5FE8A

Crystal structure of human pcaf bromodomain in complex with compound sl1126 (compound 12)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe8A00
3Q2FA 5A5PA 4QSSA 5AMFA 4NUCA 5EWCA 4QC3A 4Z6IA 5E0RA 4HXOA 4QR5A 4TYLA 5DFCA 2F6NA 3U5KA 5I86A 4MEOA 4BJXA 5I88A 4YH4A 4NR8A 5L98A 4CL9A 4Q0OA 5AD2A 4A9HA 4YBTA 5I83A 4O74A 4FLPA 5FFWA 2NXBA 3UV2A 5FE1A 3O33A 5A85A 5A5QA 3O35A 4LR6A 5D3JA 4NR4A 4QBMA 5CZGA 5CY9A 5F25A 4YY4A 2YW5A 4NYXA 5D3PA 4ALHA 5CQTA 2OSSA 3UVDA 5CQ4A 5DYUA 3QZTA 5TCMA 5HQ7A 4HXRA 1WUMA 4TU4A 4E96A 5DBMA 4YAXA 5D26A 4J0SA 5F61A 2WP2A 3DAIA 2GRCA 4F3IA 3MQMA 4MR3A 5C85A 3LQHA 3P1FA 3JVLA 4J1PA 5EI4A 4O7CA 5FB0A 4O75A 5D7XA 5H1UA 3NXBA 5E3DA 5HJCA 5BT3A 2RS9B 5CP5A 5F1LA 4O7AA 4C66A 5ENIA 5DW2A 4OUFA 5TB6A 4YYKA 3P1EA 4YYHA 4N4FA 4UIVA 5E9VA 4QNSA 4PCIA 4A9LA 2MJVB 4QR4A 5D3HA 5L8UA 5FE4A 4HXSA 4QC1A 2RO1A 3S92A 4KCXA 5KTWA 2DVVA 5FFYA 5LJ0A 5CRZA 5EWWA 5EP7A 2N9GA 4Z93A 4UITA 4CURA 4PS5A 4QEVA 5H1VA 5EA1A 4N4HA 4N3WA 4NRAA 4QYLA 4QR3A 2DVRA 4NQNA 5BT4A 5IIDA 5HEMA 5DX4A 4NXJA 4XUBA 3U5MA 4XUAA 3HMEA 4QY4A 5E9LA 3UVYA 5DKCA 5DYAA 2YEKA 4Q0NA 5E9YA 5DYCA 4O76A 4QSXA 3G0LA 2OO1A 4UYEA 5F63A 3U5NA 2L5EA 5EGUA 5IGLA 4HXPA 5LJ2A 2G4AA 5DY7A 5C89A 4WHUA 5C8GA 4MENA 4HXMA 5CUCA 4MEPA 4HXKA 4BHWA 5LKXA 4UYDA 5FE3A 5FE9A 2WP1A 4YY6A 4HBVA 3SVFA 4IORA 4HBYA 4IR3A 4YK0A 5C4QA 4IR6A 2RFJA 4QZSA 5L96A 4LZSA 4CUSA 4CUQA 5J0DA 4X2IA 4YBMA 4QUUA 4UYFA 5DFDA 4Z1QA 5HCLA 1WUGA 5I29A 4QB3A 5FH6A 5ENCA 4O7FA 5EWVA 5IGNA 3O34A 4Y03A 5FH8A 1F68A 5CUDA 3SVGA 3P1DA 5F2PA 2LSPB 2YDWA 5LVQA 3QZSA 4UIYA 3U5PA 4NR7A 3DWYA 5CUBA 2RNYA 5DLZA 5I7YA 1EQFA 5HRXA 4QSRA 5II1A 4IOQA 5HFRA 3FKMX 3I3JA 3U5OA 1X0JA 4N4IA 5D3NA 4ZW1A 4YYGA 4HBXA 4A9MA 3LQJA 4C67A 4YABA 5CU8A 5FG5A 4NQMA 4YH3A 5D3SA 5I89A 4DONA 5HLSA 5LKTA 3UW9A 2R0SA 4OGJA 5ETBA 5KTUA 4TZ2A 4CLBA 5L8TA 4QSPA 5CFWA 5A5RA 4YYIA 3TLPA 4LYIA 5EM3A 4J3IA 5DKHA 5FBXA 2DATA 4O70A 5A81A 4O78A 3MB3A 4CUPA 3MB4A 3UVXA 4ZC9A 5D25A 4LZ2A 4BW3A 4Z6HA 3MXFA 4CUUA 4AKNA 5I7XA 4BW4A 3P1CA 5FE0A 4UYHA 2DVQA 3U5LA 4A9OA 2L84A 4LRGA 5F1HA 4Z1SA 5FH7A 2RNWA 4O71A 3JVMA 3G0JA 4TT4A 5CGPA 5ENJA 5FE6A 5DFBA 5CUAA 4NUEA 5ENFA 2R0YA 3AQAA 1JM4B 4UIWA 4KV4A 4TQNA 5EISA 4YATA 5F3AA 4HBWA 4YYMA 2YELA 4QYDA 4IR4A 5CS8A 5HRVA 5FG6A 5E7DA 3MUKA 3GG3A 5D3LA 2RNXA 2YEMA 4TT2A 5A7CA 2KTBB 3UVWA 4QSVA 5F62A 3AADA 4NR9A 5EWDA 4A9FA 4YYDA 4QEUA 5LKUA 4QSWA 4N4GA 5CQAA 3LJWA 4A9KA 5LJ1A 5E3GA 5A5SA 2D9EA 5EPRA 5ACYA 4GPJA 5I1QA 5DW1A 1E6IA 5HRWA 5D24A 5I40A 4HXNA 4YYJA 3D7CA 3ZYUA 5D0CA 4XYAA 5DLXA 5FFVA 3HMFA 3S91A 5ENBA 5FE7A 5I80A 2YQDA 5EWHA 4QUTA 3LQIA 4J0RA 4LDFA 4TU6A 4CFKA 5LVRA 3O36A 4NR5A 5H85A 4MR5A 4PCEA 4MR6A 4TTEA 3LXJA 3HMHA 3UV5A 4A9IA 2E3KA 5G4SA 5A82A 4RVRA 4XY9A 3O37A 5ETDA 5IBNA 5CUGA 5L97A 5II2A 2H60A 5CRMA 5E9MA 4YC9A 4UIUA 4BW1A 3JVKA 4HXLA 2I8NA 2OUOA 2DWWA 2RI7A 4TS8A 5H1TA 4QEWA 4QSQA 5CQ7A 4QSTA 5F5ZA 4O7EA 5G4RA 5COIA 2DKWA 4CUTA 4TT6A 3Q2EA 5HQ6A 2FSAA 3ONIA 3U5JA 5FE8A 3SVHA 2DVSA 5HELA 4IR5A 5FG4A 4NRBA 5CQ8A 5HM0A 2L85A 2E7NA 4PY6A 3IU5A 5C87A 5KHMA 4A9JA 4KV1A 5A5NA 5LUUA 5A83A 3RCWA 4NYVA 4YBSA 5CTLA 5IGMA 4O7BA 4UIZA 4NR6A 5L99A 4NRCA 5FE2A 4QSUA 4UIXA 4WIVA 3IU6A 4NUDA 5D3RA 5IGKA 4ZQLA 5F36A 5CQ3A 5D3TA 5KTXA 4TZ8A 5ENGA 4UYGA 2R0VA 3MULA 5JI8A 5BT5A 3QZVA 5CUEA 5LKZA 4MR4A 5IG6A 5ENHA 5EU1A 2F6JA 2YYNA 5DKDA 5E73A 4YYNA 1N72A 4O72A 5HFQA 5EV9A 4LC2A 5EK9A 4XY8A 4UYFB 4NS5A 5FB1A 5EQ1A 3JVJA 5A5OA 5F60A 5HQ5A 5KO4A 4PTBA 5E9IA 2E7OA 3UV4A 5HENA 5FDZA 4O77A 4IOOA 5CQ5A 5AMEA 2D82A 5EPBA 4LZRA 5FE5A 4LYSA 4MEQA 4LYWA 4OGIA 4A9NA 2R10A 5EVAA 4BW2A 5K29A 5DYXA 4ALGA 5KU3A 5E9KA 5E74A 4A9EA 3K2JA 4NYWA 5EICA 5ENEA 5AD3A 5JWMA 4YADA 4PKLA 4CFLA 1ZS5A 1JSPB 5CPEA 3P5OA 5CQ6A 2I7KA 4WHWA 5C7NA 5EPSA
chains in the Genus database with same CATH superfamily
3Q2FA 5A5PA 4QSSA 5AMFA 4NUCA 5EWCA 4QC3A 4Z6IA 5E0RA 4HXOA 4QR5A 4TYLA 5DFCA 2F6NA 3U5KA 5I86A 4MEOA 4BJXA 5I88A 4YH4A 4NR8A 5L98A 4CL9A 4Q0OA 5AD2A 4A9HA 4YBTA 5I83A 4O74A 4FLPA 5FFWA 2NXBA 4AKHA 3UV2A 5FE1A 3O33A 5A85A 5A5QA 3O35A 4LR6A 5D3JA 4NR4A 4QBMA 5CZGA 5CY9A 5F25A 4YY4A 2YW5A 4NYXA 5D3PA 4ALHA 5CQTA 2OSSA 3UVDA 5CQ4A 5DYUA 3QZTA 5TCMA 5HQ7A 4HXRA 1WUMA 4TU4A 4E96A 5DBMA 4YAXA 5D26A 4J0SA 5F61A 2WP2A 3DAIA 2GRCA 4F3IA 3MQMA 4MR3A 5C85A 3LQHA 3P1FA 3JVLA 4J1PA 5EI4A 4O7CA 5FB0A 4O75A 5D7XA 5H1UA 3NXBA 5E3DA 5HJCA 5BT3A 2RS9B 5CP5A 5F1LA 4O7AA 4C66A 5ENIA 5DW2A 4OUFA 5TB6A 4YYKA 3P1EA 1PUOA 4YYHA 4N4FA 4UIVA 5E9VA 4QNSA 1ZKRA 4PCIA 4A9LA 2MJVB 4QR4A 5D3HA 5L8UA 5FE4A 4HXSA 4QC1A 2RO1A 3S92A 4KCXA 5KTWA 2DVVA 5FFYA 5LJ0A 5CRZA 5EWWA 5EP7A 2N9GA 4Z93A 4UITA 4CURA 4PS5A 4QEVA 5H1VA 5EA1A 4N4HA 4N3WA 4NRAA 4QYLA 4QR3A 2DVRA 4NQNA 5BT4A 5IIDA 5HEMA 5DX4A 4NXJA 4XUBA 3U5MA 4XUAA 2EJNA 3HMEA 4QY4A 5E9LA 3UVYA 5DKCA 5DYAA 2YEKA 4Q0NA 5E9YA 5DYCA 4O76A 4QSXA 3G0LA 2OO1A 4UYEA 5F63A 3U5NA 2L5EA 5EGUA 5IGLA 4HXPA 5LJ2A 2G4AA 5DY7A 5C89A 4WHUA 5C8GA 4MENA 4HXMA 5CUCA 4MEPA 4HXKA 4BHWA 5LKXA 4UYDA 5FE3A 5FE9A 2WP1A 4YY6A 4HBVA 3SVFA 4IORA 4HBYA 4IR3A 4YK0A 5C4QA 4IR6A 2RFJA 4QZSA 5L96A 4LZSA 4CUSA 4CUQA 5J0DA 4X2IA 4YBMA 4QUUA 4UYFA 5DFDA 4Z1QA 5HCLA 1WUGA 5I29A 4QB3A 5FH6A 5ENCA 4O7FA 5EWVA 5IGNA 3O34A 4Y03A 5FH8A 1F68A 5CUDA 4AI6A 3SVGA 4AKGA 3P1DA 5F2PA 2LSPB 2YDWA 5LVQA 3QZSA 4UIYA 3U5PA 4NR7A 3DWYA 5CUBA 2RNYA 5DLZA 5I7YA 1EQFA 5HRXA 4QSRA 5II1A 4IOQA 5HFRA 3FKMX 3I3JA 3U5OA 1X0JA 4N4IA 5D3NA 4ZW1A 4YYGA 4HBXA 4A9MA 3LQJA 4C67A 4YABA 5CU8A 5FG5A 4NQMA 4YH3A 5D3SA 5I89A 4DONA 5HLSA 5LKTA 3UW9A 2R0SA 4OGJA 5ETBA 5KTUA 4TZ2A 4CLBA 5L8TA 4QSPA 5CFWA 5A5RA 4YYIA 4AKIA 3TLPA 4LYIA 5EM3A 4J3IA 5DKHA 5FBXA 2DATA 4O70A 5A81A 4O78A 3MB3A 4CUPA 3MB4A 3UVXA 4ZC9A 5D25A 4LZ2A 4BW3A 4Z6HA 3MXFA 4CUUA 4AKNA 5I7XA 4BW4A 3P1CA 5FE0A 4UYHA 2DVQA 3U5LA 4A9OA 2L84A 4LRGA 5F1HA 4Z1SA 5FH7A 2RNWA 4O71A 3JVMA 3G0JA 4TT4A 5CGPA 5ENJA 5FE6A 5DFBA 5CUAA 4NUEA 5ENFA 2R0YA 3AQAA 1JM4B 4UIWA 4KV4A 4TQNA 5EISA 4YATA 5F3AA 4HBWA 4YYMA 2YELA 4QYDA 4IR4A 5CS8A 5HRVA 5FG6A 5E7DA 3MUKA 3GG3A 5D3LA 2RNXA 2YEMA 4TT2A 5A7CA 2KTBB 3UVWA 4QSVA 5F62A 3AADA 3VKHA 4NR9A 5EWDA 4A9FA 4YYDA 4QEUA 5LKUA 4QSWA 4N4GA 5CQAA 3LJWA 4A9KA 5LJ1A 5E3GA 5A5SA 2D9EA 5EPRA 5ACYA 4GPJA 5I1QA 5DW1A 1E6IA 5HRWA 5D24A 5I40A 4HXNA 4YYJA 3D7CA 3ZYUA 5D0CA 4XYAA 5DLXA 5FFVA 3HMFA 3S91A 5ENBA 5FE7A 5I80A 2YQDA 5EWHA 4QUTA 3LQIA 4J0RA 4LDFA 4TU6A 4CFKA 5LVRA 3O36A 4NR5A 5H85A 4MR5A 4PCEA 4MR6A 4TTEA 3LXJA 3HMHA 3UV5A 4A9IA 2E3KA 5G4SA 5A82A 4RVRA 4XY9A 3O37A 5ETDA 5IBNA 5CUGA 5L97A 5II2A 2H60A 5CRMA 5E9MA 4YC9A 4UIUA 4BW1A 3JVKA 4HXLA 2I8NA 2OUOA 2DWWA 2RI7A 4TS8A 5H1TA 4QEWA 4QSQA 5CQ7A 4QSTA 5F5ZA 4O7EA 5G4RA 5COIA 2DKWA 4CUTA 4TT6A 3Q2EA 5HQ6A 2FSAA 3ONIA 3U5JA 5FE8A 3SVHA 2DVSA 5HELA 4IR5A 5FG4A 4NRBA 5CQ8A 5HM0A 2L85A 2E7NA 4PY6A 3IU5A 5C87A 5KHMA 4A9JA 4KV1A 5A5NA 5LUUA 5A83A 3RCWA 4NYVA 4YBSA 5CTLA 5IGMA 4O7BA 4UIZA 4NR6A 3D1BA 5L99A 4NRCA 5FE2A 4QSUA 4UIXA 4WIVA 3IU6A 4NUDA 5D3RA 5IGKA 4ZQLA 5F36A 5CQ3A 5D3TA 5KTXA 4TZ8A 5ENGA 4UYGA 2R0VA 3MULA 5JI8A 5BT5A 3QZVA 5CUEA 5LKZA 4MR4A 5IG6A 5ENHA 5EU1A 2F6JA 2YYNA 5DKDA 5E73A 4YYNA 1N72A 4O72A 5HFQA 5EV9A 4LC2A 5EK9A 4XY8A 3VKGA 3D1DA 4UYFB 4NS5A 5FB1A 5EQ1A 3JVJA 5A5OA 5F60A 5HQ5A 5KO4A 4PTBA 5E9IA 2E7OA 3UV4A 5HENA 5FDZA 4O77A 4IOOA 5CQ5A 5AMEA 2D82A 5EPBA 4LZRA 5FE5A 4LYSA 4MEQA 4LYWA 4OGIA 4A9NA 2R10A 5EVAA 4BW2A 5K29A 5DYXA 4ALGA 5KU3A 5E9KA 5E74A 4A9EA 3K2JA 4NYWA 3ERRA 5EICA 5ENEA 5AD3A 5JWMA 4YADA 4PKLA 4CFLA 1ZS5A 1JSPB 5CPEA 3P5OA 5CQ6A 2I7KA 4WHWA 5C7NA 5EPSA
chains in the Genus database with same CATH topology
3Q2FA 5A5PA 4QSSA 5AMFA 4NUCA 5EWCA 4QC3A 4Z6IA 5E0RA 4HXOA 4QR5A 4TYLA 5DFCA 2F6NA 3U5KA 5I86A 4MEOA 4BJXA 5I88A 4YH4A 4NR8A 5L98A 4CL9A 4Q0OA 5AD2A 4A9HA 4YBTA 5I83A 4O74A 4FLPA 5FFWA 2NXBA 3UV2A 5FE1A 3O33A 5A85A 5A5QA 3O35A 4LR6A 5D3JA 4NR4A 4QBMA 5CZGA 5CY9A 5F25A 4YY4A 2YW5A 4NYXA 5D3PA 4ALHA 5CQTA 2OSSA 3UVDA 5CQ4A 5DYUA 3QZTA 5TCMA 5HQ7A 4HXRA 1WUMA 4TU4A 4E96A 5DBMA 4YAXA 5D26A 4J0SA 5F61A 2WP2A 3DAIA 2GRCA 4F3IA 3MQMA 4MR3A 5C85A 3LQHA 3P1FA 3JVLA 4J1PA 5EI4A 4O7CA 5FB0A 4O75A 5D7XA 5H1UA 3NXBA 5E3DA 5HJCA 5BT3A 2RS9B 5CP5A 5F1LA 4O7AA 4C66A 5ENIA 5DW2A 4OUFA 5TB6A 4YYKA 3P1EA 4YYHA 4N4FA 4UIVA 5E9VA 4QNSA 4PCIA 4A9LA 2MJVB 4QR4A 5D3HA 5L8UA 5FE4A 4HXSA 4QC1A 2RO1A 3S92A 4KCXA 5KTWA 2DVVA 5FFYA 5LJ0A 5CRZA 5EWWA 5EP7A 2N9GA 4Z93A 4UITA 4CURA 4PS5A 4QEVA 5H1VA 5EA1A 4N4HA 4N3WA 4NRAA 4QYLA 4QR3A 2DVRA 4NQNA 5BT4A 5IIDA 5HEMA 5DX4A 4NXJA 4XUBA 3U5MA 4XUAA 3HMEA 4QY4A 5E9LA 3UVYA 5DKCA 5DYAA 2YEKA 4Q0NA 5E9YA 5DYCA 4O76A 4QSXA 3G0LA 2OO1A 4UYEA 5F63A 3U5NA 2L5EA 5EGUA 5IGLA 4HXPA 5LJ2A 2G4AA 5DY7A 5C89A 4WHUA 5C8GA 4MENA 4HXMA 5CUCA 4MEPA 4HXKA 4BHWA 5LKXA 4UYDA 5FE3A 5FE9A 2WP1A 4YY6A 4HBVA 3SVFA 4IORA 4HBYA 4IR3A 4YK0A 5C4QA 4IR6A 2RFJA 4QZSA 5L96A 4LZSA 4CUSA 4CUQA 5J0DA 4X2IA 4YBMA 4QUUA 4UYFA 5DFDA 4Z1QA 5HCLA 1WUGA 5I29A 4QB3A 5FH6A 5ENCA 4O7FA 5EWVA 5IGNA 3O34A 4Y03A 5FH8A 1F68A 5CUDA 3SVGA 3P1DA 5F2PA 2LSPB 2YDWA 5LVQA 3QZSA 4UIYA 3U5PA 4NR7A 3DWYA 5CUBA 2RNYA 5DLZA 5I7YA 1EQFA 5HRXA 4QSRA 5II1A 4IOQA 5HFRA 3FKMX 3I3JA 3U5OA 1X0JA 4N4IA 5D3NA 4ZW1A 4YYGA 4HBXA 4A9MA 3LQJA 4C67A 4YABA 5CU8A 5FG5A 4NQMA 4YH3A 5D3SA 5I89A 4DONA 5HLSA 5LKTA 3UW9A 2R0SA 4OGJA 5ETBA 5KTUA 4TZ2A 4CLBA 5L8TA 4QSPA 5CFWA 5A5RA 4YYIA 3TLPA 4LYIA 5EM3A 4J3IA 5DKHA 5FBXA 2DATA 4O70A 5A81A 4O78A 3MB3A 4CUPA 3MB4A 3UVXA 4ZC9A 5D25A 4LZ2A 4BW3A 4Z6HA 3MXFA 4CUUA 4AKNA 5I7XA 4BW4A 3P1CA 5FE0A 4UYHA 2DVQA 3U5LA 4A9OA 2L84A 4LRGA 5F1HA 4Z1SA 5FH7A 2RNWA 4O71A 3JVMA 3G0JA 4TT4A 5CGPA 5ENJA 5FE6A 5DFBA 5CUAA 4NUEA 5ENFA 2R0YA 3AQAA 1JM4B 4UIWA 4KV4A 4TQNA 5EISA 4YATA 5F3AA 4HBWA 4YYMA 2YELA 4QYDA 4IR4A 5CS8A 5HRVA 5FG6A 5E7DA 3MUKA 3GG3A 5D3LA 2RNXA 2YEMA 4TT2A 5A7CA 2KTBB 3UVWA 4QSVA 5F62A 3AADA 4NR9A 5EWDA 4A9FA 4YYDA 4QEUA 5LKUA 4QSWA 4N4GA 5CQAA 3LJWA 4A9KA 5LJ1A 5E3GA 5A5SA 2D9EA 5EPRA 5ACYA 4GPJA 5I1QA 5DW1A 1E6IA 5HRWA 5D24A 5I40A 4HXNA 4YYJA 3D7CA 3ZYUA 5D0CA 4XYAA 5DLXA 5FFVA 3HMFA 3S91A 5ENBA 5FE7A 5I80A 2YQDA 5EWHA 4QUTA 3LQIA 4J0RA 4LDFA 4TU6A 4CFKA 5LVRA 3O36A 4NR5A 5H85A 4MR5A 4PCEA 4MR6A 4TTEA 3LXJA 3HMHA 3UV5A 4A9IA 2E3KA 5G4SA 5A82A 4RVRA 4XY9A 3O37A 5ETDA 5IBNA 5CUGA 5L97A 5II2A 2H60A 5CRMA 5E9MA 4YC9A 4UIUA 4BW1A 3JVKA 4HXLA 2I8NA 2OUOA 2DWWA 2RI7A 4TS8A 5H1TA 4QEWA 4QSQA 5CQ7A 4QSTA 5F5ZA 4O7EA 5G4RA 5COIA 2DKWA 4CUTA 4TT6A 3Q2EA 5HQ6A 2FSAA 3ONIA 3U5JA 5FE8A 3SVHA 2DVSA 5HELA 4IR5A 5FG4A 4NRBA 5CQ8A 5HM0A 2L85A 2E7NA 4PY6A 3IU5A 5C87A 5KHMA 4A9JA 4KV1A 5A5NA 5LUUA 5A83A 3RCWA 4NYVA 4YBSA 5CTLA 5IGMA 4O7BA 4UIZA 4NR6A 5L99A 4NRCA 5FE2A 4QSUA 4UIXA 4WIVA 3IU6A 4NUDA 5D3RA 5IGKA 4ZQLA 5F36A 5CQ3A 5D3TA 5KTXA 4TZ8A 5ENGA 4UYGA 2R0VA 3MULA 5JI8A 5BT5A 3QZVA 5CUEA 5LKZA 4MR4A 5IG6A 5ENHA 5EU1A 2F6JA 2YYNA 5DKDA 5E73A 4YYNA 1N72A 4O72A 5HFQA 5EV9A 4LC2A 5EK9A 4XY8A 4UYFB 4NS5A 5FB1A 5EQ1A 3JVJA 5A5OA 5F60A 5HQ5A 5KO4A 4PTBA 5E9IA 2E7OA 3UV4A 5HENA 5FDZA 4O77A 4IOOA 5CQ5A 5AMEA 2D82A 5EPBA 4LZRA 5FE5A 4LYSA 4MEQA 4LYWA 4OGIA 4A9NA 2R10A 5EVAA 4BW2A 5K29A 5DYXA 4ALGA 5KU3A 5E9KA 5E74A 4A9EA 3K2JA 4NYWA 5EICA 5ENEA 5AD3A 5JWMA 4YADA 4PKLA 4CFLA 1ZS5A 1JSPB 5CPEA 3P5OA 5CQ6A 2I7KA 4WHWA 5C7NA 5EPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2F A;  5A5P A;  4QSS A;  5AMF A;  4NUC A;  5EWC A;  4QC3 A;  4Z6I A;  5E0R A;  4HXO A;  4QR5 A;  4TYL A;  5DFC A;  2F6N A;  3U5K A;  5I86 A;  4MEO A;  4BJX A;  5I88 A;  4YH4 A;  4NR8 A;  5L98 A;  4CL9 A;  4Q0O A;  5AD2 A;  4A9H A;  4YBT A;  5I83 A;  4O74 A;  4FLP A;  5FFW A;  2NXB A;  3UV2 A;  5FE1 A;  3O33 A;  5A85 A;  5A5Q A;  3O35 A;  4LR6 A;  5D3J A;  4NR4 A;  4QBM A;  5CZG A;  5CY9 A;  5F25 A;  4YY4 A;  2YW5 A;  4NYX A;  5D3P A;  4ALH A;  5CQT A;  2OSS A;  3UVD A;  5CQ4 A;  5DYU A;  3QZT A;  5TCM A;  5HQ7 A;  4HXR A;  1WUM A;  4TU4 A;  4E96 A;  5DBM A;  4YAX A;  5D26 A;  4J0S A;  5F61 A;  2WP2 A;  3DAI A;  2GRC A;  4F3I A;  3MQM A;  4MR3 A;  5C85 A;  3LQH A;  3P1F A;  3JVL A;  4J1P A;  5EI4 A;  4O7C A;  5FB0 A;  4O75 A;  5D7X A;  5H1U A;  3NXB A;  5E3D A;  5HJC A;  5BT3 A;  2RS9 B;  5CP5 A;  5F1L A;  4O7A A;  4C66 A;  5ENI A;  5DW2 A;  4OUF A;  5TB6 A;  4YYK A;  3P1E A;  4YYH A;  4N4F A;  4UIV A;  5E9V A;  4QNS A;  4PCI A;  4A9L A;  2MJV B;  4QR4 A;  5D3H A;  5L8U A;  5FE4 A;  4HXS A;  4QC1 A;  2RO1 A;  3S92 A;  4KCX A;  5KTW A;  2DVV A;  5FFY A;  5LJ0 A;  5CRZ A;  5EWW A;  5EP7 A;  2N9G A;  4Z93 A;  4UIT A;  4CUR A;  4PS5 A;  4QEV A;  5H1V A;  5EA1 A;  4N4H A;  4N3W A;  4NRA A;  4QYL A;  4QR3 A;  2DVR A;  4NQN A;  5BT4 A;  5IID A;  5HEM A;  5DX4 A;  4NXJ A;  4XUB A;  3U5M A;  4XUA A;  3HME A;  4QY4 A;  5E9L A;  3UVY A;  5DKC A;  5DYA A;  2YEK A;  4Q0N A;  5E9Y A;  5DYC A;  4O76 A;  4QSX A;  3G0L A;  2OO1 A;  4UYE A;  5F63 A;  3U5N A;  2L5E A;  5EGU A;  5IGL A;  4HXP A;  5LJ2 A;  2G4A A;  5DY7 A;  5C89 A;  4WHU A;  5C8G A;  4MEN A;  4HXM A;  5CUC A;  4MEP A;  4HXK A;  4BHW A;  5LKX A;  4UYD A;  5FE3 A;  5FE9 A;  2WP1 A;  4YY6 A;  4HBV A;  3SVF A;  4IOR A;  4HBY A;  4IR3 A;  4YK0 A;  5C4Q A;  4IR6 A;  2RFJ A;  4QZS A;  5L96 A;  4LZS A;  4CUS A;  4CUQ A;  5J0D A;  4X2I A;  4YBM A;  4QUU A;  4UYF A;  5DFD A;  4Z1Q A;  5HCL A;  1WUG A;  5I29 A;  4QB3 A;  5FH6 A;  5ENC A;  4O7F A;  5EWV A;  5IGN A;  3O34 A;  4Y03 A;  5FH8 A;  1F68 A;  5CUD A;  3SVG A;  3P1D A;  5F2P A;  2LSP B;  2YDW A;  5LVQ A;  3QZS A;  4UIY A;  3U5P A;  4NR7 A;  3DWY A;  5CUB A;  2RNY A;  5DLZ A;  5I7Y A;  1EQF A;  5HRX A;  4QSR A;  5II1 A;  4IOQ A;  5HFR A;  3FKM X;  3I3J A;  3U5O A;  1X0J A;  4N4I A;  5D3N A;  4ZW1 A;  4YYG A;  4HBX A;  4A9M A;  3LQJ A;  4C67 A;  4YAB A;  5CU8 A;  5FG5 A;  4NQM A;  4YH3 A;  5D3S A;  5I89 A;  4DON A;  5HLS A;  5LKT A;  3UW9 A;  2R0S A;  4OGJ A;  5ETB A;  5KTU A;  4TZ2 A;  4CLB A;  5L8T A;  4QSP A;  5CFW A;  5A5R A;  4YYI A;  3TLP A;  4LYI A;  5EM3 A;  4J3I A;  5DKH A;  5FBX A;  2DAT A;  4O70 A;  5A81 A;  4O78 A;  3MB3 A;  4CUP A;  3MB4 A;  3UVX A;  4ZC9 A;  5D25 A;  4LZ2 A;  4BW3 A;  4Z6H A;  3MXF A;  4CUU A;  4AKN A;  5I7X A;  4BW4 A;  3P1C A;  5FE0 A;  4UYH A;  2DVQ A;  3U5L A;  4A9O A;  2L84 A;  4LRG A;  5F1H A;  4Z1S A;  5FH7 A;  2RNW A;  4O71 A;  3JVM A;  3G0J A;  4TT4 A;  5CGP A;  5ENJ A;  5FE6 A;  5DFB A;  5CUA A;  4NUE A;  5ENF A;  2R0Y A;  3AQA A;  1JM4 B;  4UIW A;  4KV4 A;  4TQN A;  5EIS A;  4YAT A;  5F3A A;  4HBW A;  4YYM A;  2YEL A;  4QYD A;  4IR4 A;  5CS8 A;  5HRV A;  5FG6 A;  5E7D A;  3MUK A;  3GG3 A;  5D3L A;  2RNX A;  2YEM A;  4TT2 A;  5A7C A;  2KTB B;  3UVW A;  4QSV A;  5F62 A;  3AAD A;  4NR9 A;  5EWD A;  4A9F A;  4YYD A;  4QEU A;  5LKU A;  4QSW A;  4N4G A;  5CQA A;  3LJW A;  4A9K A;  5LJ1 A;  5E3G A;  5A5S A;  2D9E A;  5EPR A;  5ACY A;  4GPJ A;  5I1Q A;  5DW1 A;  1E6I A;  5HRW A;  5D24 A;  5I40 A;  4HXN A;  4YYJ A;  3D7C A;  3ZYU A;  5D0C A;  4XYA A;  5DLX A;  5FFV A;  3HMF A;  3S91 A;  5ENB A;  5FE7 A;  5I80 A;  2YQD A;  5EWH A;  4QUT A;  3LQI A;  4J0R A;  4LDF A;  4TU6 A;  4CFK A;  5LVR A;  3O36 A;  4NR5 A;  5H85 A;  4MR5 A;  4PCE A;  4MR6 A;  4TTE A;  3LXJ A;  3HMH A;  3UV5 A;  4A9I A;  2E3K A;  5G4S A;  5A82 A;  4RVR A;  4XY9 A;  3O37 A;  5ETD A;  5IBN A;  5CUG A;  5L97 A;  5II2 A;  2H60 A;  5CRM A;  5E9M A;  4YC9 A;  4UIU A;  4BW1 A;  3JVK A;  4HXL A;  2I8N A;  2OUO A;  2DWW A;  2RI7 A;  4TS8 A;  5H1T A;  4QEW A;  4QSQ A;  5CQ7 A;  4QST A;  5F5Z A;  4O7E A;  5G4R A;  5COI A;  2DKW A;  4CUT A;  4TT6 A;  3Q2E A;  5HQ6 A;  2FSA A;  3ONI A;  3U5J A;  5FE8 A;  3SVH A;  2DVS A;  5HEL A;  4IR5 A;  5FG4 A;  4NRB A;  5CQ8 A;  5HM0 A;  2L85 A;  2E7N A;  4PY6 A;  3IU5 A;  5C87 A;  5KHM A;  4A9J A;  4KV1 A;  5A5N A;  5LUU A;  5A83 A;  3RCW A;  4NYV A;  4YBS A;  5CTL A;  5IGM A;  4O7B A;  4UIZ A;  4NR6 A;  5L99 A;  4NRC A;  5FE2 A;  4QSU A;  4UIX A;  4WIV A;  3IU6 A;  4NUD A;  5D3R A;  5IGK A;  4ZQL A;  5F36 A;  5CQ3 A;  5D3T A;  5KTX A;  4TZ8 A;  5ENG A;  4UYG A;  2R0V A;  3MUL A;  5JI8 A;  5BT5 A;  3QZV A;  5CUE A;  5LKZ A;  4MR4 A;  5IG6 A;  5ENH A;  5EU1 A;  2F6J A;  2YYN A;  5DKD A;  5E73 A;  4YYN A;  1N72 A;  4O72 A;  5HFQ A;  5EV9 A;  4LC2 A;  5EK9 A;  4XY8 A;  4UYF B;  4NS5 A;  5FB1 A;  5EQ1 A;  3JVJ A;  5A5O A;  5F60 A;  5HQ5 A;  5KO4 A;  4PTB A;  5E9I A;  2E7O A;  3UV4 A;  5HEN A;  5FDZ A;  4O77 A;  4IOO A;  5CQ5 A;  5AME A;  2D82 A;  5EPB A;  4LZR A;  5FE5 A;  4LYS A;  4MEQ A;  4LYW A;  4OGI A;  4A9N A;  2R10 A;  5EVA A;  4BW2 A;  5K29 A;  5DYX A;  4ALG A;  5KU3 A;  5E9K A;  5E74 A;  4A9E A;  3K2J A;  4NYW A;  5EIC A;  5ENE A;  5AD3 A;  5JWM A;  4YAD A;  4PKL A;  4CFL A;  1ZS5 A;  1JSP B;  5CPE A;  3P5O A;  5CQ6 A;  2I7K A;  4WHW A;  5C7N A;  5EPS A; 
#chains in the Genus database with same CATH topology
 3Q2F A;  5A5P A;  4QSS A;  5AMF A;  4NUC A;  5EWC A;  4QC3 A;  4Z6I A;  5E0R A;  4HXO A;  4QR5 A;  4TYL A;  5DFC A;  2F6N A;  3U5K A;  5I86 A;  4MEO A;  4BJX A;  5I88 A;  4YH4 A;  4NR8 A;  5L98 A;  4CL9 A;  4Q0O A;  5AD2 A;  4A9H A;  4YBT A;  5I83 A;  4O74 A;  4FLP A;  5FFW A;  2NXB A;  4AKH A;  3UV2 A;  5FE1 A;  3O33 A;  5A85 A;  5A5Q A;  3O35 A;  4LR6 A;  5D3J A;  4NR4 A;  4QBM A;  5CZG A;  5CY9 A;  5F25 A;  4YY4 A;  2YW5 A;  4NYX A;  5D3P A;  4ALH A;  5CQT A;  2OSS A;  3UVD A;  5CQ4 A;  5DYU A;  3QZT A;  5TCM A;  5HQ7 A;  4HXR A;  1WUM A;  4TU4 A;  4E96 A;  5DBM A;  4YAX A;  5D26 A;  4J0S A;  5F61 A;  2WP2 A;  3DAI A;  2GRC A;  4F3I A;  3MQM A;  4MR3 A;  5C85 A;  3LQH A;  3P1F A;  3JVL A;  4J1P A;  5EI4 A;  4O7C A;  5FB0 A;  4O75 A;  5D7X A;  5H1U A;  3NXB A;  5E3D A;  5HJC A;  5BT3 A;  2RS9 B;  5CP5 A;  5F1L A;  4O7A A;  4C66 A;  5ENI A;  5DW2 A;  4OUF A;  5TB6 A;  4YYK A;  3P1E A;  1PUO A;  4YYH A;  4N4F A;  4UIV A;  5E9V A;  4QNS A;  1ZKR A;  4PCI A;  4A9L A;  2MJV B;  4QR4 A;  5D3H A;  5L8U A;  5FE4 A;  4HXS A;  4QC1 A;  2RO1 A;  3S92 A;  4KCX A;  5KTW A;  2DVV A;  5FFY A;  5LJ0 A;  5CRZ A;  5EWW A;  5EP7 A;  2N9G A;  4Z93 A;  4UIT A;  4CUR A;  4PS5 A;  4QEV A;  5H1V A;  5EA1 A;  4N4H A;  4N3W A;  4NRA A;  4QYL A;  4QR3 A;  2DVR A;  4NQN A;  5BT4 A;  5IID A;  5HEM A;  5DX4 A;  4NXJ A;  4XUB A;  3U5M A;  4XUA A;  2EJN A;  3HME A;  4QY4 A;  5E9L A;  3UVY A;  5DKC A;  5DYA A;  2YEK A;  4Q0N A;  5E9Y A;  5DYC A;  4O76 A;  4QSX A;  3G0L A;  2OO1 A;  4UYE A;  5F63 A;  3U5N A;  2L5E A;  5EGU A;  5IGL A;  4HXP A;  5LJ2 A;  2G4A A;  5DY7 A;  5C89 A;  4WHU A;  5C8G A;  4MEN A;  4HXM A;  5CUC A;  4MEP A;  4HXK A;  4BHW A;  5LKX A;  4UYD A;  5FE3 A;  5FE9 A;  2WP1 A;  4YY6 A;  4HBV A;  3SVF A;  4IOR A;  4HBY A;  4IR3 A;  4YK0 A;  5C4Q A;  4IR6 A;  2RFJ A;  4QZS A;  5L96 A;  4LZS A;  4CUS A;  4CUQ A;  5J0D A;  4X2I A;  4YBM A;  4QUU A;  4UYF A;  5DFD A;  4Z1Q A;  5HCL A;  1WUG A;  5I29 A;  4QB3 A;  5FH6 A;  5ENC A;  4O7F A;  5EWV A;  5IGN A;  3O34 A;  4Y03 A;  5FH8 A;  1F68 A;  5CUD A;  4AI6 A;  3SVG A;  4AKG A;  3P1D A;  5F2P A;  2LSP B;  2YDW A;  5LVQ A;  3QZS A;  4UIY A;  3U5P A;  4NR7 A;  3DWY A;  5CUB A;  2RNY A;  5DLZ A;  5I7Y A;  1EQF A;  5HRX A;  4QSR A;  5II1 A;  4IOQ A;  5HFR A;  3FKM X;  3I3J A;  3U5O A;  1X0J A;  4N4I A;  5D3N A;  4ZW1 A;  4YYG A;  4HBX A;  4A9M A;  3LQJ A;  4C67 A;  4YAB A;  5CU8 A;  5FG5 A;  4NQM A;  4YH3 A;  5D3S A;  5I89 A;  4DON A;  5HLS A;  5LKT A;  3UW9 A;  2R0S A;  4OGJ A;  5ETB A;  5KTU A;  4TZ2 A;  4CLB A;  5L8T A;  4QSP A;  5CFW A;  5A5R A;  4YYI A;  4AKI A;  3TLP A;  4LYI A;  5EM3 A;  4J3I A;  5DKH A;  5FBX A;  2DAT A;  4O70 A;  5A81 A;  4O78 A;  3MB3 A;  4CUP A;  3MB4 A;  3UVX A;  4ZC9 A;  5D25 A;  4LZ2 A;  4BW3 A;  4Z6H A;  3MXF A;  4CUU A;  4AKN A;  5I7X A;  4BW4 A;  3P1C A;  5FE0 A;  4UYH A;  2DVQ A;  3U5L A;  4A9O A;  2L84 A;  4LRG A;  5F1H A;  4Z1S A;  5FH7 A;  2RNW A;  4O71 A;  3JVM A;  3G0J A;  4TT4 A;  5CGP A;  5ENJ A;  5FE6 A;  5DFB A;  5CUA A;  4NUE A;  5ENF A;  2R0Y A;  3AQA A;  1JM4 B;  4UIW A;  4KV4 A;  4TQN A;  5EIS A;  4YAT A;  5F3A A;  4HBW A;  4YYM A;  2YEL A;  4QYD A;  4IR4 A;  5CS8 A;  5HRV A;  5FG6 A;  5E7D A;  3MUK A;  3GG3 A;  5D3L A;  2RNX A;  2YEM A;  4TT2 A;  5A7C A;  2KTB B;  3UVW A;  4QSV A;  5F62 A;  3AAD A;  3VKH A;  4NR9 A;  5EWD A;  4A9F A;  4YYD A;  4QEU A;  5LKU A;  4QSW A;  4N4G A;  5CQA A;  3LJW A;  4A9K A;  5LJ1 A;  5E3G A;  5A5S A;  2D9E A;  5EPR A;  5ACY A;  4GPJ A;  5I1Q A;  5DW1 A;  1E6I A;  5HRW A;  5D24 A;  5I40 A;  4HXN A;  4YYJ A;  3D7C A;  3ZYU A;  5D0C A;  4XYA A;  5DLX A;  5FFV A;  3HMF A;  3S91 A;  5ENB A;  5FE7 A;  5I80 A;  2YQD A;  5EWH A;  4QUT A;  3LQI A;  4J0R A;  4LDF A;  4TU6 A;  4CFK A;  5LVR A;  3O36 A;  4NR5 A;  5H85 A;  4MR5 A;  4PCE A;  4MR6 A;  4TTE A;  3LXJ A;  3HMH A;  3UV5 A;  4A9I A;  2E3K A;  5G4S A;  5A82 A;  4RVR A;  4XY9 A;  3O37 A;  5ETD A;  5IBN A;  5CUG A;  5L97 A;  5II2 A;  2H60 A;  5CRM A;  5E9M A;  4YC9 A;  4UIU A;  4BW1 A;  3JVK A;  4HXL A;  2I8N A;  2OUO A;  2DWW A;  2RI7 A;  4TS8 A;  5H1T A;  4QEW A;  4QSQ A;  5CQ7 A;  4QST A;  5F5Z A;  4O7E A;  5G4R A;  5COI A;  2DKW A;  4CUT A;  4TT6 A;  3Q2E A;  5HQ6 A;  2FSA A;  3ONI A;  3U5J A;  5FE8 A;  3SVH A;  2DVS A;  5HEL A;  4IR5 A;  5FG4 A;  4NRB A;  5CQ8 A;  5HM0 A;  2L85 A;  2E7N A;  4PY6 A;  3IU5 A;  5C87 A;  5KHM A;  4A9J A;  4KV1 A;  5A5N A;  5LUU A;  5A83 A;  3RCW A;  4NYV A;  4YBS A;  5CTL A;  5IGM A;  4O7B A;  4UIZ A;  4NR6 A;  3D1B A;  5L99 A;  4NRC A;  5FE2 A;  4QSU A;  4UIX A;  4WIV A;  3IU6 A;  4NUD A;  5D3R A;  5IGK A;  4ZQL A;  5F36 A;  5CQ3 A;  5D3T A;  5KTX A;  4TZ8 A;  5ENG A;  4UYG A;  2R0V A;  3MUL A;  5JI8 A;  5BT5 A;  3QZV A;  5CUE A;  5LKZ A;  4MR4 A;  5IG6 A;  5ENH A;  5EU1 A;  2F6J A;  2YYN A;  5DKD A;  5E73 A;  4YYN A;  1N72 A;  4O72 A;  5HFQ A;  5EV9 A;  4LC2 A;  5EK9 A;  4XY8 A;  3VKG A;  3D1D A;  4UYF B;  4NS5 A;  5FB1 A;  5EQ1 A;  3JVJ A;  5A5O A;  5F60 A;  5HQ5 A;  5KO4 A;  4PTB A;  5E9I A;  2E7O A;  3UV4 A;  5HEN A;  5FDZ A;  4O77 A;  4IOO A;  5CQ5 A;  5AME A;  2D82 A;  5EPB A;  4LZR A;  5FE5 A;  4LYS A;  4MEQ A;  4LYW A;  4OGI A;  4A9N A;  2R10 A;  5EVA A;  4BW2 A;  5K29 A;  5DYX A;  4ALG A;  5KU3 A;  5E9K A;  5E74 A;  4A9E A;  3K2J A;  4NYW A;  3ERR A;  5EIC A;  5ENE A;  5AD3 A;  5JWM A;  4YAD A;  4PKL A;  4CFL A;  1ZS5 A;  1JSP B;  5CPE A;  3P5O A;  5CQ6 A;  2I7K A;  4WHW A;  5C7N A;  5EPS A; 
#chains in the Genus database with same CATH homology
 3Q2F A;  5A5P A;  4QSS A;  5AMF A;  4NUC A;  5EWC A;  4QC3 A;  4Z6I A;  5E0R A;  4HXO A;  4QR5 A;  4TYL A;  5DFC A;  2F6N A;  3U5K A;  5I86 A;  4MEO A;  4BJX A;  5I88 A;  4YH4 A;  4NR8 A;  5L98 A;  4CL9 A;  4Q0O A;  5AD2 A;  4A9H A;  4YBT A;  5I83 A;  4O74 A;  4FLP A;  5FFW A;  2NXB A;  3UV2 A;  5FE1 A;  3O33 A;  5A85 A;  5A5Q A;  3O35 A;  4LR6 A;  5D3J A;  4NR4 A;  4QBM A;  5CZG A;  5CY9 A;  5F25 A;  4YY4 A;  2YW5 A;  4NYX A;  5D3P A;  4ALH A;  5CQT A;  2OSS A;  3UVD A;  5CQ4 A;  5DYU A;  3QZT A;  5TCM A;  5HQ7 A;  4HXR A;  1WUM A;  4TU4 A;  4E96 A;  5DBM A;  4YAX A;  5D26 A;  4J0S A;  5F61 A;  2WP2 A;  3DAI A;  2GRC A;  4F3I A;  3MQM A;  4MR3 A;  5C85 A;  3LQH A;  3P1F A;  3JVL A;  4J1P A;  5EI4 A;  4O7C A;  5FB0 A;  4O75 A;  5D7X A;  5H1U A;  3NXB A;  5E3D A;  5HJC A;  5BT3 A;  2RS9 B;  5CP5 A;  5F1L A;  4O7A A;  4C66 A;  5ENI A;  5DW2 A;  4OUF A;  5TB6 A;  4YYK A;  3P1E A;  4YYH A;  4N4F A;  4UIV A;  5E9V A;  4QNS A;  4PCI A;  4A9L A;  2MJV B;  4QR4 A;  5D3H A;  5L8U A;  5FE4 A;  4HXS A;  4QC1 A;  2RO1 A;  3S92 A;  4KCX A;  5KTW A;  2DVV A;  5FFY A;  5LJ0 A;  5CRZ A;  5EWW A;  5EP7 A;  2N9G A;  4Z93 A;  4UIT A;  4CUR A;  4PS5 A;  4QEV A;  5H1V A;  5EA1 A;  4N4H A;  4N3W A;  4NRA A;  4QYL A;  4QR3 A;  2DVR A;  4NQN A;  5BT4 A;  5IID A;  5HEM A;  5DX4 A;  4NXJ A;  4XUB A;  3U5M A;  4XUA A;  3HME A;  4QY4 A;  5E9L A;  3UVY A;  5DKC A;  5DYA A;  2YEK A;  4Q0N A;  5E9Y A;  5DYC A;  4O76 A;  4QSX A;  3G0L A;  2OO1 A;  4UYE A;  5F63 A;  3U5N A;  2L5E A;  5EGU A;  5IGL A;  4HXP A;  5LJ2 A;  2G4A A;  5DY7 A;  5C89 A;  4WHU A;  5C8G A;  4MEN A;  4HXM A;  5CUC A;  4MEP A;  4HXK A;  4BHW A;  5LKX A;  4UYD A;  5FE3 A;  5FE9 A;  2WP1 A;  4YY6 A;  4HBV A;  3SVF A;  4IOR A;  4HBY A;  4IR3 A;  4YK0 A;  5C4Q A;  4IR6 A;  2RFJ A;  4QZS A;  5L96 A;  4LZS A;  4CUS A;  4CUQ A;  5J0D A;  4X2I A;  4YBM A;  4QUU A;  4UYF A;  5DFD A;  4Z1Q A;  5HCL A;  1WUG A;  5I29 A;  4QB3 A;  5FH6 A;  5ENC A;  4O7F A;  5EWV A;  5IGN A;  3O34 A;  4Y03 A;  5FH8 A;  1F68 A;  5CUD A;  3SVG A;  3P1D A;  5F2P A;  2LSP B;  2YDW A;  5LVQ A;  3QZS A;  4UIY A;  3U5P A;  4NR7 A;  3DWY A;  5CUB A;  2RNY A;  5DLZ A;  5I7Y A;  1EQF A;  5HRX A;  4QSR A;  5II1 A;  4IOQ A;  5HFR A;  3FKM X;  3I3J A;  3U5O A;  1X0J A;  4N4I A;  5D3N A;  4ZW1 A;  4YYG A;  4HBX A;  4A9M A;  3LQJ A;  4C67 A;  4YAB A;  5CU8 A;  5FG5 A;  4NQM A;  4YH3 A;  5D3S A;  5I89 A;  4DON A;  5HLS A;  5LKT A;  3UW9 A;  2R0S A;  4OGJ A;  5ETB A;  5KTU A;  4TZ2 A;  4CLB A;  5L8T A;  4QSP A;  5CFW A;  5A5R A;  4YYI A;  3TLP A;  4LYI A;  5EM3 A;  4J3I A;  5DKH A;  5FBX A;  2DAT A;  4O70 A;  5A81 A;  4O78 A;  3MB3 A;  4CUP A;  3MB4 A;  3UVX A;  4ZC9 A;  5D25 A;  4LZ2 A;  4BW3 A;  4Z6H A;  3MXF A;  4CUU A;  4AKN A;  5I7X A;  4BW4 A;  3P1C A;  5FE0 A;  4UYH A;  2DVQ A;  3U5L A;  4A9O A;  2L84 A;  4LRG A;  5F1H A;  4Z1S A;  5FH7 A;  2RNW A;  4O71 A;  3JVM A;  3G0J A;  4TT4 A;  5CGP A;  5ENJ A;  5FE6 A;  5DFB A;  5CUA A;  4NUE A;  5ENF A;  2R0Y A;  3AQA A;  1JM4 B;  4UIW A;  4KV4 A;  4TQN A;  5EIS A;  4YAT A;  5F3A A;  4HBW A;  4YYM A;  2YEL A;  4QYD A;  4IR4 A;  5CS8 A;  5HRV A;  5FG6 A;  5E7D A;  3MUK A;  3GG3 A;  5D3L A;  2RNX A;  2YEM A;  4TT2 A;  5A7C A;  2KTB B;  3UVW A;  4QSV A;  5F62 A;  3AAD A;  4NR9 A;  5EWD A;  4A9F A;  4YYD A;  4QEU A;  5LKU A;  4QSW A;  4N4G A;  5CQA A;  3LJW A;  4A9K A;  5LJ1 A;  5E3G A;  5A5S A;  2D9E A;  5EPR A;  5ACY A;  4GPJ A;  5I1Q A;  5DW1 A;  1E6I A;  5HRW A;  5D24 A;  5I40 A;  4HXN A;  4YYJ A;  3D7C A;  3ZYU A;  5D0C A;  4XYA A;  5DLX A;  5FFV A;  3HMF A;  3S91 A;  5ENB A;  5FE7 A;  5I80 A;  2YQD A;  5EWH A;  4QUT A;  3LQI A;  4J0R A;  4LDF A;  4TU6 A;  4CFK A;  5LVR A;  3O36 A;  4NR5 A;  5H85 A;  4MR5 A;  4PCE A;  4MR6 A;  4TTE A;  3LXJ A;  3HMH A;  3UV5 A;  4A9I A;  2E3K A;  5G4S A;  5A82 A;  4RVR A;  4XY9 A;  3O37 A;  5ETD A;  5IBN A;  5CUG A;  5L97 A;  5II2 A;  2H60 A;  5CRM A;  5E9M A;  4YC9 A;  4UIU A;  4BW1 A;  3JVK A;  4HXL A;  2I8N A;  2OUO A;  2DWW A;  2RI7 A;  4TS8 A;  5H1T A;  4QEW A;  4QSQ A;  5CQ7 A;  4QST A;  5F5Z A;  4O7E A;  5G4R A;  5COI A;  2DKW A;  4CUT A;  4TT6 A;  3Q2E A;  5HQ6 A;  2FSA A;  3ONI A;  3U5J A;  5FE8 A;  3SVH A;  2DVS A;  5HEL A;  4IR5 A;  5FG4 A;  4NRB A;  5CQ8 A;  5HM0 A;  2L85 A;  2E7N A;  4PY6 A;  3IU5 A;  5C87 A;  5KHM A;  4A9J A;  4KV1 A;  5A5N A;  5LUU A;  5A83 A;  3RCW A;  4NYV A;  4YBS A;  5CTL A;  5IGM A;  4O7B A;  4UIZ A;  4NR6 A;  5L99 A;  4NRC A;  5FE2 A;  4QSU A;  4UIX A;  4WIV A;  3IU6 A;  4NUD A;  5D3R A;  5IGK A;  4ZQL A;  5F36 A;  5CQ3 A;  5D3T A;  5KTX A;  4TZ8 A;  5ENG A;  4UYG A;  2R0V A;  3MUL A;  5JI8 A;  5BT5 A;  3QZV A;  5CUE A;  5LKZ A;  4MR4 A;  5IG6 A;  5ENH A;  5EU1 A;  2F6J A;  2YYN A;  5DKD A;  5E73 A;  4YYN A;  1N72 A;  4O72 A;  5HFQ A;  5EV9 A;  4LC2 A;  5EK9 A;  4XY8 A;  4UYF B;  4NS5 A;  5FB1 A;  5EQ1 A;  3JVJ A;  5A5O A;  5F60 A;  5HQ5 A;  5KO4 A;  4PTB A;  5E9I A;  2E7O A;  3UV4 A;  5HEN A;  5FDZ A;  4O77 A;  4IOO A;  5CQ5 A;  5AME A;  2D82 A;  5EPB A;  4LZR A;  5FE5 A;  4LYS A;  4MEQ A;  4LYW A;  4OGI A;  4A9N A;  2R10 A;  5EVA A;  4BW2 A;  5K29 A;  5DYX A;  4ALG A;  5KU3 A;  5E9K A;  5E74 A;  4A9E A;  3K2J A;  4NYW A;  5EIC A;  5ENE A;  5AD3 A;  5JWM A;  4YAD A;  4PKL A;  4CFL A;  1ZS5 A;  1JSP B;  5CPE A;  3P5O A;  5CQ6 A;  2I7K A;  4WHW A;  5C7N A;  5EPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...