 4FKBA 5K6TA 2J1LA 2Q5QA 1C4XA 2IEIA 1L4EA 2P9QA 3QQPA 4IIVA 3WTBA 4ER0A 1TAGA 2OXFA 4LRYA 3N8GA 3RROA 2W8BA 4KPUA 1YL5A 4QBGB 5DW0A 3D7NA 1EFRA 3RUDA 4D41A 1G8SA 4U7PB 3V1TC 3SK0A 4MV6A 1KXJA 3HI4A 2OK7A 4QNNA 3CR3C 1Q21A 3BULA 5FUQA 4CMEC 3RSGA 1F1JA 4BMVA 3AYXB 2IT1A 3MJDA 3VPCA 1DC4A 1U9IA 1WDLA 2Q3FA 3H5NA 4QFMA 5LFAA 2IOQA 3NIBA 2FN9A 4FW9A 4HXEB 4HEA6 1DKMA 2UZ1A 3EN0A 1GXSB 3H1EA 1QTNA 3BVPA 2PZKA 3OLWA 3L4KA 3FWYA 4QPPA 5DM70 3R3YA 3FLEA 5JSYA 5FPQA 4NBVA 3BDVA 1LSOA 1ESZA 2HA0A 3AVOA 2RFLA 2ZE8A 2R8ZA 3LPDA 3FYUC 4KPUB 1LUAA 2GSDA 2IEZA 4GDMA 3SM9A 3ZHYA 1Y8CA 3CSUA 2J7KA 1PG5A 3CH6A 3WO1A 3LVRE 1GZ6A 2DYKA 4PX5A 1RXVA 1T9AA 3WB1A 2E5FA 3HVJA 1JEYA 5B7PA 2ZR0A 3R5TA 4LCJA 4LQDA 1W44A 4WLFA 4HAVA 2GRAA 3BERA 3PEVA 4WI1A 3M3HA 3ZU2A 1U5BA 5J59A 1GG2A 3BDAA 1GZ7A 2IOFA 3COJA 4URZR 2Q9BA 5K8TA 4HKTA 4PHCA 3IS3A 4AZ3B 2HM7A 3NV9A 4L6CA 4NEHB 1QX3A 4NOKA 5IVDA 1OJ7A 1I9GA 4GXRA 2H31A 3C70A 1H22A 2B2XA 4MWEA 1L8XA 4R3NA 5JDCC 4TMFA 1T9CA 1EDEA 5H0IA 4YP1A 1WMBA 5C7IO 3V4PB 1OLXA 3LT0A 1PJTA 1QX4A 2FZKA 3EDMA 3P96A 1J5EB 1XP5A 2Z08A 3WYAA 1T1JA 3GGGA 4LRUA 1MJNA 4MUFA 3U4QA 1ATIA 1OT5A 1JYEA 1Z0IA 2D13A 4AS2A 5CA1A 2ECOA 3OQ1A 5F64A 4NG5A 5NULA 4JT8A 1G8AA 4BFSA 4COKA 2JLAA 5DKFA 3Q8WA 2MSNA 2Y6UA 4JYZA 1MH9A 1P5ZB 1T91A 3D1JA 2I7XA 3N8NA 4I4CA 1K97A 3CT4A 3AEQB 1BDIA 5DYGA 5K3FB 3IV6A 1NX9A 2D0PB 2A0XA 4NENA 5CD1A 1A1VA 3PJGA 5H8WA 3FDZB 2YL2A 4FYXA 4JUBA 4BO1A 4X7RA 4N01A 3WRXA 3BRWA 5KWSA 1EIWA 1HT0A 1UF9A 2BW0A 2XKJE 3KE9A 1HORA 4HDNB 4YP0A 3R75A 1H2AS 2HT6A 4RL4A 1R6UA 1W25A 4YRPA 2W2OA 3NUQA 3PP8A 4KGZA 3KPYA 4AG5A 2P0AA 4YRQA 4DLWA 3LUPA 4B7UA 4UOZA 3I73A 1DCKA 1JUDA 1JDSA 1OV4A 1Z6TA 2CFOA 2IYUA 3AEZA 3MM4A 3AK4A 4A26A 4BDTA 3TSAA 4C14A 2B69A 2XODA 3IHWA 4O6VA 1F7UA 2YYAA 3RV3A 4C43A 3BEDA 2HA4A 5CJPA 3RVDA 1IEQA 4CKBB 1Y3AA 2XMZA 3HFJA 3PC2A 2YS7A 4YAJA 1DADA 1QJ4A 1PR0A 4Z9XA 3TOXA 1ZK4A 4WZBE 4YUZA