5FDFA

Crystal structure of the monoclinic form of thermotoga maritima acetyl esterase tm0077 (apo structure) at 1.76 angstrom resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
total genus 124
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fdfA00
1XRNA 3E3AA 2JGJA 2VTVA 3DEAA 5CW2A 1TAHA 5ALUA 2WSLA 4IH9A 4QDZA 4J7AA 3RARA 3N2ZB 1SCKA 4Y9SA 2CUTA 2XMSA 4UHFA 5JASA 3WJ2A 1VE7A 5A7HA 4UUQA 2YXPX 5AI4A 1SCIA 3WLAA 4MWTA 1GPNA 2PSHA 3BIXA 4X6UA 3OOSA 5T4HA 1N8SA 4MYDA 5EIHA 1K4YA 4AN1A 3C8HA 1XQWA 2WIKA 5CH5A 2HL6A 3WKAA 5K3FB 2WG2A 3GROA 5FV4A 4Y7DA 3HC7A 4X7BA 1F0PA 5DJ5A 4DM7A 1U4NA 1ETHA 3WK7A 3A70A 2HA5A 1XZJA 3WL6A 1YS1X 4UHEA 5AK3A 5E4YA 3ZV7A 2CB9A 3FLBA 4XIIA 3D0KA 5FPQA 4EZIA 3F8SA 2XQIA 5EHQA 4GECA 4QA9A 2GYUA 3AZPA 2J3DA 5JARA 3EIOA 4CCWA 4NZZA 4ZXFA 1CUIA 2WU3A 3WWCA 2OGSA 4PW0A 1TCCA 3O4HA 4DNFA 1CUGA 3M83A 3QM1A 1WPXA 1WHSA 3WKBA 1XFDA 4BVJA 3IIIA 3NGMA 2QOEA 1U65A 3ILSA 1B41A 2QJRA 2RGUA 1P0MA 2IITA 5T4BA 1FFDA 1VZ2A 5CT5A 5AK6A 1NU6A 1XLVA 2ZYRA 5AH0A 2QRUA 3OG9A 1G4HA 2PUHA 4FLMA 2HA7A 3G9TA 3IDAA 1CUVA 2B20A 2GYWA 5BOVA 2FUKA 3O95A 3S2ZA 2Z3WA 4UPDA 4FBMA 1ZI8A 5HF9A 1TQHA 2DFPA 4ZV7A 5FPPA 4PQEA 3F9CA 1U8EA 2C0QA 3JYHA 4OPMA 1PFQA 4P92A 1C7IA 2WKWA 4FNGA 3DDUA 2WFLA 1ODCA 3DOIA 5BV7A 2W22A 1ZJ4A 2G4LA 3I6MA 4XVCA 3G0GA 3LIIA 5AICA 1UFOA 5ALKA 2BKLA 3B3QA 4MWSA 2R11A 1MU0A 3TGLA 1JJIA 3O4IA 4QEKA 1ZD2P 3WK9A 4ZGBA 3H0CA 3B5EA 4K6GA 2VATA 4OB7A 3V1KA 1EB9A 1QOZA 3YASA 4Y2VA 1YS2X 5K3AA 2ONCA 4X85A 4KYVA 1VJ5A 4DMKA 2BGRA 5F4ZA 4OUKX 3KSRA 4YASA 4K6HA 3IBTA 4CG1A 3ZLUA 1AUOA 1DT5A 2HDWA 1EVQA 1XQYA 3C6YA 4UFNA 5HKBA 3WWPA 2HA4A 2Z3ZA 3AJAA 4HTAA 3G9UA 3P2MA 4TGLA 5BWBA 5ALJA 2PKYX 2YYSA 4BATA 2ZVDA 1X2EA 1CUAA 4E46A 3R0VA 4JH0A 4GI1A 3D2CA 4H35A 5AKKA 2VF2A 4B81A 4BDSA 5CXUA 2WFLB 1JKMA 2XUHA 3I1YA 3MUNA 1C4XA 1MX9A 5LZ9A 4B0OA 1R4ZA 2XUPA 1VXOA 2HFKA 1Y7HA 2J3QA 2PM8A 3ESAA 1F8UA 4HAIA 3M82A 1DT3A 3F98A 4WFJA 1HLGA 4G9EA 1BCSA 1CRLA 2HU7A 5AM1A 4GBGA 1HQDA 2XMBA 2VJAA 4RPCA 3Q0TA 4HRXA 1HPLA 3H04A 1DX6A 1H2WA 4GWLA 4HS9A 4IH1A 4UHHA 2GZRA 5FUMA 4B83A 3O9MA 5SYMA 2OAGA 2O2HA 2XDWA 4E15A 5A62A 1W76A 4M0MA 4AZ0A 3WZLA 1RYYA 4KEAA 3K6KA 1QE3A 3LLCA 5IVDA 1QIDA 3ESCA 2PSDA 1N1MA 4Y2UA 3FVTA 2R8BA 1LZLA 5E4JA 2JF0A 1MT3A 4JEIA 3D3NA 5CH8A 5D3KA 5K3DA 2ZJ7A 4G8BA 3HACA 1XZHA 2AJBA 3QZUA 4DSAA 1FFAA 4FBLA 2XUGA 3WYDA 2GBCA 3CN7A 5FDFA 5AIAA 4A16A 5CTAA 1XZEA 1E8NA 1F6WA 4Q34A 2PUJA 3QPAA 5C81A 1QGED 3E4DA 1JJFA 5HF5A 2XE4A 4KR0A 2QXUA 2FJ0A 5CH3A 5FKJA 2OAEA 3QPDA 5J3JA 3FYUC 2GBGA 3C6ZA 1THGA 3QMVA 3PICA 2O7VA 4AO8A 3C43A 1JI3A 4DNPA 2ACKA 1ISPA 5AM4A 3G0DA 4BYMA 1K63A 4AMZA 4Q3KA 2DQYA 5AKLA 3WKDA 1SOMA 4MEBA 1RWQA 4LXHA 2WTNA 3R41A 2UZ0A 5LKRA 1XZLA 1R88A 3FCXA 5ESRA 1DWQA 4ZWNA 4K6KA 4G1FA 5AK4A 3STWA 3G9ZA 3H1BA 1LPPA 2VEOA 5DTJA 4CG3A 2JEZA 4AN0A 2QVBA 2P8SA 3H1AA 1XZAA 4BBZA 1WPRA 4J0DA 2WHRA 4EUSA 5FP0A 2OCLA 5ALEA 1CR6A 1VA4A 3VVLA 4F0JA 1EI9A 2ECFA 3BWXA 4ZRDA 3R40A 4B82A 2ACEA 4MQLA 2V9ZA 4K2AA 3PI6A 1QIFA 1XLUA 5LYYA 5BWCA 1A8SA 3F97A 3WWEA 2HA6A 3HEAA 4IHAA 2I3ZA 5K3BA 3G02A 3I2GA 5KWJA 3FNBA 1LGYA 4LIPD 1IUPA 4GHWA 1UKBA 1QLWA 4G8CA 4J0HA 4JYMA 1F0NA 3IUJA 2ZYHA 3ZLVA 5HQ3A 1JFRA 4FFWA 4LXIA 1K5PA 2HU5A 3AZQA 1XKTA 1XZCA 3QYJA 4X95A 1USWA 1ORWA 4DTCA 3L1HA 3FLAA 3WI7A 7YASA 2JBWA 1BN7A 4RE5A 4U2DA 5K3EA 3STVA 3WK8A 2JGKA 4LKOA 3VVMA 1FFEA 1A7UA 5ALLA 1E89A 4OB8A 2ES4A 3PDCA 3RKSA 4FOLA 3DYIA 4UBMA 3VJKA 1CUJA 4UFOA 3PF9A 2B9VA 1YA8A 3DL7A 1EVEA 2EEPA 1R50A 1CUDA 4H7KA 3V1NA 2HFJA 4GDMA 2D0DA 2CBGA 5AM5A 3IULA 4PSDA 1FFCA 1JU3A 2JGLA 1UK7A 4XWGA 4G4IA 4KE7A 4P08A 4Y2XA 1XRLA 2H7YA 5JAOA 1XROA 5IVHA 1MAAA 3STUA 1UZAA 5AM3A 1T2NA 2QS9A 2AJLI 2EDAA 4H7HA 4L9AA 4L3WA 4W63A 4DMHA 3G0IA 3C5WP 4C01A 5AIBA 2HA3A 2C0PA 4BTVA 3WL8A 1CFJA 4CFSA 1XZGA 2WHPA 2NW6A 4OB6A 5I7UA 1VA5A 3MVEA 3PF8A 3G7NA 4B84A 4BC0A 1EB8A 3C6XA 5A7GA 3V48A 3HJUA 1CUWA 2WUFA 3FYUB 2X5XA 5AKYA 3FSGD 2XUKA 2PX6A 1E8MA 2JGFA 1J06A 1CLEA 1BRTA 1W6RA 2ROQA 2VQ6A 5HQ3B 2RI6A 4G5XA 5A6VA 3F67A 4N8SA 4X6YA 4BVLA 2JGIA 3I2IA 1GQRA 1ZOIA 3EQ8A 1ZI9A 3I2FA 4NS4A 1KU6A 3O4JA 4LHEA 1AQLA 4IQ4A 4TVKA 5LKAA 2XMDA 2C4HA 1UK6A 3BXPA 2HADA 5A2GA 3RM3A 4BP8A 3GFFA 1MN6A 1AKNA 3A2LA 2JIDA 3R3ZA 3EF3A 3DYVA 2PVSA 2XQJA 2XMQA 2RHWA 4UHBA 5HFAA 4RGYA 1THTA 1VXRA 1QO9A 1QO7A 1SC9A 3ZLTA 3M81A 1CUFA 4B9AA 1MAHA 1L7RA 2Z5GA 3LIPA 2LIPA 1QTIA 3IUQA 1H2XA 1QTRA 2QUAA 3ED1A 4BAGA 4X00A 1XRMA 5ALYA 1YAHA 2DCMA 1XLWA 5AKGA 4DNOA 4FMPA 2WFMA 2QMQA 4RE6A 1E66A 4F5ZA 2OGZA 4QLAA 3FWHA 1T4MA 2K2QB 2QXTA 4UHDA 1XZIA 3WL5A 4JUIA 1DWOA 4E11A 5A7FA 5H3HA 1OCEA 1SFRA 1EDDA 1XZBA 2JGMA 3KOOA 3BE8A 1HDEA 4JNCA 1QIGA 5E2IA 4FNMA 4BZWA 5IVKA 4X90A 4K5QA 3D4LA 2C7BA 4B7ZA 5DYWA 1TK3A 2WIFA 3IVMA 1RP1A 2BFNA 5AOCA 5CMLA 5I9IA 3V1LA 1CUYA 3U1TA 3CXUA 4X6XA 2VAVA 4QWMA 5JZ9A 1U2EA 3C5VA 3V1MA 4BZZA 5KBYA 1ACLA 3I6ZA 5AI5A 3H17A 4WDQA 3GBSA 3HRHA 5HF6A 5CT9A 3VJMA 4B80A 2PU5A 4NVRA 1CUUA 1IUOA 2WILA 5FLKA 1DINA 2YH2A 1BE0A 1QIMA 3A6ZA 4HVTA 1LZKA 4TPKA 1UXOA 1CEXA 3N0TA 4H7EA 3H2KA 2DHCA 4W1PA 1VZ3A 1CPYA 3DKKA 2Y2VA 5FRDA 5C8VA 2HA2A 1DX4A 4UBNA 1VOTA 1SCQA 2JGEA 5AO9A 2X8BA 3HYSA 4U2CA 4PSUA 4X97A 2GBIA 4U2BA 2ZYIA 2XT0A 1ZD5A 3STTA 2QTBA 1WOMA 2DHEA 2ZSIA 1GPLA 3V9AA 3GUUA 1UK9A 4YX9A 4DIUA 4BDTA 3DCNA 4I19A 5ALDA 1OILA 4H7DA 1Y37A 4OU5A 3O9VA 3K2IA 1IMJA 4Q05A 2WIDA 4CIAA 1LNSA 2PSEA 4PV7A 5AKJA 4MXDA 5C8ZA 1GT6A 1YASA 3WKEA 4DMCA 2B61A 2PL5A 2WIGA 1CUBA 1Q0RA 5JANA 3FYUA 3R3XA 1IZ7A 1UT6A 4CG2A 3DOHA 3OPMA 5EI5A 1CUEA 4C4ZA 1HBJA 1J2EA 1XKLA 5AI0A 3C8DA 4MEAA 3NOXA 3DD5A 1ZIYA 3ICVA 4EBBA 2G5TA 3FYTA 1R9NA 2GBFA 3DS8A 5IH7A 3IUMA 3SC2A 4QZVA 2WG0A 1GZ7A 5LZ5A 3DQZA 1XZFA 3QBJA 4BVKA 3Q8WA 1XZKA 4LYEA 3I2KA 3S8YA 1UOPA 3FCYA 4NMWA 1M33A 1TKRA 4KAAA 1JMYA 2PBLA 4G8DA 1G66A 5JYCA 5ALQA 3VDXA 2WHPB 1A88A 5ALZA 2VT7A 5LZ8A 2HRQA 3D59A 1LPSA 3H2HA 2H9YA 2WQZA 1YAJA 4X71A 4CCYA 2BAGA 2QUBA 2QT9A 5AKXA 4Q3LA 2OQVA 2Y2UA 1ORVA 3CN9A 5AOAA 1W1IA 4UBIA 1YR2A 1P0PA 3HABA 1E5TA 3KXPA 2XUAA 3WK5A 4QNNA 5DNUA 3CCBA 4BCCA 4BCBA 4GLBA 5JADA 5DNWA 5D3ZA 1YB6A 1QFSA 4AMYA 3CCCA 1WB5A 1VE6A 4M0EA 2G5PA 5AK5A 1OXMA 1QIEA 3W2TA 2QKYA 1VLQA 2V96A 3BF8A 4CIBA 3LCRA 3I1IA 4FLFA 5HCUA 2GYVA 2I3DA 5ALTA 4OYYA 3WK4A 3ZI7A 2DSNA 1MPXA 1AC5A 1H2YA 5ALMA 5HZGA 4EY5A 3LS2A 1MNQA 1BS9A 3C6BA 1YCDA 2XUFA 3HI4A 2OXEA 3E1GA 4BCDA 5ALXA 5JD5A 3IB3A 2Y6UA 4W9RA 5D6OA 2VJDA 1XRQA 2V97A 2VAXA 2ZSHA 1W4LA 3W9UA 1AMNA 1WM1A 1IUNA 5IVIA 3F96A 4EY7A 2GZSA 5JIBA 4J0KA 4ROTA 3DKRA 1MJ5A 5EHZA 1H2ZA 4UBKA 1ODTC 4BE9A 5AM2A 4Y2PA 5JAHA 1GPKA 4KE8A 4C88A 5DTIA 3RK4A 1UWCA 5ALPA 5JAUA 2H1IA 3QMMA 5EGNA 2WJ3A 4QDOA 4C4XA 2RAUA 4Q82A 1C7JA 2Q0XA 3X3HA 3C70A 4BP9A 2ZJ6A 1O6FA 4I3FA 5JD4A 2XQKA 2ORYA 2AJ8A 1CUCA 2WU4A 4L0CA 3G0BA 1Q0ZA 4M0FA 4KAFA 4I4CA 5DWDA 1J1IA 4Q3OA 1UKAA 1DQYA 1EHYA 1YB7A 4JYPA 5DYTA 4J3JA 2OCKA 3PUIA 4YPVA 1AURA 1CQZA 2PSFA 3KD2A 4WY5A 1BEEA 1JMKC 3TRDA 4FDMA 2WJ4A 4BB0A 1L7AA 1ZGBA 3OURA 4MYSA 1EA5A 4X3CA 1ZD4A 5LP1A 4G9GA 2PPLA 5CT8A 1EK2A 2VJCA 4UFPA 2XMRA 2WUDA 4X93A 5ISMA 4OYLA 2G63A 3ANTA 1CUHA 1CIJA 3W9BA 2AJCA 4L72A 1VKHA 3PFBA 2XI4A 2RHTA 1QZ3A 1CVLA 4J03A 4BRSA 3T4UA 1QFMA 4Y2QA 2V98A 3OC0A 2BUBA 4AO6A 5JALA 3NUZA 2VA9A 4J0GA 1EX9A 5DYYA 3FAKA 4HZGA 4G4JA 3KWJA 3ESBA 5FOQA 4H77A 4N5HX 1ZGCA 3H18A 4U2FA 1XZDA 5YASA 2IX9A 3D5EA 1G5FA 2AXEA 1A8UA 3PE6A 1LPNA 3R3UA 4X91A 1FJ2A 4YK7A 1UKCA 5EIAA 3T52A 2FJPA 2XQGA 3H2IA 3OTQA 3GZJA 4ITVA 1AGYA 3DNMA 3AIMA 4WFKA 2OQIA 3HSSA 5AKZA 3WA6A 2WLSA 4AB1A 1K6EA 3WWDA 4QLOA 5K5EA 4LYDA 1UOOA 4CCYB 5JATA 1D07A 5AOBA 1CQWA 3PFCA 1GKLA 1MX5A 4KE9A 4OSEA 3DL4A 4AX4A 2CZQA 4PNZA 3W05A 2WTMA 3FSGA 3WMRA 3NWOA 3WYNA 4W1SA 5CBKA 4WJLA 4PO3X 2QR5A 3LP5A 1FFBA 2HU8A 4F21A 1IZ8A 1X2BA 2HM7A 3O4GA 1JJBA 1EXWA 1TCAA 4UBOA 4FFVA 5AI8A 3IUNA 2C58A 3STXA 3R3YA 1N5MA 3C45A 1LPBB 3UUFA 3KDAA 4N5IX 1S8OA 4ZI5A 3B12A 3QH4A 3R3WA 1MTZA 2WUGA 3RLIA 2O7RA 4QE3A 3GA7A 4UHCA 5CURA 3TJMA 6YASA 5LIPA 3FBWA 1NU8A 2QJWA 4S0XA 4XX1A 4DMFA 2WHQA 2FX5A 2RIPA 1R9MA 4AQDA 1MNAA 3ICWA 3I28A 4E14A 4H7IA 4BTLA 4V2IA 3BF7A 5ALNA 3WL7A 1H22A 1JT2A 3QVMA 2HIHA 2WIJA 3I6YA 3SX4A 2WG1A 1P0IA 2I03A 3FOBA 3UUEA 3VXKA 2I78A 4KE6A 4QDUA 1QJ4A 3WJ1A 1I6WA 1YA4A 5T4EA 4OCZA 3JWEA 4P9NA 1EINA 4HRYA 3WQHA 1E3QA 3WIOA 3QITA 2IIVA 4WCVA 3SK0A 3AZOA 5IKXA 4XJVA 3A2MA 5AI6A 2CKMA 1FSSA 2VSQA 4KAJA 4ETWA 2DR0A 5ALGA 1ODSA 4C87A 1MX1A 1W52X 1BEZA 4J0IA 4KJXA 1Q83A 3WWOA 5I8PA 3FVRA 2C5GA 2DHDA 2JEYA 5AM0A 1AZWA 2O2IA 4Y2TA 5HK9A 3EQ9A 4Y2SA 1PV1A 1QIKA 5ALFA 5EHNA 3D2BA 5KWIA 2CMFA 4QWWA 3WZMA 1KU0A 4UBJA 4H7JA 2H7CA 3AFIA 3BJMA 5A71A 2H7XA 3H19A 1AX9A 3R3VA 4B85A 4A23A 3U0VA 4FTWA 4RNCA 4ZV9A 2OGTA 3WKCA 2OG1A 3DJYA 2XLBA 1DQZA 4A5SA 4UBLA 4FLEA 1LPOA 1TCBA 4J0JA 3DLTA 1WB4A 3I2JA 5DNVA 2PSJA 5JZSA 1A8QA 1J07A 1QIHA 3QPCA 1EK1A 3MUOA 3AUKA 5AI9A 3OM8A 2VT6A 4KACA 4INZA 2BGNA 4EY8A 2D5LA 4FHZA 5HK8A 4P93A 4HXFB 3L1IA 4B0PA 3IA2A 2OCGA 1R1DA 2Z8ZA 4H7FA 1Y7IA 2J4CA 2AJDA 1XZMA 4BC1A 4D9JA 3A2NA 1WB6A 1XQVA 2HA0A 4Q1VA 5LZ2A 1DWPA 2E3JA 4AXBA 4B6GA 2ZJFA 2W6CX 5AKHA 4DLNA 5SYNA 4GEGA 1WHTA 2BJHA 3C87A 4DGQA 4PSCA 5D7BA 3AIOA 4ARBA 5ALIA 2RONA 4U2EA 2XUQA 1BCRA 3FLEA 3WK6A 4EY6A 2XUDA 2OLEA 2BUCA 2XB6A 3JW8A 2HRRA 5HFNA 4GXNA 5K3CA 3UMJA 2C5FA 1LPAB 5EFZA 4LXGA 1CUSA 2XUOA 2CEKA 3HXKA 1WCYA 3EBLA 5ALVA 4Y2JA 5ALOA 1DU4A 3ZWQA 5FXMA 1B6GA 1TRHA 5ALRA 1E8DA 1QIIA 1XRRA 4BRZA 1MO2A 3L1JA 3W04A 4EHBA 2QZPA 5E4TA 1GQSA 4EA6A 5HF8A 2HHAA 5T4FA 5AKEA 2O2GA 5JZBA 2XMCA 4ZREA 1G42A 4WDRA 3ZPXA 4FKBA 4IH4A 1DTEA 4O08A 3W06A 1ZJ5A 1GKKA 1HL7A 3M3DA 4W1QA 4N8DA 5AKIA 3VJLA 4EY4A 1JU4A 3BDIA 4J0CA 5K3FA 1N5RA 1GGVA 2CJPA 3H2GA 1UK8A 5EIEA 1H23A 1KEZA 3E0XA 2J4FA 3I2HA 1QIJA 3IURA 3BL8A 2X76A 5CT4A 1BROA 4QDXA 3D7RA 2VJBA 5ALSA 1HKHA 2B4KA 3K9BA 3G9XA 5DLPA 5C7YA 3H2JA 4DYHA 2WFZA 1NX9A 2YASA 1ZD3A 1LPMA 1BN6A 3MGAA 2XQFA 4N8EA 3G0CA 1R3DA 4KRXA 4B9EA 1LBSA 3HLKA 1LLFA 4G4GA 3O0DA 4OU4A 3D2AA 4KRYA 5ALHA 4Y2RA 3WIBA 1YSCA 3AINA 3STYA 5CXXA 2Z8XA 4Z49A 1ZI6A 4H18A 4Y2YA 3ANSA 3KWFA 4WFIA 1BU8A 1QONA 1W75A 2EDCA 1XQXA 3BJRA 2WJ6A 4IO0A 5LLSA 1P0QA 2OPHA 1K8QA 4MQMA 1LBTA 3BIWA 1EDBA 5ALWA 4H0CA 1UOQA 3QMWA 1EH5A 2XLCA 4X92A 3SWWA 5LZ7A 4C4YA 1Q84A 5AJHA 4GW3A 2XUIA 3AIKA 1ZIXA 3HZOA 4C6HA 4HXGA 5HKAA 2ZYSA 4AZ3A 1X70A 3G8YA 5CRIA 2XMGA 3PUHA 4QDTA 5C8XA 3VKFA 3EQ7A 4AO7A 4DNQA 4PF1A 2WUEA 5CT6A 1TIBA 1O6GA 2BUAA 1XRPA 4OD0A 2BCEA 1Z68A 4HXEB 2XMZA 4MJ3A 1CUZA 4ARAA 5JD6A 5LZ4A 4BAZA 2Y1KA 1ZICA 4DSZA 4U2GA 4F60A 2OCIA 4BAUA 3BDVA 3AILA 5JAPA 1PJAA 4BE4A 2WM2A 1IVYA 3TEJA 2XUJA 5KREA 5AHXA 2PU7A 4W1RA 4FWBA 1GXSA 4WY8A 1CUXA 1ACJA 3VISA 4X94A 4CI9A 1EDEA 3GELA 1L7QA 2QM0A 5EHXA 4C89A 1CV2A 2DQZA 3ESDA 2Y6VA 3WA7A 5AP9A 4EB0A
chains in the Genus database with same CATH superfamily
3LP6A 4WKBA 2X8AA 4NYIQ 1X9HA 4Y9RA 1M73E 2Q3HA 4Q1AA 2VTVA 2I1VB 3AI2A 3GB9A 1XQ9A 1BQ4A 4Q6WA 1T91A 3FJYA 4BGIA 1NN3A 3OE7A 2WSLA 1E5VA 3F7MA 4OJMX 4NH4A 3AKCA 3E4CA 4RD2A 3RU7A 3U3RA 1N78A 3Q3HA 1ULSA 3SJZA 2DCUA 5GWXA 2V9PA 1EWQA 2Y66A 4X65B 1N7IA 1KJ9A 2ZI3A 2IWHA 4V0OA 2H17A 3GHHA 4FMCB 5CAEB 1MCZA 5DP2A 5TPZA 3ZCQA 2QT0A 1PYDA 2B8NA 2Q49A 3GFPA 1JEDA 1DTWB 3F3MA 3ZCVA 5C53B 4IV5A 3OPXA 3DE0X 3MGKA 3OIYA 1FDVA 1UQUA 2CHVA 2MSKA 2GSDA 4UVGA 1T8TA 5G0TA 4BU1A 3C4VA 5HIIA 3SX2A 1J0AA 4FXPA 5I5EA 2YXPX 3DWIA 4H1TA 4QBFA 5AI4A 4YJ2B 4G2NA 3VHLB 3WLAA 3NIWA 4ZZ3A 3FHCB 5LNK6 5HBRA 2IW1A 3G5LA 2AVNA 5T4HA 1N8SA 2NUAA 5FL3A 1MZPA 5I7WA 1KA9H 4ZZ1A 2ODPA 1K4YA 4JBXA 3V3KA 2GAIA 1O1YA 1ZP6A 3FNHA 3LVRE 3RF7A 1CJVC 3D02A 3IAFA 2XBMA 4TSRA 4WZ6A 3J81A 1QH1A 4LBZA 3WKAA 4QXMA 4NBVA 1Z4NA 1YOBA 4BKOA 2ZRNA 1TMYA 3A06A 3H1PA 1INLA 5CLFA 1J5EB 4IVQA 5JECA 2BBSA 1GQOA 3TIXB 1LEHA 3SYTA 1AG9A 1Z75A 2HJGA 4JLWA 3QE0A 4PYMA 3FVQA 2RK6A 3EFOB 1OWLA 1HNWB 4KXUA 1D03A 5FFNA 1P2TA 1OJ7A 4LG1A 1UIRA 4K6CA 4CM4B 2ID7A 4EI8A 5JS1A 1OD6A 1X1QA 3T9BA 1Z5ZA 4FDUA 3CNHA 3NDJA 4YH1A 5DM60 1QAQA 3G82C 3WK7A 3D4IA 2ZI6A 3A70A 3A26A 1GAEO 2QLLA 1R0RE 3HKBB 4AVYA 4MI6A 2W83A 3WGOA 1S0UA 3TW8A 1SWVA 2JI6A 3KM0A 4MYCA 4RYLA 4AP5A 3GLGB 2C2OA 1YS1X 5ENVA 2BKXA 3QLUA 4BZPA 4WACA 1I2DA 2VXCA 3HBAA 3HY3A 3TSZA 4MW9A 4XIFA 4HDRB 4NOLA 1BHO1 3F8SA 4O2RA 3VPCA 1N2CA 3ILVA 5EHQA 3K9FC 1N77A 1DO0A 4GECA 4Q66C 2JEOA 2H1VA 4JROA 4EYKA 3LUAA 4HO1X 3W7VA 2B4QA 2KJQA 1A7AA 5JARA 2IZ0A 4U2KA 3EIOA 2I62A 4Z3OA 1VP3A 2GYYA 1I3NA 3L6EA 3C16C 2FPXA 5IS2A 4IJ6A 1B6TA 3NIGB 4ZXFA 3CLTD 4YP0A 3L6BA 1OIWA 2NZ8A 3BWDD 4IQFA 3BZUA 2A1IA 2RGNA 3DFUA 3FCUB 2JFUA 3NGLA 3P9SA 1UZUA 1P9OA 3GVIA 3W6OA 3TSYA 1Z83A 1YDMA 5B1HA 2B69A 4LHXA 3FE2A 4P4LA 1FQKA 4WD3A 5A4JA 5KZMB 2RKOA 1NMZA 3A1EA 5JG7A 5AVUA 5MGNA 2HWXA 4C0WA 4D46A 1YQ9A 3B1JA 3NBFA 4IW3B 5REQB 5TQ2B 4XQEA 3R1IA 2W2MA 2J0UB 3PWZA 3Q3VA 1E9VA 3DWFA 4RA9B 3IIIA 3K5PA 3MGGA 4BTEA 1ZGZA 3CTMA 3VNUA 2C57A 2YC4C 3EFBA 2IITA 3DMFA 4LECA 2RIRA 1VZ2A 1PJ3A 5LVAA 5AK6A 5BSWA 2Q1TA 4II3A 3PKIA 1G4AE 3U7GA 3B36A 5KJCA 1D1SA 1NU6A 5LLDA 2ZYRA 3PCRB 4QASA 5M29A 3ZCTA 5E8JA 2HMVA 2ZT7A 4NBTA 1HDXA 2HA7A 3RD5A 1UMDA 4ARZA 4YCMA 3ZIAD 3D3KA 1C0KA 1X94A 2P78A 4NE9A 3REGA 2XCRB 3EXFA 2G9QA 4AZTA 1K2VN 3IDAA 2OG2A 5DNAA 2GYWA 5G3YA 1PWHA 3K96A 2ZUBA 3MIZA 4LDAA 1B16A 1U0JA 2E5WA 3SICE 2BEUA 2Z5VA 3JZIA 2CXQA 4TMTA 2ZRDA 4S12A 1WCXA 1RCFA 3H8VA 3MJTA 4P4TA 3C24A 4V0ME 1NNEA 1F2UA 5A1JA 4JGBA 4QULA 2QZJA 1QP0A 1DGQA 4PLVA 4QOIA 4BRWA 5B58C 2EGUA 4BE7B 4E2ZA 7REQB 5FPPA 2ILTA 5IARA 4GM0A 1DDGA 1NATA 2QORA 4V0QA 4GYWA 3KT3A 2B1JA 1O08A 1K8YB 5REQA 4UDOA 4IGIA 1EX6A 2Z8YM 4UPVA 2BGWA 4RJTA 2FN4A 3JYHA 3QA3E 5GM1A 1PJ4A 1QV7A 4RORA 2GPSA 2ZVQX 3O8NA 4P92A 2VJLA 3AR7A 3D0RA 3QTLA 4KIWA 1HE2A 5AW8A 3F6EX 5KJEA 3JD2A 4ND8B 8AT1A 1OFUX 2JIQA 1QQ5A 2V45A 1NVUQ 4IUBS 5I9TA 2WDZA 4D9MA 3DOIA 1YV9A 1SXJA 2MCFA 3KQLA 3U48A 2PCJA 2Y8EA 5AJVB 3F4BA 4HVCA 4D3ZA 1TA9A 3FGPA 2EIHA 3GOHA 3MCZA 3NG1A 4JEHA 4HQ0A 2G4LA 1NJ5A 4JBNA 3VHQA 3DA8A 3ENWA 1KZGB 3G0GA 3N2LA 1RJ9A 3F1KA 4N0DA 4ZO6A 4F38A 3H9GA 3HO8A 3CV3A 2WAOA 4FE4A 3LWNA 5FPYA 4EA9A 3RADC 2QF7A 1G2OA 2BMEA 2WB2A 3NOVA 1V96A 5FPHA 3NKLA 4RFSB 1RYHA 4LJYA 2GQ0A 3BMQA 2IKSA 2V8OA 2X14A 1JDUA 3BMOB 3IKJA 4US0R 5F5XA 3PC3A 4D1YA 5K7SA 2QW8A 3TCKA 1CY4A 3AHHA 3KP1A 3KXIA 3MF4A 3GRFA 3O26A 4ZFNA 3GUHA 5FLXA 1AIPA 4K6GA 1MEOA 1JFFA 3HKDB 3OMXA 1KDZA 3GFBA 4BGEA 2JLBA 4D6XA 4P0PB 4Y2VA 5E2BA 1CP2A 2BDUA 2VTEA 3NO4A 4KDCA 4EPVA 1QP4A 4AICA 3F8WA 3LZ6A 2ONCA 1IN5A 3DYBA 1RFLA 1T4DA 1WQ3A 2ZIWB 5F5LA 1TB4A 5EKSA 3T1VA 5KYXA 3K94A 4TL8A 2QT1A 4NDAA 1NY6A 3WYCA 3JWGA 5KYXB 3F6RA 4JA0A 3HB7A 3PJGA 3W6UA 1PKXA 2W6NA 4Q4JB 2H6EA 1EP1B 3EEIA 4O2AF 4ZEVA 4FYJA 4CNQA 1L7BA 2IHZA 3LMKA 4LHZA 3ZLUA 1ZRMA 2FCRA 3HN2A 2AXPA 2V4UA 4JQOA 1HOTA 2VDQB 1SHJA 3D5TA 4KQHA 2A7XA 4MIYA 3KNZA 3TG2A 3LLSA 2X2OA 1W87A 4BJ1A 5HKBA 4JLSA 3PZRA 4J07A 2OMEA 3WL3A 4KLCA 1OBHA 1L8XA 3RRXA 3AB7A 4URYR 3JVEA 3GXBA 4IO1A 5FLYA 1S01A 3PNKA 5J2UA 1MORA 2R6FA 4YAFA 4IDGA 5A1TA 4LNHA 4EJSB 5ALJA 4Z7NB 1XEXA 3DFFA 3LCMA 2ZRHA 3B7GA 2O8BB 1E9RA 2W0SA 4F2GA 4BB5A 4DJAA 1KQOA 3R0VA 2P9CA 5H3CA 3SOPA 2G25A 1DJNA 3IJRA 4HAWA 1EPUA 2PJDA 3L7OA 2C61A 5AKKA 3QVGB 2VF2A 3OUZA 4X45A 5AVJA 2AW3A 2P90A 1MEEA 1Z3IX 2QB5A 2NUPA 3N8IA 3HP7A 5B7GA 1JF8A 1I1OA 2GPTA 1IZ9A 1RJGA 3GWGA 2UXBB 4G01B 2DLNA 1QB8A 2IEAA 3B1ZA 3CW2A 4EJ2A 1JTEA 1KI2A 5F64A 1MX9A 4WZBA 5JJBA 2GS9A 4C29A 2QE6A 4JENA 3UJBA 2D3WA 4C20A 3EPRA 4NRDA 4U7FA 3VHXB 2II6A 4ZANA 4V3BA 5J5CA 1SUBA 1WZEA 4G63A 5CD9A 4Y6QA 3IQIX 4OHWA 3UT5B 2PL3A 4HWPA 5CEFA 5CVTA 2ZQZA 4BS9A 3NRCA 2YHIA 3OZWA 3E84A 3ESAA 3QBTA 4QDJA 1GFZA 3OJEA 4FGJA 4HAIA 1C0EA 2J3LA 3M82A 2C95A 4HFNA 3UIEA 1BJKA 2ODTX 4L4ZA 4WFJA 3ETLA 4J3FA 2D1QA 4AG3A 1TQDA 4F3KA 4ZRNA 3HJHA 3JARB 2HU7A 1J2RA 3GUZA 2EFJA 3ZU6A 2E21A 3HYRA 2CLEB 5KQRA 1D6MA 3IBYA 1KEEA 1UWLA 4GBGA 5LJIA 1RZRD 4RL4A 4YPOA 1R5BA 5C5CA 3VZRA 5IZ4A 1EBBA 3DWGA 4RPCA 3UJ8A 4OSPA 5DTQA 3ZHBA 3OP1A 3LT4A 1H2WA 1L4MA 2DBVO 3IDOA 2VHCA 4AF6A 4R9SA 3LOPA 4GWLA 4IH1A 1FEZA 3R0XA 1UBFA 3LDHA 3ODGA 4MKIA 3FZNA 2O1EA 4PSKA 2JVIA 4B83A 2CFSA 5CVEA 2O2HA 2Q4EA 2YV4A 4IZIA 4LE0A 2W7TA 5A62A 2B37A 3NEJA 1CF4A 3CKMA 3CBGA 1QQ6A 4G23A 4M0MA 1CQXA 1XVAA 1XU9A 5EHGA 4D4JA 1RYYA 4GE0A 1S7CA 4JR0A 4UMVA 4YAUA 3SQOA 2HKIA 1ZWKA 4B6RA 2HU2A 3VAZA 1WDLA 2PSDA 3O73A 2PRZA 4ZCQA 2A5YB 3FDZA 3CU5A 2W4MA 4NCNA 5FH9A 3BZBA 4X5OA 1LZLA 1LRJA 3U09A 2GCOA 4KPUB 5AK0A 2O54A 3F7TA 1MT3A 1UBTS 1BW9B 4LY3A 3H83A 4PYLA 5L53A 2O8EB 4EG5A 3EXAA 4B4VA 4CLRB 4EJSA 2GA9A 1GTG1 3GYBA 1ISHA 2JAXA 2YTZA 4PG6A 4ARVA 1Z2NX 1KL7A 2ZJ7A 3ZY5A 2IF0A 2NQ8A 2ZWAA 3TJRA 4ZKDA 1XAHA 4JNKA 1XZHA 3HJGA 5JQGF 3EDMA 1F4LA 4DSAA 3H1EA 3T0FA 4KL8S 1NI4B 4KWEA 1Q7BA 4Z9YA 4N03A 4HLCA 3CN7A 5CYPA 4RADA 5AIAA 5FDFA 5JHHB 2IIBA 3HVKA 3LYHA 5FL7D 2EJBA 1YE8A 4AWXA 5BVGA 1I2CA 5CTAA 1TADA 2KSQA 4IYRA 4KYIB 3GGJA 1VB3A 1Z7BA 3DLCA 2AZTA 4ZGBA 4NYJR 2KHZA 4MMZB 1C5KA 2C2YA 3KUXA 4RZIA 4XSGA 1ZCZA 4YIHA 1JR6A 1BDMA 1G5RA 2QXUA 2ZAMA 3AW8A 3D3WB 4KMRA 1HLDA 5A9RA 4ZARA 4IKPA 5FKJA 3A1FA 4V02A 1PT9A 4QYIB 3QPDA 5FWXB 4WEQA 3A31A 2IL1A 2B2CA 2J9GA 2ZIXA 3WE7A 2GBGA 3GPIA 5AHKA 3PYMA 3FCCA 1THGA 4QYXA 4CXMA 4EP1A 4K9NA 1SOVA 3K0AB 3P4UA 1ADBA 4LI0A 3SI7A 3U39A 1QYRA 3FM9A 3WX0A 4QUHA 3UBMA 2DFDA 2JA2A 1V8OA 3B3FA 3DB1A 5BP7A 3IO5A 2B34A 4PBTA 1VL1A 4YJFB 3G0DA 4AWAA 4DUZB 1K3UB 3T5BA 2I7CA 4NPCA 1NZJA 3KJNA 5CDSA 3AM5A 3VDNB 4BLVA 5ESWA 4MZXA 1GKIA 1DDIA 2AX3A 4U7JA 4XD7A 5FUVA 4JUAA 5KTTA 3QVSA 1XGKA 1K63A 2GO1A 2PKCA 4IOKA 5BWOA 4XR9A 1VJRA 2AI1A 1EP2B 3AI3A 3P5SA 2ZIFA 4Q3KA 5E6UA 3ZDXB 4QM6A 4PU0A 1EE1A 3EEQA 4B8ZA 2VQEB 4C4SA 4GKKB 1L4KA 3O31A 1AKWA 3BXGA 4YDSA 1KJJA 1IY2A 2EW8A 1VMIA 3R41A 5LXTF 3UMBA 3OJXA 2GN9A 4Q12A 2D5IA 4KUHA 3RIGA 3WQBA 1JLHA 2CMKA 2GMWA 3E3OA 1R8SA 3ROGA 1R88A 1AU9A 2W48A 3A36A 4HGZA 1W19A 4HFRA 2B4RO 4MVJI 2NXNA 1AM4D 4G56A 4IRUB 4G1EB 4Q7LA 4K6KA 3K15A 3JQ7A 2J41A 1O0SA 2R1VA 3RUPA 4G1FA 3VDMA 5AK4A 3TDNA 3QFTA 3MWEB 3OTWA 1SG9A 8ATCA 1LPPA 4AECA 2HBYA 2Q3CA 2FUG6 1E1CA 5CHYA 2BFMA 3QQ5A 3SHVA 1HMPA 1X8XA 3KAPA 4QUAA 4B4WA 1N2BA 2IC5A 2ONJA 1MOSA 1QRDA 3PLRA 3OI7A 2NZVG 2P8SA 1H8HD 5CB4F 3B89A 4PC1A 4RGBA 4FS8A 1T8SA 4JI3B 5FLEX 3WGJA 1J42A 1WPRA 3ROKA 1NYQA 4F4FA 4XB2A 1X1RA 3OZBA 1TOAA 4R2IA 1WV1A 2V3WA 4H3SA 5ALEA 1BDIA 1VA4A 2FXIA 3V55A 4Q9JA 4CLDA 5HPYB 2QVGA 4ZYTA 1U8CB 1OLSB 4F0JA 1EI9A 3N2IA 1XEWX 1Y7PA 1BJTA 2WU1A 1PU2A 3FZQA 4HHEA 2PH7A 3FCEA 2ECFA 1AY0A 1G98A 3CB2A 4ZRDA 1W2HA 1YL7A 5TF0A 2YIJA 5D5PA 3R40A 2FF7A 1U7PA 4IDEA 2IYFA 4QUDA 3T1TA 2IP1A 4DLPA 4E5UA 3EEOA 2RBEA 1YZFA 1QX3A 2ETVA 2OBFA 1Q0PA 3L40A 3GXOA 2QX7A 3KSAC 1PCXA 4G5YA 1KMHA 4MQLA 3OIUA 5HJEA 1OAKA 3CWCA 4LWPA 5DEOA 3ILHA 3VUEA 4I55F 4ENUA 3GLFB 1DQPA 1S4QA 1YMUA 3PI6A 3E9RA 4KQWA 3ER8A 1Q91A 3TM5A 1U3DA 1A04A 3JWIA 4R1MA 2JJMA 3CUTA 3SY8A 5BWCA 3OESA 3SXUA 4C5CA 3WWEA 4OLBA 1I9CA 4RK5A 3SSAA 1N6PA 2PKWA 2DRIA 3F6PA 3KCQA 4TLEA 5K3BA 5KS2A 3DMTC 4M37A 2FAXA 3GJ4A 4K40A 3PD7A 1YQEA 2C77A 4IDCA 2B21A 1FLVA 2FW6A 4TLLB 1QFYA 1GNVA 2OORA 3U3MA 4CU2A 1N8NA 3NDBB 1THZA 1UKBA 2I6GA 4FCCA 1SQSA 3M6AA 1VJCA 4KFUA 5DX0A 1XNRB 3EUWA 4Q3BA 2MSNA 1KDVA 3LA8A 4DUYB 3CYFA 4LXIA 3HXQA 3FPJA 1K5PA 3L41A 1GSIA 1MB2A 1PJ8A 2HPZA 2LGJA 4B40A 4BKQA 4EA7A 4MGYR 1NMQA 1RTKA 1GUZA 3FLAA 2RG1A 4LBVA 7YASA 1SKYE 3KIPA 4YALA 5EWJA 4NEHB 2AG0A 4WESA 1FLAA 1O58A 3Q6NA 2WSSD 1OBOA 2VUIB 4HWKA 1BN7A 5EIBD 4DLXA 1JQAA 1WP4A 3MWDB 3Q12A 2NU8B 2AOVA 3Q0EA 4G1BA 2P3SA 1NJ2A 3RSSA 4YJ3F 3WK8A 3TMAA 1P1RA 1UKEA 1UPBA 4LKOA 2QL7A 1XMOB 4CLRA 3NBQA 2H1RA 4FEYA 3U5TA 1Y81A 2J5XA 1EFUA 2Q3EA 4CCSA 4M0CA 1SCUA 1RI4A 2Z57A 4I55A 1KO5A 1XVTA 3UB4A 4RBNA 4V2UA 2VDUE 1EFVB 2V3VA 4KXMA 1B8UA 2UYGA 3GJ7A 4NENB 13PKA 4WJKB 2P6MA 1IWBB 3KB6A 3OLCX 1CXZA 4NPAA 3PDCA 2XNDA 4XI9A 5EIOA 4EYOA 1KNXA 4R2JA 4BMYA 1WTAA 4OXXA 2G6BA 4UNRA 4TVOA 1YDFA 2G4CA 3U4AA 3VJKA 3QVVA 2ZRLA 3V8PA 4LZJA 2WYWA 2IPAB 5GGXA 1ICEA 1FC0A 1YFLA 2JD0A 2M9MA 1RQ2A 1WEHA 4L22A 2CJWA 4AYTA 1E3LA 2V03A 5DHPA 3DL7A 1EVEA 1H85A 5LFAA 2EEPA 3ES9A 5FR2A 2BFBA 4GLFA 1JHUA 2O2JA 1FYFA 3RO7A 2CVOA 4RHYA 1Z0ZA 4UJ3A 4BKRA 2GEKA 3NT5A 2EWWA 3V1NA 2HFJA 2HSZA 3IQXA 1PFUA 2V5AA 4GDMA 4YAGA 2Q5EA 4II2A 3IV9A 1ABBA 2CBGA 1NA5A 4QRDA 1G18A 3IULA 4PSDA 2CL5A 1FFCA 1CULC 3NASA 4P3PA 5AM5A 4Z0HO 5CB8A 3SYMA 1H5NA 1IM8A 1GA1A 4XX0B 1C7FA 2YFQA 8ABPA 3JSAA 2WE7A 2WWWA 2ZATA 3UG6A 3F6YA 1P3DA 4FS3A 4JC5A 4JJIA 4BYGA 4RTLA 4QICA 2FR8A 2FSGA 3BQMB 3QXHA 1XB2A 2FPKA 3B2QA 4DCMA 5IANA 4REMA 4MDFA 2GVZC 1NF2A 3JQQA 3KUDA 3HFJA 1H3NA 2I71A 1HFJA 3AP3A 4FDVA 4M7WA 2J31A 3HDGA 4HTFA 1T2NA 4EKIA 3E9DA 3IEMA 2QRJA 3BMNB 3FGNA 4KRFA 1G9XA 2XVXA 3U9TA 2GZAA 1F1BA 4IDAA 5BR1A 4DV3B 4TZ6A 1QOPB 2OO7A 3KHUA 4L9AA 5KHOC 3KKQA 1R6UA 3AEQA 3VR2A 5E3HA 1GIAA 4HUQA 4OAPA 4ZODA 3R44A 3KLPX 1ABFA 2FFQA 2JI9A 3P9QA 2AF4C 3UHJA 1JG1A 2FOLA 2C0PA 4L75A 4OHXA 3ZK8A 1TUIA 1GZ4A 4EA8A 4OFWA 1U4SA 1ICIA 3NLLA 4S35A 1M8PA 2FN7A 2JFBA 4KB5A 3E9CA 3L0OA 3TXXA 4ZALA 2P6RA 1VJ0A 3VR1A 4CFSA 4MJ7A 3EIWA 4KR3A 4LZOA 1BAPA 2EIXA 2XYRA 5FJIA 2WBLC 4L4RA 4HDCA 4Q9DA 4XEHA 3BTOA 2NW6A 3EJ6A 3I0ZA 4Q21A 1BXGA 4GRIA 3S4YA 3GLQA 1OLXB 2YWEA 4OB6A 2VRCD 4U02A 2O59A 3MVEA 3SZMA 4B7XA 4ZHQA 1CRWG 3BGVA 2ZEJA 2AG5A 1GCGA 1Z5PA 4MWBA 4OF4A 3PF8A 2OBMA 5HFJA 5GIOE 3GP8A 1LW6E 3RB8A 4L8YA 1ZYUA 2WUWE 3O8OA 3N74A 1ABEA 4BC0A 4QTYA 5A7GA 4FBGA 2F2TA 3MGBA 3HJUA 2FWBA 1OLOA 4CM4A 3DLHA 2WUFA 1SCAA 3FYUB 1E9SA 3DBRA 4PYJA 3FSGD 1YRAA 3ZDYB 1U28A 5CB0A 4KR6A 2JGFA 4JDPA 5ARBA 3P2YA 2X15A 5K5EA 1JDVA 2YBEA 2DFNA 4TWAA 5GTDA 1W8DA 2Z4TA 2VQ6A 3KVNA 5HQ3B 1IIRA 4EMBA 3HEMA 4G5XA 1VMKA 1U3GA 3L8HA 3F67A 4WW0A 1N6OA 4EHFA 2JLXA 2IH4A 1A5ZA 1XNJA 3LX8A 4QVKA 2GEUA 4AXXA 4ONEA 3RBAA 2WHEA 2X13A 3EQ8A 1KIFA 1ML4A 1CYEA 5SZKB 1HK7A 3CTPA 4I8XA 2I6QA 3PHLA 2AMYA 4NS4A 2E4YA 5DM0A 3EVEA 5JI2E 3DCYA 1TNDA 1I14A 4PSAA 1Z2OX 4TQ9A 4D97A 3PU6A 4LHEA 1P5JA 3UMSA 3RYFB 3V4RA 2WWHA 1J56A 2QUKA 1W94A 1P6UA 3OFKA 2X23A 1H4SA 1GT91 4EX6A 3HK2A 1SBQA 1A98A 2ZP1A 3L84A 5DMHA 1A4XA 2EWVA 3NHYA 4OGFA 3RSCA 4OQEA 5DIFA 2XMDA 1RMYA 1ZN7A 2C4HA 1E3JA 2FWMX 3PQ6A 4M1OA 2JLSA 1JHRA 2HADA 3P0EA 1URPA 3GLSA 5HRUA 2OVBA 4X41A 4IIXA 1CJMA 1P2BA 2OBXA 3RSFA 2PUCA 3GFFA 1MN6A 4Q0MA 1Q57A 1UBUS 4LI3X 1TZCA 3GN2A 1WRBA 2O1SA 5DP1A 3EGXB 3R3ZA 4ZAXA 4DJFC 1L6RA 4L3VA 4EB3A 3LRXA 4W5QA 3DYVA 3KQKA 1A9YA 1GLVA 2VJPA 2IPOA 1EAYA 1V48A 1R12A 2X42A 4OG2A 4PCVA 1IAVA 2E37A 4LOAA 4OHBA 1L5KA 1AK2A 1VSQA 2HDNB 3BCSA 3V80A 5BQXA 2YQZA 3VR6H 2FE1A 4MUKA 5KX5A 4PPNA 3PC8A 2HREA 4MKFA 2C1XA 3I1FA 4N7BA 4QOHA 1ARZA 1ADCA 2FQYA 2YIVX 3QKSB 4DUPA 3OQOA 2R6ZA 1NVVQ 1JAZA 4U3JA 1SB8A 3GY0A 5KVSA 5GPBA 2DR3A 3GT4A 4YJKA 1ZVJA 3EA4A 3CF6R 5EKTA 5FD8A 2IBSA 4ETNA 2AK2A 1IBMB 3M81A 4MUYA 4C6TB 4IG9A 3IH5A 3MNFA 3O94A 4B9AA 1P6QA 4C04A 1KBQA 4HPXB 4FU0A 1WXQA 3GDOA 4JEUA 3T7TA 1MAHA 1FY2A 2PZJA 4YDRA 2VP2A 1KERA 4R9RA 2C4NA 2WD7B 2I3BA 2WD8A 3ZGYA 4A2WA 1UBNA 4ZAGA 1U7OA 2OBBA 3E53A 1E5QA 1FB5A 2YR0A 3F78A 3U6BA 4XOIA 6LDHA 4ZJPA 2G09A 1H2XA 1TA0A 2ZDHA 2NSYA 1O87A 1FYDA 1UJ4A 2BFWA 2AN3A 2R7MA 4Z99A 2B4AA 4X00A 2G9ZA 3BXOA 2FW0A 1KSFX 3UWOA 1SBTA 5IX8A 1YAHA 2DCMA 2D5BA 3MXTA 3D8RA 4HB2A 1XLWA 3C3KA 2NMVA 2D3TA 5AKGA 4HSGA 4IP0A 1H9AA 2V0CA 2BEKA 4ZMRA 4CKXA 1CY7A 3B6IA 2DPYA 1LK0A 2ZBFA 3G6KA 4M1EA 4ESEA 2OHJA 1QR2A 2DKOA 2DQKA 4XGQA 3SP1A 3ZK7A 3D0QA 4ALNA 3ZX5A 3FOZA 1TIKA 1E66A 1IHOA 2BEJA 2WK1A 2VQ3A 1I4TD 4QLAA 4FNAA 2QUZA 4HH4A 3OOHA 2C94A 3FWHA 1T4MA 1D1TA 4BY9E 1AHNA 4K9LA 4JJFA 3Q3EA 4LMPA 4MW4A 3RUEA 3T61A 4CKYA 1QS0B 4RK4A 1A5BB 1Y1SA 1I6MA 2BKUA 1U8XX 1D4FA 2V0NA 3FZGA 3AVUA 1N1GA 4MV1A 1HO3A 1BHQ1 4NCAA 1XIVA 1PEKE 2MIIA 4QXQA 2G1PA 2NZJA 1U2GC 2ZJ0A 3CE9A 2IYQA 1OTHA 3DOUA 2OUKA 3OQ6A 1SFRA 2VP6A 1MGPA 5E3IA 2CB0A 3O8DA 1ZX1A 4J6FA 4C05A 1JWLA 1K8XB 4LTMA 1E1DA 1XEXB 4EAQA 1R7RA 1JEYA 4V39A 4CEIB 1WQ1R 3BE8A 2BHRA 2NZWA 3LWDA 1KO1A 4D0NA 1GVHA 2FLKA 3EA5A 3PJFA 5JJ5A 1MO4A 4MYTA 4JNCA 3JQGA 1W8IA 2C4KA 2P1ZA 4FNMA 4ID9A 3S44A 3ZN2A 5IVKA 2HLHA 4X84A 1SU4A 1OHHA 3D4LA 1N2ZA 3CKKA 3T3EA 2JVKA 1BD4A 3ETDA 4YONB 5DYWA 1YE5A 4AY3A 2Y1XA 4F7DA 2CMGA 2PGJA 2JPDA 3GP5A 3TH5A 2CVPA 1JWBB 1RP1A 2BFNA 1QNLA 5DM4A 3PC8C 3HJBA 3KVYA 3TQCA 2BKEA 3BAZA 5CMLA 3HVUA 5IDWA 1TU3A 4IUDS 3ST7A 5I9IA 1WA5A 3FPHA 2VDWA 4ZA2A 1IN8A 3AY6A 1CUYA 3KUCA 1T9HA 3O9ZA 1WUJS 3UXMA 4JJ8A 2FQQA 2YNMC 3C97A 4Q48A 3TAUA 2IYAA 3V1MA 3ZZ0A 5K6TA 1BFKA 4BX0A 4KXQA 4EBFA 4FGZA 4GLJA 1PQ4A 2PUTA 4HY3A 4N47A 4CWAA 3JASB 3WBBA 1CU1A 3H17A 4RGVA 3R3HA 1WXWA 2OEPA 4PTZA 2G17A 3GEIA 4M86A 1YB5A 3ENKA 3RHSA 1PL6A 3FCOA 5HF6A 5LM3A 1R27A 3I58A 5CT9A 4B80A 2JLQA 1PWZA 2CL0X 2CUKA 2DFTA 3ECCA 4MOWA 4NVRA 4DG5A 2E4ZA 3GC6A 1EVLA 1YC5A 3F74A 3HDJA 2MYUA 1T3TA 2QMZA 1RPNA 3NHRA 4YAJA 4PHHA 3MS4A 1BH2A 3ZE9A 2FZCA 3C2QA 3UKOA 3W5HA 1NI5A 3OWHA 1EEXB 2WILA 1I33A 4WN9B 1ODJA 2YH2A 3IEPA 1QIMA 3ZZMA 5ER6A 4PG8A 3LG2A 1YRLA 1SXPA 1J22A 4MS1A 3T1QA 4DDTA 4DJEC 4ZAVA 2HN9A 1U3WA 1Z8NA 4XLTA 4PYIA 6REQA 2I4NA 4MLCA 1J8QA 2QIOA 1CEXA 5AHWA 4A6XA 4CUJA 4QEZA 3MJVA 1G7RA 1P8JA 1XALA 2QTAA 2BSAA 2XT6A 3H0KA 3KVRA 5TR9A 4DV2B 1E3SA 4TYQA 3NIBA 1J8MF 3IEXA 4FFBB 4E30A 4N76A 5EPUA 2FYTA 3WV5A 4GZ6A 4O2AA 1G1MA 1T9CA 2ZI9A 4K7JA 5IVPA 2HDHA 2B92A 5F1YA 3V8QA 2B3TA 4UBNA 1SCQA 3KFXA 1V16B 5CBPA 3S1AA 1JJ7A 1ZL0A 3ZW8A 2KW5A 4IXDA 2EX0A 5GZ6A 1CQPA 1SQ6A 4E7PA 4OQXA 2PD4A 5JD3A 3RS5A 4E2XA 4RHTA 3RAJA 4IFEA 4MRAA 3DVAA 2F1IA 4B3XA 3EASA 1QS0A 2GBIA 3U1BA 2R7AA 3BCRA 2ZUFA 2OTCA 4LXYA 4ALKA 2VZ0A 2Y67A 2ZYIA 1F5SA 3STTA 4PE5B 1M7HA 5D5HA 1SBYA 2UYOA 3KOYA 4Y2GA 3I5MA 5FUBA 3VYSB 2EFHB 3V9AA 3B82A 4HRVA 4CKWB 4HAOA 2AKEA 1MVLA 2IHUA 2EKDA 4EPXA 4DJDC 3WLIA 4LRUA 2R00A 4J49A 1J2JA 3KDPA 2JK0A 4OHKA 2HIAA 4YRMA 4D4GA 3DCNA 2O2YA 4KUGA 3DBLA 2XNSA 1OILA 2EJCA 3P9ZA 4FQ8A 4G6ZA 1T26A 1Y37A 1NVKA 3DAHA 3DM5A 1NVTA 5CFRA 2JJ2D 1FVFA 3AR3A 1IATA 3G1TA 3K2IA 3VNSA 4H1VA 4JMLA 1JIKA 5HR5A 3J7AC 5LC1A 3X43A 1P9LA 1QCDA 1LU9A 3BWYA 3RABA 5JC8A 5DTMA 1CT9A 1VKNA 2JHPA 1RQ7A 1UBHS 2ZRKA 3GJ6A 1SXGA 5J40A 4QKQA 1NUHA 2EW2A 2IYEA 3QG5A 3GLHA 4PV7A 4AZVA 2DY1A 4HQKA 1GT6A 1YASA 1CY2A 1C30A 4JBWA 4EI9A 1GSHA 5JBQA 3ZTTA 5HOQA 2BMJA 4KQFA 5KKNB 2BZGA 5CA0F 2C99A 3FYUA 2VNKA 3WDMA 2IZZA 5BUZA 1E6MA 5AHRA 2BCJQ 3DOHA 1EESA 4G36A 1WWKA 3CZ5A 1WDWB 1USVA 3Q10A 4XWYA 4MV7A 2VAWA 3MCUA 4IILA 4KH1A 4EW3A 5CLJA 3OU7A 3HVRA 3R5FA 4CMGA 3KHSA 1Z2AA 2AQIA 4BJHB 2QG6A 2RMKA 3DVQX 3FYTA 4K88A 3IQFA 3IP7A 2XF8A 4O4JB 3FMVA 3BK2A 3IUMA 3ZV6A 3MOGA 5DW3A 1UT8A 2WG0A 4KQKA 4NNOA 3RC7A 5FI0B 1PFYA 1GY8A 1Z0JA 4JP1A 1I1QB 1VBFA 2HLPA 1V4NA 2WMOB 5KNLA 4AU1A 4RS4A 4BLQA 1COZA 1YS7A 3HE3A 3OIFA 4HGPA 4UU1A 3SSOA 1ONPA 2DBRA 4WTOA 3MMZA 3GR6A 3S8YA 1EGMB 1GCUA 4ND8A 4NMWA 3K0FB 5DCYA 4B7CA 2FSFA 1XG5A 3A27A 3MHPA 1JMYA 5CLIA 4ND4A 4MHSA 1Q3TA 2PBLA 2RJNA 3SR4A 1N2IA 4A4DA 1WETA 4YAIA 1ZW1A 1F8GA 2JFGA 5ALQA 1UJCA 5ARCA 3VDXA 2G0NA 4PC6A 5IUNC 2BFFB 2WV7A 1D2HA 3JVVA 4B43A 5JDIA 4LQDA 3PTAA 1DJQA 2B4YA 2HRQA 5LZ8A 3CJTA 4NCKA 5IJ0B 4WLNA 2JKVA 4FQ5A 3W77A 1W73A 3ZYCA 3TKYA 2IZ6A 4RMGA 3CVUA 1G21E 1H2RS 2I34A 3H2HA 3DBOB 2PX4A 2H9YA 2WQZA 3C7DB 5M7EA 3THWA 2IF2A 2XITA 1YA6A 4OFXA 1I3LA 2YW2A 2WMYA 1G9TA 2NU9A 2OXFA 2R60A 3MWGA 4XSHA 3WDSA 2QT9A 5AKXA 2QRVB 4CCYA 3LPLA 4Q3LA 1QFJA 2C5EA 3U7EB 3NM6B 2JG3A 3KQMA 3VNVA 2DHQA 4HGQA 4GKAA 2X6TA 4A0QA 1CYDA 4I8DA 4R6XA 3N6XA 4OKNA 4UARA 2VPWA 1CNEA 1AOXA 2OP1A 3HWRA 3VTFA 1J6UA 1Q1BA 1W1IA 1CX9B 2GARA 4C5BA 1KEUA 5HOEA 3GCZA 3K20A 3KAKA 4JQCA 3KLOA 4UBIA 3HV2A 3C3XA 2GN6A 3GGOA 2EZ9A 3OKPA 2JBAB 4MRSA 1S9HA 2HD4A 4P7GA 2FSPA 1IQ0A 2NT4A 4GC9A 4QJ3A 2XUAA 2FZKA 2YJTD 2HI0A 3UGJA 3PKZA 2IHBA 2OV2A 3CPHA 3K1AA 3INTA 1KS2A 2GHQA 2KLHA 2P27A 3NGXA 2P3OA 5DNUA 2QG9A 2ZBVA 3KJQA 4DBLE 3KDSE 4BCCA 2YN2A 2C04A 1KC3A 1T2CA 2FPGA 3IA7A 1R66A 3MS2A 4GLBA 3DMGA 1DLJA 2GWHA 4EEKA 1GYRA 1DCMA 5DNWA 5JADA 5KMGA 4HGYA 4LHSA 2ZWIA 3MMNA 3EZ7A 3TQSA 3DV0B 4Q6BA 5D86A 1SCUB 4I55B 3CNQS 4FNOA 2ACVA 4XR4A 1KH2A 3ED5A 3IEKA 5AR1A 5CNMA 4HT3B 1YB6A 3HA7A 1CF9A 2WJGA 1U1GA 4ZC1A 4UOZA 2O0KA 1YS6A 2YWFA 3ZGLA 1OH6A 1R6VA 1Z0KA 1VE6A 1RAFA 2BGGA 1QF9A 1QTNA 2FPRA 4NQRA 4AMBA 3ZHRA 3L7IA 4O2BB 3NEPX 3O1JC 3QWAA 4K2HA 2P3QA 16PKA 2HX1A 2QKYA 1WULS 4YV2A 1HT0A 2Y1FA 4D81A 1ZUIA 4CIBA 3EVGA 3LCRA 2WOJA 3JD1A 4FLFA 1U98A 5HCUA 2MSEB 2YUTA 4RSHA 4CR8A 2I3DA 4DLWA 1CETA 2JJ2A 1C81A 2SECE 2W6OA 1GRVA 2BKVA 3O91A 5ALTA 5EZYB 4ERNA 3CVJA 2UAGA 1ZZGA 3CNBA 4RK1A 4M88A 2C97A 3T9CA 5EKUA 5CNIA 3S7ZA 3C1AA 1Z7WA 2I91A 2QN2A 3Q72A 4WKGA 4NC9A 4ZAYA 2G77B 1DBQA 3ZIUA 3CG0A 5EPEA 1B0AA 2Z43A 4ABYA 4KFSA 1PQUA 1MX3A 5HZGA 3G2JA 4J0EA 2GCOB 1ESZA 1NBME 4J9VA 1MAWA 1Z5OA 4G0ZA 2P62A 3ND8A 1NXQA 1FS5A 3QWFA 3LAWA 4EY5A 4LY0A 4DARA 5IT5A 3P2EA 3DD1A 4G5QA 5SZIA 3T3HA 1NXOA 5E7JA 1XCGB 2BL4A 2DY0A 4HYEA 2WT8A 4GYKA 4Q1CA 1FCJA 1ZIPA 2YS6A 4RD1A 4X7MA 3NHPA 4RKFA 3MA0A 4AZ3B 2WKSA 4C08A 3GJ8A 2JB9A 4V0LA 4NJOA 4BCDA 1E32A 2Z2YA 4KN6A 1M6EX 3HFRA 2XOEA 4UEWA 3PQ5A 2ODBA 1BQ3A 4MUHA 4V1CA 1KVUA 2O3TA 1D4OA 4ER5A 3FHOA 4LUCA 3H6GA 2JAOA 1PTJA 3IPYA 1BDJA 1XA4A 2QGFA 5EL0A 3RIYA 1JHZA 4FYIA 3I61A 3WB0A 3JVIA 4H27A 1FK8A 3X2SA 5F2EA 3MLAA 1N0UA 1JLKA 3DJFA 1OFHA 1TZBA 3Q15C 3W9UA 1HFEL 3HRIA 1AMNA 3K72B 4EQZA 2ZI7A 5LQJA 4LE2A 1LS1A 2QU7A 4L73A 1JJVA 1OV6A 2XNHA 1U0BB 5DRTA 3LHDA 1QE0A 5KYUB 2GZSA 3IKVA 2QTWB 2A67A 3DAOA 3MILA 3PUVA 4XFDA 2H85A 4LVNA 1XCJA 4D4LA 5K20A 1H2ZA 4LSGA 4P5EA 1ODTC 2FUG1 4JJKA 5IF3A 4CIXA 3P9IA 2R2GA 4P4GA 1J99A 4OXQA 2R8ZA 4UNQA 1E5XA 1F60A 4GICA 4EO7A 1A27A 2LW7A 4NY1A 1M8JA 4QYMA 4WNCA 4MA4A 5DTIA 3TR6A 5FHQA 2WA2A 5JAUA 3H8WA 3DTVD 3GEPA 2Q2VA 3PQ3A 4E1BA 3R75A 1G6HA 1BKDR 2A9KA 4Q82A 4ZVNA 3WGVA 1C7JA 3ORYA 3P9YA 4CETA 2YQ5A 3CIFA 3GFOA 3OOYA 1PGPA 4BP9A 3RROA 4HN9A 4CUZA 4BNIA 4FOSA 4MP3A 1O6FA 4P36A 5F7ZA 4HWRA 3UEOA 2WJWA 2REOA 3CT6A 5JD4A 4Y9DA 2TS1A 5GOTA 4ALLA 1KO4A 2C0CA 3DTTA 3TNYA 1E3MA 1LSSA 3WIUA 5F23A 2DQ4A 1V6SA 4K26A 1NN5A 1B8OA 2PH1A 5LR6A 4YHHB 5DGIA 3Q2KA 4TRMA 3N0RA 4FPXA 1J2YA 1YTUA 3FETA 4U6QA 4LRQA 1IWPB 3S7TA 3O8BA 4CKEA 3KQUA 5DOVA 5KYUA 4AKIA 2ZJAA 3L0PA 1DQYA 1FL9A 4YREA 4RIIA 3NWJA 3ROQA 3ZU4A 2HHLA 1ZSYA 4Q03A 3GEEA 3MGCA 1OHHD 1CQZA 1QRRA 1TECE 3FPKA 3Q3IA 2ZROA 3OFVA 5BSMA 4RK6A 1BEEA 2EP8A 3VO1A 3WGUA 4YCAA 2XTJA 2EYQA 4ZIRA 3AQIA 2IZ5A 2HQRA 4FDMA 3ZWXA 4RTMA 3FPAA 3I12A 3T3OA 3OURA 4DMGA 3V46A 3V8NA 4CN8A 4H1HA 3WTCA 1H05A 3RV3A 3SF0A 1FTYA 2DTDA 3QOYA 5EESA 1CTQA 3L9WA 4Q4HA 1I2AA 4AX8A 1SA0B 5TIIA 3W8DA 5AWFC 2D2EA 2ZPTX 4G86A 2OCYC 1F8FA 3NHWA 4KXLA 4EDFA 3NQ41 3W9SA 1Y63A 4OBEA 3TJZA 3DV9A 3IVXA 4RJ2A 5GMOA 1N5IA 1CY8A 4NJMA 3ZYZA 1C14A 1EG2A 2H1WA 3L6DA 2YRXA 2HMUA 1CVRA 1ZA2A 2BF4A 3HCCA 5LA6A 4DLBA 3RS7A 4M1MA 2OA0A 1RRCA 4X93A 2IYVA 1IRIA 1P80A 1Z8DA 2GCNA 3ANTA 4M4SA 4RXMA 1CIJA 3EZ9A 5B7QA 4H16A 1J0EA 3VYTB 1QBKC 3RU9A 2EBUA 2TECE 1EWKA 1CVLA 1M75A 3BILA 3BJIC 4M38A 3T4UA 5INTA 3B6KA 3HN6A 2OZLB 4JDUA 4Y2QA 4ZOAA 1P19A 3DPSA 1YH3A 1IXZA 4WXMA 4PPYA 4YGXB 3B6JA 1XCPA 2C8LA 4FDLA 3W8FA 1JT9A 1JHPA 3PD0A 2LVBA 4NHOA 2PWBA 1NM5A 3ZCRA 1KFBB 2ZYTX 1XT6A 5AJXA 1FNDA 2CT8A 1WSAA 2P9GA 2YFHA 2PFKA 2J48A 2G9RA 3LT5A 3JQGB 3DBHA 2HSEA 3CRNA 5FOQA 3H7AA 5JSUA 2VCYA 1T4BA 2ZJ8A 3I30X 1B0PA 3H18A 5JMTA 5C80A 1XQ6A 2G80A 3GYGA 3DLBA 2MWMA 4UEQA 5B6JA 3DWEX 1BVHA 5L3QB 4QOJA 5LN1A 2JKYA 1QX4A 2NSDA 4HDRA 2PD3A 1ONNA 3ZBUA 1I7LA 5DBHX 4I9FA 1TJYA 4EIWA 3USZA 2HEGA 5M5BA 4JN6B 1GO2A 1B3BA 2IX9A 3D5EA 5L4LA 1Q7RA 3EPJA 3FVVA 3VI4B 1Z33A 5L3VA 2VP3A 1SVOA 1A8UA 3E2IA 1GL7A 4TROA 2MJLA 5IAJA 2ZRGA 2XZPA 3R3UA 1K3TA 1E0SA 2ZPAA 1UKCA 5EIAA 3UF0A 3T52A 1W7AA 4LDQA 4R9UC 5EJ2A 3WIDA 3LF2A 3CLRD 3OTQA 5KTYA 2QLFA 4TTSA 2NNWB 2DKFA 1IN6A 2A9JA 2RHMA 4LF7B 1YKGA 1AGYA 2X1LA 4V1CI 2QTRA 3PQCA 4JD5A 2ZR7A 3WGQA 3L0SA 2A9PA 2GETA 1Z4JA 3E15A 4YBRA 3AIMA 3BORA 2XNCA 4UE6A 1CD5A 1Q14A 3DNPA 3HSSA 4WFKA 1KEEB 3ZQ6A 2EKBA 1E18A 1I5OA 2AUMA 2WLSA 2VP4A 4JBLA 4AB1A 3CX6A 1B1AA 1PL7A 1G1AA 2FEMA 4WN3A 3UH1A 4PWZA 3JVUA 2QBYA 1RYDA 3K6JA 4QLOA 5FBVB 1KMCA 1K7XB 2AQ8A 2C03A 2QTFA 4KX5A 4LYDA 4WJZA 2NU9B 4HLUC 1JG3A 2PPVA 2F48A 4CCYB 3L7MA 3N8HA 4LQ4A 2HF7A 5JATA 1Q0TA 1D07A 3QU7A 1PSWA 5E6SB 2ZXUA 1G41A 4GL4A 3SM3A 1Z3CA 2E7ZA 2QVLA 4IMJB 3FPEA 4QPDA 5CLGA 4YHBA 3GCGA 2SCUB 4BMZA 5HEKA 3JYNA 1OPRA 3NBYC 5KNBA 5FA5A 2E85A 2XKAA 1X9GA 4D92A 3HZRA 4DA8A 5HRAA 1OGYA 4GPD1 5B64A 5JNRA 2PD6A 2WJPA 3MLEA 1UDXA 3AB8A 5DWQA 4AX4A 3K5IA 2C2XA 4PNZA 2WTMA 1GN9A 3FSGA 3KJEA 4MRMB 4A0HA 5HZKA 5J2TA 5I6DA 3VKVA 3EW7A 2A92A 2C54A 3A6KA 4B1FA 1YBVA 3B8EA 5AW6A 1WMFA 5L7YA 4AQ7A 4P4SB 1U7UA 3MLBA 1FX0A 1WIWA 2GD6A 5K6AA 2XXBA 2E18A 1X9IA 1JHOA 2GD2A 4N5NA 2O57A 1IZ8A 3IUBA 1T2AA 3TOXA 1JKJB 2QUJA 5I7SA 3TQIA 3K8QA 5E6UB 4UBOA 4OY3A 1CEQA 3IUNA 4P4UA 2VQSA 3CLTC 2BTQB 4QGSA 3K6SB 3LNTA 1Z73A 3AR6A 4IZHA 1EEHA 1H4VB 2NO9A 4KO1S 4TX1A 2BPOA 3WNCA 5IEBA 4Z6KA 1YOVB 2Q7OE 1DIHA 2V6MA 3JQAA 2QPLA 1NW9B 3HPRA 1N5MA 4Z4QA 1AKYA 4CEJB 3VNQA 3AP2A 1UBCA 1CRPA 3UUFA 1P18A 4Q4CA 1AGNA 1A77A 1PJQA 1AHIA 3KDAA 4CHTA 4EWLA 5BOSA 1FPQA 4BFLA 3KOWA 3MWLA 4CMIA 5J4KA 2Q6IA 4PZZA 4UE2A 4WOCA 1JBQA 3H9QA 3VR2D 3EEYA 3A10A 2A3RA 2JH9A 5FWXA 2G72A 5GM2A 2J67A 4OFBA 3VH3A 1BMQA 3ZZ1A 1E2JA 2WUGA 4AN0A 3ZDBA 1RRFA 4QOFA 3PR3A 2O7RA 3GOQA 4MLPA 4PQFA 1N2XA 4LJKA 2DH5A 2JLCA 3FHJA 1TTQB 4UHCA 4DWVA 1DRWA 2PGDA 1YMQA 4Y3UA 3KTAB 4AM8A 2QY6A 4TQAA 1VL8A 4BNLA 5IJ0A 2JAQA 3B53X 3FPSA 4MW6A 1BU5A 4QGHA 3PQ2A 4ZYUA 1AO3A 2X1VA 3T06B 4XX1A 1LQ2A 1B4DA 1NNSA 3C6QA 3GAZA 3T8YA 4F6RA 2CZCA 5HZMA 4ZCPA 3ONFA 3RRBA 2UXDB 3M1YA 2AMLA 1XRJA 1DZIA 3MB8A 4ZMBA 2F1RA 4TKLA 4DSNA 2ZBRA 5JT1A 4H7IA 3PFNA 5EGSA 1LC3A 4BBPA 4DV0B 2KM1A 1DVRA 1JT2A 3K2QA 3L6UA 2YWDA 2C00A 3QV2A 2HNAA 3QVMA 3ETCA 5TSDA 2EJUA 5DW0A 4WSOA 1QVVA 1GILA 3EAFA 2GXAA 2WG1A 3RTAA 4ZHQF 2I03A 3RVLA 4AJJA 1PVOA 4LVCA 3PNYA 4NOKA 2NO6A 4QDUA 3G89A 5E38A 3RVRA 1SUCA 1GDHA 4I1PA 4HDQB 1YA4A 5T4EA 2ZSUA 2EBFX 1ORRA 3EDYA 3EWAA 2NP6A 1X19A 1WKVA 3AY7A 1E1NA 4C3ZA 2VHEA 1NVEA 3AJ9A 2PZMA 3GD7A 5KNBH 1GA6A 4JB0A 4RSGA 1OQAA 2B6HA 2KWIA 2HMWA 3H1TA 3PIRA 5FBRB 1RYNA 3OETA 2Y9MB 4TTTS 3SK0A 3AZOA 4NFYA 3SHWA 3W79A 3DC2A 5IKXA 1O0BA 2RG7A 3NTRA 1KH3A 4A3SA 1M6VB 1PBNA 1A9SA 2AT1A 4NXNB 1FSSA 1ND5A 4K28A 5AJUA 8LDHA 5LP6B 2DR0A 3DBVO 4L5IA 2K7ZA 4EKNB 1TYEB 1S1CA 3IPCA 1EVKA 1W52X 1P4JA 3A2KA 2ZQ5A 4DPKA 4HF7A 3ANXA 1R8YA 1RM0A 1Q83A 3VHRA 5I4KA 5AQEA 5I8PA 2MOKA 3JPYA 2YXEA 4QHSA 3FVRA 3NYWA 2HCFA 1SBZA 1JU9A 1QQAA 4H6XA 4WA8A 1NLZA 3BIOA 1QYDA 4CT0A 1G16A 3BD9A 2C5HA 1VIDA 3KU1A 3GJ3A 4FDTA 2DHDA 3GPCA 2JEYA 1GNQA 1E60A 4KFTA 1PJZA 4Y2TA 1YOVA 1PV1A 2BGUA 5ALFA 1E61A 1YUNA 2OV8A 3JASA 4BQFA 1EG7A 1GGHA 2HEIA 4BVLA 4WQMA 1K0FA 3R8FA 4D3XA 4B3FX 5KWVA 3RQSA 3E7WA 2VDVE 1CFZA 2QW1A 2FPPB 3WSWA 1PNQA 1SOUA 3ESZA 4I5IA 4O4JF 5JVDB 2PMEA 1QDEA 3A1UA 4QRHA 4MGHA 1UBRS 3ZWAA 3O8CA 1I1HA 1CZHA 4YXWA 4HX5A 4HX9A 2ZAGA 1UP7A 1J90A 3WLRA 1X14A 3U7JA 4OI2A 3SIPA 1VYUA 4J43A 1I7QB 1FU4A 2D4AA 1AX9A 1B73A 3R3VA 2ZBQA 4PM4A 3TS1A 1ZD8A 1UBOS 2JAUA 1XPOA 1C2TA 1IY0A 1SJ9A 2C1ZA 5I8WA 2RGXA 3ZH2A 4L51A 1AS0A 5EC8A 2QP3A 2J45A 2PT7A 3GLIE 2JAWA 4HH0A 1NMYA 3D1LA 2HXGA 4URVR 1P77A 2OGTA 3B1FA 1DEXA 3DMYA 3OCVA 2OG1A 3TL6A 1PFKA 2JFNA 4Z2YA 2H4XA 2YWBA 1ZMOA 1NR1A 4A5SA 4PTLA 3DEYX 1DCFA 1FP1D 1N2CB 1W5EA 2WHXA 1XE3A 2H5JA 2NWQA 2QP9X 3AERB 4FLEA 4KQMA 5E9JA 4LYHA 4RTNA 1P9WA 5JMWA 3Q8KA 3WDKA 4EG3A 3JQ9C 2Q21A 3WZ2A 3KTAA 4HI0E 3DLTA 2FK8A 3QNWA 4J0JA 5IJZA 1ZGAA 1WB4A 4YUZA 2WUVA 2HV8A 3WBKA 3ZUPA 2PSJA 3T3IA 4LJ7A 4ASUA 1Q12A 1WDTA 2C9ZA 3CH5A 3LUDA 2BEWA 2NM0A 3K5WA 4I8IA 3WNZA 2CLIB 3KYCA 2MMCA 3MSXA 3NATA 4D42A 1M1NB 1H8HA 1F06A 2D54A 1T3HA 4IYJA 1BQEA 4UXJA 3MUOA 3AUKA 1ZD1A 1DQSA 2YHAA 3OM8A 2R6AA 4N9QA 2VT6A 3OZEA 2HR1A 1KI7A 3FF4A 4KACA 3A7EA 2BGNA 3JRXA 3LL7A 1T15A 3WLPA 2D5LA 1WKCA 4RDHA 3H5TA 2H2WA 4BLOA 4Z9BA 4HFJA 4B0PA 4HXFB 2HH9A 4GGPA 2PZFA 3FY4A 3IA2A 3OFSA 4URHA 1J2UA 1Z29A 4MWZA 5EXSA 4KBYA 1DFIA 1U0FA 2IUSA 3V4OA 4ARSA 2AIRA 2G36A 1IBCA 3KEQA 3MTIA 3KKZA 2AJDA 5JR3A 3N7TA 4YIKA 1XZMA 1UC4B 4WGGA 5B3JA 1JR3D 3MIIA 4BUZA 2WYIA 5K0FA 3WBFA 3IBCA 1ESNA 5FOTA 5H59A 3M4ZA 3MD0A 4GX0A 3GLHB 4YAOA 3E61A 4MP8A 2HA0A 5T7BA 3CONA 2I4RA 1WU8A 1IBKB 2HMSA 4MS3B 3E48A 3DOCA 5G0WA 5FUXA 5LZ2A 1ZOLA 1KWKA 2FWAA 3HJRA 2DERA 4PGMA 4PLZA 1TEZA 2ZJFA 5IC4A 4NNPA 2ODQA 4YRTA 2GEVA 5AKHA 1SCBA 4ZYVA 2ZUUA 3D81A 3J7TA 4GEGA 3B5IA 1T1SA 3HL4A 2HWUA 2N46A 4CFZA 2DFKB 2FB9A 3LYLA 3K53A 5ALIA 2ZUEA 1O94A 3GAFA 4LMBA 2XUQA 1L7EA 3VU9A 1B43A 3ZG6A 4X44A 5KNDA 1OW3B 3FSRA 2XUDA 4OL9A 1ZGGA 2Y0DA 1O9HA 5FUQA 3IQGX 5AW3A 3COSA 2ZB3A 3NTOA 3V4VB 3JW8A 1P4SA 4NX2A 5HFNA 3OE4A 3DOOA 4EITA 2WWTA 1D6NA 3H65A 1EFAA 3IEVA 5KDLA 3LPCA 3TWOA 4TTIA 1LPAB 2IUTA 4KVZA 3VOBA 5FAKA 2JATA 4UHJA 3EDQA 1SIBE 4IM7A 1BX3A 5JS8A 4DZTA 1I10A 4JLJA 5GZ3A 3HXKA 5A6SA 3WJ7A 5L6MB 2CKDA 5FUWA 3AUFA 1MIOB 3T9AA 5JJLA 5ALVA 1RS0A 4K8RB 3QBEA 5ED0A 4N3BA 2QAGC 4R1TA 2YY6A 3KL4A 1YVUA 3F5MA 5DGDA 4YPFA 1RYFA 3D7LA 3LQ4A 1H5UA 5ALRA 3RKRA 4EKYA 2BE7A 2CJWB 1LTHR 2O7QA 4BRZA 4I4NA 1Z39A 5EMNA 4BFZA 4EG6A 4R2KA 3G7UA 1N6IA 4PYNA 2PFGA 1BFUA 2QENA 3I9LA 5TMDA 2IYZA 1Y42X 1KO8A 3A6JA 5HF8A 3FKSD 1KZ6A 3X1DA 1KAMA 4AS3A 3UO8B 1M6VA 5C7IO 3DZJA 1MJGM 2W6ID 4AP9A 3G79A 3TL3A 3NOQA 1L8AA 4PG4A 4ZREA 5JTUA 3EJWA 3KL2A 3UWPA 3CSSA 4N6GA 1G42A 4CG0A 3VOSA 1NUUA 2BM1A 3BFVA 4P3XA 2BZSA 3LQQA 3IYLW 4G5GA 1UEXC 1XVUA 1P17A 3OZVA 4GRDA 4RAQA 5E1BA 3UNXA 2DG2A 3MT9A 3W06A 3OKAA 1FFYA 1N57A 2XVYA 1GKKA 2HGZA 1U2DA 1XJQA 1XP8A 1AVTA 1D2RA 1Y3DE 3A3KA 4U0JA 3VJLA 3ZIDA 2B82A 3FAZA 3REFA 2W2NA 3B60A 4RHEA 2PBZA 3BH7A 3IR6A 4BWVA 4EY4A 1CJSA 1M8KA 1QH0A 1S5PA 1Y8CA 3EYWA 4MCHA 2E82A 5C35A 3GLFE 5JXIA 2WPNA 3F9IA 4GSKA 4J0CA 2ACWA 2IYRA 3GLHE 3JXEA 2FRVA 2V6BA 5LL6P 2Q99A 1O97C 1T3ZA 3OZXA 1J7KA 1J2TA 2W00A 4X1IB 3WYAA 2QNBA 1W581 3W5SA 4CM8B 5DULA 1KE1A 5D8DA 1YI0A 2IFTA 2VDNB 4UVDA 5AJZA 1PS9A 1VPLA 1SM4A 2J4FA 4I2NA 1E7RA 5IT4A 4KDEA 4URXR 5JCOC 4L6CA 1ZESA 2GAAA 2PGXA 3OJOA 1P2FA 1H0HA 3F1LA 4J94A 2ET6A 3HEBA 2W8BA 3EWIA 1CERA 3MT8A 4RMNA 5EE9A 5CT4A 3T3PB 4P6VF 1S8AA 1T3GA 3D7RA 4N1AA 3G7SA 2EXXA 3U3OA 3GNTA 4DXAA 2LWIA 4F1KA 4TVSA 4Z7OB 3ETHA 3EXIB 1E4EB 3G9XA 2H5EA 7ABPA 1WNFA 3AXTA 1HX7A 1YZKA 3GRVA 3VYVA 1VIYA 1V4VA 3Q7PA 4RVCA 5J4YA 1SQ0A 1OZHA 3L06A 3H2JA 4F3CA 4G0YA 2JFOA 4OL0A 4XWKA 4CMIB 1USGA 4LOKA 3OY7A 2H3HA 3LUKA 2WFZA 4LYJA 1NX9A 2GN0A 4R1NA 4XPZA 5IJ9A 1ZY2A 4B3JA 1HZZA 5EJEA 4LFBB 4NCHA 1NXVA 1H9BA 1ZD3A 1LPMA 2GHIA 3MGAA 4IOLA 4ZPJA 4LCBA 3MOSA 4UM8B 5H82A 5THXA 1QVAA 4KIGA 3PUKA 4MUJA 3G0CA 2ZYDA 3PDHA 4KRXA 2RKBA 3ESXA 4OQFA 2VYNA 3THYA 3U4QB 2QI9F 3L92A 3IVCA 4CT4B 1Z34A 3HDVA 2A9RA 2AEJA 3BHNA 2Q5OA 4GKVA 4IJWA 2BKAA 1W5BA 3IHKA 4E21A 3AVXA 1B2LA 1IK6A 1JYEA 1Y48E 2CE7A 5DB4A 5IUKC 2Q4RA 2WP8J 4W6QA 1G21A 4I5FA 4EF6A 1CNMA 1FX0B 3TLKA 3WIBA 3IL2A 1T9GS 2KLBA 1DEAA 3KAJA 4B6QA 4RDXA 3R8XA 3UJHA 1C41A 2M6SA 5JCPA 2OHHA 3AWDA 1NBWB 3WLSA 1C3OA 3BMCB 1LFDB 2JFFA 2BW0A 4A8TA 1IPEA 2HAEA 1DPFA 2XB4A 2JGNA 3S28A 4H2DA 4AJPA 1YUMA 2LKCA 4Z49A 4YLEA 3MPUA 4MVWA 2ZE6A 5HSGA 1ZI6A 3GG9A 4TYNA 4IIEA 3ANSA 2XF2A 3KWFA 2P7IA 5CLQA 1MQAA 4CF7A 1TD9A 2R1TB 1L7NA 1QONA 1W75A 2FQWA 5TMBA 3UJPA 3PPWA 2VTDA 4MS4A 3TI9A 2E89A 3ZDRA 5L9AA 4U3JB 4YRFA 4BP1A 1LJ8A 4GMXA 4IIYA 2CMHA 1Z08A 3S3TA 3JQ7B 3SLRA 1LC0A 2R4QA 2DE0X 3EC1A 3PDIA 4OMFG 1G7TA 4RPJA 3INGA 2VYQA 4LQCA 3RS4A 4I1SA 1YBAA 4LBWA 1A9RA 4HWGA 3VTAA 4DR3B 2WM8A 1DBSA 1P0QA 3H9CA 3LFUA 2OPHA 1ZG3A 2Z08A 3BIWA 4C0BA 1EDBA 1UUFA 5ADWA 2EZTA 4BV8A 5ALWA 2BM0A 3NTLA 2BHNA 4NAVA 1UZNA 1XPRA 3ZJVA 3UW3A 5BUQA 2G3YA 3IC5A 3IMFA 4BX2A 1UOQA 4XDHA 3I9OA 4Q1EA 1Z6TA 3U31A 4US2R 3URKA 1MAUA 5KYNA 3QMWA 2GWRA 2I4MA 5KOJB 4Z4FA 2IXGA 3CISA 2PE5A 4CM9D 3TPCA 2YWXA 4XM0A 1XF1A 1GNSA 1M5TA 2XXAB 2QZSA 5LZ7A 3EDCA 3VV2A 1G5TA 3F6CA 1NM5C 3AIKA 2Q3BA 3ZR4B 4C6HA 3DDNA 2B83A 3V8BA 1FW6A 2WJHA 3DCIA 3JQRA 1TTPB 1M83A 4RS3A 4U8GA 4AZ3A 4CR6A 4EW2A 4RLFA 5T57A 3DPIA 1SXJD 2XMGA 2P4EA 1V11A 3HVIA 1QRAA 1U5CA 2Z04A 3PK0A 1ZXXA 1W0CA 3NH6A 4QJIA 4DC9A 4PF1A 2VYFA 1E2PA 4PBSA 1O6GA 2BUAA 1UINA 2P9YA 4AJEA 3WHPA 4OD0A 3K70B 2BCEA 2EVWX 2G9VA 1UKVY 3NBAA 3NIFB 1Z74A 1NONA 4WADA 4A8PA 2CVHA 4GLLA 4HXEB 4NU8X 4EECA 1WG8A 2CXPA 2WU0A 2B5VA 2IVZA 3RRNA 1PJLA 4MJ3A 3U62A 3VYWA 3PGXA 2D74A 1UAAA 3UJ7A 1RVV1 6GPBA 2PQMA 5JD6A 3WLTA 4FSDA 1NQAO 2C92A 3EIEA 2F1KA 1J39A 3IFSA 1EZ1A 4KR9A