5FDFA

Crystal structure of the monoclinic form of thermotoga maritima acetyl esterase tm0077 (apo structure) at 1.76 angstrom resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
total genus 124
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fdfA00
1QIMA 1QGED 1THGA 5CW2A 1LNSA 3STWA 3R40A 5DNUA 2OAGA 2WIFA 5IKXA 1RP1A 5AKXA 4BE9A 4CIAA 3DLTA 5IVDA 2QXTA 4X85A 1MAAA 5E4JA 2I3DA 4QEKA 3DKRA 1XZDA 4BE4A 3STYA 1XRNA 3ZPXA 1BCRA 5ALHA 4CI9A 1CR6A 3G9TA 1CV2A 1GXSA 4NVRA 5HQ3A 4FBLA 3FCXA 3Q0TA 5E4TA 5JIBA 1WB4A 3M83A 3OURA 3PE6A 3H19A 5HQ3B 2OLEA 1R9MA 5A7FA 4KACA 4Q34A 1CUEA 4Q3LA 3F9CA 3QPAA 4DSZA 1BN6A 5FP0A 4AZ3A 1XQVA 3IVMA 1UK7A 1UFOA 4BVLA 3ED1A 2GBIA 4BCDA 5LZ2A 4WFJA 2PUHA 1G66A 1CUYA 5ALPA 1R9NA 2ZVDA 4N5IX 4Y2VA 2OGZA 5ALDA 2QUBA 4OYLA 1B6GA 1EXWA 6YASA 1MO2A 5C8ZA 4QDXA 2HFKA 3G0CA 1TCAA 4GECA 3U0VA 2FJPA 4J0IA 3T52A 4ZWNA 1MNQA 4GEGA 1FSSA 4PSCA 2WU4A 4WY8A 1UKCA 3OPMA 1JJFA 1U8EA 1YR2A 5DTJA 3RKSA 3WL6A 4BAUA 4LYDA 4Y2QA 1K6EA 1JT2A 4UHBA 1KEZA 1YS2X 1E8DA 4Q82A 3IIIA 1JMKC 2ZJFA 1QIEA 4WDQA 3AFIA 1IVYA 1UKAA 2OAEA 2ONCA 3G9UA 2RONA 1F0NA 5AOAA 4F0JA 3ESCA 1FFEA 1RWQA 3DCNA 1CUFA 1DU4A 4AO8A 3EBLA 1Q0ZA 4H7FA 4CIBA 4AO7A 1XRPA 5T4BA 4C88A 3QMMA 2Z3ZA 3WK8A 4A16A 5EHQA 5D6OA 3T4UA 5EIEA 3SK0A 1W4LA 1P0IA 1QIHA 4N8EA 3WJ2A 1XZGA 1CUGA 1BN7A 2VAXA 2X8BA 2XDWA 4G8BA 4YASA 4KYVA 4ZV9A 2QJWA 3D2AA 1N5RA 2O2GA 1BRTA 4RE5A 2BFNA 4H7EA 1CQZA 5AM3A 3GFFA 1CUSA 3UMJA 3U1TA 4X6YA 5FPPA 2BUBA 3FAKA 5KWIA 4WY5A 4NS4A 4UHHA 5AO9A 5DJ5A 1FJ2A 4INZA 4HRXA 4P9NA 1ZI8A 3OTQA 5JAPA 4AB1A 4N5HX 2GBFA 1E8MA 3DS8A 1N8SA 4YX9A 4Y2UA 4BRSA 3DKKA 3GZJA 5ALIA 4X91A 3VISA 2QMQA 3C8HA 5ALSA 2WFMA 3KD2A 4UFOA 2CUTA 4J0KA 1JI3A 3LLCA 1PV1A 4PO3X 1EA5A 1XZKA 4MQLA 2C0PA 3G7NA 3GROA 3B3QA 3O4IA 2JGIA 1VE6A 4Y9SA 2H7XA 1ODSA 4G4IA 4XJVA 5AM0A 4OU4A 1EDEA 3L1IA 4L0CA 2VAVA 2WHQA 5A7HA 2XUOA 3IB3A 2XLBA 4X6UA 3C70A 2ECFA 1S8OA 3WQHA 1CUBA 3PDCA 4X7BA 3IUJA 1R88A 1HKHA 4X95A 1Q0RA 4EY7A 4PW0A 3KWJA 5K3AA 1JU3A 3BL8A 4N8DA 3A2NA 4K2AA 3VJKA 3L1HA 1Z68A 2YYSA 2Z8XA 5JD6A 4E14A 2OCLA 2HRRA 2W22A 4UUQA 1MTZA 3YASA 2B61A 5ALNA 5JANA 2XQIA 2J4CA 1FFDA 2QT9A 5ESRA 3FBWA 4GHWA 3O4HA 3W06A 3H04A 5FKJA 4BDSA 3D3NA 3F98A 1R4ZA 1DQZA 1JJIA 1XKTA 4BTVA 5ALWA 1F6WA 3FWHA 4G8DA 4QWWA 2HM7A 7YASA 1XRLA 1R50A 3ZLUA 1ZI6A 2HFJA 4FKBA 4KJXA 2JIDA 5JD4A 3WK6A 5LZ7A 4QLAA 3QZUA 2V9ZA 4CG3A 2ACKA 3PFBA 3WL5A 4C4XA 4HRYA 4J3JA 4QLOA 2GBGA 1Y7IA 3BE8A 1E3QA 1F8UA 4GXNA 1WPRA 4BYMA 3EF3A 1VKHA 4FTWA 2X76A 1ZD3A 2XMZA 5AM5A 3H2HA 4JNCA 1ZIXA 1QIIA 1A8SA 3FYUC 2QJRA 2VJBA 3CCCA 1K63A 4BZZA 2JGJA 3E1GA 3FCYA 3W05A 3JYHA 3D2BA 3K6KA 4V2IA 5ALLA 1EK2A 1IUPA 3EQ8A 2Y6UA 3GA7A 4H77A 4F5ZA 4Q3OA 5LLSA 5A2GA 2AJLI 3HLKA 5IVHA 3MGAA 3TRDA 1TCCA 4CG2A 2PX6A 4K6GA 1CRLA 2EDCA 2O2IA 5J3JA 1HPLA 4UHCA 1XROA 2WU3A 3HZOA 2VEOA 4WFIA 2O2HA 2BAGA 3IA2A 4LXIA 1EVEA 5D7BA 3WI7A 2O7RA 2AXEA 3W9BA 4G9EA 4JH0A 1EB9A 3I1YA 1BEZA 1B41A 3D2CA 5HK8A 1LPBB 1LZLA 4BBZA 4I3FA 4L9AA 4GDMA 4C89A 4XIIA 1UOPA 3BF8A 2DHCA 4Y2YA 3N2ZB 5K3FA 4TPKA 3EQ7A 5AI6A 3QPDA 2JEYA 3WZMA 1DWPA 4H7IA 4OPMA 2VJCA 2OGTA 1ZOIA 2WQZA 3DDUA 1QZ3A 2AJBA 3R3YA 1UK6A 4UBJA 1TRHA 1UWCA 1UOOA 3DEAA 5LKRA 2JEZA 5FOQA 3H2KA 5CRIA 5CMLA 4BAZA 3A2LA 4I19A 5C8XA 3N0TA 1NX9A 3IUQA 4BATA 3FLBA 5AIAA 2HRQA 5CT6A 1F0PA 2XMQA 3QVMA 3OC0A 1LBTA 2CB9A 2K2QB 1GT6A 1XRRA 1ISPA 1TIBA 1JJBA 2XMGA 5KWJA 1H2YA 1LGYA 1UZAA 4UBNA 5D3ZA 2XUGA 3M81A 4TVKA 1XZMA 5JZSA 4XVCA 1UK9A 2HA3A 3ESBA 1E5TA 5I9IA 1PJAA 3I2KA 4CFSA 4BRZA 3WIOA 3G8YA 1BROA 3EQ9A 3LIIA 2RIPA 5AK5A 2J3QA 1AMNA 2DCMA 4OB7A 5AP9A 4RNCA 1YS1X 4EY6A 2R8BA 5HKBA 3EIOA 3E3AA 2P8SA 1XKLA 4EY5A 1H2ZA 4JYPA 5ALFA 5HCUA 1CPYA 3DQZA 4U2EA 3G02A 4HXEB 3M82A 3C8DA 2C5GA 2XMCA 3LP5A 3C6BA 3WMRA 2Q0XA 1TCBA 4Q1VA 4G9GA 4B0OA 2G4LA 1T2NA 1ZIYA 1CVLA 3DD5A 3F8SA 2RHTA 5HFNA 3O9MA 4QNNA 4A23A 4DMCA 3WK7A 1VXRA 2ZSHA 3MUOA 4MWTA 2GZRA 4DMKA 3I2JA 1C7IA 3LIPA 1DTEA 2Y2VA 2XI4A 3D7RA 5DNWA 4DIUA 3V1NA 1CUJA 5E2IA 5F4ZA 3E0XA 3WYDA 1BU8A 1XZEA 5K3DA 5JYCA 4BVJA 1JFRA 1ZD5A 4B6GA 2JGFA 5ALMA 5AKJA 4KRXA 4FBMA 5K3CA 4UBMA 2Y6VA 2XUFA 4H18A 1G5FA 3F96A 3STTA 1J06A 4LIPD 5JADA 3K2IA 3ESAA 1AQLA 1MT3A 3ZWQA 1OILA 1XZAA 1N5MA 2CJPA 2ZJ7A 5AJHA 4QA9A 4Y2SA 4DMHA 2Y1KA 2JGLA 4KE8A 1MNAA 2O7VA 2DQYA 3QBJA 4KE7A 4MEAA 2XE4A 2H7CA 3VJMA 5ALQA 2V96A 2FX5A 3D5EA 1XRQA 4QE3A 5JZ9A 2GYWA 2ORYA 3RM3A 2D5LA 2WIGA 1XRMA 2HU8A 2HDWA 3ZV7A 4NMWA 3VJLA 4KAFA 4H0CA 5IVIA 4BB0A 2J3DA 5ALTA 3WK5A 5LZ4A 5AIBA 5AI4A 5T4HA 1ACJA 5CH5A 3H0CA 1EB8A 1TAHA 1YCDA 1K8QA 2DSNA 1CUWA 4Y2XA 3C5VA 1IZ7A 4LXHA 2VSQA 3LCRA 2AJ8A 2PL5A 1MX1A 3ESDA 4I4CA 2QXUA 3H2IA 3RLIA 4WDRA 3R3WA 5YASA 3WA7A 3I28A 1VZ3A 4UBLA 4M0FA 5DWDA 4ZV7A 1KU6A 1CUZA 4UHFA 4KAJA 5AKGA 4WFKA 1CLEA 4MQMA 3A6ZA 5LZ9A 2AJDA 2CMFA 1KU0A 1MPXA 4DNQA 4EUSA 3ANTA 4K6HA 3R3UA 2DHDA 5JARA 4M0EA 1Y37A 2ZYSA 3V1KA 3BDVA 3BJRA 3NWOA 5K3FB 1FFAA 2OXEA 4EB0A 5CH8A 1NU6A 1ORVA 5AM2A 5T4FA 1QTIA 4W1SA 5SYNA 3WL7A 3I6YA 2ZYHA 4D9JA 4X94A 4XX1A 1AURA 1XFDA 1UK8A 4UHDA 3I6MA 3HJUA 3WKDA 2Z3WA 1AKNA 3V1LA 5AK4A 3HSSA 1DT3A 4WCVA 1BCSA 3V9AA 4OSEA 4G4GA 5AKKA 1GPKA 4JUIA 1WHTA 5AM1A 1ZICA 3PF9A 3P2MA 2B9VA 4FOLA 4RGYA 5ALEA 1ORWA 3DOIA 2WHPB 4GW3A 3VVLA 1AUOA 1QONA 3GBSA 2HHAA 1YAJA 3DL4A 4QDOA 1EX9A 2WKWA 1O6FA 4UBKA 5IVKA 3WKAA 4LXGA 1ZJ4A 2WLSA 4ARBA 4DNFA 5LKAA 4EY4A 1QLWA 1EVQA 1R1DA 4X71A 2QR5A 1Q84A 3WA6A 2WG1A 1ZGBA 4C87A 1LLFA 2IX9A 2HA2A 4OU5A 4S0XA 1OCEA 3CXUA 1YSCA 4EZIA 4F21A 2WUFA 5AKIA 5ALXA 1AGYA 5C81A 4ZGBA 2I3ZA 1LPMA 4KR0A 4C6HA 3O9VA 2V98A 2XB6A 1XQWA 3W04A 2PSFA 4Y2RA 3W2TA 3WWOA 1XZLA 1M33A 3R3ZA 2XMBA 2FUKA 2YH2A 4QDUA 2EEPA 3V48A 1CUAA 4BC1A 1K4YA 1EI9A 5FDFA 4GI1A 4O08A 4J03A 3R3VA 5CXXA 5A7GA 3QMWA 3WYNA 4UBOA 3F97A 3L1JA 3DYVA 1ZD2P 3A70A 1SFRA 3QYJA 3HABA 4PSDA 1U2EA 2W6CX 2WUDA 1H23A 4HZGA 4G1FA 4YPVA 4H7HA 4DSAA 4HXFB 1QIDA 5AICA 2WILA 4OD0A 4H7DA 2H1IA 4UFPA 4BTLA 3JW8A 3D0KA 2DFPA 3G0DA 5ISMA 4AMYA 2ZSIA 3G9XA 1K5PA 5CT4A 3BIXA 2RGUA 3M3DA 2XUHA 3MUNA 4ZXFA 3BDIA 3FYUB 5JASA 2WHRA 5BOVA 2VTVA 3SC2A 1H2XA 5C8VA 3FOBA 4FLEA 3W9UA 4E11A 1EHYA 1HQDA 4DM7A 1XQXA 2HA0A 3KXPA 3WKCA 4KE9A 1XZFA 4ITVA 5H3HA 3TEJA 1W76A 2EDAA 3GELA 5DNVA 5AM4A 1AC5A 5EHNA 3H2JA 1X2EA 5ALRA 1R3DA 4U2FA 5ALZA 3OG9A 4C4YA 1WHSA 2BJHA 3S8YA 3KSRA 2VA9A 3I2IA 5I7UA 2QUAA 1GQSA 2PU5A 3I2GA 4HVTA 4M0MA 2VT7A 4DGQA 4BZWA 2VATA 1X2BA 2Z8ZA 2C58A 4ARAA 5DTIA 1SCQA 3IURA 4ZREA 4XWGA 1EH5A 4N8SA 1IZ8A 2QRUA 2C4HA 1QIJA 1VJ5A 1DX4A 2ROQA 3O0DA 3WZLA 1QFMA 4PV7A 4J0GA 2XUJA 2WFLA 4DYHA 1LZKA 3VKFA 4AN1A 2XUAA 4X92A 3ZI7A 1QOZA 4L3WA 1G42A 2JF0A 1ODTC 2WTMA 2DQZA 3DL7A 5LZ8A 2I03A 4CCWA 1ZD4A 3OOSA 4B9AA 2GZSA 1JKMA 3G0GA 4YK7A 3HACA 3HYSA 5A6VA 2RAUA 4HS9A 4IO0A 2XLCA 4KAAA 3C6YA 1T4MA 2Z5GA 2PSJA 3C5WP 4J7AA 3TGLA 5EGNA 1U65A 3IUNA 3KWFA 4RE6A 4GWLA 4LHEA 1WM1A 5HF5A 4DMFA 3AIKA 5BWCA 1YAHA 3PUIA 3FVTA 1G4HA 3UUEA 1VXOA 3OM8A 1QTRA 4KEAA 1GPLA 1VE7A 5EHXA 2C0QA 5BWBA 1IUOA 3AINA 5AOBA 2XQJA 4FLFA 5JATA 4ZRDA 1FFBA 4TGLA 2G63A 4W1RA 4UFNA 1ZJ5A 1X70A 1H2WA 4PQEA 2ZYRA 2AJCA 4LKOA 3WL8A 4AZ0A 1MJ5A 5AHXA 3QH4A 3LS2A 2OCGA 1CFJA 5JAUA 4X97A 2CBGA 4GBGA 2PPLA 4ZI5A 5CBKA 2VJDA 4J0DA 4CCYA 1JU4A 3ANSA 1L7AA 1CEXA 3ILSA 3C45A 1DX6A 2XUQA 4K5QA 5ALVA 3R0VA 5FUMA 1XZBA 1SC9A 1W52X 3IDAA 2J4FA 3CN7A 5LZ5A 4QWMA 1UOQA 4X93A 1EINA 1GPNA 1GKLA 1SCKA 1XQYA 1YB7A 4DLNA 4UHEA 3RARA 4MEBA 2XQKA 5DYTA 1EK1A 1NU8A 4E15A 1HLGA 4X3CA 2VT6A 2ACEA 2XQGA 4AX4A 1MAHA 5HK9A 3QM1A 1EDBA 3E4DA 4CG1A 1YA4A 2QZPA 4P93A 1GGVA 1EDDA 2B20A 5AKLA 1QJ4A 2PSDA 2CZQA 3BJMA 4MYSA 4FLMA 1XLVA 3KOOA 5FXMA 4IHAA 3CCBA 2QOEA 4Y7DA 4EBBA 3STUA 3STVA 4AO6A 3AJAA 2OPHA 4Q3KA 2GYVA 5I8PA 1USWA 4J0HA 5KBYA 4OB8A 4IH4A 1FFCA 2HA7A 5AK6A 2CKMA 3G0BA 4W9RA 5CT8A 2Y2UA 1MN6A 5K3EA 1DWQA 4AN0A 2PSHA 1CUUA 5K3BA 1CUCA 1W6RA 1PFQA 2BKLA 4G5XA 3C6XA 4PSUA 5CT9A 4B7ZA 1Q83A 4B85A 4IH9A 2CEKA 3DYIA 3NGMA 2WTNA 2XUPA 2C7BA 2HA4A 3PUHA 1YASA 3Q8WA 5CURA 1P0PA 2G5PA 1CUXA 2LIPA 1SOMA 4ETWA 2RI6A 4F60A 1VOTA 2OGSA 5T4EA 4HAIA 1E89A 1UXOA 2JGMA 2ZJ6A 4FMPA 2WJ3A 4X6XA 2UZ0A 4CCYB 1ZI9A 2BUAA 1JMYA 5E4YA 1VLQA 1HDEA 2C5FA 2V97A 2IIVA 2HIHA 5JALA 2OG1A 5AKHA 4J0JA 2VJAA 3B12A 3FLAA 2PUJA 3AILA 5JZBA 3WJ1A 3AUKA 2BCEA 3QITA 4A5SA 1LPNA 4RPCA 1WOMA 2QTBA 2ZYIA 4FHZA 4PF1A 4U2GA 5LP1A 4BP9A 4HXGA 1CIJA 1HBJA 5SYMA 2WIKA 4B84A 2QVBA 3O4JA 1VZ2A 3AIMA 2E3JA 1UKBA 2XMRA 4JYMA 4B81A 3D4LA 5C7YA 3PICA 1QIGA 3ICVA 3WK4A 5AI0A 1J07A 3WKEA 1MU0A 3ICWA 5HF9A 5LIPA 4C4ZA 2WUEA 3C87A 5AKEA 3IUMA 1GQRA 1QIFA 1AX9A 2I78A 1QO9A 1BS9A 1CUHA 1DINA 2GYUA 3S2ZA 1HL7A 1XZCA 2WIDA 5EI5A 1ACLA 3I6ZA 4AMZA 2RHWA 2WIJA 4MJ3A 1RYYA 2NW6A 4OYYA 5FLKA 3FSGD 3BXPA 3H1BA 1LPSA 3G0IA 2WFLB 2QS9A 3H18A 1J1IA 1ODCA 2HU5A 5HFAA 3RK4A 4E46A 3CN9A 4FFWA 1I6WA 4U2BA 4MWSA 5ALKA 2B4KA 3WWEA 2WFZA 5JD5A 1E8NA 2HA5A 2WHPA 4PNZA 1J2EA 2HU7A 4EA6A 3VDXA 1DWOA 5IH7A 3WKBA 3TJMA 1P0QA 3BF7A 4FFVA 4ROTA 2PM8A 3NOXA 4QDZA 4HTAA 4B9EA 4FNMA 2X5XA 5A62A 1BEEA 4GLBA 2QM0A 3KDAA 5DYWA 3X3HA 5K5EA 3STXA 2YASA 3WWPA 5ALGA 1LPOA 1GKKA 1CQWA 2JGKA 1YB6A 2OCKA 3PF8A 5A71A 2XUIA 3FVRA 5HF6A 4OUKX 1ZGCA 3HC7A 4BAGA 3HRHA 3DJYA 3FNBA 1IUNA 1CUVA 4WJLA 2WUGA 1QO7A 1QE3A 2OCIA 2IITA 1THTA 4MXDA 3QPCA 3I1IA 1L7QA 1E66A 4Y2TA 4OCZA 5LYYA 1LPAB 1VA5A 4FWBA 3AZPA 2XUDA 4FNGA 2WG0A 4FDMA 5EIHA 5HZGA 2H7YA 5EIAA 4IQ4A 5FRDA 4X90A 4UPDA 1A88A 3AZQA 3WWDA 1TKRA 2WSLA 1C7JA 4W1QA 2FJ0A 5EHZA 3B5EA 4Q05A 5HKAA 1BE0A 2BGRA 3O95A 4AXBA 2BUCA 4U2DA 1N1MA 1DT5A 5DLPA 3QMVA 3IBTA 2VF2A 4LYEA 1ETHA 4W63A 3UUFA 1CUDA 3BIWA 4IH1A 3WLAA 2JGEA 1IMJA 5BV7A 4U2CA 3FLEA 2G5TA 3HI4A 2PVSA 1UT6A 2VQ6A 3AIOA 3FYUA 4DNOA 4G4JA 1A8UA 4QDTA 3H2GA 5AKYA 3PI6A 4BP8A 1MX5A 4BDTA 1DQYA 4C01A 5ALYA 4Y2JA 3ZLVA 5FPQA 1OXMA 1XZHA 1CUIA 3FYTA 4J0CA 4B80A 2D0DA 4H35A 1XLUA 4L72A 3JWEA 1WB5A 1A8QA 2XMDA 2WM2A 2BGNA 3H17A 1WPXA 5JAOA 4W1PA 4DTCA 2YXPX 5CT5A 3HEAA 4NZZA 5ALJA 2XUKA 4P92A 2OQIA 1QFSA 3A2MA 1XZJA 1XLWA 5AI8A 4Y2PA 3VXKA 1D07A 2GBCA 4QZVA 3R41A 3I2HA 3F67A 2PKYX 3I2FA 5AK3A 4B0PA 3AZOA 4KE6A 3DNMA 2H9YA 1SCIA 3VVMA 2DR0A 3NUZA 1XZIA 2ES4A 3BWXA 4BCBA 4OB6A 1QIKA 1W75A 2PBLA 4JEIA 5AI9A 5ALUA 4DNPA 5JAHA 5EFZA 2WJ4A 2XT0A 4B82A 3GUUA 3MVEA 1A7UA 3O4GA 2R11A 2HADA 4K6KA 5AKZA 3V1MA 5CH3A 3G9ZA 1W1IA 2PSEA 2WJ6A 1H22A 3D59A 3WIBA 1LBSA 1P0MA 5FV4A 4UBIA 4BVKA 1U4NA 5ALOA 2OQVA 1TQHA 2WG2A 3C6ZA 4BCCA 2XQFA 1VA4A 4X00A 1MX9A 1TK3A 5DYYA 1L7RA 4EY8A 2HA6A 2JBWA 2QKYA 5HF8A 1WB6A 3SX4A 3ZLTA 4AQDA 4P08A 4H7KA 1GZ7A 5CTAA 3K9BA 3WWCA 1Y7HA 1O6GA 4Z49A 4G8CA 5AOCA 4B83A 5AH0A 3PFCA 4KRYA 2DHEA 3R3XA 2HL6A 4MYDA 4BC0A 3H1AA 5KREA 3FSGA 3C43A 3WK9A 1C4XA 3IULA 1AZWA 2XMSA 4EHBA 3SWWA 1YA8A 3HXKA 5AI5A 5D3KA 3DOHA 5CXUA 1WCYA 2PU7A 1LPPA 4H7JA
chains in the Genus database with same CATH superfamily
2O1WA 2EGHA 3EBPA 2CCGA 4TV8F 1LNSA 3HV2A 3OO0A 4HK4A 2XT9A 1KJNA 2PEYA 1NYQA 3GRKA 1HTBA 1V41E 2B83A 3BMOB 4PZ0A 1RRCA 1NW8A 1PX0A 2Z5FA 4WQMA 2R1TA 5TJ9A 3N7TA 1RP1A 1J2TA 3WOHA 3CISA 2E7ZA 3NP7A 2NU8B 3VR6A 1NF8A 1A2OA 1OHHD 4RTNA 4JWTA 3N2IA 2RGYA 3U3OA 1PV2A 4WNIA 1CY4A 3DLTA 5CDSA 2LKDA 4YRMA 1X77A 3N3AC 1OB2A 4PYQA 1Z6PA 4KBYA 1MAAA 1M34A 1NN0A 3OSZA 2JPDA 3ZCQA 4MMXB 1OH5A 3PXUA 1TQ6A 1ZVQA 1JKIA 1TYEB 5BQOA 1NX6A 3NOOA 1HE4A 1ODJA 3NNDA 1WCWA 4LDJA 3IPLA 4NP6A 4PCUA 4WN9B 5F2NA 3BWBA 4WXEA 3PJRA 1XCBA 2ZRBA 4QULA 5C8YF 5AW9A 1CV2A 1GXSA 4NVRA 1T6YA 3OQIA 4J9VA 3TINA 4N1AA 4OXKA 2DETA 4O5OA 3OPYI 5E4TA 2AXQA 4F4UA 4KUGA 5JHGB 2IYLD 3FPHA 5F7ZA 5JVDF 4UOQA 4DY4A 3W2GA 2JFBA 2W8BA 3HA5A 3PE6A 4BIIA 4C7VA 2AX4A 4TRNA 3ZBTA 2G1PA 2OLEA 1ZIDA 4X9XA 5A7FA 3GJTA 3L1KA 2P5UA 3RS7A 4W5TA 4Q3LA 5SYAA 1YE8A 1T6BY 2YWHA 3GVIA 4F5WA 2RG1A 2CLSA 5DI3B 1BN6A 2WDZA 2I8LA 5BSMA 4ZI2A 3U39A 2LCFA 4S05A 1UBNA 5AJXA 1GU7A 1C8KA 3DHEA 5F9MA 3NBQA 1UFOA 3OIYA 3ASYA 4FU0A 3ZE1B 1RTTA 4JLAA 2VZ9A 5LZ2A 1JG1A 2V5AA 2XRMA 3PQ7A 4RD0A 4WFJA 1U81A 4JBHA 4WXMA 3SQDA 4RELA 4IHQA 4IJQA 5DXAA 5CK5A 4EHLA 2ZGVA 3IQFA 4ODIA 1VLZA 2CXRA 3GXBA 1KKUA 3K32A 1A5SB 4LK3A 4L7QA 1KZYC 3LY8A 2ZBPA 1TECE 4R98A 2VO1A 3EIWA 5DGCA 2CLKB 3TNFA 3P9QA 3ROZA 1CP2A 5ALDA 4IKEA 4IMJB 3WS7A 1IQ0A 2HHLA 5BNWA 4WKNA 3OKAA 2D0PB 4WFQA 1QC5A 1VE9A 2RGNA 5LUBA 5AOVA 2HXYA 4REOA 2CHQA 3IIEA 3LHIA 2EVWX 2A4MA 4G01B 4Q37A 1DKRA 4NHEA 3QTTA 5H59A 5C8ZA 2ZPTX 4JLBA 1KP3A 3EZFA 4QUKA 3G0CA 4PAOA 3WXBA 1Z0FA 5FV7A 2VAMA 2ZM6B 4Z7QB 5KYUA 4IMPA 1LLUA 2SKEA 4J0IA 3L7JA 4JGGA 1NURA 3ZUPA 4D8YA 1CQXA 4H59A 4LMAA 2PKQO 3KFLA 4F1JA 2CDNA 1MNQA 1FSSA 3MOSA 1NZFA 4M49A 2M6KA 4LVCA 5HQJA 4B48A 2X0FA 2WU4A 4BWFB 1NNI1 3FRJA 4WY8A 3GG2A 3ABZA 3USES 5CNIA 2XJ9A 1XCJA 2H1RA 2VOEA 4H0FA 4K0RA 2D5AA 2NO1A 1KC1A 1UKCA 2GFIA 2XCUA 4JK3A 1JJFA 4M37A 3F5MA 1NRJB 1VYHA 3NIGB 4LN1A 5T64A 1IG0A 1UBOS 2EGGA 4CPDA 4MPRA 2EHJA 4Y2QA 1UJNA 3AB3A 4I9UA 3MRXA 2AF3C 4CT5A 3ORRA 2J3MA 3FA2A 4J2HA 4WX2B 2O0KA 1B73A 3JVIA 4QUEA 5BMVF 5CYFA 4YJ3A 2GEDA 2NN3C 1E8DA 1M6VA 4UULA 1GNRA 3IIIA 5B3JC 3DZFA 1MO6A 1ZNYA 3JS5A 1QIEA 4BFSA 3OQMA 4PXYA 2PL9A 3AGPA 4TWBA 2CE2X 3VAAA 2GEUA 4AMBA 1XYGA 1UKAA 2EKLA 1GV0A 5JDCC 3DTYA 3W2IA 3JD1A 3RB8A 3EEIA 6ADHA 1RYBA 3WLPA 2X8WA 4A03A 1Z6ZA 2F7SA 4KQ6A 5AOAA 4G0WA 2BOVA 5HA5A 3AFMA 2FG5A 1SCBA 2CLEB 2XRYA 2YC4C 3Q6IA 5HIAA 5HQTA 3K2EA 1Z2AA 1T2EA 1DU4A 3OPYA 4TS1A 2EFJA 1U7UA 2OPBA 1P61B 3QXSA 3FHLA 3N5KA 4AJ9A 4PG6A 1YQDA 2CVHA 2G8NA 4RMNA 4UUBA 5B1SA 2AZDA 4LC9A 1ONSA 2YC2C 3ROPA 5FPTA 2PL3A 3AVVA 3FDFA 1P0FA 4FQ5A 5D6OA 2VYND 3WIEA 2FKNA 2D1RA 1GAJA 2VDWB 5FADA 3SK0A 2FFAA 2QP3A 2ZJ5A 2GCOB 3KPYA 4O2LA 5AHOA 1YQQA 1P0IA 1UJMA 2EBFX 3MWEA 4LJ5A 1WSAA 3LSTA 3QUQA 3DA8A 1P81A 3CLKA 1DZ3A 4IICA 3VYTB 4RGBA 5L3QA 2XDWA 5KAPA 4RZ3A 1AVTA 1EVJA 1JECA 1E2GA 4IOKA 2JJ1D 3AETB 2Q8PA 4KYVA 1Z74A 2ZCVA 1QS0A 3UWSA 1LS6A 2ZTVA 5EP3A 3WAGA 4OL9A 4UXJA 3TKLA 1UJ6A 4RE5A 1EFUA 3AVPA 4FK8A 3TL3A 1TUEA 2R6CA 3U60B 2O8BB 4OQXA 1YD7A 1A9XB 1JIXA 2HC9A 3A8TA 3PIRA 3SP1A 4WUTA 2ZIFA 5HIJA 1DAOA 4J0FA 4EATA 2G72A 1USIA 4CTMA 4MDHA 2QR3A 1OI3A 3P45A 1JX6A 2BEVA 2VPIA 3EVBA 4IJMA 2UYCA 3LX5A 4HDNA 4ZALA 4V1CB 2A57A 3UMJA 1G7SA 3H8WA 1Q1BA 1HDIA 8MHTA 1HYBA 1JP7A 1M34E 4QRHA 4X6YA 4YR7A 4FE4A 5DTEA 3NB0A 2BUBA 3BHNA 4NU6A 2JIBA 1QB7A 1RHMA 1L4UA 4JUCA 1VLMA 5GOTA 1DO8A 1BHJA 1GN9A 4L4YA 3MTGA 3UICA 2J45A 1WL8A 4NS4A 1EBFA 2ENUA 3K20A 3TD6A 5I4IA 4FCWA 5AO9A 5DJ5A 2ZSJA 4BO6A 4I6EA 3HXQA 1A8PA 2ONKA 1FJ2A 1DC7A 1QHEA 3Q2IA 2IV2X 5LYJF 4DABA 2ZKLA 5DX0A 2Q0SA 5EWMA 3M9WA 4H9GA 4BEJA 3CLRD 4P9NA 4KR3A 1G2QA 1LF0A 1ULUA 2F43B 2P9QA 3EY9A 4EHIA 2WHXA 3A3PA 3RF7A 5JAPA 1ESNA 2IYQA 3GDGA 4L6IA 5A1JA 2IK8A 4ICIA 1ND5A 1E8MA 2OB2A 3DS8A 3CPSA 1N8SA 2CFSA 2RHOA 4TZ6A 3EWIA 3H9EO 3NU1A 1A2QA 2XZPA 4O2BA 1GZHB 1TB4A 4XZ3A 4DUPA 5DSXA 1OVMA 4RJTA 3K53A 1USKA 3B38A 4RX1A 3D6MA 5ALIA 3DBIA 3VO2A 1YQ9A 2IIPA 3CT6A 2M98A 4X91A 4R8KA 4YWHA 6LDHA 4ZCRA 4N3AA 3TLEA 5HS6A 2YX1A 4IM7A 1COWD 2CK3D 4NV1A 1BH2A 2AVNA 1KMMA 5G02A 4DUGA 1QQ7A 1N3IA 1SCDA 2D7CA 3QLEA 4UTZA 5CAEA 3OP1A 3Q8KA 1AHNA 4UFOA 1RJGA 4UE2A 1U99A 3RRJA 3WQQA 1WMFA 3ZTTA 2MT9A 4BNUA 2ZAYA 4PO3X 4G2TA 2BKUA 2C57A 4MQLA 2EFDB 3G7NA 1OZ0A 2GZ3A 5EKSA 3TAUA 1V7ZA 2Y68A 3O4IA 1RRPA 1K3FA 4MWDA 2JGIA 5A4KA 2IBTA 3D7MA 3B5IA 1XDGA 4KLNA 4Y9SA 3V3TA 4GZ3A 3D6VA 4YAIA 3L6EA 2ZXEA 2GERA 1KI7A 4WXPA 4I66A 4NE2A 1D0IA 2OYSA 2H9AA 3PXBA 4OU4A 1MO4A 3FD8A 4L0CA 5IJ0A 1LB1B 5HZKA 1EESA 2WHQA 1H8HD 4ZAGA 1DEAA 1Y8QB 2XOKD 3ZQ6A 2XUOA 2GPAA 1GTJ1 4L22A 4EHFA 3F6CA 4J9UE 5SZHB 1X19A 4KXUA 1AF7A 1DO2A 1NBOA 4W5WA 5F1YA 4LF8B 3WQHA 1QCYA 1SVOA 1CDOA 1JJ7A 2P30A 4FMDF 3FPJA 4H3VA 4OSOA 1U0GA 3FR8A 1GPH1 1SUIA 2B37A 2C4WA 2Q3CA 2GK7A 3PDCA 3TW8B 4D45A 4YRKA 3GFVA 1HV8A 1P7ZA 1YZQA 3FYCA 1RWMA 4ERNA 5KSWB 2Q2OA 1SPBS 5KOJB 4OMCA 1J0BA 3GDFA 4JD5A 3IRUA 1VJ1A 4BNVA 4EEKA 4DCGA 4FP9A 4AS3A 3KWJA 4UEJA 4I4LA 3SIRA 2F9FA 2B25A 4UEKA 3GXOA 2C31A 1UDXA 2J3HA 4UM7A 1X1SA 2R4QA 3PTLA 1RYEA 2C5AA 3ZK9A 3PWTA 3RYFA 1NLFA 4RVFA 3A6LA 3RABA 4URYR 4OFXA 1JSCA 4UPVA 3TBHA 4JI4B 1QF6A 2A92A 1MB9A 2BEUA 4E2ZA 1W5SA 3FNIA 1ZN9A 3UFXA 4LV5B 3HCAA 2FN8A 3CZQA 4ZYUA 2BDTA 2FK8A 3FMIA 3QQ5A 3HNOA 2HRRA 3I5MA 2NYUA 4UUQA 3ROKA 2WAYA 3TVDA 2VHJA 2HCJB 4ZAWA 1I4WA 5IW8A 4C0BA 3TFQA 1B74A 4EKYA 1UWLA 1PR3A 2I6GA 3OZUA 4RVUA 2GUGA 2XQIA 3G2OA 5LCXA 2FCRA 2ZE7A 3K4HA 4D0LB 1KWGA 3N2YA 4H60A 4N54A 2WT9A 3T34A 3LLUA 4L85A 1UBLS 4L4RA 2UZ3A 3CSUA 4PRZA 2HHJA 2IHYA 2IUUA 1CYDA 2AI2A 1KAHA 5KWVA 5ESRA 3OX4A 3ZE9A 3V4OA 3VPHA 1ULZA 1LK0A 1MKYA 2AUMA 3KQLA 2JASA 2RGGA 3FBWA 4A8JC 4AD8A 1T4BA 5ELXA 1UDRA 3OT5A 3W06A 3WLEA 4CZ2A 2I54A 2Y0BA 1Z6AA 2VKTA 3S44A 3N7UA 4C7XA 5FBZA 1DQZA 3E48A 3FVWA 4A2WA 1MGOA 2KJQA 1B16A 2HOQA 1P6UA 4HLNA 2OCYC 2BISA 3U40A 2ODEA 1W73A 4J4BA 1W4AA 4AVYA 4B71A 4EGAA 3H3XA 4PCLA 5FCDA 4XFKA 4MUXA 3FWHA 3CS3A 1V4VA 2F3RA 3IT1A 4QWWA 2AJTA 1MH9A 4UM9B 1ZMBA 4C6TB 2ICAA 4YJ2F 2ZQ5A 1JFFB 3ZLUA 2IOFK 1D2AA 1IOWA 2E21A 3LQQA 4KJXA 2JIDA 4XGKA 4MKIA 2FRVA 4I9GA 4K87A 4WCFA 3FOAA 1G8FA 1GT91 4D26A 1H5QA 1H3EA 5DT9A 3CF2A 5LZ7A 3WYGA 2QW1A 4CIXA 4L07A 4WASA 2REBA 4AY5A 1WXDA 1TLTA 5JI3E 5HXAA 3WL5A 5KOIA 3HG7A 4P80A 1YIOA 4QLOA 2H92A 3DV9A 3EGCA 3AVOA 3JALA 3QYFA 3WMXA 3BE8A 4GOLD 1E3QA 3EISA 2YDYA 3EDRA 3F4BA 4GSKA 4KH0A 1GZVA 1HSOA 1N92A 2A33A 4HH1A 5H80A 1B0PA 4G5OA 3M6WA 1N36B 3A3YA 5EUQB 3TOSA 5HKOA 3EF3A 1K98A 1HTTA 2JFUA 1JPUA 3GBPA 3NFYA 4LRYA 1W49A 1UFVA 1TA9A 4XW2A 1A04A 2DERA 2H9IA 4OKSA 3ASZA 4B8ZA 4UOEA 1C80A 3GFBA 4ZXPA 3WGGA 5D3MB 5F64A 2NPFA 4DT1B 3GCWA 1XLTC 3D43A 3MS7A 3FYUC 4E1VA 3ZBQA 1K63A 2YJ5A 4JJ7A 3HWRA 4PFJA 3EH2A 2JAUA 1CR4A 4BB9A 1Z4OA 4EGFA 2IS4A 1Z25A 3GUCA 4QD3A 3QUCA 1EVIA 1T9GS 1AK9A 1B3BA 1ZOSA 5G0SA 5H7XA 1TL7C 2CJWA 1EK2A 3EQ8A 3HV0A 4UUNA 4G1CA 4F5ZA 1JB9A 2AJLI 3DGEC 3FPEA 2P4SA 1GQOA 1RRMA 3RT9A 1J97A 4AK9A 4AKEA 5LQNA 1TIKA 4UPEA 1FVOA 3TRDA 5AVTA 1RM4A 4IEFB 3GARA 2JS7A 3IVXA 4L50A 5EJGA 3FFWA 4CG2A 1A7JA 2GVZC 3FRHA 3T4EA 3HNRA 1DI0A 4K6GA 2GETA 4PX5A 1NNLA 1CRLA 3QVLA 1E59A 2ZIXA 3PVSA 5DMHA 2ILTA 4IIYA 4JLOA 4X41A 3PR3A 2ZUBA 5E8JA 2GKSA 2Q2VA 4ABTA 4PICA 3OQVA 1GFIA 3AM1A 5F2KA 1JNYA 1XZQA 2BM1A 4QXAA 3V34A 1PR0A 4TTJA 2ZCJA 2P65A 3L8DA 4LXIA 2D1QA 3OMWA 1BDJA 4WJZA 4PG8A 2DHQA 1GL6A 3K35A 3NPAA 2NQ2C 5D7BA 2ZT5A 3ONNA 4A4DA 4UCQA 4PC7A 1C1HA 5CXQA 1C9KA 2G40A 1EJ0A 2QX7A 2V4MA 2CFOA 2VRCD 4HAVA 1H9BA 5K51A 5SZKB 1ZL2A 2DC1A 3EIHA 2VJKA 4R1MA 4BO3A 2O4UX 1H0RA 3BFJA 4M9ZA 3H9GA 2QY6A 5DIZA 1N77A 4JH0A 2HQBA 2A1UB 5EWLA 4L4UA 4NFLA 2F8LA 4S12A 4RO0A 3ZHTA 3DLHA 3ZHOA 4JLPA 5SICE 3J7TA 3JQ9A 2B35A 2ZS8A 2NUPA 4I55B 4XEUA 1ZJYA 1SU7A 1SEVA 2D5BA 3FCEA 1IHXA 2EFYA 1INLA 3AL0C 1WUIS 3PL5A 4PC6A 4H1UA 2GK3A 4TTRA 2ZIAA 2OZLB 3GUHA 3SZRA 3RVLA 2GEJA 4CM8B 2F8MA 4H6VA 2A88A 4CF7A 5KJ6A 3MIZA 1EE1A 3D6TB 4FILA 1KEVA 4DA4A 2OD9A 5CIQA 4ZD6A 3EMVA 2AXNA 1W7AA 3OFVA 4FFRA 3OQHA 4ZAVA 1J56A 1SB9A 1UOPA 3GRAA 3PQ5A 4LI0A 5B58C 2IS1A 3CLTC 4TVOA 2EQAA 4XYGA 3CJRA 2QMOA 3TQSA 3KALA 3DCYA 4QHYA 3C4VA 1L4BA 2WSBA 3QVTA 4BASA 3ZGZA 1NRWA 1ZRSA 3CO5A 4E94A 2YN0A 4IZOA 5K3FA 1A3CA 3GOQA 1DFGA 4DVGA 4JKIA 1RADA 4CLHA 5TQ0A 2DWOA 4H16A 1LCIA 3WZMA 2QPAA 3BE4A 5BN4A 1SBCA 2AI1A 1UMBB 4OPMA 2WPNA 5EP1A 2VJCA 3PUWA 4QBIA 1RAEA 2C9ZA 2LV8A 4OHMA 3OUZA 3LX8A 3S4YA 5HS4A 1ZOIA 3W2EA 2XNCA 1ADBA 3MT0A 5DN6A 2X5OA 5J47A 3U1VA 3ZLBA 1CX9B 3DDUA 4Y1RB 1I7NA 1LKZA 1QGZA 1ZMXA 4CRWB 4OAQA 1P33A 3E1KA 1R10A 1IN4A 4G36A 2A78A 3QBDA 1TCUA 4GVXA 1M2WA 3ND7A 1TNDA 5HGJA 3IQWA 2ZXFA 4ESEA 2YDXA 4LY6A 1FNBA 3V7NA 1YS4A 2JEZA 4G07A 5F1PA 5IS2A 1GU0A 3FROA 2DUJA 1Q3TA 4MCIA 2YY7A 5LQSA 1DO0A 1XPUA 4NL4H 3EB9A 3BJIC 5CXSA 1PNOA 2BSXA 2WT8A 3BKWA 5BR8B 2QUIA 3E84A 5D84A 1E1RA 1ZM7A 2YQZA 3G6KA 2P6MA 1OKKD 1KJJA 4BAZA 2WZQA 3VKWA 5F9HA 5EXXA 4MQFB 2WRZA 4RC9A 4ZI3A 2JHFA 1QVZA 4IOMA 5HOQA 3RAJA 4LVOA 3KOZA 3TLGA 4KWEA 2FMXA 3PB3A 4KN5A 4XIGS 4AECA 5H8WA 4NH0A 3FLBA 5AIAA 3LRXA 1F0PA 3HBAA 4HDRB 5CT6A 5E6SB 5LBTA 3R7NA 4BJ6A 4P98A 3OC0A 1LD3A 1CJVC 1RWWA 1S3SA 2K2QB 4YJ3F 2PFGA 5DRTA 5LSAA 3COPA 2GXAA 1GILA 3GGPA 4BPRA 5AVUA 2XMGA 3CF0A 3VNRA 4DNXA 4GLLA 3X1KA 1ZSYA 3ZG6A 2VNSA 5D3ZA 4MVJM 3B3AA 1ZW6A 2AXPA 1W85A 1NJ8A 3LCCA 1XZMA 4I1YA 5FULA 4UEQA 4HUQB 3R9IA 1UK9A 1DFHA 3JQAA 5LYJB 1CS4C 3BSSA 3SVTA 3AP2A 3KELA 4IVPA 1P8JA 3ZWWA 1TJ4A 5I7HA 1P7VA 4HDCA 4EW2A 3A11A 3D81A 4D9FA 1RQGA 4N0EA 3WIOA 4K9DA 1W5TA 3G8YA 1AB5A 4PC3A 2D06A 1Y8RA 1V9CA 1BROA 1GZ4A 1WSWA 4FOTA 4CEIA 1QG6A 2P2ZA 2FUNB 3BWVA 5AK5A 4D79A 3WWYA 3VDQA 4DPLA 5F9FA 1RI4A 3IKTA 1T91A 4C3OB 3A4MA 2WVGA 3LNTA 2IYWA 2TRSB 5DULA 4RPIA 1R9GA 3B8EA 1L7PA 4X65B 2WZDA 3ID6C 5KUTA 4U3JB 1ZJZA 2QRHA 1FJGB 1JIJA 2EFEB 4JYPA 1G8SA 3T9CA 5ALFA 1SUCA 1WDMA 3AUFA 1N5LA 3LI2A 5DKFA 1ZSVA 5LXTA 3TB6A 2I87A 2NADA 3AKDA 4JX9A 4PO1A 4CF5A 4E3WA 5K8UA 2QE6A 3TCKA 3S1SA 1A1VA 1WG8A 3G02A 1XEFA 4R84A 3PHHA 4OBEA 4NYMR 2IDMA 2JIZA 4GSLA 5K09A 4KLRA 1IBLB 1L4YA 2XMCA 2XUZA 2PBZA 1KOLA 4CR6A 5LXTB 4GP9A 3G2HA 2PV0A 3MTJA 3NORA 2RHGB 3OICA 4CMIB 5IABA 1OXBB 5IUJC 4HDMB 4PGHA 5A3QA 1TYBE 3UH0A 2HDHA 1TCBA 4LNAA 5KYUB 5JCXA 1DBRA 3GLFA 2IOFA 2PGDA 4G9GA 4AICA 4B0OA 4CQMA 4JN6B 4O4LA 4GUDA 4YUVA 4YT2A 1T2NA 3AEYA 5DASA 2BFBB 4MITA 4IILA 1X80A 1CVLA 1VRCA 3TTYA 1KSFX 3F8SA 1RU3A 5FBKA 2EF0A 2RHTA 2PKWA 4IDBA 1Z34A 2X22A 3B60A 1PW5A 4X61A 4BNFA 5L95A 3E27A 3ZCTA 2R6HA 4DMCA 3LCUA 4L9WA 4MS1B 5D86A 3UJHA 2DY0A 2PD4A 2PYDA 1HDYA 4YJ2A 1P1CA 2I2XB 3SXJA 4EPVA 3AOEC 2BHSA 2CSUA 4ZYXA 4TUYF 4WXYB 2FPIB 5CCDA 3AIIA 2CD9A 3LUJA 4HNTA 5LJIA 4W9MC 4OLBA 1BVYF 2FW1A 2GTIA 4JBLA 4U1RA 1GYPA 1NUSA 3AUTA 3X43A 2Z6VA 2E4ZA 2XI4A 3GLFE 1Y7PA 2E1PA 2G09A 2NO4A 1DAMA 2ID8A 3VU1A 3TF5A 4XIJA 1LC3A 1ZC4A 3DE5X 2J67A 4WAUA 3SM3A 3SN6A 4DIUA 5EPOA 4JYAB 2I29A 4PGMA 2A35A 3F8WA 2JIZD 1B6SA 2LE0A 5H9WA 5JYCA 3R76A 2WLTA 1QHXA 3WB0A 1YRQA 3KYJB 3AB8A 5FUBA 4D3ZA 5IT4A 4QJBA 1R27A 1OB5A 1ZD5A 4ETIA 4EPTA 1GA1A 2IKSA 3GGGA 1H4VB 4B6GA 1L8AA 2JGFA 3SU8A 2KMLA 3AFNA 3NRJA 5ITZB 3DP7A 1X1AA 3LJKA 3R9WA 1YULA 3EXEA 1C7ZA 3QE2A 1YVDA 2BBWA 4HJRA 5CJ2A 5E3JA 1JKJB 1RRFA 2X15A 3CT4A 3L8HA 3AETA 3MJEA 4TZTA 3CH6A 3CR7A 1QK3A 3ENKA 3PR2B 4JI5B 2CEAA 2WVAA 1VMIA 4H18A 4HB2A 1XTSA 3ZDRA 4FYVA 4GG1A 3STTA 3RSSA 3JVVA 3LX4A 1H1LB 3S27A 1GXSB 3COZA 5E0KB 3PYLA 2EP5A 5JAMA 5KTYA 2XX3A 3BXOA 5CVVA 4ADSG 1QFXA 4LIPD 2R84A 4ZYWA 3UNXA 2NSDA 3X1WA 5BRJA 4ESVA 2BGKA 3IBYA 2I4IA 3LDAA 5K4AA 3KT3A 4CR8A 5J4HA 3HO6A 3ZDCA 3ESAA 3FUTA 1HLDA 3MF4A 3R7BA 1NVVQ 3GJ3A 4M9RA 4ER6A 3ZWQA 3VNUA 1OILA 1RWNA 1VL2A 5IAKA 1XZAA 2GPJA 4ALJA 4TYPA 4ENTA 2Q5LA 4WADA 1SBYA 2I33A 1K7SN 1PNQA 4LPSA 1MQ9A 2DTEA 1L5ZA 2E37A 3FCCA 4YCCA 1WMEA 1MNAA 3KB2A 3TZLA 2IH2A 3FPCA 2DQYA 2VWQA 2ZYWX 1M5RA 3L8CA 2X5JO 2J87A 3TRFA 4MEAA 4DR3B 2KYRA 3BCSA 3P9IA 4UCFA 5HDQA 2NUTA 1NVTA 2GJAA 4YJDA 4WA8A 2WWXA 4KO2S 1DEKA 1F0KA 4K26A 3TLKA 4M98A 3AR7A 2QWXA 4I5DA 4JASB 4WOCA 3D5EA 1OX6A 4YJFA 1V43A 1D03A 2QIPA 3SAJA 3KXLA 4AXXA 4MGIR 3G8AA 4QE3A 4YDQA 4UUMA 1Q21A 4O4LB 1RJFA 3CEPB 2DWUA 5DXJA 3LXMA 1OT5A 1QK5A 4JQOA 3FZQA 4G0YA 3U1BA 3UT5B 3ZGXA 3WGJA 2IZOA 2OLJA 1GHTA 3H7AA 4D6XA 3OEHA 2UXDB 1XRMA 1P62B 2QG6A 3F71A 1IB0A 4FR0A 2P4HX 1O6CA 3RSHA 5FWNA 2ZULA 3ONDA 3Q87B 3HADA 1EFHA 1XD8A 1OV6A 4IF6A 3LBYA 3N3BC 3T54A 5HJ2A 2G70A 4MYCA 5I9MA 1B6RA 4I50F 3BZWA 3Q5EA 3MELA 3L40A 4HX2A 4ZQFA 5G3YA 3Q7QA 4OY3A 2A5GA 1SG9A 2VH1A 1OZFA 4MKFA 4DLRA 4PGAA 4BV9A 4XJTA 2WWIA 1EZ1A 3IAS6 3PS9A 1LUAA 4I1VA 3WDLA 4BX2A 3DC2A 1TTHA 5TIIA 2OGUA 3TAXA 3GN1A 1FTWA 3KKEA 4GP6A 3VDRA 2BFCB 4BZQA 2DBYA 1FFHA 1X42A 1TAHA 1MJHA 1YCDA 3F9RA 2ONJA 4F3NA 2E4UA 4WGGA 1DARA 3AF2A 3C5VA 3RHZA 3WBBA 3ZJTA 3A4TA 1TEVA 2R7NA 1SZJG 2UYOA 1CY8A 1RACA 3C7KA 3ZU2A 3I09A 3HCRA 4B3TB 2DUMA 1OBFO 2P6OA 4EFDA 4A36A 4QGHA 2VYCA 3FHOA 3FNHA 1WUKS 4Q9NA 5JEDA 5H3CA 1H0SA 2FMUA 3I28A 3EGVA 1QHHB 4FJ1A 4A8PA 3A14A 1ZA2A 1H6DA 4UMFA 3UZUA 4MUEA 5AJUA 1BSVA 3W3AA 1YS6A 2EX0A 1RPNA 2J6HA 4WNAB 5TMEA 2GJSA 4KREA 4KC0A 5DWDA 3A1VA 4ZV7A 3QLJA 1CUZA 1PTJA 3MPOA 4RY8A 5IZCC 1U9JA 3K3PA 4ARCA 1N2GA 2HLDD 3AEXA 3DOUA 3JYNA 1KYZA 1HFWA 3GZ4A 4DS3A 1FFSA 5LZ9A 1K5DA 3OF2A 1AUQA 3F5FA 3T7CA 5CB4A 2GT1A 2QM8A 2WKPA 5EJMA 1T8WA 3BZUA 1OI2A 3GPLA 2QMZA 3G13A 4KFRA 4GM0A 5EVCA 1II0A 1N0HA 2VQSA 4FDLA 5JQGF 5FBVB 2I80A 3O8OB 5FBQB 5FYDA 3DOOA 4G5GA 1KDVA 4P7FA 5CFQA 5I6DA 2PUCA 1K9SA 1SA0A 2V0CA 4MKHA 2ZYSA 4MS1A 2OWDA 2X1MA 3V1KA 3KKKA 1U7DA 2V1UA 2Y0PA 2CWWA 1QH1B 3ECCA 4NXMB 5EQFA 4BGUA 4TRRA 3P71T 5T4FA 4DC0A 3ITDA 1ISIA 4O25A 4ASUA 1U2GC 4LVNA 4BMDA 4ZVLA 4HJXA 2O0HA 2BP7B 4RL4A 4F96A 4QSHA 3N1UA 1N2CE 4N6NA 1VRWA 2XWQA 4U02A 4GI5A 2FRDA 4NU0A 2P9EA 5JR3A 3BWCA 3I6YA 4C0JA 2ZRKA 1TJPB 4HFNA 1E2HA 1DDIA 1DKNA 2P9JA 3NDPA 1HZZA 5BYBA 2HBRA 3HB4X 1IJKA 2W48A 1IXRC 4R54A 1A9TA 2MSKA 3VZBA 2AW5A 2DJIA 3IKVA 4UHDA 2HT6A 4IIUA 4JB3A 1YB4A 2GK4A 4HATA 4BFVA 2P9GA 2Z3WA 1AKNA 1F8FA 3BB1A 3FI0A 3PKIA 4CBVA 3GFRA 5AK4A 2PUEA 4KG7A 1KSHA 2IZ5A 2R1VA 1JZQA 3RWBA 4TKZA 1FZQA 1OROA 2MSLA 4QLBA 5C5DA 4G0XA 4HAUA 2O2YA 3RRNA 3ZVNA 4J29A 3TE7A 3FYDA 4Q3EA 4FMDB 4G4SP 3S3TA 4RPGA 2DT5A 3FLMA 3TLBA 4HDKB 3ISVA 2CDCA 3GDOA 1G1AA 4U7WA 4RGYA 2RAPA 5DRYA 3TZ6A 4IDDA 5BWMA 5JZOA 4JLWA 3WRVA 3GPBA 1VG8A 3DBRA 1MP0A 3CUEF 2I6FA 4UU1A 1I51A 3Q0IA 4QDJA 5KNCA 1C8VB 3DE4X 4OQYA 1Q14A 4D92A 3VVLA 1W25A 2H2IA 4JJ4A 4OJTA 5T3UA 3FCAA 1G7TA 3DKIA 2CBXA 5EXDA 3ZE2B 1JHDA 2PVCA 3MD9A 3FZGA 1MA0A 5FQOA 4BKOA 1JHZA 1IY1A 3GBSA 3PFNA 1T24A 4O1IA 4CGYA 4ACAA 4P6VF 2HHAA 1V9SA 1U8YA 1SHUX 1EAYA 1G2OA 4MULA 2B7BA 3N8DA 4YJHB 3UKDA 1A82A 1CY1A 1P1BA 1MV5A 1G5TA 1WZNA 2LDXA 1K8RA 3N2GA 3QY9A 4X0EA 3W90A 4HGOA 2WKWA 3PENA 2R4UA 1RI1A 2VF8A 5FB3A 1O6FA 2DM6A 2UVDA 4UBKA 2FR1A 7ADHA 1HYGA 3GRRA 5FBHA 4M8SA 4ARBA 1JSXA 3K0FA 4NFYA 4I4IA 1YRAA 5HRUA 2IEDA 3C3YA 3I04A 3S5JA 1TUGA 1CJBA 2G88A 2R8OA 4BLRA 2A3RA 5LKAA 1EE2A 3SBEA 1A5AB 1G3QA 2OCXA 2Y05A 3DPIA 4NIMA 1I2BA 1LLCA 1JQKA 1P5HA 1Q84A 3JQPA 4WXRA 3WA6A 1KI6A 2PZBA 1XIVA 2QAJA 2ECPA 4MH0R 4ZO8A 2JFOA 4BNMA 2Y1CA 3LYUA 1JG7A 1J8DA 3TN7A 4NOMA 3UJBA 5C2JB 1QHGA 4JP8A 4L8VA 3VKGA 2HA2A 4MOWA 3AHEA 2YWBA 4PAWA 4OU5A 3TSOA 3CV3A 3FKSD 3KPWA 5INTA 3RADC 1OCEA 1Y98A 2CUKA 3PD0A 5FEUA 4EPXA 1NGSA 2O3TA 3CZMA 4F21A 1XTZA 1U0RA 3NH6A 1CS0A 4B6JA 2C82A 5DN9A 1QHNA 4UEOA 1ZOLA 3E3LA 2HF9A 1M2JA 3VPXA 1AGYA 4KQGA 1Z4IA 1Q44A 1O97D 2JLWA 1OOEA 2BZGA 1E9DA 4WLEA 3KC2A 4Q24A 5KYKA 4OV6B 1UBGA 4GPTA 4CM7A 2DPLA 3VR5A 3AUXA 4ENSA 1NBIA 1UBEA 1WXEA 4JOQA 5J2TA 4FFPA 5KX5F 5JPCA 4GL2A 4PR0A 1Z0UA 3ZGNA 1PZEA 1D9XA 3D8TA 3DE0X 3DZCA 4DRXB 1X9GA 2DB3A 1EQUA 1XTPA 2H07A 2PKEA 2PLWA 4NKRA 2C94A 1FTYA 1J8FA 2HIAA 2GCEA 1KO7A 1DOZA 5TRTA 3D6NB 3DD1A 1IAVA 1THMA 2YH2A 2FSUA 3KR9A 4B73A 3KQPA 4MB0A 3W3AD 4AW9A 4PAMA 4ZHSA 1NE7A 5K6AA 2QMEA 1PNVA 5LDGA 1EIWA 2ERXA 2V1XA 4JODA 3HRKA 1K4YA 2IP1A 1TT7A 1P18A 4RLQA 2A0YA 4RJLA 2Z4TA 1OPRA 4J03A 5CLGA 3SLRA 2R5WA 3MB8A 1IK4A 4LZJA 2VYVA 1T9DA 2QN8A 5LWHA 5FJJA 3BXFA 4JJAA 3TB4A 1X74A 2YMLA 3VHXA 3ZZNA 5A9SA 3G23A 4KPGA 2DHRA 2DVMA 1QGOA 4XASA 1KVTA 4UBOA 1TVKA 4WKCA 2GN1A 2CGEA 2JK1A 1K6MA 5EJFA 5I3CA 2ERYA 3P9RA 1Y3IA 2V7TA 1X1EA 2VP5A 1YQGA 3DYVA 4QU8A 4ZZ3A 1ZD2P 4JP5A 2R8EA 4F84A 4RXMA 2VPPA 3FW1A 4RVCA 5BNIA 4YCSA 3QEBZ 1A1SA 1C1XA 1U2EA 1K8YB 1ZGHA 3CCFA 5F21A 1M66A 3M1AA 2PWPA 3NDIA 4LOJA 4Q4LA 2XWJI 1SUFA 1ORHA 1QIDA 5JTTA 2D7JA 2ZOSA 3BG5A 3K1AA 3ORHA 2ZI3A 2XKJE 4MS3A 2ZDGA 4RYDA 4B40A 2B78A 1JFFA 2Q6VA 1VJRA 2Z09A 2WILA 2ZITA 3CC8A 1LQTA 1KRWA 3LRTA 5D5QA 3ZWYA 4HX5A 3DOCA 5DK6A 4CT4B 3QVKA 1ZUHA 3QX9A 5ECGC 1VL1A 3G1UA 3VKHA 3EOBI 4GX2A 2AMLA 2VK1A 2DFPA 1A72A 3Q9LA 4FEEA 4HGNA 4WEQA 3EFEA 3QYAA 3UG6A 4HKTA 4CKWB 3GT7A 4ZK2A 5B7PA 1VPDA 1ZM3A 4IDFA 1YK0A 3D1LA 1K5PA 3P97A 4MQUA 5FNVF 2C77A 3IIJA 5GQSA 4QRIA 3T5CA 1Z4NA 3HVUA 3THOA 5C35A 4S04A 3GZTB 4W5NA 1AQUA 4J8PA 4RDHA 5ELMA 3VNQA 2Q4TA 1NBWB 1YDMA 5BWOA 5EE1A 4DIOA 5IC6A 2WHRA 5TPZD 1GVHA 1YZKA 2PXAA 1K4MA 3DE6X 3K92A 4NBUA 5D6NA 5KS2A 4CVNA 2PRJA 2TYSB 4IV0A 4RW0A 1DUIA 3FOBA 2A9OA 1OTXA 2DWCA 3CHYA 1I7LA 4E11A 4U7DA 5A6SB 3T1OA 3OA0A 4NZ9A 5JYBA 1MT0A 1E7SA 2ODQA 2HA0A 1NQXA 4URZR 1IDN1 1KFEB 2WTXA 3EIEA 2OO7A 3H9JA 1VHJA 4ITVA 2AUNA 3W4KA 3WKCA 4EJSA 1TT5A 3FOEC 3VI3B 1T10A 1PJ8A 2DECA 3TEJA 2Z6UA 4JXZA 5AM4A 1L4FA 3L7DA 4OQMA 5EHNA 1EBBA 1O5TA 3DZGA 4DV1B 2HDOA 4XLLA 3DMDA 3JU3A 3B5JA 5K0LA 1H2RS 3IGFA 3QW2A 1A9XA 4U2FA 3GEMA 4QEDA 2HRDA 4CN8A 3OG9A 3Q8XB 4ENVA 1QV7A 2BJHA 1CVIA 4AZ0B 2IYSA 2QT1A 2FMTA 2FYTA 4KPUB 4QFDA 1GUAA 4R1QA 3ZXYA 1NKTA 4KO1S 4F5EA 1LH0A 4IVNA 5JY1A 2ARKA 1TO6A 3PFWO 1Q1AA 5REQB 4EW6A 4IW3B 3I42A 1HNZB 3PEYA 2OFPA 4XGRA 1GQSA 5TGDA 2HXSA 4MR9B 2P9HA 3FF1A 4HVTA 3DPSA 4Y7CA 3FOWA 4UU0A 5EJIA 4EKGA 1L6RA 4YLGA 4LDAA 1SIOA 2VT7A 4DLPA 4BZWA 3OA2A 2RB4A 3CX8A 1X2BA 2INGX 3O90A 4HEQA 5J5VA 4DQ0A 5FUYA 2GN6A 1CDEA 2HSJA 1VECA 1GQYA 1OZAA 3M8KA 3N28A 1E3WB 4OM8A 3WRYC 2AN5A 5IUNC 1QMGA 4JQYA 1OMOA 3H5TA 4TSFA 1EH5A 2FGJA 1C9MA 3G2PA 3P9ZA 4PZEA 2P6NA 3LBHA 2WWGA 4C0XA 4L3OA 2YXEA 3DBHA 1VJ5A 5JNUA 2P91A 2ROQA 3PSAA 3WZLA 3KSUA 1D09A 3SHVA 4J0GA 2XUJA 3HFSA 1WJGA 1VSQA 2YYZA 3VKFA 3BDAA 5JH7A 1P31A 2EZ9A 1O95C 1V8FA 4C78A 5K20A 2XUAA 2AFIA 4Z7OB 1GA4A 1XD2B 1ONPA 3ZI7A 3JATA 3RRXA 1QOZA 4RACA 4W99A 5KVVA 2EXXA 2ONZA 4D4HA 1NW7A 3C48A 1I2ZA 1W5BA 3RHTA 3RRZA 2DXIA 3A1TA 5BMVA 3UHPA 2I9PA 3BH0A 3GT0A 2QUJA 4DDKA 1R0YA 2KM1A 1XU4A 3CF4A 2M1ZA 1YGYA 2HBZA 3PIDA 2W2LD 2YY5A 1MW9X 5LZ8A 3CZPA 4URWR 1EIZA 2PD6A 3BTVA 4MQ5A 1XXHE 1M6WA 3IVGA 2OE2A 3EAFA 4L5IA 2FN3A 3G82C 4ZHQA 2WP0A 3DBVO 3UMFA 3GWZA 2X3YA 4DTIA 4PPNA 4B2YA 3QXJA 1ZD4A 3INGA 5KVSA 2NX2A 3FNRA 4U9UA 3BWDD 1M2GA 1Q0UA 5CD9A 3LC7O 3PQEA 2Z98A 2DH6A 4AMUA 5TMPA 4KFTA 1W2GA 1E61A 1W93A 2GZSA 4NRDA 4DM3A 4RD2A 1SA0B 4QQ8A 1XHEA 1MFZA 2PHZA 2Y9PB 2YWEA 2X9VA 1JKMA 2C3PA 3G0GA 3OM0A 4U6QA 3SX2A 3UTDA 1SU6A 4DG9A 3HYSA 5A6VA 1W59A 1TJ5A 3I64A 3PGXA 4FEYA 3I05A 3GJ0A 1WUHS 1PJQA 2JBHA 4IWNA 5AHRA 4IO0A 2Q5EA 2PKRA 3UM9A 3UMYA 1FXWF 4BFLA 1VLVA 1O03A 1X0XA 1I1QB 1IY0A 3C6YA 4KAAA 3OEEA 2NZ2A 2PSJA 2EBHX 3GJ7A 4FN5A 1G0NA 1PG2A 2A4KA 3A6PC 4JJEA 1B1AA 4IAOA 5GZ6A 3IV7A 5EIBC 2HV9A 4FYJA 3Q88A 3O6VA 1JH9A 2FX3A 4BLWA 2VA8A 1SXJD 4UVIA 4WY2A 3RSQA 4CKCA 3PBKA 4DBLC 5CG2A 4RFSB 1NP6A 2D4HA 3PL1A 1T0IA 1FC0A 4LHEA 1WM1A 4FGJA 3NOQA 5HF5A 3GGOA 1ISJA 3KEFA 5CA1B 1UMCB 2FN4A 3K2BA 2WHEA 3PUIA 1LSSA 4MUBA 3UB3A 3FVTA 1R74A 1MPTA 3ASUA 2I4MA 3E18A 1YQUA 1G4HA 3QNMA 4JFRA 4L27A 3UMCA 5BORA 3OM8A 2C4KA 4IRXA 4PVCA 4K86A 2BY4A 2C9CA 1GPLA 4JZYA 2UZ1A 3S70A 1NW3A 5JT1A 2IXDA 1E4EA 3CF6R 4UZSA 1CHDA 2VIIA 1OC2A 3BSFA 1NT4A 3CZAA 3N74A 3QIAA 4PRYA 4DCNA 3LSYA 4XX0B 5IDWA 2PJRA 1U4OA 1X7WB 1U2RA 3N07A 4Y0AA 2QSUA 1N2SA 6NULA 4U7FA 2JW5A 4ZRDA 1NC3A 4ZC8A 5MN6A 2XGSA 2J0QA 1TW3A 4QL3A 4A6PA 2RHHA 5I7VA 5M2QA 3E7WA 3IHWA 4IUCS 5IFKA 2G63A 3L8GA 5CFOA 2VWGA 4MRAA 4W1RA 1ZJ5A 1M2NA 4LOAA 1U7PA 1AS3A 1I5OA 1X70A 2R65A 3ETNA 3M6IA 2M6LA 2IA5A 3WP0A 4LC0A 1KTIA 2PS0A 1SM4A 5ARBA 3WL8A 1Y1KE 1IULA 3D8HA 1AIPA 3AJ9A 1S8AA 2WF5A 4D97A 1PL0A 2QN3A 3U48A 1BAPA 2W71A 2P4EA 1MJ5A 3AKYA 2XITA 1RXCA 3LS2A 1E3JA 3HUTA 4GLFA 3LBNA 5JAUA 1AGXA 4X97A 4GBGA 1M6NA 1X7YB 3WRWA 4RL6A 3U5TA 3U9SA 3W6ZA 2VRBA 4BLVA 5J4KA 4ZI5A 5AW2A 5CA0A 3LLSA 1DQSA 3OD1A 1MOZA 2QZ4A 4QNRA 4Z3DA 4DCCA 5IG2A 2Y1OA 3TLYA 4YRIA 1JU4A 3NTXA 3IELA 3BN3A 4PIMA 2O5CA 3ANSA 3AF6A 2BYTA 1PR9A 2GHQA 2VP0A 3ILSA 3BSWA 2C4NA 3C45A 1RVDA 1Y1RA 2X9LA 3KXDA 4YJGB 1T9HA 5FPYA 1WBBA 1XAIA 4LFAB 1VG1A 1OD6A 4D9MA 1SXGA 1TCVA 2OK8A 3A0UA 2YHUA 3O1LA 1SC9A 1G9TA 2PX8A 1XDSA 1XU7A 3ZKWB 1PT6A 2WF6A 2ZJ1A 3IDAA 3RF6A 5CDFA 4GGPA 2FXIA 4NBTA 1BW9A 2XXAA 4I55F 1GARA 1SHJA 2QQGA 3PCXA 4IQ8A 3TD2A 2M2IA 4FQ8A 1D6JA 3C3WA 1GKLA 2VP3A 3ONWA 1TXGA 4QXRA 1SY7A 5B4UA 1NC1A 1S5PA 1Z2PX 2D59A 5LA6B 3D0RA 2OL4A 1JQ3A 2VVTA 3KU4A 4C5CA 4M1TA 5DYTA 4Y8VA 1G5PA 3NEYA 4CLXA 4E15A 1LX7A 2WJAA 5DGHA 4HPJB 1UANA 5DW3A 4C4OA 4FOSA 3HCFA 4P7BA 2HO4A 3ZCXA 4E4YA 1T43A 4MX8A 5IAJA 3RS5A 1XPJA 2H2AA 3GP5A 3KYCB 3PWZA 4C4TA 5HK9A 1VYUA 2PH5A 3E4DA 1JEOA 3ESZA 4FJ0A 2CNNA 4HF7A 2C8KA 3C7TA 3INNA 1BH6A 4AIRA 2RHMA 4R2IA 1P4AA 2EFGA 3L43A 4CG1A 1QAMA 4N01A 1ABBA 3IXMA 2IXTA 2O7QA 5K9ZA 3OCWA 2X7JA 3PA8A 2JI6A 3WTCA 2IQ5A 1LNZA 1QANA 4G09A 1KJQA 3CKYA 2EWVA 4WBNF 1EDDA 3QVJA 1OFTA 1T9ZA 6REQB 3PQFA 4ARZA 5KQLA 1IOZA 2DJ5A 5EIFA 2FPIA 2DFTA 3BC1A 4IQ0A 5BNTA 3TNJA 4HEA1 5SV2A 4K9KA 1G5IA 2LR0A 4FLMA 4MS4A 3KEOA 3JCZA 4TKUA 3ZQKA 5GINE 3IUSA 4EH1A 1D1PA 4C7KA 1ZEMA 3JRWA 1AGPA 3NX4A 4Y7DA 5JSZB 3UWMA 4AP9A 5EJAA 2EZ8A 3IE2A 1XEWX 1Q7RA 3KZMA 3RGWS 1BXGA 4OLHA 1SBZA 3KJHA 3STUA 1YQWA 3STVA 3TRJA 2BFBA 2B69A 3SHWA 1ZH2A 4YCLA 5IT0A 1YMVA 3IC5A 1RR6A 4ARZB 3QHPA 1ZM9A 1NYLA 2A1TS 3W4JA 1E5DA 1AD2A 4P34A 1GPAA 3UJ8A 4WSOA 5EJ5A 2XNHA 1USWA 2YV4A 1VMEA 3L4EA 4JSTA 5CIWA 4YP0A 2PX5A 1KDOA 3M2PA 5KQMA 3DL2A 1B76A 1F4LA 1PQ4A 3BEDA 4OB8A 4ALMA 5HRCA 3CURA 1VHWA 3D7SA 4HZIA 5F7XA 1YFJA 4FWIB 3KYCA 4IIBA 3T7DA 1NI4A 1UKZA 1H2EA 1G4AE 1QKJA 1XXHA 1CUUA 2C92A 2UYYA 3D64A 5K3BA 1RXVA 4HT3B 5K0FA 3U19A 4TSKA 1Y42X 3SD7A 2ODPA 3W6PA 3ILVA 1U7HA 5DHRA 1L7NA 1FNDA 4DOMA 3L5KA 3L7MA 5A05A 4GMDA 2W7TA 3RIMA 2Z2YA 2O8EA 3O1IC 2DQ4A 3G2MA 4IH9A 3WYFA 3DYIA 1JIUA 5HMLA 4GZLA 4MQBA 2KX7A 4BBPA 1F6BA 1PJ4A 3CNEA 4Q3DA 2VP2A 4TMZA 5CCXA 4KQ9A 1W29A 2ZM5A 4F9TA 5BMVB 3QUAA 2H17A 4U0KA 2VYFA 4Z1MD 1OU4A 2ANBA 3AEKB 3PUHA 5C52B 4H4DA 4RV9A 4IJ6A 3K9QO 1ODKA 1EZ4A 3PNPA 2A67A 2HMVA 5CURA 3GJ5A 4BZZA 1H94A 2WU1A 1PX2A 5DK4A 4BWYA 4ETWA 3CLUC 2RI6A 3DZDA 2ORVA 1EHCA 1VOTA 3N8HA 2JFPA 3X2SA 3D2LA 2QMHA 2FX2A 3T5PA 2XKKA 3GLGE 3LWZA 1V95A 4KMOA 1FYEA 3CBQA 3IUYA 3QTLA 4E22A 2O0MA 4JSYA 1UH5A 4DUGD 2GGSA 1WCIB 1V48A 2C8JA 2OGSA 2XDQA 4J1TC 3SC2B 5AVQA 2J07A 1OT3A 2JFHA 4NOJA 4X62B 2WJWA 4I1PA 2NP6A 2JGMA 1QH0A 3RUFA 3EZGA 3I9V6 4R8MA 4AJOA 2B36A 1VIAA 1G3RA 1YKSA 5CA0B 2RIRA 3CRW1 5E7QA 3BD8A 4HDRA 4CCYB 1XA3A 3M4XA 2YVQA 2O3JA 3GRZA 4OMFG 1GAXA 2BUAA 3DDZX 1N4AA 2YJGA 4MNTA 2QLJA 5E4YA 3CNOA 3EODA 3UAGA 4C0KA 1VLQA 4CKCB 4A91A 5GZ3A 3P4UA 4CLDA 2C5FA 1HEYA 2OZEA 2V97A 2IIVA 4CQLA 5GY7A 4RHCA 1Z7EA 2VYQA 5TC4A 3CUWA 3V4RA 1TTQB 3C6MA 4OA5A 1EX1A 2BSAA 4MRRA 1EM6A 3W5VA 2NO5A 4KJZA 1ZK4A 3RV4A 2VJAA 1X8XA 3HA3A 5E7MA 3AILA 1COZA 1ZSNA 4BU1A 1H0KA 3T9AA 1E6EA 2GESA 1BFUA 2OMKA 2ZRJA 2VOJA 1U9YA 4C7JA 2ZU0C 3QU7A 1LPNA 1TMGE 4F38A 1GQFA 5EHGA 1JQBA 1P17A 2IVZA 2ZYIA 4FHZA 1DEOA 5LMZA 3FOFC 1TAUA 4WKPA 3RQIA 5KYXA 4UNPA 4BP9A 1GITA 1GPUA 1T0BA 4IP0A 1Y5MA 1EWQA 1UBMS 5E9WA 2FFQA 3ZH2A 1T9BA 3ULKA 4NNJA 2HNBA 3LW8A 2R2AA 2IU0A 5H0IA 3V2IA 5KC9A 3I39X 4YHBA 2V7EA 2WAAA 2QVBA 4NEQA 4R69A 2AQKA 3O4JA 3U37A 3SJAA 1EDZA 3LWNA 1DKOA 2H1HA 2X2PA 2F3SA 3Q10A 2V58A 1VZ2A 2R8RA 3BRQA 5TQ0B 3RVJA 4GUAA 3HYLA 3OCJA 1E7QA 1ZN2A 1ZRHA 3LVQE 3PCRB 9ATCA 2UUPA 3QPUA 3HKEB 3B9QA 1J6UA 2B0JA 2ZPUA 4JYMA 5EZYA 4EHAA 3NAMA 1E9FA 1U9CA 3RFXA 1QIGA 4D6PA 2CUZA 2O48X 5HZMA 2MYUA 3IJPA 2YFQA 3WK4A 4B1FA 5AVYA 1R0ZA 5AI0A 1IN8A 4E5VA 5E9QA 2AS0A 3JYQA 1J07A 4EG8A 4M9UA 3B9BA 1M10A 3WLKX 5B4VA 2WINI 2ZBEA 5HF9A 1D7OA 1QR2A 3KYDA 1B4DA 1L4NA 3I32A 4C4ZA 2WUEA 3HCEA 5B2EA 4HGZA 5AKEA 5JLJA 3HY4A 2EQBA 4OJQA 4R2MA 3QFCA 5G4LA 3M1IA 4RCVA 1E98A 1VLLA 5TQ2A 4GAEA 1RFLA 4JXXA 4XWAA 1VCMA 1GQRA 1G8AA 2WU0A 5DCLA 4KIGA 3TMAA 4Y0VA 2O6LA 1RLUA 2I78A 4I2VA 1BS9A 1F2DA 1ILEA 2XWBF 1N6KA 5TVGA 5EI5A 3VYSB 3MQ2A 1JHRA 1KYTA 3F5DA 5FD8A 4Z1MA 1GNLA 3R5JA 3E15A 2R8ZA 3EMBA 3D31A 5IYZB 3DBOB 3KZXA 1UZUA 5I7WA 1G7CA 1YL7A 1T5TA 1JR3A 2UYGA 1F60A 4RD3A 4FFLA 4F9EA 2OM6A 2LDBA 1II8B 3UMGA 1NONA 2DE0X 4XCVA 2PX3A 4P86A 2F64A 4BMOB 4LMRA 2YNMA 4X44A 1C7RA 4BUCA 3CLRC 3JVEA 3PQCA 3HHEA 4HG2A 4NZYA 1KIMA 4IHKA 3WGOA 4D4GA 3LLMA 3N2KB 4G9BA 3TQOA 3ZV4A 3JD4A 3VQTA 2NT3A 3KCNA 1JPNA 3NEJA 4IWYA 4ARIA 2QS9A 4ZZ2A 2C9MA 4EGJA 4P2BA 3WGMA 3QOXA 4P54A 4Q66C 4YMUA 3OOWA 2WBLC 4FFBA 4B3SB 1J0CA 2IS2A 5ALKA 2VJLA 3KSDO 1L5HB 1MF7A 4ML3A 4WKOA 4DB2A 2VUSA 4GOOD 5FHQA 1H0HA 1E8NA 2HA5A 3BRWD 3EVGA 4B6QA 2WHPA 4M9CA 2PTGA 1HFJA 5JWRA 1J2EA 4OIMA 4L6CA 1P7CA 3L77A 4KVZA 3H11B 4O4IF 4P0QB 4COOA 4HI0E 4R6XA 1U4SA 1DCTA 3NFRA 2QTRA 2CB0A 3GNTA 4PYNA 2CXTA 3N0WA 3L6RA 5D5HA 4D2IA 1NQOA 1LDGA 4P4NA 4ZEMA 1UDCA 4ZHQF 3TBFA 1KPIA 5IH7A 3TIFA 2BTQB 3WKBA 1KEUA 4C0QC 3LZ6A 1XTVA 1P0QA 2QMUA 4NDNE 3ZHBA 2XODA 3I83A 2AQHA 5IN4A 4C6RA 2VUIB 3FBTA 2VPXA 4K81B 4HTAA 3SBOA 1LVGA 2NUBA 3Q3CA 4RSGA 1N78A 1JDNA 5K1ZA 1RWVA 1US8A 4FNMA 2B1JA 4AJ2A 2ZRLA 5A62A 1U02A 3Q85A 4L57A 3VC7A 1U7OA 2AN4A 3BZBA 3TFWA 5DYWA 2WICA 3WNQA 2ZRFA 1ECPA 2FHPA 5K5EA 1ABEA 3KSZO 1JHMA 1L8QA 3STXA 1PWEA 2B3TA 1CY7A 1T8UA 4E33A 1JHPA 1IC6A 2VZEA 4B3HA 1O3YA 4WLOA 1LPOA 5ECWA 2G83A 1J33A 1F2VA 2JZOA 5J1TB 1DADA 1M8FA 1KIFA 2IUEA 3HN7A 3VR5D 4BX0A 2D5CA 4C43A 4KIFA 4UJ3A 5F35A 4IJWA 3VVCA 1PQWA 5A04A 3QMPA 2G1UA 4IS3A 1CJTC 2XUIA 3QKIA 2OZPA 4F6RA 2CZGA 2X5NA 4EUFA 2VJNA 5HF6A 4CMAA 1IZ9A 3TJZA 3NAGA 1CR1A 2HGSA 4YFVA 4S2EA 1JHAA 2WYIA 3BE6A 4J4TA 1N57A 1KBZA 1A8HA 3DT9A 4G0QA 4Q03A 1KI3A 3SQOA 5JBIA 4BVEA 3FKSA 1IUNA 1DS6A 1YUMA 4MINA 3GEDA 4HFRA 4E5SA 1QE3A 1UC5B 1RXSA 2J30A 1THTA 2QZZA 1H05A 4NJEB 2NOAA 4MXDA 2CLMB 5KAMA 4BQSA 1E9VA 4CUJA 1NOJA 1Y1PA 3T3GA 2VH5R 2VYNA 4UTPA 2NG1A 1DXHA 2D54A 4R1PA 2VC2B 1RHRA 1IOLA 1LPAB 2FQ1A 5B1IA 5LYYA 1E3WA 2NACA 3AZPA 3S1AA 3TTUA 3VU9B 4GZMA 4NJEA 3IDFA 5EY5B 2K7FA 3R9XB 1CR2A 1Q91A 1DQRA 4YRPA 3PNLA 3KPUA 3RYTC 4E5MA 4Z2AA 4PHTA 1L7MA 2BM8A 2FWRA 5EIHA 4L4ZA 3G68A 1UC9A 3EZ2A 3LQRA 5EIAA 1FQOA 1QFZA 3E9QA 2XSZA 1N9KA 4RQAA 5FRDA 4G0MA 3RTDA 3W7BA 4TVSA 1A88A 3BICA 5CDYA 2BMJA 2X2FA 1PNRA 1C7JA 1ZCFA 1YRWA 3EA5A 5K0NA 2ZRDA 1CP3A 1DC6A 5EHZA 4FVTA 4YO8A 4ATNA 4F3RA 2C9YA 5EJ7A 3BIJA 3D6AA 2YV3A 5TMDA 1BE0A 3IP9A 2CYCA 3PXDA 1ZR4A 1Q1NA 3H5AA 4J3FA 3WMGA 4ZMRA 1B3RA 2BUCA 3ZV5A 2C5EA 3CZRA 2CMKA 4U2DA 3OSUA 1RI3A 2IIBA 4I14A 4E2XA 4E5NA 2QA5A 2FUEA 3EXG2 4MUGA 2FDRA 1KERA 4P8RA 4XFDA 3WJAA 1EEHA 1UQUA 5C7IO 1GZUA 3HL0A 4NTZA 4QFCA 2H65A 3VZSA 4YRJA 1K2VN 2HCRA 2IY7A 2W83A 4WOPA 3TZEA 2IWRA 4YWJA 1USVA 1BQEA 1QH1A 2AN9A 4L4SA 5CM2Z 3IT2A 3SYLA 4MDFA 5K01A 4LJ8A 3V4ZA 3HA7A 2JGEA 1RIFA 3N2LA 4FS8A 5FO1A 5FTKA 3M6LA 4DRXA 2YMPA 3EVEA 1HX7A 1VJDA 1NQAO 4B6RA 2OQ2A 4HEA6 4ZCIA 2REXB 1VL8A 4ZOLA 1DAIA 2X5KO 2W70A 4C5AA 3PFGA 2ZZMA 3ST7A 1T3SA 2WJPA 4JL8A 4KR6A 2H08A 4P1ZA 4D8XA 3D1JA 2OILA 2A2ZA 1ZUWA 1GA6A 4RZXA 4DNOA 2B2XA 3GNSA 1G1MA 1UPBA 3M6FA 4DFDA 2R6FA 3L6CA 3HFJA 4YXWD 4D1YA 4U9HS 1A8UA 3B7GA 4LJAA 1KMCA 2I2AA 2FLKA 5JEEA 1FBTA 1ADFA 1U8AA 1KP9A 3A1DA 2RJOA 1M6EX 2ZR0A 3AEKA 1QQTA 4PLWA 2J5RA 1DQYA 3ND8A 4MO9A 1RPZA 3U81A 421PA 1MVOA 2QJOA 3D3JA 4HDKA 1FDVA 3NV7A 3QVOA 5FIUA 4K88A 4OIFA 3RBXA 1J1UA 3OY2A 3WLIA 3OX2A 4Z0PA 4ER5A 1O95A 3ZDZB 5FPQA 4E4TA 1UAAA 2IUFA 4JXJA 4BO5A 1E1MA 1BGVA 3OHSX 3QG5A 1CIVA 4MR7A 1QKKA 3UQYS 1K9VF 2EKQA 1RD4A 3VAZA 4ZJZA 3QKRA 1U2DC 2V7XA 1SURA 1YJXA 3FDZA 3OEED 4E51A 3OP4A 1F9AA 4NG5A 4PIPA 4W7IA 5B3JA 2EWMA 2QM3A 1W30A 3BFKA 4H35A 4B80A 2I34A 2W93A 3EPPA 4BB6A 1GKUB 1KO1A 1O87A 3KZ1E 5TS2A 5J43A 2BFFB 3BXHA 4HO1X 1E4OA 1WPXA 2FZWA 3HLTA 4TQ9A 5KCMA 4F4FA 2WU8A 2XV1A 4W1PA 1TX4B 5CFLA 2O1SA 3RS0A 2OV6A 2XD9A 5LU8A 4EX7A 2I2BA 2LXNA 2D2VA 4M89A 1YK1A 4NZZA 2PUDA 2I6XA 3ANMA 1RM5A 2XUKA 8AT1A 2CXXA 3G0OA 1WO8A 3L06A 1XVLA 1PWYE 1SXIA 4C06A 5FO0A 3IRVA 2PTHA 5E9AA 3IUPA 1XLWA 2AG1A 4DCMA 1OBVA 4EF4A 1T1JA 3OCXA 3OVMA 2VPTA 5IZ4A 5AI8A 2AZ4A 3NHSA 3G3EA 2WSSA 4Y2PA 5KNBH 4DUYB 2WJGA 2ZVJA 2W2LA 3F47A 1D07A 3KUDA 4OOFA 3VXKA 4ZCTA 4KQIA 2HQ1A 5IU6A 4MV0A 4EYQA 2IV3A 3DR3A 2GH1A 3EG9A 3HKDA 3R41A 3FUVA 5CX4A 4EHNA 5ESWA 3F67A 2PKYX 2PBFA 2W6IA 4ND8A 2Z56A 3E0QA 5IP5A 3IH5A 5AK3A 4P0TA 1VSUA 3VPDA 1ESMA 3ZK8A 4LBZA 4B0PA 1KAEA 3PNSA 3AZOA 3Q7PA 1FTGA 2DLCX 1JA1A 2H9YA 1KFKB 3NBKA 3IMFA 3ZXSA 2VCHA 2FWNA 1UL1X 1RYHA 1VGQA 1WU7A 1GSIA 2DR0A 1O2DA 2XB9A 3NUZA 2NU7B 3ELBA 5HCIA 3V4PB 1SBTA 3VSAA 2GEKA 2NZVG 2P7HA 4AUEA 3TKYA 1O54A 2NYVA 4RBNA 5ENVA 2O50A 1E5XA 3O1JC 4PTYA 4HEHA 4MJLA 3TSZA 1PF7E 1XGKA 5A2QA 1RMYA 4LJ4A 5DNDA 2RGCA 2PLNA 2WJ4A 4XWYA 3K15A 3WMWA 4AG5A 3A1UA 4KXFB 4DCOA 1U1CA 2GN2A 2HADA 2P0AA 4GPAA 4K6KA 1M1UA 2Q4BA 2XE8A 5KTPA 5ED0A 3RVKA 1NOIA 1AHHA 1LJ8A 3P0JA 1V7PC 2V6BA 1M1YE 3P4XA 4HDSB 4PO8A 3OX3A 3NG1A 3EOZA 3RSCA 3SXUB 5KTNA 4WACA 2TECE 5JRJA 1EP1B 1XMJA 5K6TA 2ZTMA 3NHMA 3PDJA 1ZHFA 4ZT4A 2Y1XA 1H22A 3CLTD 3TLZA 3T3IA 4DLVA 1F2TA 1YZLA 3D59A 4U5XA 5FV4A 1MLDA 4YP5A 2H4YA 4KOAA 4OXRA 2GHTA 2QRNA 3C1AA 4QTXA 5AT1A