5FE4A

Crystal structure of human pcaf bromodomain in complex with fragment mb364 (fragment 5)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe4A00
3U5JA 5D26A 5EICA 5EPSA 5HRVA 3G0LA 2F6JA 5DKDA 2FSAA 5D3HA 4QEUA 5I1QA 3D7CA 2DKWA 4YYKA 5HQ5A 2E3KA 5CUCA 4HBVA 5KTXA 4CUSA 5D24A 3ONIA 5CTLA 4HBWA 5FG5A 4CL9A 5E3GA 5I89A 2RNYA 4LYWA 5FE4A 4HXRA 5L98A 4LZ2A 5FE2A 4KCXA 4QSVA 3HMEA 5CUGA 5EWCA 5CUBA 4QSTA 5EVAA 5D7XA 4UYFA 4QR4A 5LJ2A 4Q0NA 4FLPA 3MQMA 5JWMA 4E96A 1EQFA 4BW1A 5A83A 4QBMA 5FFYA 4MR6A 2RI7A 3O33A 4QYLA 5EPBA 4YYDA 4MEPA 4ZW1A 4MR4A 4QSQA 4UIYA 4ZQLA 4YBSA 5F60A 5DFCA 5J0DA 3JVMA 5CGPA 5EU1A 4MR5A 5EWVA 5EK9A 4HXOA 5ENHA 4YYGA 5F36A 5D3SA 5L99A 4YY6A 4IR6A 4ZC9A 4HXPA 3P1CA 4YC9A 5CZGA 1WUGA 4LYSA 4O7EA 3U5OA 5AD2A 5D3TA 5II1A 1X0JA 5CQ5A 5FE9A 3MB4A 5KTWA 4NR7A 5EA1A 2N9GA 5FFVA 5LKZA 3Q2FA 2YEKA 4O77A 4QC3A 4OGJA 5C8GA 5FB1A 4XUBA 4AKNA 5I83A 3NXBA 4TU6A 2RO1A 4LC2A 4MEQA 2R0SA 5L8UA 5CQ6A 4NS5A 3O36A 5DLZA 1N72A 5ENEA 4PS5A 4YABA 5CRZA 1F68A 4O78A 3LQHA 4YADA 5IG6A 5I80A 3JVKA 5FH6A 4J0RA 4NR9A 3TLPA 5DYAA 4QSWA 3Q2EA 4NUDA 4BW3A 5LKXA 4UIUA 2R0VA 5LJ0A 4N4FA 5FG6A 4IR5A 4UYDA 4DONA 5E9YA 4KV1A 3GG3A 3MUKA 5FBXA 4BJXA 4LYIA 3UVYA 2D82A 5FE6A 5A5NA 4NR5A 2YEMA 5A5SA 3U5NA 4NRCA 4XY8A 5D0CA 5HRXA 2F6NA 2GRCA 2MJVB 1WUMA 3QZSA 3LQJA 3SVHA 2OSSA 5FG4A 4QUTA 4NYXA 5EI4A 4NQNA 5IGKA 5L8TA 1E6IA 4QSRA 4TQNA 5D3RA 5EM3A 5LVRA 3UV4A 4UIXA 4QC1A 4CUPA 2RFJA 5FB0A 5KHMA 4NR4A 4QSXA 5CS8A 4N4GA 5CFWA 5K29A 2WP1A 4YK0A 3U5PA 4GPJA 3UVXA 4A9FA 5CY9A 2RS9B 4QZSA 4A9OA 5EPRA 5DLXA 4QUUA 5CRMA 4YBTA 1JSPB 4NRAA 5ENIA 4PCIA 4Z6HA 3P1FA 3MXFA 4YY4A 4TT6A 5CQ7A 4A9HA 4YYJA 4TS8A 4J0SA 4UIVA 4C67A 3LJWA 4LDFA 3P5OA 4O72A 4RVRA 4TZ2A 4HBYA 2DATA 5F5ZA 2L84A 5F61A 1JM4B 2DVRA 4O75A 4MEOA 3QZTA 4OGIA 5D3PA 5A81A 5DFBA 3ZYUA 4NUEA 1ZS5A 2YW5A 3AADA 4LZRA 4CUQA 4NR8A 5BT5A 2NXBA 5E74A 5IBNA 3FKMX 2DWWA 2L85A 4NR6A 4CUUA 4NYWA 4CUTA 5DKHA 5C4QA 2DVVA 4TU4A 3JVLA 4O7AA 3UV2A 4HXMA 4QR5A 5FE0A 2D9EA 5C7NA 4QEVA 5JI8A 5AMEA 5I40A 5D3JA 4A9NA 4A9MA 4YATA 5IGLA 4CURA 5KO4A 4UIZA 4O74A 5D25A 4UYGA 5F62A 5L97A 4QSSA 4YYIA 5EQ1A 5LJ1A 4QYDA 4J1PA 4YH3A 5I7XA 4CFKA 5I7YA 4TT2A 3UVDA 5E9IA 2RNXA 5HFRA 5EP7A 4QR3A 4F3IA 5F2PA 2L5EA 2I8NA 3P1DA 5BT4A 5F1HA 4YYHA 3RCWA 4MR3A 5BT3A 4N3WA 5DW1A 5F1LA 5H1VA 3I3JA 5TB6A 4O7CA 5DYXA 4O71A 4HXKA 5C87A 2H60A 5CUEA 5A5QA 5HELA 5E9LA 4IOQA 3S91A 4PTBA 5DBMA 5CQ3A 4YAXA 4HBXA 5CPEA 4BW2A 5A5RA 4Z93A 2R0YA 5HCLA 4TZ8A 5ENJA 4YYNA 4A9JA 5FH7A 5HEMA 4O7BA 2OUOA 4QB3A 4WHWA 4BW4A 5A5OA 3DAIA 4Z1QA 3S92A 3IU5A 5CQTA 5CQAA 4LRGA 5E73A 3UV5A 5ENFA 2DVSA 4NYVA 5H1TA 4NUCA 5E3DA 2WP2A 5CP5A 3U5KA 3O37A 4WIVA 3P1EA 3AQAA 4IR3A 4NXJA 5FDZA 4XUAA 4TT4A 4UITA 4UYEA 4IR4A 3UVWA 3LQIA 4QSPA 5EWHA 4NRBA 5DYCA 4XY9A 5HRWA 5EGUA 4O76A 5HQ7A 3SVFA 4QY4A 5DW2A 4A9KA 5AD3A 2YQDA 4O7FA 4NQMA 4YH4A 4HXNA 5H1UA 3K2JA 5F25A 5I29A 4N4HA 2E7NA 2YYNA 3O34A 4BHWA 2OO1A 5IGNA 5TCMA 4CFLA 3IU6A 4HXLA 5CU8A 5II2A 5ETDA 4Q0OA 4C66A 2DVQA 2YELA 5IGMA 4ALGA 5LKTA 5A5PA 4A9IA 5CQ4A 5E9MA 5F3AA 5LKUA 5FH8A 4Y03A 5EV9A 4IOOA 5DFDA 5A85A 5ACYA 4QNSA 5G4SA 4N4IA 3QZVA 3HMHA 2G4AA 4IORA 5ENGA 3UW9A 4O70A 2RNWA 5AMFA 3MULA 5L96A 5HENA 5FE1A 3LXJA 4J3IA 5ETBA 5HFQA 4WHUA 5FE5A 5HLSA 5EISA 4OUFA 4Z1SA 3DWYA 5KTUA 4PKLA 4KV4A 5DY7A 5E9KA 5FFWA 3U5LA 4YYMA 5HQ6A 3SVGA 4A9LA 4A9EA 5A82A 3G0JA 2LSPB 5CUDA 3MB3A 4TYLA 2YDWA 4UYHA 4PCEA 4Z6IA 3HMFA 4XYAA 5H85A 5D3LA 3O35A 2E7OA 2KTBB 5LVQA 5CUAA 4CLBA 5FE7A 4X2IA 5IIDA 4QSUA 5COIA 5ENCA 4QEWA 4LR6A 5LUUA 5E0RA 4MENA 5DYUA 5EWWA 5I88A 2I7KA 5KU3A 5C85A 2R10A 4UYFB 4PY6A 5FE8A 5ENBA 5D3NA 4LZSA 4HXSA 5E9VA 5HM0A 5F63A 5HJCA 5EWDA 5G4RA 3U5MA 4ALHA 5C89A 5CQ8A 3JVJA 5FE3A 4YBMA 5I86A 5A7CA 4UIWA 5DX4A 5DKCA 5E7DA 4TTEA
chains in the Genus database with same CATH superfamily
3U5JA 5D26A 5EICA 5EPSA 5HRVA 3G0LA 2F6JA 5DKDA 2FSAA 5D3HA 4QEUA 5I1QA 3D7CA 2DKWA 4YYKA 5HQ5A 2E3KA 5CUCA 4HBVA 5KTXA 4CUSA 5D24A 3ONIA 5CTLA 4HBWA 5FG5A 4CL9A 5E3GA 5I89A 2RNYA 4LYWA 5FE4A 4HXRA 5L98A 4LZ2A 5FE2A 4KCXA 4QSVA 3HMEA 5CUGA 5EWCA 5CUBA 4QSTA 5EVAA 5D7XA 4UYFA 4QR4A 5LJ2A 4Q0NA 4FLPA 3MQMA 5JWMA 4E96A 1EQFA 4BW1A 5A83A 4QBMA 5FFYA 4MR6A 2RI7A 3O33A 4QYLA 5EPBA 4YYDA 4MEPA 4ZW1A 4MR4A 4QSQA 4UIYA 4ZQLA 4YBSA 5F60A 5DFCA 5J0DA 3JVMA 5CGPA 5EU1A 4MR5A 5EWVA 5EK9A 4HXOA 5ENHA 4YYGA 5F36A 1ZKRA 5D3SA 1PUOA 5L99A 4YY6A 4IR6A 4ZC9A 4HXPA 3P1CA 4YC9A 5CZGA 1WUGA 4LYSA 4O7EA 3U5OA 5AD2A 5D3TA 5II1A 1X0JA 5CQ5A 5FE9A 3MB4A 5KTWA 4NR7A 5EA1A 2N9GA 5FFVA 5LKZA 3Q2FA 2YEKA 4O77A 4QC3A 4OGJA 5C8GA 5FB1A 4XUBA 4AKNA 5I83A 3NXBA 4AI6A 4TU6A 2RO1A 4LC2A 4MEQA 2R0SA 5L8UA 5CQ6A 4NS5A 3O36A 5DLZA 1N72A 5ENEA 4PS5A 4YABA 5CRZA 1F68A 4O78A 3LQHA 4YADA 5IG6A 5I80A 3JVKA 5FH6A 4J0RA 4NR9A 3TLPA 5DYAA 4QSWA 3Q2EA 4NUDA 4BW3A 5LKXA 4UIUA 2R0VA 5LJ0A 3VKHA 4N4FA 5FG6A 4IR5A 4UYDA 4DONA 5E9YA 4KV1A 3GG3A 3MUKA 5FBXA 4BJXA 4LYIA 3UVYA 2D82A 5FE6A 5A5NA 4NR5A 2YEMA 5A5SA 3U5NA 4NRCA 4XY8A 5D0CA 5HRXA 2F6NA 2GRCA 2MJVB 1WUMA 3QZSA 3LQJA 4AKHA 3SVHA 2OSSA 5FG4A 4QUTA 4NYXA 5EI4A 4NQNA 5IGKA 5L8TA 1E6IA 4QSRA 4TQNA 5D3RA 5EM3A 5LVRA 3UV4A 4UIXA 4QC1A 4CUPA 2RFJA 5FB0A 5KHMA 2EJNA 4NR4A 4QSXA 5CS8A 4N4GA 5CFWA 5K29A 2WP1A 4YK0A 3U5PA 4GPJA 3UVXA 4A9FA 5CY9A 2RS9B 4QZSA 4A9OA 5EPRA 5DLXA 4QUUA 5CRMA 4YBTA 1JSPB 4NRAA 5ENIA 4PCIA 4Z6HA 3P1FA 3MXFA 4YY4A 4TT6A 5CQ7A 4A9HA 4YYJA 4TS8A 4J0SA 4UIVA 4C67A 3LJWA 4LDFA 3P5OA 4O72A 4RVRA 4TZ2A 4HBYA 2DATA 5F5ZA 2L84A 5F61A 1JM4B 2DVRA 4O75A 4MEOA 3QZTA 4OGIA 5D3PA 5A81A 5DFBA 3ZYUA 4NUEA 1ZS5A 2YW5A 3AADA 4LZRA 4CUQA 4NR8A 5BT5A 2NXBA 5E74A 5IBNA 3FKMX 2DWWA 2L85A 4NR6A 4CUUA 4NYWA 3D1BA 4CUTA 5DKHA 5C4QA 2DVVA 4TU4A 3JVLA 4O7AA 3UV2A 4HXMA 4QR5A 5FE0A 2D9EA 5C7NA 4QEVA 5JI8A 5AMEA 5I40A 5D3JA 4A9NA 4A9MA 4YATA 5IGLA 4CURA 5KO4A 4UIZA 4O74A 5D25A 4UYGA 5F62A 5L97A 4QSSA 4YYIA 5EQ1A 5LJ1A 4QYDA 4J1PA 4YH3A 5I7XA 4CFKA 5I7YA 4TT2A 3UVDA 5E9IA 2RNXA 5HFRA 5EP7A 4QR3A 4F3IA 5F2PA 2L5EA 2I8NA 3P1DA 5BT4A 5F1HA 4YYHA 3RCWA 4MR3A 5BT3A 4N3WA 5DW1A 5F1LA 5H1VA 3I3JA 5TB6A 4O7CA 5DYXA 4O71A 4HXKA 5C87A 2H60A 5CUEA 5A5QA 5HELA 5E9LA 4IOQA 3S91A 4PTBA 5DBMA 5CQ3A 4YAXA 4HBXA 5CPEA 4BW2A 5A5RA 4Z93A 2R0YA 5HCLA 4TZ8A 3VKGA 5ENJA 3ERRA 4YYNA 4A9JA 5FH7A 5HEMA 4O7BA 2OUOA 4QB3A 4WHWA 4BW4A 5A5OA 3DAIA 4Z1QA 3S92A 3IU5A 5CQTA 5CQAA 4LRGA 5E73A 3UV5A 5ENFA 2DVSA 4NYVA 5H1TA 4NUCA 5E3DA 2WP2A 5CP5A 3U5KA 3O37A 4WIVA 3P1EA 3AQAA 4IR3A 4NXJA 5FDZA 4XUAA 4TT4A 4UITA 4UYEA 4IR4A 3UVWA 3LQIA 4QSPA 5EWHA 4NRBA 5DYCA 4XY9A 5HRWA 4AKGA 5EGUA 4O76A 5HQ7A 3SVFA 4QY4A 3D1DA 5DW2A 4A9KA 5AD3A 2YQDA 4O7FA 4NQMA 4YH4A 4HXNA 5H1UA 3K2JA 5F25A 5I29A 4N4HA 2E7NA 2YYNA 3O34A 4BHWA 2OO1A 5IGNA 5TCMA 4CFLA 3IU6A 4HXLA 5CU8A 5II2A 5ETDA 4Q0OA 4C66A 2DVQA 2YELA 5IGMA 4ALGA 5LKTA 5A5PA 4A9IA 5CQ4A 5E9MA 5F3AA 5LKUA 5FH8A 4Y03A 5EV9A 4IOOA 5DFDA 5A85A 5ACYA 4QNSA 5G4SA 4N4IA 3QZVA 3HMHA 2G4AA 4IORA 5ENGA 3UW9A 4O70A 2RNWA 5AMFA 3MULA 5L96A 5HENA 5FE1A 3LXJA 4J3IA 5ETBA 5HFQA 4WHUA 5FE5A 5HLSA 5EISA 4OUFA 4Z1SA 3DWYA 5KTUA 4PKLA 4KV4A 5DY7A 5E9KA 5FFWA 3U5LA 4YYMA 5HQ6A 3SVGA 4A9LA 4A9EA 5A82A 3G0JA 2LSPB 5CUDA 3MB3A 4TYLA 2YDWA 4UYHA 4PCEA 4Z6IA 3HMFA 4XYAA 5H85A 5D3LA 3O35A 2E7OA 2KTBB 5LVQA 5CUAA 4CLBA 5FE7A 4X2IA 5IIDA 4QSUA 5COIA 5ENCA 4QEWA 4LR6A 5LUUA 5E0RA 4MENA 5DYUA 5EWWA 5I88A 2I7KA 5KU3A 5C85A 2R10A 4UYFB 4PY6A 5FE8A 5ENBA 5D3NA 4LZSA 4HXSA 5E9VA 5HM0A 5F63A 5HJCA 5EWDA 5G4RA 3U5MA 4ALHA 5C89A 5CQ8A 4AKIA 3JVJA 5FE3A 4YBMA 5I86A 5A7CA 4UIWA 5DX4A 5DKCA 5E7DA 4TTEA
chains in the Genus database with same CATH topology
3U5JA 5D26A 5EICA 5EPSA 5HRVA 3G0LA 2F6JA 5DKDA 2FSAA 5D3HA 4QEUA 5I1QA 3D7CA 2DKWA 4YYKA 5HQ5A 2E3KA 5CUCA 4HBVA 5KTXA 4CUSA 5D24A 3ONIA 5CTLA 4HBWA 5FG5A 4CL9A 5E3GA 5I89A 2RNYA 4LYWA 5FE4A 4HXRA 5L98A 4LZ2A 5FE2A 4KCXA 4QSVA 3HMEA 5CUGA 5EWCA 5CUBA 4QSTA 5EVAA 5D7XA 4UYFA 4QR4A 5LJ2A 4Q0NA 4FLPA 3MQMA 5JWMA 4E96A 1EQFA 4BW1A 5A83A 4QBMA 5FFYA 4MR6A 2RI7A 3O33A 4QYLA 5EPBA 4YYDA 4MEPA 4ZW1A 4MR4A 4QSQA 4UIYA 4ZQLA 4YBSA 5F60A 5DFCA 5J0DA 3JVMA 5CGPA 5EU1A 4MR5A 5EWVA 5EK9A 4HXOA 5ENHA 4YYGA 5F36A 5D3SA 5L99A 4YY6A 4IR6A 4ZC9A 4HXPA 3P1CA 4YC9A 5CZGA 1WUGA 4LYSA 4O7EA 3U5OA 5AD2A 5D3TA 5II1A 1X0JA 5CQ5A 5FE9A 3MB4A 5KTWA 4NR7A 5EA1A 2N9GA 5FFVA 5LKZA 3Q2FA 2YEKA 4O77A 4QC3A 4OGJA 5C8GA 5FB1A 4XUBA 4AKNA 5I83A 3NXBA 4TU6A 2RO1A 4LC2A 4MEQA 2R0SA 5L8UA 5CQ6A 4NS5A 3O36A 5DLZA 1N72A 5ENEA 4PS5A 4YABA 5CRZA 1F68A 4O78A 3LQHA 4YADA 5IG6A 5I80A 3JVKA 5FH6A 4J0RA 4NR9A 3TLPA 5DYAA 4QSWA 3Q2EA 4NUDA 4BW3A 5LKXA 4UIUA 2R0VA 5LJ0A 4N4FA 5FG6A 4IR5A 4UYDA 4DONA 5E9YA 4KV1A 3GG3A 3MUKA 5FBXA 4BJXA 4LYIA 3UVYA 2D82A 5FE6A 5A5NA 4NR5A 2YEMA 5A5SA 3U5NA 4NRCA 4XY8A 5D0CA 5HRXA 2F6NA 2GRCA 2MJVB 1WUMA 3QZSA 3LQJA 3SVHA 2OSSA 5FG4A 4QUTA 4NYXA 5EI4A 4NQNA 5IGKA 5L8TA 1E6IA 4QSRA 4TQNA 5D3RA 5EM3A 5LVRA 3UV4A 4UIXA 4QC1A 4CUPA 2RFJA 5FB0A 5KHMA 4NR4A 4QSXA 5CS8A 4N4GA 5CFWA 5K29A 2WP1A 4YK0A 3U5PA 4GPJA 3UVXA 4A9FA 5CY9A 2RS9B 4QZSA 4A9OA 5EPRA 5DLXA 4QUUA 5CRMA 4YBTA 1JSPB 4NRAA 5ENIA 4PCIA 4Z6HA 3P1FA 3MXFA 4YY4A 4TT6A 5CQ7A 4A9HA 4YYJA 4TS8A 4J0SA 4UIVA 4C67A 3LJWA 4LDFA 3P5OA 4O72A 4RVRA 4TZ2A 4HBYA 2DATA 5F5ZA 2L84A 5F61A 1JM4B 2DVRA 4O75A 4MEOA 3QZTA 4OGIA 5D3PA 5A81A 5DFBA 3ZYUA 4NUEA 1ZS5A 2YW5A 3AADA 4LZRA 4CUQA 4NR8A 5BT5A 2NXBA 5E74A 5IBNA 3FKMX 2DWWA 2L85A 4NR6A 4CUUA 4NYWA 4CUTA 5DKHA 5C4QA 2DVVA 4TU4A 3JVLA 4O7AA 3UV2A 4HXMA 4QR5A 5FE0A 2D9EA 5C7NA 4QEVA 5JI8A 5AMEA 5I40A 5D3JA 4A9NA 4A9MA 4YATA 5IGLA 4CURA 5KO4A 4UIZA 4O74A 5D25A 4UYGA 5F62A 5L97A 4QSSA 4YYIA 5EQ1A 5LJ1A 4QYDA 4J1PA 4YH3A 5I7XA 4CFKA 5I7YA 4TT2A 3UVDA 5E9IA 2RNXA 5HFRA 5EP7A 4QR3A 4F3IA 5F2PA 2L5EA 2I8NA 3P1DA 5BT4A 5F1HA 4YYHA 3RCWA 4MR3A 5BT3A 4N3WA 5DW1A 5F1LA 5H1VA 3I3JA 5TB6A 4O7CA 5DYXA 4O71A 4HXKA 5C87A 2H60A 5CUEA 5A5QA 5HELA 5E9LA 4IOQA 3S91A 4PTBA 5DBMA 5CQ3A 4YAXA 4HBXA 5CPEA 4BW2A 5A5RA 4Z93A 2R0YA 5HCLA 4TZ8A 5ENJA 4YYNA 4A9JA 5FH7A 5HEMA 4O7BA 2OUOA 4QB3A 4WHWA 4BW4A 5A5OA 3DAIA 4Z1QA 3S92A 3IU5A 5CQTA 5CQAA 4LRGA 5E73A 3UV5A 5ENFA 2DVSA 4NYVA 5H1TA 4NUCA 5E3DA 2WP2A 5CP5A 3U5KA 3O37A 4WIVA 3P1EA 3AQAA 4IR3A 4NXJA 5FDZA 4XUAA 4TT4A 4UITA 4UYEA 4IR4A 3UVWA 3LQIA 4QSPA 5EWHA 4NRBA 5DYCA 4XY9A 5HRWA 5EGUA 4O76A 5HQ7A 3SVFA 4QY4A 5DW2A 4A9KA 5AD3A 2YQDA 4O7FA 4NQMA 4YH4A 4HXNA 5H1UA 3K2JA 5F25A 5I29A 4N4HA 2E7NA 2YYNA 3O34A 4BHWA 2OO1A 5IGNA 5TCMA 4CFLA 3IU6A 4HXLA 5CU8A 5II2A 5ETDA 4Q0OA 4C66A 2DVQA 2YELA 5IGMA 4ALGA 5LKTA 5A5PA 4A9IA 5CQ4A 5E9MA 5F3AA 5LKUA 5FH8A 4Y03A 5EV9A 4IOOA 5DFDA 5A85A 5ACYA 4QNSA 5G4SA 4N4IA 3QZVA 3HMHA 2G4AA 4IORA 5ENGA 3UW9A 4O70A 2RNWA 5AMFA 3MULA 5L96A 5HENA 5FE1A 3LXJA 4J3IA 5ETBA 5HFQA 4WHUA 5FE5A 5HLSA 5EISA 4OUFA 4Z1SA 3DWYA 5KTUA 4PKLA 4KV4A 5DY7A 5E9KA 5FFWA 3U5LA 4YYMA 5HQ6A 3SVGA 4A9LA 4A9EA 5A82A 3G0JA 2LSPB 5CUDA 3MB3A 4TYLA 2YDWA 4UYHA 4PCEA 4Z6IA 3HMFA 4XYAA 5H85A 5D3LA 3O35A 2E7OA 2KTBB 5LVQA 5CUAA 4CLBA 5FE7A 4X2IA 5IIDA 4QSUA 5COIA 5ENCA 4QEWA 4LR6A 5LUUA 5E0RA 4MENA 5DYUA 5EWWA 5I88A 2I7KA 5KU3A 5C85A 2R10A 4UYFB 4PY6A 5FE8A 5ENBA 5D3NA 4LZSA 4HXSA 5E9VA 5HM0A 5F63A 5HJCA 5EWDA 5G4RA 3U5MA 4ALHA 5C89A 5CQ8A 3JVJA 5FE3A 4YBMA 5I86A 5A7CA 4UIWA 5DX4A 5DKCA 5E7DA 4TTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5J A;  5D26 A;  5EIC A;  5EPS A;  5HRV A;  3G0L A;  2F6J A;  5DKD A;  2FSA A;  5D3H A;  4QEU A;  5I1Q A;  3D7C A;  2DKW A;  4YYK A;  5HQ5 A;  2E3K A;  5CUC A;  4HBV A;  5KTX A;  4CUS A;  5D24 A;  3ONI A;  5CTL A;  4HBW A;  5FG5 A;  4CL9 A;  5E3G A;  5I89 A;  2RNY A;  4LYW A;  5FE4 A;  4HXR A;  5L98 A;  4LZ2 A;  5FE2 A;  4KCX A;  4QSV A;  3HME A;  5CUG A;  5EWC A;  5CUB A;  4QST A;  5EVA A;  5D7X A;  4UYF A;  4QR4 A;  5LJ2 A;  4Q0N A;  4FLP A;  3MQM A;  5JWM A;  4E96 A;  1EQF A;  4BW1 A;  5A83 A;  4QBM A;  5FFY A;  4MR6 A;  2RI7 A;  3O33 A;  4QYL A;  5EPB A;  4YYD A;  4MEP A;  4ZW1 A;  4MR4 A;  4QSQ A;  4UIY A;  4ZQL A;  4YBS A;  5F60 A;  5DFC A;  5J0D A;  3JVM A;  5CGP A;  5EU1 A;  4MR5 A;  5EWV A;  5EK9 A;  4HXO A;  5ENH A;  4YYG A;  5F36 A;  5D3S A;  5L99 A;  4YY6 A;  4IR6 A;  4ZC9 A;  4HXP A;  3P1C A;  4YC9 A;  5CZG A;  1WUG A;  4LYS A;  4O7E A;  3U5O A;  5AD2 A;  5D3T A;  5II1 A;  1X0J A;  5CQ5 A;  5FE9 A;  3MB4 A;  5KTW A;  4NR7 A;  5EA1 A;  2N9G A;  5FFV A;  5LKZ A;  3Q2F A;  2YEK A;  4O77 A;  4QC3 A;  4OGJ A;  5C8G A;  5FB1 A;  4XUB A;  4AKN A;  5I83 A;  3NXB A;  4TU6 A;  2RO1 A;  4LC2 A;  4MEQ A;  2R0S A;  5L8U A;  5CQ6 A;  4NS5 A;  3O36 A;  5DLZ A;  1N72 A;  5ENE A;  4PS5 A;  4YAB A;  5CRZ A;  1F68 A;  4O78 A;  3LQH A;  4YAD A;  5IG6 A;  5I80 A;  3JVK A;  5FH6 A;  4J0R A;  4NR9 A;  3TLP A;  5DYA A;  4QSW A;  3Q2E A;  4NUD A;  4BW3 A;  5LKX A;  4UIU A;  2R0V A;  5LJ0 A;  4N4F A;  5FG6 A;  4IR5 A;  4UYD A;  4DON A;  5E9Y A;  4KV1 A;  3GG3 A;  3MUK A;  5FBX A;  4BJX A;  4LYI A;  3UVY A;  2D82 A;  5FE6 A;  5A5N A;  4NR5 A;  2YEM A;  5A5S A;  3U5N A;  4NRC A;  4XY8 A;  5D0C A;  5HRX A;  2F6N A;  2GRC A;  2MJV B;  1WUM A;  3QZS A;  3LQJ A;  3SVH A;  2OSS A;  5FG4 A;  4QUT A;  4NYX A;  5EI4 A;  4NQN A;  5IGK A;  5L8T A;  1E6I A;  4QSR A;  4TQN A;  5D3R A;  5EM3 A;  5LVR A;  3UV4 A;  4UIX A;  4QC1 A;  4CUP A;  2RFJ A;  5FB0 A;  5KHM A;  4NR4 A;  4QSX A;  5CS8 A;  4N4G A;  5CFW A;  5K29 A;  2WP1 A;  4YK0 A;  3U5P A;  4GPJ A;  3UVX A;  4A9F A;  5CY9 A;  2RS9 B;  4QZS A;  4A9O A;  5EPR A;  5DLX A;  4QUU A;  5CRM A;  4YBT A;  1JSP B;  4NRA A;  5ENI A;  4PCI A;  4Z6H A;  3P1F A;  3MXF A;  4YY4 A;  4TT6 A;  5CQ7 A;  4A9H A;  4YYJ A;  4TS8 A;  4J0S A;  4UIV A;  4C67 A;  3LJW A;  4LDF A;  3P5O A;  4O72 A;  4RVR A;  4TZ2 A;  4HBY A;  2DAT A;  5F5Z A;  2L84 A;  5F61 A;  1JM4 B;  2DVR A;  4O75 A;  4MEO A;  3QZT A;  4OGI A;  5D3P A;  5A81 A;  5DFB A;  3ZYU A;  4NUE A;  1ZS5 A;  2YW5 A;  3AAD A;  4LZR A;  4CUQ A;  4NR8 A;  5BT5 A;  2NXB A;  5E74 A;  5IBN A;  3FKM X;  2DWW A;  2L85 A;  4NR6 A;  4CUU A;  4NYW A;  4CUT A;  5DKH A;  5C4Q A;  2DVV A;  4TU4 A;  3JVL A;  4O7A A;  3UV2 A;  4HXM A;  4QR5 A;  5FE0 A;  2D9E A;  5C7N A;  4QEV A;  5JI8 A;  5AME A;  5I40 A;  5D3J A;  4A9N A;  4A9M A;  4YAT A;  5IGL A;  4CUR A;  5KO4 A;  4UIZ A;  4O74 A;  5D25 A;  4UYG A;  5F62 A;  5L97 A;  4QSS A;  4YYI A;  5EQ1 A;  5LJ1 A;  4QYD A;  4J1P A;  4YH3 A;  5I7X A;  4CFK A;  5I7Y A;  4TT2 A;  3UVD A;  5E9I A;  2RNX A;  5HFR A;  5EP7 A;  4QR3 A;  4F3I A;  5F2P A;  2L5E A;  2I8N A;  3P1D A;  5BT4 A;  5F1H A;  4YYH A;  3RCW A;  4MR3 A;  5BT3 A;  4N3W A;  5DW1 A;  5F1L A;  5H1V A;  3I3J A;  5TB6 A;  4O7C A;  5DYX A;  4O71 A;  4HXK A;  5C87 A;  2H60 A;  5CUE A;  5A5Q A;  5HEL A;  5E9L A;  4IOQ A;  3S91 A;  4PTB A;  5DBM A;  5CQ3 A;  4YAX A;  4HBX A;  5CPE A;  4BW2 A;  5A5R A;  4Z93 A;  2R0Y A;  5HCL A;  4TZ8 A;  5ENJ A;  4YYN A;  4A9J A;  5FH7 A;  5HEM A;  4O7B A;  2OUO A;  4QB3 A;  4WHW A;  4BW4 A;  5A5O A;  3DAI A;  4Z1Q A;  3S92 A;  3IU5 A;  5CQT A;  5CQA A;  4LRG A;  5E73 A;  3UV5 A;  5ENF A;  2DVS A;  4NYV A;  5H1T A;  4NUC A;  5E3D A;  2WP2 A;  5CP5 A;  3U5K A;  3O37 A;  4WIV A;  3P1E A;  3AQA A;  4IR3 A;  4NXJ A;  5FDZ A;  4XUA A;  4TT4 A;  4UIT A;  4UYE A;  4IR4 A;  3UVW A;  3LQI A;  4QSP A;  5EWH A;  4NRB A;  5DYC A;  4XY9 A;  5HRW A;  5EGU A;  4O76 A;  5HQ7 A;  3SVF A;  4QY4 A;  5DW2 A;  4A9K A;  5AD3 A;  2YQD A;  4O7F A;  4NQM A;  4YH4 A;  4HXN A;  5H1U A;  3K2J A;  5F25 A;  5I29 A;  4N4H A;  2E7N A;  2YYN A;  3O34 A;  4BHW A;  2OO1 A;  5IGN A;  5TCM A;  4CFL A;  3IU6 A;  4HXL A;  5CU8 A;  5II2 A;  5ETD A;  4Q0O A;  4C66 A;  2DVQ A;  2YEL A;  5IGM A;  4ALG A;  5LKT A;  5A5P A;  4A9I A;  5CQ4 A;  5E9M A;  5F3A A;  5LKU A;  5FH8 A;  4Y03 A;  5EV9 A;  4IOO A;  5DFD A;  5A85 A;  5ACY A;  4QNS A;  5G4S A;  4N4I A;  3QZV A;  3HMH A;  2G4A A;  4IOR A;  5ENG A;  3UW9 A;  4O70 A;  2RNW A;  5AMF A;  3MUL A;  5L96 A;  5HEN A;  5FE1 A;  3LXJ A;  4J3I A;  5ETB A;  5HFQ A;  4WHU A;  5FE5 A;  5HLS A;  5EIS A;  4OUF A;  4Z1S A;  3DWY A;  5KTU A;  4PKL A;  4KV4 A;  5DY7 A;  5E9K A;  5FFW A;  3U5L A;  4YYM A;  5HQ6 A;  3SVG A;  4A9L A;  4A9E A;  5A82 A;  3G0J A;  2LSP B;  5CUD A;  3MB3 A;  4TYL A;  2YDW A;  4UYH A;  4PCE A;  4Z6I A;  3HMF A;  4XYA A;  5H85 A;  5D3L A;  3O35 A;  2E7O A;  2KTB B;  5LVQ A;  5CUA A;  4CLB A;  5FE7 A;  4X2I A;  5IID A;  4QSU A;  5COI A;  5ENC A;  4QEW A;  4LR6 A;  5LUU A;  5E0R A;  4MEN A;  5DYU A;  5EWW A;  5I88 A;  2I7K A;  5KU3 A;  5C85 A;  2R10 A;  4UYF B;  4PY6 A;  5FE8 A;  5ENB A;  5D3N A;  4LZS A;  4HXS A;  5E9V A;  5HM0 A;  5F63 A;  5HJC A;  5EWD A;  5G4R A;  3U5M A;  4ALH A;  5C89 A;  5CQ8 A;  3JVJ A;  5FE3 A;  4YBM A;  5I86 A;  5A7C A;  4UIW A;  5DX4 A;  5DKC A;  5E7D A;  4TTE A; 
#chains in the Genus database with same CATH topology
 3U5J A;  5D26 A;  5EIC A;  5EPS A;  5HRV A;  3G0L A;  2F6J A;  5DKD A;  2FSA A;  5D3H A;  4QEU A;  5I1Q A;  3D7C A;  2DKW A;  4YYK A;  5HQ5 A;  2E3K A;  5CUC A;  4HBV A;  5KTX A;  4CUS A;  5D24 A;  3ONI A;  5CTL A;  4HBW A;  5FG5 A;  4CL9 A;  5E3G A;  5I89 A;  2RNY A;  4LYW A;  5FE4 A;  4HXR A;  5L98 A;  4LZ2 A;  5FE2 A;  4KCX A;  4QSV A;  3HME A;  5CUG A;  5EWC A;  5CUB A;  4QST A;  5EVA A;  5D7X A;  4UYF A;  4QR4 A;  5LJ2 A;  4Q0N A;  4FLP A;  3MQM A;  5JWM A;  4E96 A;  1EQF A;  4BW1 A;  5A83 A;  4QBM A;  5FFY A;  4MR6 A;  2RI7 A;  3O33 A;  4QYL A;  5EPB A;  4YYD A;  4MEP A;  4ZW1 A;  4MR4 A;  4QSQ A;  4UIY A;  4ZQL A;  4YBS A;  5F60 A;  5DFC A;  5J0D A;  3JVM A;  5CGP A;  5EU1 A;  4MR5 A;  5EWV A;  5EK9 A;  4HXO A;  5ENH A;  4YYG A;  5F36 A;  1ZKR A;  5D3S A;  1PUO A;  5L99 A;  4YY6 A;  4IR6 A;  4ZC9 A;  4HXP A;  3P1C A;  4YC9 A;  5CZG A;  1WUG A;  4LYS A;  4O7E A;  3U5O A;  5AD2 A;  5D3T A;  5II1 A;  1X0J A;  5CQ5 A;  5FE9 A;  3MB4 A;  5KTW A;  4NR7 A;  5EA1 A;  2N9G A;  5FFV A;  5LKZ A;  3Q2F A;  2YEK A;  4O77 A;  4QC3 A;  4OGJ A;  5C8G A;  5FB1 A;  4XUB A;  4AKN A;  5I83 A;  3NXB A;  4AI6 A;  4TU6 A;  2RO1 A;  4LC2 A;  4MEQ A;  2R0S A;  5L8U A;  5CQ6 A;  4NS5 A;  3O36 A;  5DLZ A;  1N72 A;  5ENE A;  4PS5 A;  4YAB A;  5CRZ A;  1F68 A;  4O78 A;  3LQH A;  4YAD A;  5IG6 A;  5I80 A;  3JVK A;  5FH6 A;  4J0R A;  4NR9 A;  3TLP A;  5DYA A;  4QSW A;  3Q2E A;  4NUD A;  4BW3 A;  5LKX A;  4UIU A;  2R0V A;  5LJ0 A;  3VKH A;  4N4F A;  5FG6 A;  4IR5 A;  4UYD A;  4DON A;  5E9Y A;  4KV1 A;  3GG3 A;  3MUK A;  5FBX A;  4BJX A;  4LYI A;  3UVY A;  2D82 A;  5FE6 A;  5A5N A;  4NR5 A;  2YEM A;  5A5S A;  3U5N A;  4NRC A;  4XY8 A;  5D0C A;  5HRX A;  2F6N A;  2GRC A;  2MJV B;  1WUM A;  3QZS A;  3LQJ A;  4AKH A;  3SVH A;  2OSS A;  5FG4 A;  4QUT A;  4NYX A;  5EI4 A;  4NQN A;  5IGK A;  5L8T A;  1E6I A;  4QSR A;  4TQN A;  5D3R A;  5EM3 A;  5LVR A;  3UV4 A;  4UIX A;  4QC1 A;  4CUP A;  2RFJ A;  5FB0 A;  5KHM A;  2EJN A;  4NR4 A;  4QSX A;  5CS8 A;  4N4G A;  5CFW A;  5K29 A;  2WP1 A;  4YK0 A;  3U5P A;  4GPJ A;  3UVX A;  4A9F A;  5CY9 A;  2RS9 B;  4QZS A;  4A9O A;  5EPR A;  5DLX A;  4QUU A;  5CRM A;  4YBT A;  1JSP B;  4NRA A;  5ENI A;  4PCI A;  4Z6H A;  3P1F A;  3MXF A;  4YY4 A;  4TT6 A;  5CQ7 A;  4A9H A;  4YYJ A;  4TS8 A;  4J0S A;  4UIV A;  4C67 A;  3LJW A;  4LDF A;  3P5O A;  4O72 A;  4RVR A;  4TZ2 A;  4HBY A;  2DAT A;  5F5Z A;  2L84 A;  5F61 A;  1JM4 B;  2DVR A;  4O75 A;  4MEO A;  3QZT A;  4OGI A;  5D3P A;  5A81 A;  5DFB A;  3ZYU A;  4NUE A;  1ZS5 A;  2YW5 A;  3AAD A;  4LZR A;  4CUQ A;  4NR8 A;  5BT5 A;  2NXB A;  5E74 A;  5IBN A;  3FKM X;  2DWW A;  2L85 A;  4NR6 A;  4CUU A;  4NYW A;  3D1B A;  4CUT A;  5DKH A;  5C4Q A;  2DVV A;  4TU4 A;  3JVL A;  4O7A A;  3UV2 A;  4HXM A;  4QR5 A;  5FE0 A;  2D9E A;  5C7N A;  4QEV A;  5JI8 A;  5AME A;  5I40 A;  5D3J A;  4A9N A;  4A9M A;  4YAT A;  5IGL A;  4CUR A;  5KO4 A;  4UIZ A;  4O74 A;  5D25 A;  4UYG A;  5F62 A;  5L97 A;  4QSS A;  4YYI A;  5EQ1 A;  5LJ1 A;  4QYD A;  4J1P A;  4YH3 A;  5I7X A;  4CFK A;  5I7Y A;  4TT2 A;  3UVD A;  5E9I A;  2RNX A;  5HFR A;  5EP7 A;  4QR3 A;  4F3I A;  5F2P A;  2L5E A;  2I8N A;  3P1D A;  5BT4 A;  5F1H A;  4YYH A;  3RCW A;  4MR3 A;  5BT3 A;  4N3W A;  5DW1 A;  5F1L A;  5H1V A;  3I3J A;  5TB6 A;  4O7C A;  5DYX A;  4O71 A;  4HXK A;  5C87 A;  2H60 A;  5CUE A;  5A5Q A;  5HEL A;  5E9L A;  4IOQ A;  3S91 A;  4PTB A;  5DBM A;  5CQ3 A;  4YAX A;  4HBX A;  5CPE A;  4BW2 A;  5A5R A;  4Z93 A;  2R0Y A;  5HCL A;  4TZ8 A;  3VKG A;  5ENJ A;  3ERR A;  4YYN A;  4A9J A;  5FH7 A;  5HEM A;  4O7B A;  2OUO A;  4QB3 A;  4WHW A;  4BW4 A;  5A5O A;  3DAI A;  4Z1Q A;  3S92 A;  3IU5 A;  5CQT A;  5CQA A;  4LRG A;  5E73 A;  3UV5 A;  5ENF A;  2DVS A;  4NYV A;  5H1T A;  4NUC A;  5E3D A;  2WP2 A;  5CP5 A;  3U5K A;  3O37 A;  4WIV A;  3P1E A;  3AQA A;  4IR3 A;  4NXJ A;  5FDZ A;  4XUA A;  4TT4 A;  4UIT A;  4UYE A;  4IR4 A;  3UVW A;  3LQI A;  4QSP A;  5EWH A;  4NRB A;  5DYC A;  4XY9 A;  5HRW A;  4AKG A;  5EGU A;  4O76 A;  5HQ7 A;  3SVF A;  4QY4 A;  3D1D A;  5DW2 A;  4A9K A;  5AD3 A;  2YQD A;  4O7F A;  4NQM A;  4YH4 A;  4HXN A;  5H1U A;  3K2J A;  5F25 A;  5I29 A;  4N4H A;  2E7N A;  2YYN A;  3O34 A;  4BHW A;  2OO1 A;  5IGN A;  5TCM A;  4CFL A;  3IU6 A;  4HXL A;  5CU8 A;  5II2 A;  5ETD A;  4Q0O A;  4C66 A;  2DVQ A;  2YEL A;  5IGM A;  4ALG A;  5LKT A;  5A5P A;  4A9I A;  5CQ4 A;  5E9M A;  5F3A A;  5LKU A;  5FH8 A;  4Y03 A;  5EV9 A;  4IOO A;  5DFD A;  5A85 A;  5ACY A;  4QNS A;  5G4S A;  4N4I A;  3QZV A;  3HMH A;  2G4A A;  4IOR A;  5ENG A;  3UW9 A;  4O70 A;  2RNW A;  5AMF A;  3MUL A;  5L96 A;  5HEN A;  5FE1 A;  3LXJ A;  4J3I A;  5ETB A;  5HFQ A;  4WHU A;  5FE5 A;  5HLS A;  5EIS A;  4OUF A;  4Z1S A;  3DWY A;  5KTU A;  4PKL A;  4KV4 A;  5DY7 A;  5E9K A;  5FFW A;  3U5L A;  4YYM A;  5HQ6 A;  3SVG A;  4A9L A;  4A9E A;  5A82 A;  3G0J A;  2LSP B;  5CUD A;  3MB3 A;  4TYL A;  2YDW A;  4UYH A;  4PCE A;  4Z6I A;  3HMF A;  4XYA A;  5H85 A;  5D3L A;  3O35 A;  2E7O A;  2KTB B;  5LVQ A;  5CUA A;  4CLB A;  5FE7 A;  4X2I A;  5IID A;  4QSU A;  5COI A;  5ENC A;  4QEW A;  4LR6 A;  5LUU A;  5E0R A;  4MEN A;  5DYU A;  5EWW A;  5I88 A;  2I7K A;  5KU3 A;  5C85 A;  2R10 A;  4UYF B;  4PY6 A;  5FE8 A;  5ENB A;  5D3N A;  4LZS A;  4HXS A;  5E9V A;  5HM0 A;  5F63 A;  5HJC A;  5EWD A;  5G4R A;  3U5M A;  4ALH A;  5C89 A;  5CQ8 A;  4AKI A;  3JVJ A;  5FE3 A;  4YBM A;  5I86 A;  5A7C A;  4UIW A;  5DX4 A;  5DKC A;  5E7D A;  4TTE A; 
#chains in the Genus database with same CATH homology
 3U5J A;  5D26 A;  5EIC A;  5EPS A;  5HRV A;  3G0L A;  2F6J A;  5DKD A;  2FSA A;  5D3H A;  4QEU A;  5I1Q A;  3D7C A;  2DKW A;  4YYK A;  5HQ5 A;  2E3K A;  5CUC A;  4HBV A;  5KTX A;  4CUS A;  5D24 A;  3ONI A;  5CTL A;  4HBW A;  5FG5 A;  4CL9 A;  5E3G A;  5I89 A;  2RNY A;  4LYW A;  5FE4 A;  4HXR A;  5L98 A;  4LZ2 A;  5FE2 A;  4KCX A;  4QSV A;  3HME A;  5CUG A;  5EWC A;  5CUB A;  4QST A;  5EVA A;  5D7X A;  4UYF A;  4QR4 A;  5LJ2 A;  4Q0N A;  4FLP A;  3MQM A;  5JWM A;  4E96 A;  1EQF A;  4BW1 A;  5A83 A;  4QBM A;  5FFY A;  4MR6 A;  2RI7 A;  3O33 A;  4QYL A;  5EPB A;  4YYD A;  4MEP A;  4ZW1 A;  4MR4 A;  4QSQ A;  4UIY A;  4ZQL A;  4YBS A;  5F60 A;  5DFC A;  5J0D A;  3JVM A;  5CGP A;  5EU1 A;  4MR5 A;  5EWV A;  5EK9 A;  4HXO A;  5ENH A;  4YYG A;  5F36 A;  5D3S A;  5L99 A;  4YY6 A;  4IR6 A;  4ZC9 A;  4HXP A;  3P1C A;  4YC9 A;  5CZG A;  1WUG A;  4LYS A;  4O7E A;  3U5O A;  5AD2 A;  5D3T A;  5II1 A;  1X0J A;  5CQ5 A;  5FE9 A;  3MB4 A;  5KTW A;  4NR7 A;  5EA1 A;  2N9G A;  5FFV A;  5LKZ A;  3Q2F A;  2YEK A;  4O77 A;  4QC3 A;  4OGJ A;  5C8G A;  5FB1 A;  4XUB A;  4AKN A;  5I83 A;  3NXB A;  4TU6 A;  2RO1 A;  4LC2 A;  4MEQ A;  2R0S A;  5L8U A;  5CQ6 A;  4NS5 A;  3O36 A;  5DLZ A;  1N72 A;  5ENE A;  4PS5 A;  4YAB A;  5CRZ A;  1F68 A;  4O78 A;  3LQH A;  4YAD A;  5IG6 A;  5I80 A;  3JVK A;  5FH6 A;  4J0R A;  4NR9 A;  3TLP A;  5DYA A;  4QSW A;  3Q2E A;  4NUD A;  4BW3 A;  5LKX A;  4UIU A;  2R0V A;  5LJ0 A;  4N4F A;  5FG6 A;  4IR5 A;  4UYD A;  4DON A;  5E9Y A;  4KV1 A;  3GG3 A;  3MUK A;  5FBX A;  4BJX A;  4LYI A;  3UVY A;  2D82 A;  5FE6 A;  5A5N A;  4NR5 A;  2YEM A;  5A5S A;  3U5N A;  4NRC A;  4XY8 A;  5D0C A;  5HRX A;  2F6N A;  2GRC A;  2MJV B;  1WUM A;  3QZS A;  3LQJ A;  3SVH A;  2OSS A;  5FG4 A;  4QUT A;  4NYX A;  5EI4 A;  4NQN A;  5IGK A;  5L8T A;  1E6I A;  4QSR A;  4TQN A;  5D3R A;  5EM3 A;  5LVR A;  3UV4 A;  4UIX A;  4QC1 A;  4CUP A;  2RFJ A;  5FB0 A;  5KHM A;  4NR4 A;  4QSX A;  5CS8 A;  4N4G A;  5CFW A;  5K29 A;  2WP1 A;  4YK0 A;  3U5P A;  4GPJ A;  3UVX A;  4A9F A;  5CY9 A;  2RS9 B;  4QZS A;  4A9O A;  5EPR A;  5DLX A;  4QUU A;  5CRM A;  4YBT A;  1JSP B;  4NRA A;  5ENI A;  4PCI A;  4Z6H A;  3P1F A;  3MXF A;  4YY4 A;  4TT6 A;  5CQ7 A;  4A9H A;  4YYJ A;  4TS8 A;  4J0S A;  4UIV A;  4C67 A;  3LJW A;  4LDF A;  3P5O A;  4O72 A;  4RVR A;  4TZ2 A;  4HBY A;  2DAT A;  5F5Z A;  2L84 A;  5F61 A;  1JM4 B;  2DVR A;  4O75 A;  4MEO A;  3QZT A;  4OGI A;  5D3P A;  5A81 A;  5DFB A;  3ZYU A;  4NUE A;  1ZS5 A;  2YW5 A;  3AAD A;  4LZR A;  4CUQ A;  4NR8 A;  5BT5 A;  2NXB A;  5E74 A;  5IBN A;  3FKM X;  2DWW A;  2L85 A;  4NR6 A;  4CUU A;  4NYW A;  4CUT A;  5DKH A;  5C4Q A;  2DVV A;  4TU4 A;  3JVL A;  4O7A A;  3UV2 A;  4HXM A;  4QR5 A;  5FE0 A;  2D9E A;  5C7N A;  4QEV A;  5JI8 A;  5AME A;  5I40 A;  5D3J A;  4A9N A;  4A9M A;  4YAT A;  5IGL A;  4CUR A;  5KO4 A;  4UIZ A;  4O74 A;  5D25 A;  4UYG A;  5F62 A;  5L97 A;  4QSS A;  4YYI A;  5EQ1 A;  5LJ1 A;  4QYD A;  4J1P A;  4YH3 A;  5I7X A;  4CFK A;  5I7Y A;  4TT2 A;  3UVD A;  5E9I A;  2RNX A;  5HFR A;  5EP7 A;  4QR3 A;  4F3I A;  5F2P A;  2L5E A;  2I8N A;  3P1D A;  5BT4 A;  5F1H A;  4YYH A;  3RCW A;  4MR3 A;  5BT3 A;  4N3W A;  5DW1 A;  5F1L A;  5H1V A;  3I3J A;  5TB6 A;  4O7C A;  5DYX A;  4O71 A;  4HXK A;  5C87 A;  2H60 A;  5CUE A;  5A5Q A;  5HEL A;  5E9L A;  4IOQ A;  3S91 A;  4PTB A;  5DBM A;  5CQ3 A;  4YAX A;  4HBX A;  5CPE A;  4BW2 A;  5A5R A;  4Z93 A;  2R0Y A;  5HCL A;  4TZ8 A;  5ENJ A;  4YYN A;  4A9J A;  5FH7 A;  5HEM A;  4O7B A;  2OUO A;  4QB3 A;  4WHW A;  4BW4 A;  5A5O A;  3DAI A;  4Z1Q A;  3S92 A;  3IU5 A;  5CQT A;  5CQA A;  4LRG A;  5E73 A;  3UV5 A;  5ENF A;  2DVS A;  4NYV A;  5H1T A;  4NUC A;  5E3D A;  2WP2 A;  5CP5 A;  3U5K A;  3O37 A;  4WIV A;  3P1E A;  3AQA A;  4IR3 A;  4NXJ A;  5FDZ A;  4XUA A;  4TT4 A;  4UIT A;  4UYE A;  4IR4 A;  3UVW A;  3LQI A;  4QSP A;  5EWH A;  4NRB A;  5DYC A;  4XY9 A;  5HRW A;  5EGU A;  4O76 A;  5HQ7 A;  3SVF A;  4QY4 A;  5DW2 A;  4A9K A;  5AD3 A;  2YQD A;  4O7F A;  4NQM A;  4YH4 A;  4HXN A;  5H1U A;  3K2J A;  5F25 A;  5I29 A;  4N4H A;  2E7N A;  2YYN A;  3O34 A;  4BHW A;  2OO1 A;  5IGN A;  5TCM A;  4CFL A;  3IU6 A;  4HXL A;  5CU8 A;  5II2 A;  5ETD A;  4Q0O A;  4C66 A;  2DVQ A;  2YEL A;  5IGM A;  4ALG A;  5LKT A;  5A5P A;  4A9I A;  5CQ4 A;  5E9M A;  5F3A A;  5LKU A;  5FH8 A;  4Y03 A;  5EV9 A;  4IOO A;  5DFD A;  5A85 A;  5ACY A;  4QNS A;  5G4S A;  4N4I A;  3QZV A;  3HMH A;  2G4A A;  4IOR A;  5ENG A;  3UW9 A;  4O70 A;  2RNW A;  5AMF A;  3MUL A;  5L96 A;  5HEN A;  5FE1 A;  3LXJ A;  4J3I A;  5ETB A;  5HFQ A;  4WHU A;  5FE5 A;  5HLS A;  5EIS A;  4OUF A;  4Z1S A;  3DWY A;  5KTU A;  4PKL A;  4KV4 A;  5DY7 A;  5E9K A;  5FFW A;  3U5L A;  4YYM A;  5HQ6 A;  3SVG A;  4A9L A;  4A9E A;  5A82 A;  3G0J A;  2LSP B;  5CUD A;  3MB3 A;  4TYL A;  2YDW A;  4UYH A;  4PCE A;  4Z6I A;  3HMF A;  4XYA A;  5H85 A;  5D3L A;  3O35 A;  2E7O A;  2KTB B;  5LVQ A;  5CUA A;  4CLB A;  5FE7 A;  4X2I A;  5IID A;  4QSU A;  5COI A;  5ENC A;  4QEW A;  4LR6 A;  5LUU A;  5E0R A;  4MEN A;  5DYU A;  5EWW A;  5I88 A;  2I7K A;  5KU3 A;  5C85 A;  2R10 A;  4UYF B;  4PY6 A;  5FE8 A;  5ENB A;  5D3N A;  4LZS A;  4HXS A;  5E9V A;  5HM0 A;  5F63 A;  5HJC A;  5EWD A;  5G4R A;  3U5M A;  4ALH A;  5C89 A;  5CQ8 A;  3JVJ A;  5FE3 A;  4YBM A;  5I86 A;  5A7C A;  4UIW A;  5DX4 A;  5DKC A;  5E7D A;  4TTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...