5FE8A

Crystal structure of human pcaf bromodomain in complex with compound sl1126 (compound 12)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
b'DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
molecule keywords Histone acetyltransferase KAT2B
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe8A00
5FG5A 4AKNA 4KCXA 4LRGA 2DKWA 5ETDA 4E96A 4WHWA 5KTWA 5EWDA 5HENA 4QUUA 5ENBA 4WHUA 4IR5A 3LQHA 5L8TA 5TB6A 5FE2A 4QSVA 5E9YA 5FG4A 5D3NA 5DFDA 5EV9A 5AMFA 2E3KA 5A83A 4A9HA 4A9JA 5E9VA 5F3AA 5IG6A 4QUTA 4Y03A 4CUPA 5EPRA 5A82A 4YAXA 4BJXA 4BW1A 4GPJA 3HMFA 3U5MA 5LVQA 4ZQLA 5DYCA 4IOQA 5I80A 4HBXA 4FLPA 4LYSA 2NXBA 4UIXA 4QYLA 4A9EA 5D0CA 5DLZA 4A9OA 1X0JA 5KTXA 5FDZA 3O33A 5FH6A 1JSPB 1E6IA 4TU6A 5ENHA 5ENCA 2DWWA 4TZ2A 4N4GA 4QSQA 4UIUA 4YYKA 4HXRA 4NR6A 2I7KA 5L8UA 4HBWA 3QZTA 5D3RA 5DLXA 5LJ0A 5BT3A 4C66A 3MQMA 5EPSA 5HELA 5JI8A 4TQNA 5COIA 4N4IA 3UVDA 3DWYA 5D3TA 5CY9A 4XY9A 3MB3A 4ALHA 3LQIA 3UV4A 4J0RA 3Q2EA 5A5QA 1ZS5A 4O7FA 2RFJA 4LZRA 3IU6A 5EM3A 4OGIA 5F5ZA 3MB4A 4TS8A 4CUTA 3TLPA 5L97A 5E74A 4IOOA 2L85A 3S92A 1WUGA 4O70A 5IBNA 5KHMA 3LXJA 5CQ6A 5CGPA 5FE0A 5I7XA 5A85A 5FE4A 5DKDA 5I83A 4QC1A 3U5LA 4MR3A 4UIWA 5J0DA 3P1CA 4UITA 5EWVA 3LJWA 4QY4A 4A9IA 1WUMA 5C8GA 5IGNA 5EK9A 4UIYA 3UVYA 4MR4A 4QSTA 4O74A 4MEOA 5A5SA 3RCWA 5HJCA 5E7DA 5L96A 3QZVA 5HM0A 4NR4A 3K2JA 4CURA 2RS9B 4CFLA 4HXKA 2YEKA 5AD3A 5DKCA 3U5NA 4PCEA 3S91A 4MR6A 4BW2A 5KO4A 3SVHA 4HBVA 4NUCA 4Z6IA 1N72A 3O37A 3UVXA 2RNXA 2RNWA 3O36A 5DX4A 5A5PA 4QBMA 5E3GA 5HQ5A 5CZGA 3O34A 2E7OA 2LSPB 5DFCA 2R0SA 4NUEA 4CL9A 5HEMA 4NS5A 5KU3A 5D3SA 3IU5A 5CUGA 4KV1A 4XYAA 3DAIA 4UYEA 4TTEA 4YBSA 2YYNA 2YELA 4PTBA 2DVRA 5DY7A 4NYVA 5F62A 5F63A 2H60A 3I3JA 2G4AA 4OUFA 4NQNA 4NRCA 4NUDA 5FE6A 5FBXA 4O7CA 5LKXA 5H1TA 3G0JA 5LKTA 3Q2FA 5HFQA 5A7CA 5ENFA 4DONA 4YYGA 5FB0A 4QSSA 4LYWA 5CQAA 3JVJA 2E7NA 2RI7A 4O7EA 5AMEA 4QSUA 5I7YA 4LDFA 2KTBB 2OUOA 5F25A 4NQMA 4NRBA 5KTUA 5A5RA 5I40A 3U5OA 4HXSA 5ENIA 5F1HA 5II1A 5AD2A 4J3IA 4YBMA 5D26A 3D7CA 5EPBA 5HQ6A 2DVQA 4NRAA 4TU4A 5EWCA 5C89A 4PY6A 4O77A 4QR3A 5EI4A 5E9LA 5CU8A 5EISA 4O71A 3P5OA 4CUUA 4XUAA 5ACYA 5CQTA 4HXNA 4QSXA 5ENJA 4BW3A 5A5NA 4UIZA 5DYAA 2YW5A 5CQ4A 4YABA 5FFWA 4NR7A 2YDWA 4NYXA 5CUEA 2N9GA 5CS8A 5D3HA 4YY4A 3NXBA 4A9LA 5E9KA 5EQ1A 5C4QA 4ALGA 5D25A 5CFWA 5F60A 4X2IA 5DFBA 4XY8A 4Q0NA 5C7NA 5LKUA 5FE5A 4MEPA 5A81A 5F2PA 4O78A 3QZSA 4O72A 4XUBA 4IORA 4OGJA 4PS5A 5JWMA 2L5EA 5E73A 4YATA 5DYUA 5HRWA 4YH3A 5FE7A 5FH7A 5CP5A 4QNSA 5IGMA 3MULA 5ENGA 4O75A 3SVFA 4LC2A 4NXJA 5LJ1A 2D9EA 4Z1SA 2R0YA 2RO1A 4HBYA 4QR4A 5FE1A 2RNYA 4A9FA 4F3IA 4UYHA 3FKMX 4J1PA 5EA1A 3P1FA 2MJVB 5A5OA 3MXFA 4IR3A 3JVMA 5DKHA 5F36A 5FE8A 3UW9A 5CUBA 3ZYUA 2D82A 5EU1A 5EWWA 5K29A 4QSWA 4HXLA 4QYDA 3HMEA 3P1DA 3G0LA 5E0RA 4Z6HA 3UVWA 3U5PA 5E3DA 4ZC9A 5LKZA 5HRXA 5FB1A 3P1EA 5FH8A 3U5JA 4C67A 4YYJA 4WIVA 5LJ2A 3LQJA 4UIVA 5C87A 4O7AA 3GG3A 3HMHA 4NR5A 5D24A 2L84A 5TCMA 5F61A 4BHWA 5CQ8A 5L99A 4O76A 5EWHA 4YBTA 4J0SA 5E9IA 5EP7A 5I86A 4LZSA 5G4RA 4N4FA 4YY6A 3JVLA 4QB3A 4YC9A 5DW2A 2GRCA 2OO1A 4QSRA 3UV2A 4NR8A 4MENA 5ENEA 4YYDA 2WP1A 5CTLA 4A9NA 1F68A 3SVGA 4A9KA 4YADA 2YQDA 4QC3A 2F6NA 4HXMA 4Q0OA 4IR6A 5CQ3A 5D3PA 4UYFB 5EVAA 5FE9A 4N4HA 4YYMA 4MEQA 2F6JA 5LVRA 4Z93A 5HQ7A 4LYIA 4YK0A 5H1VA 5IGKA 4NR9A 2OSSA 5HRVA 4PCIA 4Z1QA 1EQFA 4UYDA 5DYXA 5EICA 5HFRA 4CFKA 5C85A 5HLSA 5CUAA 4QSPA 4LZ2A 4A9MA 2DVSA 3ONIA 5EGUA 5DW1A 5FFVA 4LR6A 4QR5A 5IIDA 5BT4A 2DATA 4QEUA 5F1LA 5CPEA 4HXOA 4UYGA 2R0VA 3MUKA 5CRMA 4NYWA 2YEMA 4RVRA 4HXPA 5CRZA 4BW4A 5E9MA 5I88A 3U5KA 5FG6A 1JM4B 5BT5A 5I1QA 5DBMA 4YYIA 4CUSA 5CQ7A 5HCLA 3O35A 4YYHA 5CUDA 4CUQA 5FE3A 5H85A 4TT2A 5D3LA 4CLBA 5H1UA 4IR4A 2DVVA 5ETBA 2I8NA 4MR5A 4KV4A 4N3WA 4TZ8A 2FSAA 3AQAA 2R10A 2WP2A 4YH4A 4YYNA 5LUUA 5II2A 4QEVA 4UYFA 4QZSA 5I89A 4ZW1A 5FFYA 4TYLA 5L98A 3UV5A 3AADA 4TT6A 5D3JA 5CUCA 4TT4A 3JVKA 4QEWA 5I29A 5G4SA 5D7XA 5IGLA 4O7BA 5CQ5A 4PKLA
chains in the Genus database with same CATH superfamily
5FG5A 4AKNA 4KCXA 4LRGA 2DKWA 5ETDA 4E96A 4WHWA 5KTWA 5EWDA 5HENA 4QUUA 5ENBA 4WHUA 4IR5A 3LQHA 5L8TA 5TB6A 5FE2A 4QSVA 5E9YA 5FG4A 5D3NA 5DFDA 5EV9A 5AMFA 2E3KA 5A83A 4A9HA 4A9JA 5E9VA 5F3AA 5IG6A 4QUTA 4Y03A 4CUPA 5EPRA 5A82A 4YAXA 4BJXA 4BW1A 4GPJA 3HMFA 3U5MA 5LVQA 4ZQLA 5DYCA 4IOQA 5I80A 4HBXA 4FLPA 3D1BA 4LYSA 2NXBA 4UIXA 3VKGA 4QYLA 4A9EA 5D0CA 5DLZA 4A9OA 1X0JA 5KTXA 5FDZA 3O33A 5FH6A 1JSPB 1E6IA 4TU6A 5ENHA 5ENCA 2DWWA 4TZ2A 4N4GA 4QSQA 4UIUA 4YYKA 4HXRA 4NR6A 2I7KA 4AI6A 5L8UA 4HBWA 3QZTA 5D3RA 5DLXA 5LJ0A 5BT3A 4C66A 3MQMA 5EPSA 5HELA 5JI8A 4TQNA 5COIA 4N4IA 3UVDA 3DWYA 5D3TA 5CY9A 4XY9A 3MB3A 4ALHA 3LQIA 3UV4A 4J0RA 3Q2EA 5A5QA 1ZS5A 4O7FA 2RFJA 4AKGA 4LZRA 3IU6A 5EM3A 4OGIA 5F5ZA 3MB4A 4TS8A 4CUTA 3TLPA 5L97A 5E74A 4IOOA 2L85A 3S92A 1WUGA 4O70A 5IBNA 5KHMA 3LXJA 5CQ6A 5CGPA 5FE0A 5I7XA 5A85A 5FE4A 5DKDA 5I83A 4QC1A 3U5LA 4MR3A 4UIWA 5J0DA 3P1CA 4UITA 5EWVA 3LJWA 4QY4A 4A9IA 1WUMA 5C8GA 5IGNA 5EK9A 4UIYA 3UVYA 4MR4A 4QSTA 4O74A 4MEOA 5A5SA 3RCWA 5HJCA 5E7DA 5L96A 3QZVA 5HM0A 4NR4A 3K2JA 4CURA 2RS9B 4CFLA 4HXKA 2YEKA 5AD3A 5DKCA 3U5NA 4PCEA 3S91A 4MR6A 4BW2A 5KO4A 3SVHA 4HBVA 4NUCA 4Z6IA 1N72A 3O37A 3UVXA 2RNXA 2RNWA 3O36A 5DX4A 5A5PA 4QBMA 5E3GA 5HQ5A 5CZGA 3O34A 2E7OA 2LSPB 5DFCA 2R0SA 4NUEA 4CL9A 5HEMA 4NS5A 5KU3A 5D3SA 3IU5A 5CUGA 3D1DA 4KV1A 4XYAA 3DAIA 4UYEA 4TTEA 4YBSA 2YYNA 2YELA 4PTBA 2DVRA 5DY7A 4NYVA 5F62A 5F63A 2H60A 3I3JA 2G4AA 4OUFA 4NQNA 4NRCA 4NUDA 5FE6A 5FBXA 4O7CA 5LKXA 5H1TA 3G0JA 5LKTA 3Q2FA 5HFQA 5A7CA 5ENFA 4DONA 4YYGA 5FB0A 4QSSA 4LYWA 5CQAA 3JVJA 2E7NA 2RI7A 4O7EA 5AMEA 4QSUA 5I7YA 4LDFA 2KTBB 2OUOA 5F25A 4NQMA 4NRBA 5KTUA 5A5RA 5I40A 3U5OA 4HXSA 5ENIA 5F1HA 5II1A 5AD2A 4J3IA 4YBMA 5D26A 3D7CA 5EPBA 5HQ6A 2DVQA 4NRAA 4TU4A 5EWCA 5C89A 4PY6A 4O77A 1PUOA 4QR3A 5EI4A 5E9LA 5CU8A 5EISA 4O71A 3P5OA 4CUUA 4XUAA 5ACYA 5CQTA 4HXNA 4QSXA 4AKHA 5ENJA 4BW3A 5A5NA 4UIZA 5DYAA 2YW5A 5CQ4A 4YABA 5FFWA 4NR7A 2YDWA 4NYXA 5CUEA 2N9GA 5CS8A 5D3HA 4YY4A 3NXBA 4A9LA 5E9KA 5EQ1A 5C4QA 4ALGA 5D25A 5CFWA 5F60A 4X2IA 5DFBA 4XY8A 4Q0NA 5C7NA 5LKUA 5FE5A 4MEPA 5A81A 5F2PA 4O78A 3QZSA 4O72A 4XUBA 4IORA 4OGJA 1ZKRA 4PS5A 2L5EA 5JWMA 5E73A 4YATA 5DYUA 5HRWA 4YH3A 5FE7A 5FH7A 5CP5A 4QNSA 5IGMA 3MULA 5ENGA 4O75A 3SVFA 4LC2A 4NXJA 5LJ1A 2D9EA 4Z1SA 2EJNA 2R0YA 2RO1A 4HBYA 4QR4A 5FE1A 2RNYA 4A9FA 4F3IA 4UYHA 3FKMX 4J1PA 5EA1A 3P1FA 2MJVB 3ERRA 5A5OA 3MXFA 4IR3A 3JVMA 5DKHA 5F36A 5FE8A 3UW9A 5CUBA 3ZYUA 2D82A 5EU1A 5EWWA 5K29A 4QSWA 4HXLA 4QYDA 3HMEA 3P1DA 3G0LA 5E0RA 4Z6HA 3UVWA 3U5PA 5E3DA 4ZC9A 5LKZA 5HRXA 5FB1A 3P1EA 5FH8A 3U5JA 4C67A 4YYJA 4WIVA 5LJ2A 3LQJA 4UIVA 5C87A 4O7AA 3GG3A 3HMHA 4NR5A 5D24A 2L84A 5TCMA 5F61A 4BHWA 5CQ8A 5L99A 4O76A 5EWHA 4YBTA 4J0SA 5E9IA 5EP7A 5I86A 4LZSA 5G4RA 4N4FA 4YY6A 3JVLA 4QB3A 4YC9A 5DW2A 2GRCA 2OO1A 4QSRA 3UV2A 4NR8A 4MENA 5ENEA 4YYDA 2WP1A 5CTLA 4A9NA 1F68A 3SVGA 4A9KA 4YADA 2YQDA 4QC3A 2F6NA 4HXMA 4Q0OA 4IR6A 5CQ3A 5D3PA 4UYFB 5EVAA 5FE9A 4N4HA 4YYMA 4MEQA 2F6JA 5LVRA 4Z93A 5HQ7A 4LYIA 4YK0A 5H1VA 5IGKA 4NR9A 2OSSA 5HRVA 4PCIA 4Z1QA 1EQFA 4UYDA 5DYXA 5EICA 5HFRA 4CFKA 5C85A 5HLSA 5CUAA 4QSPA 4LZ2A 4A9MA 2DVSA 3ONIA 5EGUA 5DW1A 5FFVA 4LR6A 4QR5A 5IIDA 5BT4A 2DATA 4QEUA 5F1LA 5CPEA 4HXOA 4UYGA 2R0VA 3MUKA 5CRMA 4NYWA 2YEMA 4RVRA 4HXPA 5CRZA 4BW4A 5E9MA 5I88A 3U5KA 5FG6A 1JM4B 5BT5A 5I1QA 5DBMA 4YYIA 4CUSA 5CQ7A 5HCLA 3O35A 4YYHA 5CUDA 4CUQA 5FE3A 5H85A 4TT2A 5D3LA 4CLBA 5H1UA 4IR4A 2DVVA 5ETBA 2I8NA 4MR5A 4KV4A 4N3WA 4TZ8A 2FSAA 3AQAA 2R10A 2WP2A 4YH4A 4YYNA 5LUUA 5II2A 3VKHA 4QEVA 4UYFA 4QZSA 5I89A 4ZW1A 5FFYA 4TYLA 5L98A 3UV5A 3AADA 4TT6A 5D3JA 5CUCA 4TT4A 4AKIA 3JVKA 4QEWA 5I29A 5G4SA 5D7XA 5IGLA 4O7BA 5CQ5A 4PKLA
chains in the Genus database with same CATH topology
5FG5A 4AKNA 4KCXA 4LRGA 2DKWA 5ETDA 4E96A 4WHWA 5KTWA 5EWDA 5HENA 4QUUA 5ENBA 4WHUA 4IR5A 3LQHA 5L8TA 5TB6A 5FE2A 4QSVA 5E9YA 5FG4A 5D3NA 5DFDA 5EV9A 5AMFA 2E3KA 5A83A 4A9HA 4A9JA 5E9VA 5F3AA 5IG6A 4QUTA 4Y03A 4CUPA 5EPRA 5A82A 4YAXA 4BJXA 4BW1A 4GPJA 3HMFA 3U5MA 5LVQA 4ZQLA 5DYCA 4IOQA 5I80A 4HBXA 4FLPA 4LYSA 2NXBA 4UIXA 4QYLA 4A9EA 5D0CA 5DLZA 4A9OA 1X0JA 5KTXA 5FDZA 3O33A 5FH6A 1JSPB 1E6IA 4TU6A 5ENHA 5ENCA 2DWWA 4TZ2A 4N4GA 4QSQA 4UIUA 4YYKA 4HXRA 4NR6A 2I7KA 5L8UA 4HBWA 3QZTA 5D3RA 5DLXA 5LJ0A 5BT3A 4C66A 3MQMA 5EPSA 5HELA 5JI8A 4TQNA 5COIA 4N4IA 3UVDA 3DWYA 5D3TA 5CY9A 4XY9A 3MB3A 4ALHA 3LQIA 3UV4A 4J0RA 3Q2EA 5A5QA 1ZS5A 4O7FA 2RFJA 4LZRA 3IU6A 5EM3A 4OGIA 5F5ZA 3MB4A 4TS8A 4CUTA 3TLPA 5L97A 5E74A 4IOOA 2L85A 3S92A 1WUGA 4O70A 5IBNA 5KHMA 3LXJA 5CQ6A 5CGPA 5FE0A 5I7XA 5A85A 5FE4A 5DKDA 5I83A 4QC1A 3U5LA 4MR3A 4UIWA 5J0DA 3P1CA 4UITA 5EWVA 3LJWA 4QY4A 4A9IA 1WUMA 5C8GA 5IGNA 5EK9A 4UIYA 3UVYA 4MR4A 4QSTA 4O74A 4MEOA 5A5SA 3RCWA 5HJCA 5E7DA 5L96A 3QZVA 5HM0A 4NR4A 3K2JA 4CURA 2RS9B 4CFLA 4HXKA 2YEKA 5AD3A 5DKCA 3U5NA 4PCEA 3S91A 4MR6A 4BW2A 5KO4A 3SVHA 4HBVA 4NUCA 4Z6IA 1N72A 3O37A 3UVXA 2RNXA 2RNWA 3O36A 5DX4A 5A5PA 4QBMA 5E3GA 5HQ5A 5CZGA 3O34A 2E7OA 2LSPB 5DFCA 2R0SA 4NUEA 4CL9A 5HEMA 4NS5A 5KU3A 5D3SA 3IU5A 5CUGA 4KV1A 4XYAA 3DAIA 4UYEA 4TTEA 4YBSA 2YYNA 2YELA 4PTBA 2DVRA 5DY7A 4NYVA 5F62A 5F63A 2H60A 3I3JA 2G4AA 4OUFA 4NQNA 4NRCA 4NUDA 5FE6A 5FBXA 4O7CA 5LKXA 5H1TA 3G0JA 5LKTA 3Q2FA 5HFQA 5A7CA 5ENFA 4DONA 4YYGA 5FB0A 4QSSA 4LYWA 5CQAA 3JVJA 2E7NA 2RI7A 4O7EA 5AMEA 4QSUA 5I7YA 4LDFA 2KTBB 2OUOA 5F25A 4NQMA 4NRBA 5KTUA 5A5RA 5I40A 3U5OA 4HXSA 5ENIA 5F1HA 5II1A 5AD2A 4J3IA 4YBMA 5D26A 3D7CA 5EPBA 5HQ6A 2DVQA 4NRAA 4TU4A 5EWCA 5C89A 4PY6A 4O77A 4QR3A 5EI4A 5E9LA 5CU8A 5EISA 4O71A 3P5OA 4CUUA 4XUAA 5ACYA 5CQTA 4HXNA 4QSXA 5ENJA 4BW3A 5A5NA 4UIZA 5DYAA 2YW5A 5CQ4A 4YABA 5FFWA 4NR7A 2YDWA 4NYXA 5CUEA 2N9GA 5CS8A 5D3HA 4YY4A 3NXBA 4A9LA 5E9KA 5EQ1A 5C4QA 4ALGA 5D25A 5CFWA 5F60A 4X2IA 5DFBA 4XY8A 4Q0NA 5C7NA 5LKUA 5FE5A 4MEPA 5A81A 5F2PA 4O78A 3QZSA 4O72A 4XUBA 4IORA 4OGJA 4PS5A 5JWMA 2L5EA 5E73A 4YATA 5DYUA 5HRWA 4YH3A 5FE7A 5FH7A 5CP5A 4QNSA 5IGMA 3MULA 5ENGA 4O75A 3SVFA 4LC2A 4NXJA 5LJ1A 2D9EA 4Z1SA 2R0YA 2RO1A 4HBYA 4QR4A 5FE1A 2RNYA 4A9FA 4F3IA 4UYHA 3FKMX 4J1PA 5EA1A 3P1FA 2MJVB 5A5OA 3MXFA 4IR3A 3JVMA 5DKHA 5F36A 5FE8A 3UW9A 5CUBA 3ZYUA 2D82A 5EU1A 5EWWA 5K29A 4QSWA 4HXLA 4QYDA 3HMEA 3P1DA 3G0LA 5E0RA 4Z6HA 3UVWA 3U5PA 5E3DA 4ZC9A 5LKZA 5HRXA 5FB1A 3P1EA 5FH8A 3U5JA 4C67A 4YYJA 4WIVA 5LJ2A 3LQJA 4UIVA 5C87A 4O7AA 3GG3A 3HMHA 4NR5A 5D24A 2L84A 5TCMA 5F61A 4BHWA 5CQ8A 5L99A 4O76A 5EWHA 4YBTA 4J0SA 5E9IA 5EP7A 5I86A 4LZSA 5G4RA 4N4FA 4YY6A 3JVLA 4QB3A 4YC9A 5DW2A 2GRCA 2OO1A 4QSRA 3UV2A 4NR8A 4MENA 5ENEA 4YYDA 2WP1A 5CTLA 4A9NA 1F68A 3SVGA 4A9KA 4YADA 2YQDA 4QC3A 2F6NA 4HXMA 4Q0OA 4IR6A 5CQ3A 5D3PA 4UYFB 5EVAA 5FE9A 4N4HA 4YYMA 4MEQA 2F6JA 5LVRA 4Z93A 5HQ7A 4LYIA 4YK0A 5H1VA 5IGKA 4NR9A 2OSSA 5HRVA 4PCIA 4Z1QA 1EQFA 4UYDA 5DYXA 5EICA 5HFRA 4CFKA 5C85A 5HLSA 5CUAA 4QSPA 4LZ2A 4A9MA 2DVSA 3ONIA 5EGUA 5DW1A 5FFVA 4LR6A 4QR5A 5IIDA 5BT4A 2DATA 4QEUA 5F1LA 5CPEA 4HXOA 4UYGA 2R0VA 3MUKA 5CRMA 4NYWA 2YEMA 4RVRA 4HXPA 5CRZA 4BW4A 5E9MA 5I88A 3U5KA 5FG6A 1JM4B 5BT5A 5I1QA 5DBMA 4YYIA 4CUSA 5CQ7A 5HCLA 3O35A 4YYHA 5CUDA 4CUQA 5FE3A 5H85A 4TT2A 5D3LA 4CLBA 5H1UA 4IR4A 2DVVA 5ETBA 2I8NA 4MR5A 4KV4A 4N3WA 4TZ8A 2FSAA 3AQAA 2R10A 2WP2A 4YH4A 4YYNA 5LUUA 5II2A 4QEVA 4UYFA 4QZSA 5I89A 4ZW1A 5FFYA 4TYLA 5L98A 3UV5A 3AADA 4TT6A 5D3JA 5CUCA 4TT4A 3JVKA 4QEWA 5I29A 5G4SA 5D7XA 5IGLA 4O7BA 5CQ5A 4PKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG5 A;  4AKN A;  4KCX A;  4LRG A;  2DKW A;  5ETD A;  4E96 A;  4WHW A;  5KTW A;  5EWD A;  5HEN A;  4QUU A;  5ENB A;  4WHU A;  4IR5 A;  3LQH A;  5L8T A;  5TB6 A;  5FE2 A;  4QSV A;  5E9Y A;  5FG4 A;  5D3N A;  5DFD A;  5EV9 A;  5AMF A;  2E3K A;  5A83 A;  4A9H A;  4A9J A;  5E9V A;  5F3A A;  5IG6 A;  4QUT A;  4Y03 A;  4CUP A;  5EPR A;  5A82 A;  4YAX A;  4BJX A;  4BW1 A;  4GPJ A;  3HMF A;  3U5M A;  5LVQ A;  4ZQL A;  5DYC A;  4IOQ A;  5I80 A;  4HBX A;  4FLP A;  4LYS A;  2NXB A;  4UIX A;  4QYL A;  4A9E A;  5D0C A;  5DLZ A;  4A9O A;  1X0J A;  5KTX A;  5FDZ A;  3O33 A;  5FH6 A;  1JSP B;  1E6I A;  4TU6 A;  5ENH A;  5ENC A;  2DWW A;  4TZ2 A;  4N4G A;  4QSQ A;  4UIU A;  4YYK A;  4HXR A;  4NR6 A;  2I7K A;  5L8U A;  4HBW A;  3QZT A;  5D3R A;  5DLX A;  5LJ0 A;  5BT3 A;  4C66 A;  3MQM A;  5EPS A;  5HEL A;  5JI8 A;  4TQN A;  5COI A;  4N4I A;  3UVD A;  3DWY A;  5D3T A;  5CY9 A;  4XY9 A;  3MB3 A;  4ALH A;  3LQI A;  3UV4 A;  4J0R A;  3Q2E A;  5A5Q A;  1ZS5 A;  4O7F A;  2RFJ A;  4LZR A;  3IU6 A;  5EM3 A;  4OGI A;  5F5Z A;  3MB4 A;  4TS8 A;  4CUT A;  3TLP A;  5L97 A;  5E74 A;  4IOO A;  2L85 A;  3S92 A;  1WUG A;  4O70 A;  5IBN A;  5KHM A;  3LXJ A;  5CQ6 A;  5CGP A;  5FE0 A;  5I7X A;  5A85 A;  5FE4 A;  5DKD A;  5I83 A;  4QC1 A;  3U5L A;  4MR3 A;  4UIW A;  5J0D A;  3P1C A;  4UIT A;  5EWV A;  3LJW A;  4QY4 A;  4A9I A;  1WUM A;  5C8G A;  5IGN A;  5EK9 A;  4UIY A;  3UVY A;  4MR4 A;  4QST A;  4O74 A;  4MEO A;  5A5S A;  3RCW A;  5HJC A;  5E7D A;  5L96 A;  3QZV A;  5HM0 A;  4NR4 A;  3K2J A;  4CUR A;  2RS9 B;  4CFL A;  4HXK A;  2YEK A;  5AD3 A;  5DKC A;  3U5N A;  4PCE A;  3S91 A;  4MR6 A;  4BW2 A;  5KO4 A;  3SVH A;  4HBV A;  4NUC A;  4Z6I A;  1N72 A;  3O37 A;  3UVX A;  2RNX A;  2RNW A;  3O36 A;  5DX4 A;  5A5P A;  4QBM A;  5E3G A;  5HQ5 A;  5CZG A;  3O34 A;  2E7O A;  2LSP B;  5DFC A;  2R0S A;  4NUE A;  4CL9 A;  5HEM A;  4NS5 A;  5KU3 A;  5D3S A;  3IU5 A;  5CUG A;  4KV1 A;  4XYA A;  3DAI A;  4UYE A;  4TTE A;  4YBS A;  2YYN A;  2YEL A;  4PTB A;  2DVR A;  5DY7 A;  4NYV A;  5F62 A;  5F63 A;  2H60 A;  3I3J A;  2G4A A;  4OUF A;  4NQN A;  4NRC A;  4NUD A;  5FE6 A;  5FBX A;  4O7C A;  5LKX A;  5H1T A;  3G0J A;  5LKT A;  3Q2F A;  5HFQ A;  5A7C A;  5ENF A;  4DON A;  4YYG A;  5FB0 A;  4QSS A;  4LYW A;  5CQA A;  3JVJ A;  2E7N A;  2RI7 A;  4O7E A;  5AME A;  4QSU A;  5I7Y A;  4LDF A;  2KTB B;  2OUO A;  5F25 A;  4NQM A;  4NRB A;  5KTU A;  5A5R A;  5I40 A;  3U5O A;  4HXS A;  5ENI A;  5F1H A;  5II1 A;  5AD2 A;  4J3I A;  4YBM A;  5D26 A;  3D7C A;  5EPB A;  5HQ6 A;  2DVQ A;  4NRA A;  4TU4 A;  5EWC A;  5C89 A;  4PY6 A;  4O77 A;  4QR3 A;  5EI4 A;  5E9L A;  5CU8 A;  5EIS A;  4O71 A;  3P5O A;  4CUU A;  4XUA A;  5ACY A;  5CQT A;  4HXN A;  4QSX A;  5ENJ A;  4BW3 A;  5A5N A;  4UIZ A;  5DYA A;  2YW5 A;  5CQ4 A;  4YAB A;  5FFW A;  4NR7 A;  2YDW A;  4NYX A;  5CUE A;  2N9G A;  5CS8 A;  5D3H A;  4YY4 A;  3NXB A;  4A9L A;  5E9K A;  5EQ1 A;  5C4Q A;  4ALG A;  5D25 A;  5CFW A;  5F60 A;  4X2I A;  5DFB A;  4XY8 A;  4Q0N A;  5C7N A;  5LKU A;  5FE5 A;  4MEP A;  5A81 A;  5F2P A;  4O78 A;  3QZS A;  4O72 A;  4XUB A;  4IOR A;  4OGJ A;  4PS5 A;  5JWM A;  2L5E A;  5E73 A;  4YAT A;  5DYU A;  5HRW A;  4YH3 A;  5FE7 A;  5FH7 A;  5CP5 A;  4QNS A;  5IGM A;  3MUL A;  5ENG A;  4O75 A;  3SVF A;  4LC2 A;  4NXJ A;  5LJ1 A;  2D9E A;  4Z1S A;  2R0Y A;  2RO1 A;  4HBY A;  4QR4 A;  5FE1 A;  2RNY A;  4A9F A;  4F3I A;  4UYH A;  3FKM X;  4J1P A;  5EA1 A;  3P1F A;  2MJV B;  5A5O A;  3MXF A;  4IR3 A;  3JVM A;  5DKH A;  5F36 A;  5FE8 A;  3UW9 A;  5CUB A;  3ZYU A;  2D82 A;  5EU1 A;  5EWW A;  5K29 A;  4QSW A;  4HXL A;  4QYD A;  3HME A;  3P1D A;  3G0L A;  5E0R A;  4Z6H A;  3UVW A;  3U5P A;  5E3D A;  4ZC9 A;  5LKZ A;  5HRX A;  5FB1 A;  3P1E A;  5FH8 A;  3U5J A;  4C67 A;  4YYJ A;  4WIV A;  5LJ2 A;  3LQJ A;  4UIV A;  5C87 A;  4O7A A;  3GG3 A;  3HMH A;  4NR5 A;  5D24 A;  2L84 A;  5TCM A;  5F61 A;  4BHW A;  5CQ8 A;  5L99 A;  4O76 A;  5EWH A;  4YBT A;  4J0S A;  5E9I A;  5EP7 A;  5I86 A;  4LZS A;  5G4R A;  4N4F A;  4YY6 A;  3JVL A;  4QB3 A;  4YC9 A;  5DW2 A;  2GRC A;  2OO1 A;  4QSR A;  3UV2 A;  4NR8 A;  4MEN A;  5ENE A;  4YYD A;  2WP1 A;  5CTL A;  4A9N A;  1F68 A;  3SVG A;  4A9K A;  4YAD A;  2YQD A;  4QC3 A;  2F6N A;  4HXM A;  4Q0O A;  4IR6 A;  5CQ3 A;  5D3P A;  4UYF B;  5EVA A;  5FE9 A;  4N4H A;  4YYM A;  4MEQ A;  2F6J A;  5LVR A;  4Z93 A;  5HQ7 A;  4LYI A;  4YK0 A;  5H1V A;  5IGK A;  4NR9 A;  2OSS A;  5HRV A;  4PCI A;  4Z1Q A;  1EQF A;  4UYD A;  5DYX A;  5EIC A;  5HFR A;  4CFK A;  5C85 A;  5HLS A;  5CUA A;  4QSP A;  4LZ2 A;  4A9M A;  2DVS A;  3ONI A;  5EGU A;  5DW1 A;  5FFV A;  4LR6 A;  4QR5 A;  5IID A;  5BT4 A;  2DAT A;  4QEU A;  5F1L A;  5CPE A;  4HXO A;  4UYG A;  2R0V A;  3MUK A;  5CRM A;  4NYW A;  2YEM A;  4RVR A;  4HXP A;  5CRZ A;  4BW4 A;  5E9M A;  5I88 A;  3U5K A;  5FG6 A;  1JM4 B;  5BT5 A;  5I1Q A;  5DBM A;  4YYI A;  4CUS A;  5CQ7 A;  5HCL A;  3O35 A;  4YYH A;  5CUD A;  4CUQ A;  5FE3 A;  5H85 A;  4TT2 A;  5D3L A;  4CLB A;  5H1U A;  4IR4 A;  2DVV A;  5ETB A;  2I8N A;  4MR5 A;  4KV4 A;  4N3W A;  4TZ8 A;  2FSA A;  3AQA A;  2R10 A;  2WP2 A;  4YH4 A;  4YYN A;  5LUU A;  5II2 A;  4QEV A;  4UYF A;  4QZS A;  5I89 A;  4ZW1 A;  5FFY A;  4TYL A;  5L98 A;  3UV5 A;  3AAD A;  4TT6 A;  5D3J A;  5CUC A;  4TT4 A;  3JVK A;  4QEW A;  5I29 A;  5G4S A;  5D7X A;  5IGL A;  4O7B A;  5CQ5 A;  4PKL A; 
#chains in the Genus database with same CATH topology
 5FG5 A;  4AKN A;  4KCX A;  4LRG A;  2DKW A;  5ETD A;  4E96 A;  4WHW A;  5KTW A;  5EWD A;  5HEN A;  4QUU A;  5ENB A;  4WHU A;  4IR5 A;  3LQH A;  5L8T A;  5TB6 A;  5FE2 A;  4QSV A;  5E9Y A;  5FG4 A;  5D3N A;  5DFD A;  5EV9 A;  5AMF A;  2E3K A;  5A83 A;  4A9H A;  4A9J A;  5E9V A;  5F3A A;  5IG6 A;  4QUT A;  4Y03 A;  4CUP A;  5EPR A;  5A82 A;  4YAX A;  4BJX A;  4BW1 A;  4GPJ A;  3HMF A;  3U5M A;  5LVQ A;  4ZQL A;  5DYC A;  4IOQ A;  5I80 A;  4HBX A;  4FLP A;  3D1B A;  4LYS A;  2NXB A;  4UIX A;  3VKG A;  4QYL A;  4A9E A;  5D0C A;  5DLZ A;  4A9O A;  1X0J A;  5KTX A;  5FDZ A;  3O33 A;  5FH6 A;  1JSP B;  1E6I A;  4TU6 A;  5ENH A;  5ENC A;  2DWW A;  4TZ2 A;  4N4G A;  4QSQ A;  4UIU A;  4YYK A;  4HXR A;  4NR6 A;  2I7K A;  4AI6 A;  5L8U A;  4HBW A;  3QZT A;  5D3R A;  5DLX A;  5LJ0 A;  5BT3 A;  4C66 A;  3MQM A;  5EPS A;  5HEL A;  5JI8 A;  4TQN A;  5COI A;  4N4I A;  3UVD A;  3DWY A;  5D3T A;  5CY9 A;  4XY9 A;  3MB3 A;  4ALH A;  3LQI A;  3UV4 A;  4J0R A;  3Q2E A;  5A5Q A;  1ZS5 A;  4O7F A;  2RFJ A;  4AKG A;  4LZR A;  3IU6 A;  5EM3 A;  4OGI A;  5F5Z A;  3MB4 A;  4TS8 A;  4CUT A;  3TLP A;  5L97 A;  5E74 A;  4IOO A;  2L85 A;  3S92 A;  1WUG A;  4O70 A;  5IBN A;  5KHM A;  3LXJ A;  5CQ6 A;  5CGP A;  5FE0 A;  5I7X A;  5A85 A;  5FE4 A;  5DKD A;  5I83 A;  4QC1 A;  3U5L A;  4MR3 A;  4UIW A;  5J0D A;  3P1C A;  4UIT A;  5EWV A;  3LJW A;  4QY4 A;  4A9I A;  1WUM A;  5C8G A;  5IGN A;  5EK9 A;  4UIY A;  3UVY A;  4MR4 A;  4QST A;  4O74 A;  4MEO A;  5A5S A;  3RCW A;  5HJC A;  5E7D A;  5L96 A;  3QZV A;  5HM0 A;  4NR4 A;  3K2J A;  4CUR A;  2RS9 B;  4CFL A;  4HXK A;  2YEK A;  5AD3 A;  5DKC A;  3U5N A;  4PCE A;  3S91 A;  4MR6 A;  4BW2 A;  5KO4 A;  3SVH A;  4HBV A;  4NUC A;  4Z6I A;  1N72 A;  3O37 A;  3UVX A;  2RNX A;  2RNW A;  3O36 A;  5DX4 A;  5A5P A;  4QBM A;  5E3G A;  5HQ5 A;  5CZG A;  3O34 A;  2E7O A;  2LSP B;  5DFC A;  2R0S A;  4NUE A;  4CL9 A;  5HEM A;  4NS5 A;  5KU3 A;  5D3S A;  3IU5 A;  5CUG A;  3D1D A;  4KV1 A;  4XYA A;  3DAI A;  4UYE A;  4TTE A;  4YBS A;  2YYN A;  2YEL A;  4PTB A;  2DVR A;  5DY7 A;  4NYV A;  5F62 A;  5F63 A;  2H60 A;  3I3J A;  2G4A A;  4OUF A;  4NQN A;  4NRC A;  4NUD A;  5FE6 A;  5FBX A;  4O7C A;  5LKX A;  5H1T A;  3G0J A;  5LKT A;  3Q2F A;  5HFQ A;  5A7C A;  5ENF A;  4DON A;  4YYG A;  5FB0 A;  4QSS A;  4LYW A;  5CQA A;  3JVJ A;  2E7N A;  2RI7 A;  4O7E A;  5AME A;  4QSU A;  5I7Y A;  4LDF A;  2KTB B;  2OUO A;  5F25 A;  4NQM A;  4NRB A;  5KTU A;  5A5R A;  5I40 A;  3U5O A;  4HXS A;  5ENI A;  5F1H A;  5II1 A;  5AD2 A;  4J3I A;  4YBM A;  5D26 A;  3D7C A;  5EPB A;  5HQ6 A;  2DVQ A;  4NRA A;  4TU4 A;  5EWC A;  5C89 A;  4PY6 A;  4O77 A;  1PUO A;  4QR3 A;  5EI4 A;  5E9L A;  5CU8 A;  5EIS A;  4O71 A;  3P5O A;  4CUU A;  4XUA A;  5ACY A;  5CQT A;  4HXN A;  4QSX A;  4AKH A;  5ENJ A;  4BW3 A;  5A5N A;  4UIZ A;  5DYA A;  2YW5 A;  5CQ4 A;  4YAB A;  5FFW A;  4NR7 A;  2YDW A;  4NYX A;  5CUE A;  2N9G A;  5CS8 A;  5D3H A;  4YY4 A;  3NXB A;  4A9L A;  5E9K A;  5EQ1 A;  5C4Q A;  4ALG A;  5D25 A;  5CFW A;  5F60 A;  4X2I A;  5DFB A;  4XY8 A;  4Q0N A;  5C7N A;  5LKU A;  5FE5 A;  4MEP A;  5A81 A;  5F2P A;  4O78 A;  3QZS A;  4O72 A;  4XUB A;  4IOR A;  4OGJ A;  1ZKR A;  4PS5 A;  2L5E A;  5JWM A;  5E73 A;  4YAT A;  5DYU A;  5HRW A;  4YH3 A;  5FE7 A;  5FH7 A;  5CP5 A;  4QNS A;  5IGM A;  3MUL A;  5ENG A;  4O75 A;  3SVF A;  4LC2 A;  4NXJ A;  5LJ1 A;  2D9E A;  4Z1S A;  2EJN A;  2R0Y A;  2RO1 A;  4HBY A;  4QR4 A;  5FE1 A;  2RNY A;  4A9F A;  4F3I A;  4UYH A;  3FKM X;  4J1P A;  5EA1 A;  3P1F A;  2MJV B;  3ERR A;  5A5O A;  3MXF A;  4IR3 A;  3JVM A;  5DKH A;  5F36 A;  5FE8 A;  3UW9 A;  5CUB A;  3ZYU A;  2D82 A;  5EU1 A;  5EWW A;  5K29 A;  4QSW A;  4HXL A;  4QYD A;  3HME A;  3P1D A;  3G0L A;  5E0R A;  4Z6H A;  3UVW A;  3U5P A;  5E3D A;  4ZC9 A;  5LKZ A;  5HRX A;  5FB1 A;  3P1E A;  5FH8 A;  3U5J A;  4C67 A;  4YYJ A;  4WIV A;  5LJ2 A;  3LQJ A;  4UIV A;  5C87 A;  4O7A A;  3GG3 A;  3HMH A;  4NR5 A;  5D24 A;  2L84 A;  5TCM A;  5F61 A;  4BHW A;  5CQ8 A;  5L99 A;  4O76 A;  5EWH A;  4YBT A;  4J0S A;  5E9I A;  5EP7 A;  5I86 A;  4LZS A;  5G4R A;  4N4F A;  4YY6 A;  3JVL A;  4QB3 A;  4YC9 A;  5DW2 A;  2GRC A;  2OO1 A;  4QSR A;  3UV2 A;  4NR8 A;  4MEN A;  5ENE A;  4YYD A;  2WP1 A;  5CTL A;  4A9N A;  1F68 A;  3SVG A;  4A9K A;  4YAD A;  2YQD A;  4QC3 A;  2F6N A;  4HXM A;  4Q0O A;  4IR6 A;  5CQ3 A;  5D3P A;  4UYF B;  5EVA A;  5FE9 A;  4N4H A;  4YYM A;  4MEQ A;  2F6J A;  5LVR A;  4Z93 A;  5HQ7 A;  4LYI A;  4YK0 A;  5H1V A;  5IGK A;  4NR9 A;  2OSS A;  5HRV A;  4PCI A;  4Z1Q A;  1EQF A;  4UYD A;  5DYX A;  5EIC A;  5HFR A;  4CFK A;  5C85 A;  5HLS A;  5CUA A;  4QSP A;  4LZ2 A;  4A9M A;  2DVS A;  3ONI A;  5EGU A;  5DW1 A;  5FFV A;  4LR6 A;  4QR5 A;  5IID A;  5BT4 A;  2DAT A;  4QEU A;  5F1L A;  5CPE A;  4HXO A;  4UYG A;  2R0V A;  3MUK A;  5CRM A;  4NYW A;  2YEM A;  4RVR A;  4HXP A;  5CRZ A;  4BW4 A;  5E9M A;  5I88 A;  3U5K A;  5FG6 A;  1JM4 B;  5BT5 A;  5I1Q A;  5DBM A;  4YYI A;  4CUS A;  5CQ7 A;  5HCL A;  3O35 A;  4YYH A;  5CUD A;  4CUQ A;  5FE3 A;  5H85 A;  4TT2 A;  5D3L A;  4CLB A;  5H1U A;  4IR4 A;  2DVV A;  5ETB A;  2I8N A;  4MR5 A;  4KV4 A;  4N3W A;  4TZ8 A;  2FSA A;  3AQA A;  2R10 A;  2WP2 A;  4YH4 A;  4YYN A;  5LUU A;  5II2 A;  3VKH A;  4QEV A;  4UYF A;  4QZS A;  5I89 A;  4ZW1 A;  5FFY A;  4TYL A;  5L98 A;  3UV5 A;  3AAD A;  4TT6 A;  5D3J A;  5CUC A;  4TT4 A;  4AKI A;  3JVK A;  4QEW A;  5I29 A;  5G4S A;  5D7X A;  5IGL A;  4O7B A;  5CQ5 A;  4PKL A; 
#chains in the Genus database with same CATH homology
 5FG5 A;  4AKN A;  4KCX A;  4LRG A;  2DKW A;  5ETD A;  4E96 A;  4WHW A;  5KTW A;  5EWD A;  5HEN A;  4QUU A;  5ENB A;  4WHU A;  4IR5 A;  3LQH A;  5L8T A;  5TB6 A;  5FE2 A;  4QSV A;  5E9Y A;  5FG4 A;  5D3N A;  5DFD A;  5EV9 A;  5AMF A;  2E3K A;  5A83 A;  4A9H A;  4A9J A;  5E9V A;  5F3A A;  5IG6 A;  4QUT A;  4Y03 A;  4CUP A;  5EPR A;  5A82 A;  4YAX A;  4BJX A;  4BW1 A;  4GPJ A;  3HMF A;  3U5M A;  5LVQ A;  4ZQL A;  5DYC A;  4IOQ A;  5I80 A;  4HBX A;  4FLP A;  4LYS A;  2NXB A;  4UIX A;  4QYL A;  4A9E A;  5D0C A;  5DLZ A;  4A9O A;  1X0J A;  5KTX A;  5FDZ A;  3O33 A;  5FH6 A;  1JSP B;  1E6I A;  4TU6 A;  5ENH A;  5ENC A;  2DWW A;  4TZ2 A;  4N4G A;  4QSQ A;  4UIU A;  4YYK A;  4HXR A;  4NR6 A;  2I7K A;  5L8U A;  4HBW A;  3QZT A;  5D3R A;  5DLX A;  5LJ0 A;  5BT3 A;  4C66 A;  3MQM A;  5EPS A;  5HEL A;  5JI8 A;  4TQN A;  5COI A;  4N4I A;  3UVD A;  3DWY A;  5D3T A;  5CY9 A;  4XY9 A;  3MB3 A;  4ALH A;  3LQI A;  3UV4 A;  4J0R A;  3Q2E A;  5A5Q A;  1ZS5 A;  4O7F A;  2RFJ A;  4LZR A;  3IU6 A;  5EM3 A;  4OGI A;  5F5Z A;  3MB4 A;  4TS8 A;  4CUT A;  3TLP A;  5L97 A;  5E74 A;  4IOO A;  2L85 A;  3S92 A;  1WUG A;  4O70 A;  5IBN A;  5KHM A;  3LXJ A;  5CQ6 A;  5CGP A;  5FE0 A;  5I7X A;  5A85 A;  5FE4 A;  5DKD A;  5I83 A;  4QC1 A;  3U5L A;  4MR3 A;  4UIW A;  5J0D A;  3P1C A;  4UIT A;  5EWV A;  3LJW A;  4QY4 A;  4A9I A;  1WUM A;  5C8G A;  5IGN A;  5EK9 A;  4UIY A;  3UVY A;  4MR4 A;  4QST A;  4O74 A;  4MEO A;  5A5S A;  3RCW A;  5HJC A;  5E7D A;  5L96 A;  3QZV A;  5HM0 A;  4NR4 A;  3K2J A;  4CUR A;  2RS9 B;  4CFL A;  4HXK A;  2YEK A;  5AD3 A;  5DKC A;  3U5N A;  4PCE A;  3S91 A;  4MR6 A;  4BW2 A;  5KO4 A;  3SVH A;  4HBV A;  4NUC A;  4Z6I A;  1N72 A;  3O37 A;  3UVX A;  2RNX A;  2RNW A;  3O36 A;  5DX4 A;  5A5P A;  4QBM A;  5E3G A;  5HQ5 A;  5CZG A;  3O34 A;  2E7O A;  2LSP B;  5DFC A;  2R0S A;  4NUE A;  4CL9 A;  5HEM A;  4NS5 A;  5KU3 A;  5D3S A;  3IU5 A;  5CUG A;  4KV1 A;  4XYA A;  3DAI A;  4UYE A;  4TTE A;  4YBS A;  2YYN A;  2YEL A;  4PTB A;  2DVR A;  5DY7 A;  4NYV A;  5F62 A;  5F63 A;  2H60 A;  3I3J A;  2G4A A;  4OUF A;  4NQN A;  4NRC A;  4NUD A;  5FE6 A;  5FBX A;  4O7C A;  5LKX A;  5H1T A;  3G0J A;  5LKT A;  3Q2F A;  5HFQ A;  5A7C A;  5ENF A;  4DON A;  4YYG A;  5FB0 A;  4QSS A;  4LYW A;  5CQA A;  3JVJ A;  2E7N A;  2RI7 A;  4O7E A;  5AME A;  4QSU A;  5I7Y A;  4LDF A;  2KTB B;  2OUO A;  5F25 A;  4NQM A;  4NRB A;  5KTU A;  5A5R A;  5I40 A;  3U5O A;  4HXS A;  5ENI A;  5F1H A;  5II1 A;  5AD2 A;  4J3I A;  4YBM A;  5D26 A;  3D7C A;  5EPB A;  5HQ6 A;  2DVQ A;  4NRA A;  4TU4 A;  5EWC A;  5C89 A;  4PY6 A;  4O77 A;  4QR3 A;  5EI4 A;  5E9L A;  5CU8 A;  5EIS A;  4O71 A;  3P5O A;  4CUU A;  4XUA A;  5ACY A;  5CQT A;  4HXN A;  4QSX A;  5ENJ A;  4BW3 A;  5A5N A;  4UIZ A;  5DYA A;  2YW5 A;  5CQ4 A;  4YAB A;  5FFW A;  4NR7 A;  2YDW A;  4NYX A;  5CUE A;  2N9G A;  5CS8 A;  5D3H A;  4YY4 A;  3NXB A;  4A9L A;  5E9K A;  5EQ1 A;  5C4Q A;  4ALG A;  5D25 A;  5CFW A;  5F60 A;  4X2I A;  5DFB A;  4XY8 A;  4Q0N A;  5C7N A;  5LKU A;  5FE5 A;  4MEP A;  5A81 A;  5F2P A;  4O78 A;  3QZS A;  4O72 A;  4XUB A;  4IOR A;  4OGJ A;  4PS5 A;  5JWM A;  2L5E A;  5E73 A;  4YAT A;  5DYU A;  5HRW A;  4YH3 A;  5FE7 A;  5FH7 A;  5CP5 A;  4QNS A;  5IGM A;  3MUL A;  5ENG A;  4O75 A;  3SVF A;  4LC2 A;  4NXJ A;  5LJ1 A;  2D9E A;  4Z1S A;  2R0Y A;  2RO1 A;  4HBY A;  4QR4 A;  5FE1 A;  2RNY A;  4A9F A;  4F3I A;  4UYH A;  3FKM X;  4J1P A;  5EA1 A;  3P1F A;  2MJV B;  5A5O A;  3MXF A;  4IR3 A;  3JVM A;  5DKH A;  5F36 A;  5FE8 A;  3UW9 A;  5CUB A;  3ZYU A;  2D82 A;  5EU1 A;  5EWW A;  5K29 A;  4QSW A;  4HXL A;  4QYD A;  3HME A;  3P1D A;  3G0L A;  5E0R A;  4Z6H A;  3UVW A;  3U5P A;  5E3D A;  4ZC9 A;  5LKZ A;  5HRX A;  5FB1 A;  3P1E A;  5FH8 A;  3U5J A;  4C67 A;  4YYJ A;  4WIV A;  5LJ2 A;  3LQJ A;  4UIV A;  5C87 A;  4O7A A;  3GG3 A;  3HMH A;  4NR5 A;  5D24 A;  2L84 A;  5TCM A;  5F61 A;  4BHW A;  5CQ8 A;  5L99 A;  4O76 A;  5EWH A;  4YBT A;  4J0S A;  5E9I A;  5EP7 A;  5I86 A;  4LZS A;  5G4R A;  4N4F A;  4YY6 A;  3JVL A;  4QB3 A;  4YC9 A;  5DW2 A;  2GRC A;  2OO1 A;  4QSR A;  3UV2 A;  4NR8 A;  4MEN A;  5ENE A;  4YYD A;  2WP1 A;  5CTL A;  4A9N A;  1F68 A;  3SVG A;  4A9K A;  4YAD A;  2YQD A;  4QC3 A;  2F6N A;  4HXM A;  4Q0O A;  4IR6 A;  5CQ3 A;  5D3P A;  4UYF B;  5EVA A;  5FE9 A;  4N4H A;  4YYM A;  4MEQ A;  2F6J A;  5LVR A;  4Z93 A;  5HQ7 A;  4LYI A;  4YK0 A;  5H1V A;  5IGK A;  4NR9 A;  2OSS A;  5HRV A;  4PCI A;  4Z1Q A;  1EQF A;  4UYD A;  5DYX A;  5EIC A;  5HFR A;  4CFK A;  5C85 A;  5HLS A;  5CUA A;  4QSP A;  4LZ2 A;  4A9M A;  2DVS A;  3ONI A;  5EGU A;  5DW1 A;  5FFV A;  4LR6 A;  4QR5 A;  5IID A;  5BT4 A;  2DAT A;  4QEU A;  5F1L A;  5CPE A;  4HXO A;  4UYG A;  2R0V A;  3MUK A;  5CRM A;  4NYW A;  2YEM A;  4RVR A;  4HXP A;  5CRZ A;  4BW4 A;  5E9M A;  5I88 A;  3U5K A;  5FG6 A;  1JM4 B;  5BT5 A;  5I1Q A;  5DBM A;  4YYI A;  4CUS A;  5CQ7 A;  5HCL A;  3O35 A;  4YYH A;  5CUD A;  4CUQ A;  5FE3 A;  5H85 A;  4TT2 A;  5D3L A;  4CLB A;  5H1U A;  4IR4 A;  2DVV A;  5ETB A;  2I8N A;  4MR5 A;  4KV4 A;  4N3W A;  4TZ8 A;  2FSA A;  3AQA A;  2R10 A;  2WP2 A;  4YH4 A;  4YYN A;  5LUU A;  5II2 A;  4QEV A;  4UYF A;  4QZS A;  5I89 A;  4ZW1 A;  5FFY A;  4TYL A;  5L98 A;  3UV5 A;  3AAD A;  4TT6 A;  5D3J A;  5CUC A;  4TT4 A;  3JVK A;  4QEW A;  5I29 A;  5G4S A;  5D7X A;  5IGL A;  4O7B A;  5CQ5 A;  4PKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...