5FEGA

Crystal structure of the dimeric allergen profilin (hev b 8)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
b'SWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 29
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fegA00
1PFLA 3MSHA 3T1QB 3T12B 3MS6A 2V8FA 5EV0A 1HLUP 1VEUB 1AWIA 4D60A 3T1RA 4X1LA 3CPTA 4FUWA 2PBDP 3T1SA 2V8CA 1D1JA 1J3WA 2ACGA 1VETA 3LEQA 3LGOA 4ESPA 4X1MA 2B95A 1PRQA 2ZL1A 4QWOA 3NULA 1CF0A 1VEUA 1CQAA 2PAVP 2JKFA 5EVEA 2BTFP 1Z09A 3U4LP 1FIKA 5FEFA 1SKOB 3L9KA 1YPRA 1F2KA 3NECA 3L7HA 5EM1A 3T1XA 1A0KA 2VK3A 1PNEA 2JKGA 2ZL1B 5FDSA 3UB5P 1FILA 4FTXA 5EM0A 1CJFA 1Y4OA 3CPTB 2E8JA 2PRFA 1ACFA 5FEGA 4X25A 1SKOA 1SZVA 3DAVA 3KYEA 3CHWP 3D9YA 1G5UA 1VETB 1K0KA 2HZ5A
chains in the Genus database with same CATH superfamily
2OLUA 1TS0A 2BG1A 1YQSA 3MSHA 3VFFA 2HDQA 5EFWA 2ZC4B 3GRJA 3C2WA 3NCKA 1L0EA 4WLAA 4YINA 1I5QA 4KZ5A 1N9LA 1OTAA 4PM5A 3QP5A 4LRZE 2HGVA 4R6LA 4OQHA 4JLFA 4B93A 5HARA 1D1JA 4O01A 5CEBA 4P6ZM 3SS4A 5M1AA 4LFUA 4GS9A 3CUEC 3M2KA 2XQZA 5A90A 2X01A 1GCEA 4YOFA 5GL9A 1ES4A 5FQMA 5FA7A 1N9NA 2XA7S 1LSWA 2PAVP 3QP1A 2XK1A 3ZVTA 1QMFA 4UQIM 5FEFA 2QZ6A 3Q7VB 5EVIC 4R3BA 4EQ1A 1PW1A 3L7HA 3OCNA 3IWIA 3LEZA 3NDGA 4IEDA 5HL1A 2UV0E 1PNEA 3KYZA 4P6BA 4ZBEA 4PHTA 1H8MA 1MXOA 1DP6A 4UHUA 1KDSA 1OJ5A 5L10A 5FI2A 1GSXA 3UDIA 5EECA 3GSGA 2VV7A 1S1YA 3GECA 4S2NC 2EFXA 2JHEA 2ZJ9A 2K31A 2PT7A 1ERMA 3IWOA 1K4EA 1G5UA 2INWA 5G4ZA 4O8GA 4GS9B 4BENA 3OCLA 1HZOA 4N1HA 4EQIA 4HBUA 2WKRA 3CAXA 2P08A 3M2JA 3G2ZA 5E2EA 5FL3A 1KGFA 4N1XA 5HDCA 4S2LA 2ZQ7A 3QNCA 4FUWA 4LV3A 4HJ3A 4Q0HA 4M4XA 5EUAA 4Y0TA 5K5BA 4O7DA 3IS2A 4HEFA 1BUEA 2W3GA 3HJIA 4S2OA 4E3NA 4HQAA 1PYYA 2PBYA 4JGOA 3CG5A 4Q0IA 3MMHA 3UPOA 1CQAA 2G7UA 1RP5A 4R4RA 1D06A 2BTFP 3HREA 1TDGA 2EX9A 5EE8A 3TOIA 2EWVA 1YMSA 1LHYA 2OAP1 3G4PA 2ZD8A 2ZQCA 1GA0A 3QNBA 3NECA 3DTMA 4ZTKA 1MBLA 2Y8HA 3SH8A 3IBRA 3PBTA 3UPPA 1KGGA 3PR6A 1YT4A 3PYPA 1ES2A 3IF5A 4MDZA 3AGEA 1YLTA 3LO7A 4NEED 1XP4A 2VKSA 1OPXA 2Y2IA 5EM0A 3LIBA 4R4SA 3H9WA 3DWZA 4X25A 2JKTM 2WGWA 4MBKA 4LRXC 4WZ5C 3IS2B 4IUHA 4Y0UA 4PKYG 3MFDA 2W0NA 4IVIA 4K0XA 1K4FA 5A91A 3VP4A 2QJ5A 5EV0A 2B5RA 4HIAA 5IS1A 3CPTA 3ITAA 4YNRA 3VOYA 2CMNA 3T4TA 2E8IA 4N9KA 4R3AA 3IF6C 2ZM0A 2KDKA 1K55A 5HD5A 1QMEA 4GN2A 2ZL1A 2WAEA 2O9AA 2V1BA 3KX0X 4DF6A 2R9XA 1OTEA 4E3JA 1JWPA 1W8YA 3BQ8A 4ETZA 2DMWA 5KZHA 5GLAA 4GZBA 3OPRA 3PBQA 4EUVA 3OOVA 2PU2A 3PTEA 1ALQA 3TE8A 3NY4A 4RA7A 1GA9A 1G6OA 1BLSA 4K08A 4HOIA 1KE0A 1OTIA 1VHMA 2A24A 4EBLA 4MN6A 2P04A 1P0ZA 4E3KA 3CPTB 1KGEA 1C3BA 3HUOA 2V0WA 3RJUA 2PR6A 5CERA 3SS5A 1M40A 4KZ8A 1SZVA 3T50A 5CHJA 1TEMA 3O3VA 3VP3A 1DY6A 1EROA 1Y28A 3BFGA 3T1QB 3G6OA 4C75A 4ARZA 5F1FA 4D60A 3T1RA 4X1LA 2Y4AA 1JTDA 3ZFZA 1LL9A 4I3IA 5FI7A 2M7UA 2QKPA 1GSWA 4MN7A 2EX8A 5AQAA 5FQ9A 1ERQA 4JXWA 2OWJA 3MQ0A 2I72A 1Z6FA 2B95A 5IU1A 2EX2A 1HTZA 1RGZA 1UGUA 3MQOA 2A24B 3WS2A 5L07A 4ME4A 4S2PA 1EWZA 3ZYTA 3CJMA 4BD0A 5F5YA 1PWDA 1T1BA 2V1ZA 1YPRA 4S2MA 4GDNA 4I5SA 1F2KA 4PM8A 4BJPA 4G3WA 4KG6A 3T4QA 2A3UA 1K38A 3N7WA 1ZC2A 2GZAA 1TDLA 4LV0A 2Y79A 4ARZB 1E3UA 4Y5FA 3FYZA 4KZ3A 1SDNA 1IYSA 4EBPA 5DFXA 3SH7A 5G18A 2WGVA 2OSUA 5TFQA 3A3FA 1NXYA 5EVID 4KZAA 4XXRA 4QHCA 3KYEA 1GHIA 3B47A 3CUEA 3JVUA 2QJ7A 1XJ3A 1W79A 1WYBA 4JGPA 3WS1A 4E3MA 4Y0OA 1BTLA 5A93A 3HCYA 4L0LA 3K3CA 3W8KA 1S66L 4OPZA 2ZM8A 3V50A 4B88A 2Q9NA 2GJ3A 3T1SA 1GHPA 5GHXA 2ZMFA 5EVIA 2WZXA 3F1NA 1K57A 4DN0A 2ZQAA 5TJJA 4IHQA 3Q82A 2ZC6B 4XUXA 1DJAA 3HLCA 4Y15A 3RXXA 5EOEA 2B18A 1S4RA 3N8SA 3PBSA 3PBNA 4ZJ1A 3HBRA 4I3JA 3NULA 3UB7A 4DE0A 4JGRA 3ZG7B 4GLQA 1J9MA 2V1AA 3F1OA 1AXBA 2B02A 4BMWA 3IXDA 1OT9A 3GQZA 4S2NA 4Z9QA 3ZG8B 3HJKA 1XA7A 3L9KA 2J9PA 1XXMA 3GDIA 3FKVA 1YLZA 3LY4A 1NZUA 2VZWA 1XPBA 5CHUA 3T1XA 4DMZA 4X68A 4DDYA 2VJWA 1EI5A 1H5XA 1TVFA 2ZOIA 5FAQA 1BLPA 1NYMA 2OOLA 1SKOA 3LIDA 4GW9A 5EVIB 3E98A 3F1NB 2ZC3B 3LI8A 3LIFA 1NJ4A 2J8YA 4DRTA 4EXOA 4H6JA 1LI9A 4WELA 4R23A 1K6RA 1GHMA 4P85A 3EWKA 4JBFA 3V5MA 3ZG5A 3SZTA 1BLCA 1WE4A 3C38A 4H8RA 3ZG0A 3F1OB 4OOLA 4WMCD 2K7SA 2V8CA 1K54C 2ZBBA 4Z1WA 3IX4A 3KSHA 1CK3A 5M18A 3Q1FA 3EEAA 2O99A 5HDSA 1DP9A 2WKIA 1LI0A 2WYXA 2H10A 3IH9A 5CTMA 4WZ4A 3CI6A 3E4QA 5IT5A 4BL2A 4Q0JA 4CJNA 4RX2A 4QWOA 3R4KA 1STZA 1Q2PA 5AJGA 1RGYA 5DJTA 4EWFA 5GLBA 4JXGA 2O9CA 3OBFA 1XJ6A 1O7EA 3BW6A 2A2LA 1TS8A 1SKOB 4CLCC 4BBUA 2VEAA 4KQQA 4WZ5A 3C30A 3W4PA 3MF0A 4OVDA 1OJGA 5FAOA 4N9LA 2X02A 5FAPA 4H6JB 2JBFA 4DXBA 5AVFA 2EXAA 1K6SA 4RQ9A 4WYYA 3C4PA 4OQGA 2Y2HA 5CTNA 2JKGA 4OLGA 5CXWA 3WRZA 4FTXA 3WRTA 1CJFA 2EWWA 3IQAA 1NWZA 1IKGA 4GCZA 4OPQA 5L8MA 2VGKA 3LR3A 5KMWA 2V9AA 4MLLA 5HWWA 3IH8A 3NOUC 4EEUA 1BLHA 2QYBA 1DRMA 2QHKA 4QU3A 3ZHHA 3IXBA 5FATA 4HI4A 1ES3A 1H8ZA 1BSGA 2YKHA 1D7EA 3GR2A 4R70A 2I9VA 1MZUA 4P87A 3E2KA 4R1GA 1LSXA 1XA1A 3UE3A 3UE0A 2HPBA 3G30A 3PAGA 4M3KA 3G31A 3LICA 3SOIA 4X55A 3QP4A 1XGJA 3E4OA 4LCLA 2BLSA 5FQIA 3UO9A 3HLGA 3MR0A 4PM7A 3EEHA 5CECA 3VMAA 3GVBA 4DJ2A 5DF9A 3LY3A 5FQQA 1XFQA 3EQUA 3TJZC 3WS4A 4D2OA 1IELA 3LR4A 4MN5A 2HP6A 4FH4A 2ZM2A 5F83A 5A8BA 4KQDA 2P7JA 1Y4OA 1MY8A 1FR6A 2XROA 1V9YA 4S2KA 1HVBA 4IBXA 3MXRA 2HZ5A 1TF1A 4U0XA 3ITBA 2GDNA 2HJEA 1CEGA 4KQOA 2M7VA 2FFYA 2XSSA 5GHZA 4RYEA 2W27A 1TD5A 5HL6A 3GV9A 3IHBA 5GLCA 2V8FA 4I39A 5DTKA 5DTTA 3HLEA 3TSGA 3S7NA 3ZDJA 3HLWA 3IBJA 4OQ0A 4UA6A 2Y2PA 2Y2OA 2Z2LB 2ACGA 4B4XA 1CI8A 4K0WA 4NXEA 4LENA 3VOLA 3UPNA 3IX8A 1JTGA 3B33A 4B4ZA 5HAIA 1GSVA 2QMIA 4WEJA 4WL9A 3UDXA 1FCMA 2OLVA 3ZGAB 1VEUA 2ZC7A 4U3TA 3U4LP 1O07A 4Q8IA 3ISGA 2P9VA 3MXQA 3MQQA 4OP8A 3DBAA 4PKYA 4S2JA 4KENB 1K25A 1CI9A 3KSFA 1IOUA 5U47A 4PM9A 5KSCA 3D3OA 5DFYA 3B3XA 3OZHA 1YLYA 4OH0A 4EBNA 1E4DA 2ZOHA 2OV5A 2Y2LA 3V67A 3WS0A 3C5AA 3UB6A 3UDFA 4C3QA 4NETA 4BBTA 2YKFA 2H0TA 2OAQ1 3V3RA 3TW8A 2WK0A 1KOUA 1LSVA 3DAVA 2KLIA 4EU0A 1L0DA 4I3AA 1IFQA 3RH8B 4BBVA 4GJ4A 5HD3A 4X6TA 4E6WA 2G2UA 4QY6A 3H7WA 4MMNA 5HWTA 4DKIA 4HH3A 1VEUB 2FH5A 3ZVWA 5FSRA 3UNWA 4HP4A 3FV7A 4IVKA 4X53A 2JKRM 2P9VB 1XKZA 2R78A 5F69A 3LR0A 2VGLM 4ESPA 3S22A 3KSIA 4HJ4A 2GNXA 4WM9A 4YFMA 4GD6A 1OTDA 2PD7A 4GNUA 1NRFA 2WKEA 4UAAA 1YM1A 3ZG9B 1L3LA 2XF3A 3BFEA 3VOZA 3T4LA 3NIAA 1KVMA 5CRFA 5CGWA 1LL5A 4HY8A 4E6XA 1KVLA 3FG8A 2Y2JA 3PXPA 1S6RA 3FPVA 5HPFA 4XT2A 4WBGA 3CMZA 3FC7A 3G35A 3NDEA 5KSHA 1K56D 4HBTA 1XX2A 5HZHA 3AGDA 3BFDA 3H7WB 1PW8A 3V3SA 1MWRA 1MWUA 3C4OA 4L9EA 3Q07A 4L9GA 4EESA 4EV4A 1K54A 1UWNX 4CLCD 4WEKA 3VE4A 4B9OA 3BEBA 4ZRRA 4OPYA 3VP0A 3LYXA 4GHIA 4NK3A 4R38A 1F9IA 3O88A 2WGIA 1NRJA 3OC2A 3PBRA 3CWFA 2W1TA 2GX5A 3IHAA 5CHMA 4KZBA 4GDBA 1OTBA 1Q2QA 3T4OA 2W3EA 4A5RA 2OWHA 4FD8A 1NZOA 3HLDA 3BY8A 2IWCA 1VETA 3E4PA 3DW0A 1M6KA 2H5SA 1VB6A 5CGXA 2Y2NA 2D02A 3RTYA 1N4OA 5FI6A 1G68A 5DF7A 4XT2B 2WADA 1K55C 2IA2A 1P9RA 5FASA 3UB8A 3ULFA 2XA7M 4E3LA 5C5KA 2O9BA 4EUZA 1BULA 3IX3A 1T18A 5F82A 2Y2MA 2XEPA 4LPZA 4EEPA 3GTCA 3LI9A 4OOMA 2XRNA 1H0MA 1BYWA 2V20A 3O86A 4GHIB 4N92A 2J3WA 3HUMA 2DRWA 3MZDA 1DJBA 2J3TD 4WUJA 5HX9A 3HL9A 2R9WA 3N4IA 2JCHA 1W8QA 3R7WA 4BL3A 2L0WA 4DE3A 2W1TB 5HAQA 3UB5P 2PR5A 4Y2FA 2ZMVA 2E8JA 2QWSA 2W3DA 4IUKA 3DTKA 3VP1A 3N6IA 2V2FF 3O87A 4O0PA 2PU4A 2J80A 1VETB 5HW3A 1K0KA 2WUQA 4KUKA 3BFCA 1OT6A 1X0OA 5CGSA 2EXBA 4NXGA 2EA9A 4GOGA 4BWIA 4FOFA 2HP5A 1H8YA 3S7QA 2PBDP 3A3EA 5E2FA 3FWLA 1SCWA 4PMAA 1J3WA 3B42A 1KDWA 4OQIA 2VGJA 3P7NA 3I7JA 2JE5A 4OPRA 3MKFA 1NYYA 5KIZA 4HP9A 2RCXA 2JN7A 3VP2A 4LRYC 1FCNA 3CITA 5AQ9A 3R7WB 5MC7A 3S1YA 3S7OA 5I94A 4R3JA 1YLJA 1Y54A 2Z6DA 1Z09A 4KG2A 3HLFA 4Y3IA 4ID4A 2ZQ9A 1ESIA 4JPMA 1NLYA 4XUZA 4ZAMA 1P9WA 2VA0A 2ZC5B 5IHVA 1XFNA 1YLPA 4ZDXA 4UA7A 3C8CA 4LV1A 2VK3A 4DE1A 2K2NA 1G6AA 3QP6A 4WMCA 1YSQA 3P09A 2PD8A 2Z2MB 4KG5A 3KSGA 1SHVA 3A0SA 1MPLA 1YAXA 1NLZA 1FSYA 4GB7A 3U2AA 1JWZA 5HWVA 1ZTUA 4GKUA 5AQ7A 2JKRI 4C6YA 5M19A 3BJNA 3D9YA 2VV6A 5G4YA 4FH2A 2LB5A 3DTEA 4F3LA 4JKTA 2HDSA 3D4FA 1JWVA 3E0YA 3BLSA 4UEYA 5L09A 4R0QA 2J9OA 3IF6A 1G28A 3MZEA 3PBOA 1T1AA 5GHYA 4FCFA 5JYOA 4K91A 3BQAA 3NJAA 3RXWA 5DJUA 4DXCA 3ZNTA 3UMEA 5GLDA 1K57C 3A0RA 1VM1A 3MZFA 4QJGA 1CF0A 5EVEA 5EVLA 1LL8A 5E43A 4UA9A 5JYPA 1FIKA 1VQQA 3BECA 4KZ4A 4QPRA 3Q81A 4GD8A 3G32A 4DE2A 2J3TC 4F3LB 1U60A 1W5DA 4QB8A 1P97A 2A49A 3BM6A 5J8XA 3HVFA 5FDSA 1I2SA 1KE3A 3LFVA 1KE4A 3IF6B 4LGWA 2Y2KA 3MJQA 1ACFA 3W4OA 3WWXA 1L0FA 5J3WA 1ZHHB 4X69A 4IJGA 1PWCA 3H82A 1BT5A 3V39A 1RCJA 1TS7A 3BLMA 2HJ9C 1PFLA 1JVJA 3C7UA 3MS6A 4FSFA 1HLUP 2J7VA 2V0UA 3S7PA 3T4JA 5FQJA 2FZ0A 2W3HA 4PPRA 1L2SA 3T4KA 2W3FA 3K3DA 3CZDA 1IYPA 4ZJ2A 3LEQA 1XGIA 3QP2A 4WN5A 1ONHA 4S2IA 4X1MA 4JGQA 1IKIA 4LV2A 1I2WA 1HD8A 1SDEA 3HLBA 3N8RA 4RVAA 2JKFA 4JF5A 2AVXA 3OPLA 1F98A 2BASA 2VLGA 5D3OA 2XDMA 3A3JA 4P6ZS 3VSLA 3NOTC 4F94A 3TG9A 1PIOA 1WYCA 4MBFA 2MJ6A 4RX3A 3UN7A 3LUQA 1YLWA 3H82B 3C7VA 3K2NA 1A0KA 5TGFA 2WKHA 3A0VA 1PI5A 4E04A 5CX7A 4U0TA 1IYQA 4UQIS 3EGXC 3P01A 1ZG6A 1F5MA 3FPWA 1FCOA 3PAEA 1S1ZA 2WZZA 2RL3A 4NXBA 2PYRA 1EW0A 1FSWA 3OPPA 4Y13A 4JXVA 3BYDA 3A3DA 3NC8A 2HDUA 5HDDA 4WF0A 3W2ZA 4KZ6A 2KOIA 2VV8A 5I5LA 4E3IA 3MBZA 1MKIA 1ONGA 5J4EA 1AWIA 1OMEA 2KX6A 3Q7ZA 4KZ7A 4EW7A 1W63M 3F1PA 2XLNA 1MC0A 4JF4A 4BQMA 4DJ3A 4G3VA 4CLCE 4LCMA 4HJ6A 4G3KA 2H0YA 3LGOA 1PWGA 1FOFA 2D01A 2WGWB 2H28A 3BWLA 3VE3A 5BOHA 4DDSA 1PRQA 5L2FA 1MWSA 2XD5A 1XJ2A 2NUPC 4X56A 5TR7A 3DWKA 3FZCA 4NG2A 2Y2GA 3EOIA 3ZQ5A 4OONA 4KQRA 2LB9A 3LR5A 2IWDA 1CEFA 1MWTA 4AFIA 2Y91A 1H3QA 3IT9A 5EM1A 4YWZA 3BFFA 5F1GA 1IYOA 3MXSA 2CC1A 2XH9A 4OKPA 2ZL1B 5FQKA 3EQVA 5DTSA 2VX8A 5TBMA 4LLOB 1ODVA 3VV4A 3OLOA 2PYPA 3OPHA 5FEGA 2O0YA 3F1PB 2HF6A 1N9BA 3VFHA 4BLMA 4IBRA 5DKLA 2L4RA 5HAPA 4NKPA 4MBHA 4EERA 3E2LA 2EX6A 5J7EA 1XJ4A 4I38A 2P74A 2M1CA 2QPNA 1UWPX 3BRMA 1NY0A 2ZLYA 3JYIA 4II7A 3M6HA 2XGNA 4KUOA 5FDHA 1ZG4A 2C6WB 1SKFA 5HPIA 3DTIA 5A92A 1W7FA 1E3UD 3VSKA 2X71A 3IXHA 4HESA 1PI4A 2IWBA 2DNSA 2HDRA 3JPUA 4PM6A 4ETXA 1K56A 2ZQDA 1S67L 3IXGA 3ZCZA 2FFFB 3BY9A 1T1CA 2WKPA 3G34A 4CLCA 5AVEA 5EPHA 5TBMB 4Y7PA 1FR1A 3NBLA 3EGDC 1L0GA 5E2GA 4QD4A 3NI9A 4EETB 4ZJ3A 1V9ZA 4OP5A 3UMDA 2Z6CA 2NUTC 4HH2A 1YKDA 1BZAA 3D72A 3SW1A 2L1MA 4OLDA 3RFBA 3CLOA 2C5WB 4JF6A 2G2WA 4L9FA 2EFUA 4MNRA 3ICYA 3ZNYA 3O5YA 1WA9A 3A3IA 5DKKA 4CPKA 4KZ9A 1DP8A 5HSQA 2PHYA 2PRFA 5EOOA 2JC7A 3MKEA 3LIAA 1S0WA 3UB9A 3CHWP 2PDRA 3LCEA 3IWQA 3M6BA 5AQBA 4OOYA 2HV1A 3N8LA 1ES5A 1LT0A 2XR0A 2Y55A 3G2YA 3T12B 4CLCB 4PAUA 3UE1A 2W1RA 1FQGA 2ZMAA 3NOPC 3GMWA 2Q0OA 2VGLS 3FKWA 3QP8A 2XFSA 4HNBA 5E2HA 3T4SA 1PZPA 3S4XA 2JKTI 1ZKJA 4MCWA 5CEDA 3MFXA 2UWXA 3W4QA 3SS3A 4CQHA 4JXSA 3NHQA 2ZQ8A 2DCFA 4P0MA 3WS5A 1LLBA 3AGFA 4Y17A 3P98A 2HP9A 1E25A 1YMXA 3SH9A 2Q9MA 3KYQA 2XD1A 1TS6A 3QHYA 2WKQA 2Y59A 4QY5A 5F6AA 5DF8A 3UE6A 3KO6A 1MKMA 3JVVA 2WAFA 4HHDA 3PHYA 1DJCA 3TRCA 1YSPA 1FILA 3HUNA 1JNUA 4NXFA 5HFOA 4BD1A 4E3OA 5LBRA 3Q7VA 2Y2QA 1S4SA 4MEZA 1ESUA 2XFTA 3UY6A 1IEMA 1N9OA 5DVAA 1W63Q 5F68A 1PZOA 1T19A 3LIEA
chains in the Genus database with same CATH topology
1PFLA 3MSHA 3T1QB 3T12B 3MS6A 2V8FA 5EV0A 1HLUP 1VEUB 1AWIA 4D60A 3T1RA 4X1LA 3CPTA 4FUWA 2PBDP 3T1SA 2V8CA 1D1JA 1J3WA 2ACGA 1VETA 3LEQA 3LGOA 4ESPA 4X1MA 2B95A 1PRQA 2ZL1A 4QWOA 3NULA 1CF0A 1VEUA 1CQAA 2PAVP 2JKFA 5EVEA 2BTFP 1Z09A 3U4LP 1FIKA 5FEFA 1SKOB 3L9KA 1YPRA 1F2KA 3NECA 3L7HA 5EM1A 3T1XA 1A0KA 2VK3A 1PNEA 2JKGA 2ZL1B 5FDSA 3UB5P 1FILA 4FTXA 5EM0A 1CJFA 1Y4OA 3CPTB 2E8JA 2PRFA 1ACFA 5FEGA 4X25A 1SKOA 1SZVA 3DAVA 3KYEA 3CHWP 3D9YA 1G5UA 1VETB 1K0KA 2HZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFL A;  3MSH A;  3T1Q B;  3T12 B;  3MS6 A;  2V8F A;  5EV0 A;  1HLU P;  1VEU B;  1AWI A;  4D60 A;  3T1R A;  4X1L A;  3CPT A;  4FUW A;  2PBD P;  3T1S A;  2V8C A;  1D1J A;  1J3W A;  2ACG A;  1VET A;  3LEQ A;  3LGO A;  4ESP A;  4X1M A;  2B95 A;  1PRQ A;  2ZL1 A;  4QWO A;  3NUL A;  1CF0 A;  1VEU A;  1CQA A;  2PAV P;  2JKF A;  5EVE A;  2BTF P;  1Z09 A;  3U4L P;  1FIK A;  5FEF A;  1SKO B;  3L9K A;  1YPR A;  1F2K A;  3NEC A;  3L7H A;  5EM1 A;  3T1X A;  1A0K A;  2VK3 A;  1PNE A;  2JKG A;  2ZL1 B;  5FDS A;  3UB5 P;  1FIL A;  4FTX A;  5EM0 A;  1CJF A;  1Y4O A;  3CPT B;  2E8J A;  2PRF A;  1ACF A;  5FEG A;  4X25 A;  1SKO A;  1SZV A;  3DAV A;  3KYE A;  3CHW P;  3D9Y A;  1G5U A;  1VET B;  1K0K A;  2HZ5 A; 
#chains in the Genus database with same CATH topology
 2OLU A;  1TS0 A;  2BG1 A;  1YQS A;  3MSH A;  3VFF A;  2HDQ A;  5EFW A;  2ZC4 B;  3GRJ A;  3C2W A;  3NCK A;  1L0E A;  4WLA A;  4YIN A;  1I5Q A;  4KZ5 A;  1N9L A;  1OTA A;  4PM5 A;  3QP5 A;  4LRZ E;  2HGV A;  4R6L A;  4OQH A;  4JLF A;  4B93 A;  5HAR A;  1D1J A;  4O01 A;  5CEB A;  4P6Z M;  3SS4 A;  5M1A A;  4LFU A;  4GS9 A;  3CUE C;  3M2K A;  2XQZ A;  5A90 A;  2X01 A;  1GCE A;  4YOF A;  5GL9 A;  1ES4 A;  5FQM A;  5FA7 A;  1N9N A;  2XA7 S;  1LSW A;  2PAV P;  3QP1 A;  2XK1 A;  3ZVT A;  1QMF A;  4UQI M;  5FEF A;  2QZ6 A;  3Q7V B;  5EVI C;  4R3B A;  4EQ1 A;  1PW1 A;  3L7H A;  3OCN A;  3IWI A;  3LEZ A;  3NDG A;  4IED A;  5HL1 A;  2UV0 E;  1PNE A;  3KYZ A;  4P6B A;  4ZBE A;  4PHT A;  1H8M A;  1MXO A;  1DP6 A;  4UHU A;  1KDS A;  1OJ5 A;  5L10 A;  5FI2 A;  1GSX A;  3UDI A;  5EEC A;  3GSG A;  2VV7 A;  1S1Y A;  3GEC A;  4S2N C;  2EFX A;  2JHE A;  2ZJ9 A;  2K31 A;  2PT7 A;  1ERM A;  3IWO A;  1K4E A;  1G5U A;  2INW A;  5G4Z A;  4O8G A;  4GS9 B;  4BEN A;  3OCL A;  1HZO A;  4N1H A;  4EQI A;  4HBU A;  2WKR A;  3CAX A;  2P08 A;  3M2J A;  3G2Z A;  5E2E A;  5FL3 A;  1KGF A;  4N1X A;  5HDC A;  4S2L A;  2ZQ7 A;  3QNC A;  4FUW A;  4LV3 A;  4HJ3 A;  4Q0H A;  4M4X A;  5EUA A;  4Y0T A;  5K5B A;  4O7D A;  3IS2 A;  4HEF A;  1BUE A;  2W3G A;  3HJI A;  4S2O A;  4E3N A;  4HQA A;  1PYY A;  2PBY A;  4JGO A;  3CG5 A;  4Q0I A;  3MMH A;  3UPO A;  1CQA A;  2G7U A;  1RP5 A;  4R4R A;  1D06 A;  2BTF P;  3HRE A;  1TDG A;  2EX9 A;  5EE8 A;  3TOI A;  2EWV A;  1YMS A;  1LHY A;  2OAP 1;  3G4P A;  2ZD8 A;  2ZQC A;  1GA0 A;  3QNB A;  3NEC A;  3DTM A;  4ZTK A;  1MBL A;  2Y8H A;  3SH8 A;  3IBR A;  3PBT A;  3UPP A;  1KGG A;  3PR6 A;  1YT4 A;  3PYP A;  1ES2 A;  3IF5 A;  4MDZ A;  3AGE A;  1YLT A;  3LO7 A;  4NEE D;  1XP4 A;  2VKS A;  1OPX A;  2Y2I A;  5EM0 A;  3LIB A;  4R4S A;  3H9W A;  3DWZ A;  4X25 A;  2JKT M;  2WGW A;  4MBK A;  4LRX C;  4WZ5 C;  3IS2 B;  4IUH A;  4Y0U A;  4PKY G;  3MFD A;  2W0N A;  4IVI A;  4K0X A;  1K4F A;  5A91 A;  3VP4 A;  2QJ5 A;  5EV0 A;  2B5R A;  4HIA A;  5IS1 A;  3CPT A;  3ITA A;  4YNR A;  3VOY A;  2CMN A;  3T4T A;  2E8I A;  4N9K A;  4R3A A;  3IF6 C;  2ZM0 A;  2KDK A;  1K55 A;  5HD5 A;  1QME A;  4GN2 A;  2ZL1 A;  2WAE A;  2O9A A;  2V1B A;  3KX0 X;  4DF6 A;  2R9X A;  1OTE A;  4E3J A;  1JWP A;  1W8Y A;  3BQ8 A;  4ETZ A;  2DMW A;  5KZH A;  5GLA A;  4GZB A;  3OPR A;  3PBQ A;  4EUV A;  3OOV A;  2PU2 A;  3PTE A;  1ALQ A;  3TE8 A;  3NY4 A;  4RA7 A;  1GA9 A;  1G6O A;  1BLS A;  4K08 A;  4HOI A;  1KE0 A;  1OTI A;  1VHM A;  2A24 A;  4EBL A;  4MN6 A;  2P04 A;  1P0Z A;  4E3K A;  3CPT B;  1KGE A;  1C3B A;  3HUO A;  2V0W A;  3RJU A;  2PR6 A;  5CER A;  3SS5 A;  1M40 A;  4KZ8 A;  1SZV A;  3T50 A;  5CHJ A;  1TEM A;  3O3V A;  3VP3 A;  1DY6 A;  1ERO A;  1Y28 A;  3BFG A;  3T1Q B;  3G6O A;  4C75 A;  4ARZ A;  5F1F A;  4D60 A;  3T1R A;  4X1L A;  2Y4A A;  1JTD A;  3ZFZ A;  1LL9 A;  4I3I A;  5FI7 A;  2M7U A;  2QKP A;  1GSW A;  4MN7 A;  2EX8 A;  5AQA A;  5FQ9 A;  1ERQ A;  4JXW A;  2OWJ A;  3MQ0 A;  2I72 A;  1Z6F A;  2B95 A;  5IU1 A;  2EX2 A;  1HTZ A;  1RGZ A;  1UGU A;  3MQO A;  2A24 B;  3WS2 A;  5L07 A;  4ME4 A;  4S2P A;  1EWZ A;  3ZYT A;  3CJM A;  4BD0 A;  5F5Y A;  1PWD A;  1T1B A;  2V1Z A;  1YPR A;  4S2M A;  4GDN A;  4I5S A;  1F2K A;  4PM8 A;  4BJP A;  4G3W A;  4KG6 A;  3T4Q A;  2A3U A;  1K38 A;  3N7W A;  1ZC2 A;  2GZA A;  1TDL A;  4LV0 A;  2Y79 A;  4ARZ B;  1E3U A;  4Y5F A;  3FYZ A;  4KZ3 A;  1SDN A;  1IYS A;  4EBP A;  5DFX A;  3SH7 A;  5G18 A;  2WGV A;  2OSU A;  5TFQ A;  3A3F A;  1NXY A;  5EVI D;  4KZA A;  4XXR A;  4QHC A;  3KYE A;  1GHI A;  3B47 A;  3CUE A;  3JVU A;  2QJ7 A;  1XJ3 A;  1W79 A;  1WYB A;  4JGP A;  3WS1 A;  4E3M A;  4Y0O A;  1BTL A;  5A93 A;  3HCY A;  4L0L A;  3K3C A;  3W8K A;  1S66 L;  4OPZ A;  2ZM8 A;  3V50 A;  4B88 A;  2Q9N A;  2GJ3 A;  3T1S A;  1GHP A;  5GHX A;  2ZMF A;  5EVI A;  2WZX A;  3F1N A;  1K57 A;  4DN0 A;  2ZQA A;  5TJJ A;  4IHQ A;  3Q82 A;  2ZC6 B;  4XUX A;  1DJA A;  3HLC A;  4Y15 A;  3RXX A;  5EOE A;  2B18 A;  1S4R A;  3N8S A;  3PBS A;  3PBN A;  4ZJ1 A;  3HBR A;  4I3J A;  3NUL A;  3UB7 A;  4DE0 A;  4JGR A;  3ZG7 B;  4GLQ A;  1J9M A;  2V1A A;  3F1O A;  1AXB A;  2B02 A;  4BMW A;  3IXD A;  1OT9 A;  3GQZ A;  4S2N A;  4Z9Q A;  3ZG8 B;  3HJK A;  1XA7 A;  3L9K A;  2J9P A;  1XXM A;  3GDI A;  3FKV A;  1YLZ A;  3LY4 A;  1NZU A;  2VZW A;  1XPB A;  5CHU A;  3T1X A;  4DMZ A;  4X68 A;  4DDY A;  2VJW A;  1EI5 A;  1H5X A;  1TVF A;  2ZOI A;  5FAQ A;  1BLP A;  1NYM A;  2OOL A;  1SKO A;  3LID A;  4GW9 A;  5EVI B;  3E98 A;  3F1N B;  2ZC3 B;  3LI8 A;  3LIF A;  1NJ4 A;  2J8Y A;  4DRT A;  4EXO A;  4H6J A;  1LI9 A;  4WEL A;  4R23 A;  1K6R A;  1GHM A;  4P85 A;  3EWK A;  4JBF A;  3V5M A;  3ZG5 A;  3SZT A;  1BLC A;  1WE4 A;  3C38 A;  4H8R A;  3ZG0 A;  3F1O B;  4OOL A;  4WMC D;  2K7S A;  2V8C A;  1K54 C;  2ZBB A;  4Z1W A;  3IX4 A;  3KSH A;  1CK3 A;  5M18 A;  3Q1F A;  3EEA A;  2O99 A;  5HDS A;  1DP9 A;  2WKI A;  1LI0 A;  2WYX A;  2H10 A;  3IH9 A;  5CTM A;  4WZ4 A;  3CI6 A;  3E4Q A;  5IT5 A;  4BL2 A;  4Q0J A;  4CJN A;  4RX2 A;  4QWO A;  3R4K A;  1STZ A;  1Q2P A;  5AJG A;  1RGY A;  5DJT A;  4EWF A;  5GLB A;  4JXG A;  2O9C A;  3OBF A;  1XJ6 A;  1O7E A;  3BW6 A;  2A2L A;  1TS8 A;  1SKO B;  4CLC C;  4BBU A;  2VEA A;  4KQQ A;  4WZ5 A;  3C30 A;  3W4P A;  3MF0 A;  4OVD A;  1OJG A;  5FAO A;  4N9L A;  2X02 A;  5FAP A;  4H6J B;  2JBF A;  4DXB A;  5AVF A;  2EXA A;  1K6S A;  4RQ9 A;  4WYY A;  3C4P A;  4OQG A;  2Y2H A;  5CTN A;  2JKG A;  4OLG A;  5CXW A;  3WRZ A;  4FTX A;  3WRT A;  1CJF A;  2EWW A;  3IQA A;  1NWZ A;  1IKG A;  4GCZ A;  4OPQ A;  5L8M A;  2VGK A;  3LR3 A;  5KMW A;  2V9A A;  4MLL A;  5HWW A;  3IH8 A;  3NOU C;  4EEU A;  1BLH A;  2QYB A;  1DRM A;  2QHK A;  4QU3 A;  3ZHH A;  3IXB A;  5FAT A;  4HI4 A;  1ES3 A;  1H8Z A;  1BSG A;  2YKH A;  1D7E A;  3GR2 A;  4R70 A;  2I9V A;  1MZU A;  4P87 A;  3E2K A;  4R1G A;  1LSX A;  1XA1 A;  3UE3 A;  3UE0 A;  2HPB A;  3G30 A;  3PAG A;  4M3K A;  3G31 A;  3LIC A;  3SOI A;  4X55 A;  3QP4 A;  1XGJ A;  3E4O A;  4LCL A;  2BLS A;  5FQI A;  3UO9 A;  3HLG A;  3MR0 A;  4PM7 A;  3EEH A;  5CEC A;  3VMA A;  3GVB A;  4DJ2 A;  5DF9 A;  3LY3 A;  5FQQ A;  1XFQ A;  3EQU A;  3TJZ C;  3WS4 A;  4D2O A;  1IEL A;  3LR4 A;  4MN5 A;  2HP6 A;  4FH4 A;  2ZM2 A;  5F83 A;  5A8B A;  4KQD A;  2P7J A;  1Y4O A;  1MY8 A;  1FR6 A;  2XRO A;  1V9Y A;  4S2K A;  1HVB A;  4IBX A;  3MXR A;  2HZ5 A;  1TF1 A;  4U0X A;  3ITB A;  2GDN A;  2HJE A;  1CEG A;  4KQO A;  2M7V A;  2FFY A;  2XSS A;  5GHZ A;  4RYE A;  2W27 A;  1TD5 A;  5HL6 A;  3GV9 A;  3IHB A;  5GLC A;  2V8F A;  4I39 A;  5DTK A;  5DTT A;  3HLE A;  3TSG A;  3S7N A;  3ZDJ A;  3HLW A;  3IBJ A;  4OQ0 A;  4UA6 A;  2Y2P A;  2Y2O A;  2Z2L B;  2ACG A;  4B4X A;  1CI8 A;  4K0W A;  4NXE A;  4LEN A;  3VOL A;  3UPN A;  3IX8 A;  1JTG A;  3B33 A;  4B4Z A;  5HAI A;  1GSV A;  2QMI A;  4WEJ A;  4WL9 A;  3UDX A;  1FCM A;  2OLV A;  3ZGA B;  1VEU A;  2ZC7 A;  4U3T A;  3U4L P;  1O07 A;  4Q8I A;  3ISG A;  2P9V A;  3MXQ A;  3MQQ A;  4OP8 A;  3DBA A;  4PKY A;  4S2J A;  4KEN B;  1K25 A;  1CI9 A;  3KSF A;  1IOU A;  5U47 A;  4PM9 A;  5KSC A;  3D3O A;  5DFY A;  3B3X A;  3OZH A;  1YLY A;  4OH0 A;  4EBN A;  1E4D A;  2ZOH A;  2OV5 A;  2Y2L A;  3V67 A;  3WS0 A;  3C5A A;  3UB6 A;  3UDF A;  4C3Q A;  4NET A;  4BBT A;  2YKF A;  2H0T A;  2OAQ 1;  3V3R A;  3TW8 A;  2WK0 A;  1KOU A;  1LSV A;  3DAV A;  2KLI A;  4EU0 A;  1L0D A;  4I3A A;  1IFQ A;  3RH8 B;  4BBV A;  4GJ4 A;  5HD3 A;  4X6T A;  4E6W A;  2G2U A;  4QY6 A;  3H7W A;  4MMN A;  5HWT A;  4DKI A;  4HH3 A;  1VEU B;  2FH5 A;  3ZVW A;  5FSR A;  3UNW A;  4HP4 A;  3FV7 A;  4IVK A;  4X53 A;  2JKR M;  2P9V B;  1XKZ A;  2R78 A;  5F69 A;  3LR0 A;  2VGL M;  4ESP A;  3S22 A;  3KSI A;  4HJ4 A;  2GNX A;  4WM9 A;  4YFM A;  4GD6 A;  1OTD A;  2PD7 A;  4GNU A;  1NRF A;  2WKE A;  4UAA A;  1YM1 A;  3ZG9 B;  1L3L A;  2XF3 A;  3BFE A;  3VOZ A;  3T4L A;  3NIA A;  1KVM A;  5CRF A;  5CGW A;  1LL5 A;  4HY8 A;  4E6X A;  1KVL A;  3FG8 A;  2Y2J A;  3PXP A;  1S6R A;  3FPV A;  5HPF A;  4XT2 A;  4WBG A;  3CMZ A;  3FC7 A;  3G35 A;  3NDE A;  5KSH A;  1K56 D;  4HBT A;  1XX2 A;  5HZH A;  3AGD A;  3BFD A;  3H7W B;  1PW8 A;  3V3S A;  1MWR A;  1MWU A;  3C4O A;  4L9E A;  3Q07 A;  4L9G A;  4EES A;  4EV4 A;  1K54 A;  1UWN X;  4CLC D;  4WEK A;  3VE4 A;  4B9O A;  3BEB A;  4ZRR A;  4OPY A;  3VP0 A;  3LYX A;  4GHI A;  4NK3 A;  4R38 A;  1F9I A;  3O88 A;  2WGI A;  1NRJ A;  3OC2 A;  3PBR A;  3CWF A;  2W1T A;  2GX5 A;  3IHA A;  5CHM A;  4KZB A;  4GDB A;  1OTB A;  1Q2Q A;  3T4O A;  2W3E A;  4A5R A;  2OWH A;  4FD8 A;  1NZO A;  3HLD A;  3BY8 A;  2IWC A;  1VET A;  3E4P A;  3DW0 A;  1M6K A;  2H5S A;  1VB6 A;  5CGX A;  2Y2N A;  2D02 A;  3RTY A;  1N4O A;  5FI6 A;  1G68 A;  5DF7 A;  4XT2 B;  2WAD A;  1K55 C;  2IA2 A;  1P9R A;  5FAS A;  3UB8 A;  3ULF A;  2XA7 M;  4E3L A;  5C5K A;  2O9B A;  4EUZ A;  1BUL A;  3IX3 A;  1T18 A;  5F82 A;  2Y2M A;  2XEP A;  4LPZ A;  4EEP A;  3GTC A;  3LI9 A;  4OOM A;  2XRN A;  1H0M A;  1BYW A;  2V20 A;  3O86 A;  4GHI B;  4N92 A;  2J3W A;  3HUM A;  2DRW A;  3MZD A;  1DJB A;  2J3T D;  4WUJ A;  5HX9 A;  3HL9 A;  2R9W A;  3N4I A;  2JCH A;  1W8Q A;  3R7W A;  4BL3 A;  2L0W A;  4DE3 A;  2W1T B;  5HAQ A;  3UB5 P;  2PR5 A;  4Y2F A;  2ZMV A;  2E8J A;  2QWS A;  2W3D A;  4IUK A;  3DTK A;  3VP1 A;  3N6I A;  2V2F F;  3O87 A;  4O0P A;  2PU4 A;  2J80 A;  1VET B;  5HW3 A;  1K0K A;  2WUQ A;  4KUK A;  3BFC A;  1OT6 A;  1X0O A;  5CGS A;  2EXB A;  4NXG A;  2EA9 A;  4GOG A;  4BWI A;  4FOF A;  2HP5 A;  1H8Y A;  3S7Q A;  2PBD P;  3A3E A;  5E2F A;  3FWL A;  1SCW A;  4PMA A;  1J3W A;  3B42 A;  1KDW A;  4OQI A;  2VGJ A;  3P7N A;  3I7J A;  2JE5 A;  4OPR A;  3MKF A;  1NYY A;  5KIZ A;  4HP9 A;  2RCX A;  2JN7 A;  3VP2 A;  4LRY C;  1FCN A;  3CIT A;  5AQ9 A;  3R7W B;  5MC7 A;  3S1Y A;  3S7O A;  5I94 A;  4R3J A;  1YLJ A;  1Y54 A;  2Z6D A;  1Z09 A;  4KG2 A;  3HLF A;  4Y3I A;  4ID4 A;  2ZQ9 A;  1ESI A;  4JPM A;  1NLY A;  4XUZ A;  4ZAM A;  1P9W A;  2VA0 A;  2ZC5 B;  5IHV A;  1XFN A;  1YLP A;  4ZDX A;  4UA7 A;  3C8C A;  4LV1 A;  2VK3 A;  4DE1 A;  2K2N A;  1G6A A;  3QP6 A;  4WMC A;  1YSQ A;  3P09 A;  2PD8 A;  2Z2M B;  4KG5 A;  3KSG A;  1SHV A;  3A0S A;  1MPL A;  1YAX A;  1NLZ A;  1FSY A;  4GB7 A;  3U2A A;  1JWZ A;  5HWV A;  1ZTU A;  4GKU A;  5AQ7 A;  2JKR I;  4C6Y A;  5M19 A;  3BJN A;  3D9Y A;  2VV6 A;  5G4Y A;  4FH2 A;  2LB5 A;  3DTE A;  4F3L A;  4JKT A;  2HDS A;  3D4F A;  1JWV A;  3E0Y A;  3BLS A;  4UEY A;  5L09 A;  4R0Q A;  2J9O A;  3IF6 A;  1G28 A;  3MZE A;  3PBO A;  1T1A A;  5GHY A;  4FCF A;  5JYO A;  4K91 A;  3BQA A;  3NJA A;  3RXW A;  5DJU A;  4DXC A;  3ZNT A;  3UME A;  5GLD A;  1K57 C;  3A0R A;  1VM1 A;  3MZF A;  4QJG A;  1CF0 A;  5EVE A;  5EVL A;  1LL8 A;  5E43 A;  4UA9 A;  5JYP A;  1FIK A;  1VQQ A;  3BEC A;  4KZ4 A;  4QPR A;  3Q81 A;  4GD8 A;  3G32 A;  4DE2 A;  2J3T C;  4F3L B;  1U60 A;  1W5D A;  4QB8 A;  1P97 A;  2A49 A;  3BM6 A;  5J8X A;  3HVF A;  5FDS A;  1I2S A;  1KE3 A;  3LFV A;  1KE4 A;  3IF6 B;  4LGW A;  2Y2K A;  3MJQ A;  1ACF A;  3W4O A;  3WWX A;  1L0F A;  5J3W A;  1ZHH B;  4X69 A;  4IJG A;  1PWC A;  3H82 A;  1BT5 A;  3V39 A;  1RCJ A;  1TS7 A;  3BLM A;  2HJ9 C;  1PFL A;  1JVJ A;  3C7U A;  3MS6 A;  4FSF A;  1HLU P;  2J7V A;  2V0U A;  3S7P A;  3T4J A;  5FQJ A;  2FZ0 A;  2W3H A;  4PPR A;  1L2S A;  3T4K A;  2W3F A;  3K3D A;  3CZD A;  1IYP A;  4ZJ2 A;  3LEQ A;  1XGI A;  3QP2 A;  4WN5 A;  1ONH A;  4S2I A;  4X1M A;  4JGQ A;  1IKI A;  4LV2 A;  1I2W A;  1HD8 A;  1SDE A;  3HLB A;  3N8R A;  4RVA A;  2JKF A;  4JF5 A;  2AVX A;  3OPL A;  1F98 A;  2BAS A;  2VLG A;  5D3O A;  2XDM A;  3A3J A;  4P6Z S;  3VSL A;  3NOT C;  4F94 A;  3TG9 A;  1PIO A;  1WYC A;  4MBF A;  2MJ6 A;  4RX3 A;  3UN7 A;  3LUQ A;  1YLW A;  3H82 B;  3C7V A;  3K2N A;  1A0K A;  5TGF A;  2WKH A;  3A0V A;  1PI5 A;  4E04 A;  5CX7 A;  4U0T A;  1IYQ A;  4UQI S;  3EGX C;  3P01 A;  1ZG6 A;  1F5M A;  3FPW A;  1FCO A;  3PAE A;  1S1Z A;  2WZZ A;  2RL3 A;  4NXB A;  2PYR A;  1EW0 A;  1FSW A;  3OPP A;  4Y13 A;  4JXV A;  3BYD A;  3A3D A;  3NC8 A;  2HDU A;  5HDD A;  4WF0 A;  3W2Z A;  4KZ6 A;  2KOI A;  2VV8 A;  5I5L A;  4E3I A;  3MBZ A;  1MKI A;  1ONG A;  5J4E A;  1AWI A;  1OME A;  2KX6 A;  3Q7Z A;  4KZ7 A;  4EW7 A;  1W63 M;  3F1P A;  2XLN A;  1MC0 A;  4JF4 A;  4BQM A;  4DJ3 A;  4G3V A;  4CLC E;  4LCM A;  4HJ6 A;  4G3K A;  2H0Y A;  3LGO A;  1PWG A;  1FOF A;  2D01 A;  2WGW B;  2H28 A;  3BWL A;  3VE3 A;  5BOH A;  4DDS A;  1PRQ A;  5L2F A;  1MWS A;  2XD5 A;  1XJ2 A;  2NUP C;  4X56 A;  5TR7 A;  3DWK A;  3FZC A;  4NG2 A;  2Y2G A;  3EOI A;  3ZQ5 A;  4OON A;  4KQR A;  2LB9 A;  3LR5 A;  2IWD A;  1CEF A;  1MWT A;  4AFI A;  2Y91 A;  1H3Q A;  3IT9 A;  5EM1 A;  4YWZ A;  3BFF A;  5F1G A;  1IYO A;  3MXS A;  2CC1 A;  2XH9 A;  4OKP A;  2ZL1 B;  5FQK A;  3EQV A;  5DTS A;  2VX8 A;  5TBM A;  4LLO B;  1ODV A;  3VV4 A;  3OLO A;  2PYP A;  3OPH A;  5FEG A;  2O0Y A;  3F1P B;  2HF6 A;  1N9B A;  3VFH A;  4BLM A;  4IBR A;  5DKL A;  2L4R A;  5HAP A;  4NKP A;  4MBH A;  4EER A;  3E2L A;  2EX6 A;  5J7E A;  1XJ4 A;  4I38 A;  2P74 A;  2M1C A;  2QPN A;  1UWP X;  3BRM A;  1NY0 A;  2ZLY A;  3JYI A;  4II7 A;  3M6H A;  2XGN A;  4KUO A;  5FDH A;  1ZG4 A;  2C6W B;  1SKF A;  5HPI A;  3DTI A;  5A92 A;  1W7F A;  1E3U D;  3VSK A;  2X71 A;  3IXH A;  4HES A;  1PI4 A;  2IWB A;  2DNS A;  2HDR A;  3JPU A;  4PM6 A;  4ETX A;  1K56 A;  2ZQD A;  1S67 L;  3IXG A;  3ZCZ A;  2FFF B;  3BY9 A;  1T1C A;  2WKP A;  3G34 A;  4CLC A;  5AVE A;  5EPH A;  5TBM B;  4Y7P A;  1FR1 A;  3NBL A;  3EGD C;  1L0G A;  5E2G A;  4QD4 A;  3NI9 A;  4EET B;  4ZJ3 A;  1V9Z A;  4OP5 A;  3UMD A;  2Z6C A;  2NUT C;  4HH2 A;  1YKD A;  1BZA A;  3D72 A;  3SW1 A;  2L1M A;  4OLD A;  3RFB A;  3CLO A;  2C5W B;  4JF6 A;  2G2W A;  4L9F A;  2EFU A;  4MNR A;  3ICY A;  3ZNY A;  3O5Y A;  1WA9 A;  3A3I A;  5DKK A;  4CPK A;  4KZ9 A;  1DP8 A;  5HSQ A;  2PHY A;  2PRF A;  5EOO A;  2JC7 A;  3MKE A;  3LIA A;  1S0W A;  3UB9 A;  3CHW P;  2PDR A;  3LCE A;  3IWQ A;  3M6B A;  5AQB A;  4OOY A;  2HV1 A;  3N8L A;  1ES5 A;  1LT0 A;  2XR0 A;  2Y55 A;  3G2Y A;  3T12 B;  4CLC B;  4PAU A;  3UE1 A;  2W1R A;  1FQG A;  2ZMA A;  3NOP C;  3GMW A;  2Q0O A;  2VGL S;  3FKW A;  3QP8 A;  2XFS A;  4HNB A;  5E2H A;  3T4S A;  1PZP A;  3S4X A;  2JKT I;  1ZKJ A;  4MCW A;  5CED A;  3MFX A;  2UWX A;  3W4Q A;  3SS3 A;  4CQH A;  4JXS A;  3NHQ A;  2ZQ8 A;  2DCF A;  4P0M A;  3WS5 A;  1LLB A;  3AGF A;  4Y17 A;  3P98 A;  2HP9 A;  1E25 A;  1YMX A;  3SH9 A;  2Q9M A;  3KYQ A;  2XD1 A;  1TS6 A;  3QHY A;  2WKQ A;  2Y59 A;  4QY5 A;  5F6A A;  5DF8 A;  3UE6 A;  3KO6 A;  1MKM A;  3JVV A;  2WAF A;  4HHD A;  3PHY A;  1DJC A;  3TRC A;  1YSP A;  1FIL A;  3HUN A;  1JNU A;  4NXF A;  5HFO A;  4BD1 A;  4E3O A;  5LBR A;  3Q7V A;  2Y2Q A;  1S4S A;  4MEZ A;  1ESU A;  2XFT A;  3UY6 A;  1IEM A;  1N9O A;  5DVA A;  1W63 Q;  5F68 A;  1PZO A;  1T19 A;  3LIE A; 
#chains in the Genus database with same CATH homology
 1PFL A;  3MSH A;  3T1Q B;  3T12 B;  3MS6 A;  2V8F A;  5EV0 A;  1HLU P;  1VEU B;  1AWI A;  4D60 A;  3T1R A;  4X1L A;  3CPT A;  4FUW A;  2PBD P;  3T1S A;  2V8C A;  1D1J A;  1J3W A;  2ACG A;  1VET A;  3LEQ A;  3LGO A;  4ESP A;  4X1M A;  2B95 A;  1PRQ A;  2ZL1 A;  4QWO A;  3NUL A;  1CF0 A;  1VEU A;  1CQA A;  2PAV P;  2JKF A;  5EVE A;  2BTF P;  1Z09 A;  3U4L P;  1FIK A;  5FEF A;  1SKO B;  3L9K A;  1YPR A;  1F2K A;  3NEC A;  3L7H A;  5EM1 A;  3T1X A;  1A0K A;  2VK3 A;  1PNE A;  2JKG A;  2ZL1 B;  5FDS A;  3UB5 P;  1FIL A;  4FTX A;  5EM0 A;  1CJF A;  1Y4O A;  3CPT B;  2E8J A;  2PRF A;  1ACF A;  5FEG A;  4X25 A;  1SKO A;  1SZV A;  3DAV A;  3KYE A;  3CHW P;  3D9Y A;  1G5U A;  1VET B;  1K0K A;  2HZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...