5FEGA

Crystal structure of the dimeric allergen profilin (hev b 8)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
SWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 29
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fegA00
1YPRA 3CHWP 1K0KA 1CJFA 3U4LP 3NULA 3MSHA 3CPTA 4FTXA 3MS6A 1SKOB 4X1LA 3DAVA 5EVEA 1PFLA 1VETA 2PBDP 1CF0A 4X25A 3LEQA 5EM1A 2BTFP 2HZ5A 3T1QB 3CPTB 3T1RA 4ESPA 2E8JA 3L9KA 1G5UA 3NECA 1VETB 1PNEA 1A0KA 2PAVP 2JKGA 4FUWA 2PRFA 2VK3A 1SZVA 3KYEA 1D1JA 2B95A 3T12B 3L7HA 3UB5P 2V8FA 2JKFA 1AWIA 5FEFA 1F2KA 4QWOA 5EV0A 1PRQA 1CQAA 5FEGA 1SKOA 5EM0A 1FIKA 4X1MA 1Z09A 2V8CA 1HLUP 3LGOA 1J3WA 2ZL1A 1VEUA 1ACFA 1FILA 1Y4OA 4D60A 5FDSA 3T1XA 3D9YA 3T1SA 2ACGA 2ZL1B 1VEUB
chains in the Genus database with same CATH superfamily
3ZGAB 1MKIA 4OPRA 1S6RA 3NULA 4E3KA 1D06A 5DVAA 2E8IA 3QP6A 5HPFA 1LT0A 4IEDA 5F82A 4RQ9A 2NUTC 4GW9A 4WUJA 1BLHA 2OSUA 1H5XA 5FQIA 2HF6A 4S2LA 2XH9A 3NECA 3UDIA 1SZVA 4BL2A 3B42A 2QPNA 1FR1A 1K55C 2HP6A 3G30A 5G4ZA 3Q7VB 3NOPC 2XD5A 2P9VB 2QJ7A 2H28A 1H8MA 2Y2OA 4OVDA 1L2SA 3BRMA 3EQVA 1SDEA 3Q7ZA 4WZ5A 3MQQA 1GHPA 2OLVA 1OJ5A 2ZBBA 1XJ4A 5CX7A 1DJCA 4DN0A 3Q81A 3MBZA 3A0RA 4B93A 3ZNYA 5L2FA 3MMHA 1IKIA 5E43A 5AQ9A 1YAXA 4KG5A 2ZMVA 3RJUA 3G2ZA 5CEBA 4OOYA 1LSWA 4MCWA 3ULFA 1OTBA 5TGFA 4U0XA 2ZC3B 5A90A 2D02A 1IYOA 4HBTA 5U47A 3PBOA 3D9YA 5EECA 4ZTKA 4MN7A 4OQGA 2Y59A 5IHVA 3NJAA 3DTIA 5CXWA 4YNRA 3O86A 5I94A 3HCYA 3E2KA 4HP4A 5EVIA 2VA0A 1K6RA 2A24B 5DF8A 3VP0A 1CF0A 4OQHA 3C2WA 3C30A 4R70A 2BTFP 3T1QB 4I5SA 3HVFA 1PW8A 1YLYA 3DTEA 3BLSA 2E8JA 2PR6A 4DJ2A 1XFQA 2HPBA 5FAQA 2JKGA 4PM6A 2XR0A 1XJ6A 4HH2A 5L10A 3BWLA 5J3WA 5GHXA 3UDFA 1MY8A 3HJKA 1WYBA 1OT6A 2Y2KA 4GHIA 4XUZA 1YLWA 5AVFA 4Y2FA 3SH7A 4ZDXA 2XA7M 3NOUC 1EW0A 1KDWA 3H82A 4PM7A 2QZ6A 3BFCA 2ZQ9A 2QKPA 1BTLA 4KZ6A 1GA9A 4WMCD 1J3WA 4EBNA 4P87A 5A92A 1K4FA 3N8RA 4QD4A 4JKTA 4LRYC 1ZG6A 2DCFA 3IX4A 4LRZE 3V3SA 1FQGA 1OMEA 1MWTA 3N6IA 3IQAA 1E3UD 3ZG9B 5DTSA 3U4LP 3FKWA 4EV4A 3S7PA 4JF6A 5CECA 3KO6A 1SHVA 3IWIA 2FFYA 1XGIA 4Y3IA 4CLCB 2XFSA 1IYSA 1TS8A 4MDZA 2EX2A 3UMEA 4JLFA 2VV7A 4XT2B 3T1RA 1M6KA 1LI9A 1L0DA 4KQOA 4ESPA 4RVAA 3TW8A 1K56A 2R9XA 3UO9A 4NEED 4Y15A 3F1PB 3BECA 2VZWA 4GB7A 4FUWA 1LLBA 1QMEA 2Q9MA 4KENB 3VSKA 3IXHA 4NXFA 4R3JA 1VM1A 4LV1A 2WKHA 3IHBA 4CLCC 1ZC2A 1S0WA 5FQMA 3IBJA 4LV3A 4S2JA 4WF0A 2JKRI 3BY8A 4FH4A 3I7JA 4IBRA 2EX6A 2XEPA 3HUNA 3WS4A 2QJ5A 2Y2JA 4RYEA 2PBYA 3C7UA 3ZG7B 3VFHA 3IH9A 5JYOA 1CI8A 4BD0A 4L9FA 4H6JA 4BJPA 1PIOA 4KUKA 3Q82A 2WGWA 1SCWA 2A2LA 5A8BA 3RH8B 1HZOA 3ZHHA 3KYQA 1Z6FA 1ACFA 3IF5A 3UB9A 5HDCA 3VE3A 3RTYA 3T4JA 2OAP1 4H8RA 3KX0X 1W7FA 1BLPA 5AQAA 2XD1A 1N9NA 5EPHA 1NZOA 4OPYA 4IJGA 2Y91A 3MS6A 3CAXA 4WM9A 2ZLYA 4B4ZA 3W2ZA 2HV1A 4Z1WA 4LRXC 5EVEA 3EQUA 1T1BA 5EE8A 3UB7A 1LSXA 5EM1A 1UWPX 4HP9A 2XGNA 4EBLA 2DRWA 1M40A 1O07A 2JC7A 5HFOA 3CWFA 3W4OA 4EERA 2O9AA 2PAVP 3SS4A 4EW7A 1K57C 5L09A 3CI6A 4EUZA 3PBRA 4BLMA 4IUHA 2PHYA 1W8YA 3NI9A 1OTAA 2V9AA 5GLDA 3T4LA 3ZG5A 1ES3A 4GNUA 2PDRA 3NIAA 1F2KA 1L0FA 1PRQA 4N1HA 1RGYA 2WYXA 2XA7S 1WE4A 5EVID 4GOGA 4Q0HA 4EEUA 4GDBA 2V8CA 2WADA 3UPPA 5AQ7A 1MKMA 3CMZA 5IS1A 5D3OA 4GD8A 4WN5A 1G6AA 4EWFA 3C4OA 3SH8A 3VMAA 1YKDA 1XPBA 4NETA 1KE0A 2B02A 4XUXA 4R38A 2Y55A 2WUQA 2EX9A 1VEUB 4PPRA 3BM6A 3BY9A 2HJ9C 2EWWA 5EVLA 3PYPA 2VEAA 1NWZA 1STZA 4MBFA 3WRZA 4P6ZM 2FH5A 2P04A 1KOUA 3LYXA 1K54C 3LR5A 3DTMA 1TD5A 3ZNTA 5CERA 5L07A 5DKLA 4HBUA 3SW1A 4WEKA 4WZ4A 4K91A 3N7WA 3GDIA 1S4RA 2A49A 3L9KA 1K4EA 5CRFA 2W3FA 4E3NA 2YKFA 4JXGA 3G34A 2JBFA 3ITAA 4LGWA 4ME4A 2J80A 1ESUA 1S1ZA 1NXYA 2OWJA 5DFXA 3F1OA 3SZTA 2Z2MB 3IWQA 5CTNA 1VB6A 4I39A 3V5MA 2V1AA 5FI7A 2O9BA 2I72A 2EWVA 2J3TD 1DJBA 4X69A 2PYPA 3E98A 3QP4A 2V1BA 4BMWA 1K55A 1TEMA 2EX8A 3OPRA 5FQ9A 1G28A 1W5DA 2W3GA 3C4PA 4DE1A 3F1NA 1K56D 3T50A 3PHYA 4LPZA 4S2PA 3N8SA 4I3AA 4Q8IA 1ES5A 2ZQ7A 5HWVA 4FCFA 4Y5FA 1Q2PA 4EUVA 3WS5A 5TJJA 2P9VA 2QHKA 4YOFA 5HARA 2LB9A 2XRNA 3MF0A 1F98A 4II7A 3PR6A 4X55A 2RCXA 5CGSA 2PBDP 3ZVWA 1QMFA 3CZDA 4F3LB 4X25A 3P01A 5EUAA 1ES2A 3IWOA 3HLWA 3CUEA 4MBKA 3BJNA 5G4YA 3AGEA 2VGLM 5LBRA 3HLCA 3QP8A 1LHYA 1P9WA 2VK3A 4HY8A 4K08A 1JWVA 3MQOA 3LIAA 3M2KA 3LIBA 1XJ2A 1UWNX 2FFFB 2JHEA 1RCJA 5E2FA 2PT7A 4Z9QA 1GHIA 3MZDA 3LR0A 5J4EA 5GLCA 1F5MA 1CQAA 2Y2PA 2INWA 2ZD8A 2X01A 1FIKA 3ZFZA 2W3HA 5GHZA 4E3LA 2UWXA 5AQBA 4G3WA 2KOIA 4Q0JA 3BFGA 4GD6A 3HLEA 3SS5A 4ID4A 1XXMA 2LB5A 2ZQAA 4JGRA 3HLFA 3S7OA 1H8YA 4OH0A 4QY6A 3IBRA 1ZKJA 3TG9A 5FDSA 4DF6A 1LI0A 3C5AA 3KSIA 2OOLA 3PXPA 5FASA 4S2NC 3IT9A 5HL1A 1G68A 3HJIA 2WKPA 2Y2IA 3IH8A 4P6ZS 3PTEA 3A0SA 3O3VA 4PAUA 3ZG0A 1H8ZA 1OPXA 5J7EA 2BG1A 1T18A 3LO7A 2P7JA 1PI5A 5FAPA 5E2GA 4E3JA 3R4KA 3UY6A 3K3DA 3VV4A 4U0TA 1NLYA 3C7VA 1BLCA 1A0KA 4ETZA 2VX8A 3VFFA 3MFDA 3H9WA 4L9EA 1I5QA 3LR4A 3TJZC 3KSGA 5JYPA 3HREA 5A93A 3QP1A 1MWSA 5TBMB 4X56A 3S1YA 3RXWA 1XJ3A 4JXSA 3NHQA 3OOVA 4QWOA 1IYQA 1S66L 3O5YA 5AVEA 1IELA 2JKTM 3SH9A 3LR3A 5EM0A 4Y17A 3T4SA 1T19A 4FOFA 5DF9A 2PU2A 3V3RA 1MWUA 2Z6CA 3KYZA 4PM8A 4S2IA 2HJEA 1VQQA 1C3BA 3G32A 1NYYA 1Y4OA 2GDNA 1XGJA 3IXDA 1T1CA 3ZYTA 1LL9A 1MBLA 4N92A 4DXBA 5HZHA 4ARZA 3QNBA 4OP8A 1YPRA 3PAGA 3CHWP 4EU0A 4WZ5C 4IVKA 3UPOA 5FDHA 3CPTA 2MJ6A 5F6AA 2Y8HA 3EOIA 1IYPA 4BWIA 4DDSA 5HWWA 3WS0A 1S1YA 5EOOA 4MNRA 5DTKA 5HW3A 1W79A 4WLAA 4CJNA 4XXRA 4OOLA 3NDGA 1TDGA 5DF7A 2Y4AA 4S2KA 2L4RA 4WEJA 1LL8A 2C5WB 2VGLS 5FQKA 3GECA 4RX3A 4OP5A 3GV9A 5HPIA 3PBNA 4GS9A 4NKPA 1IKGA 2VGJA 5F68A 3Q1FA 3CJMA 1H3QA 1L0EA 2Z2LB 5CEDA 3OPLA 2B5RA 2R9WA 3R7WB 3SS3A 3ISGA 3HLDA 4M3KA 4PKYA 1BT5A 2H0TA 1XFNA 2DMWA 1IFQA 4I3JA 3NOTC 5FI2A 3BW6A 4PM5A 1K57A 2R78A 2XDMA 1X0OA 2G2WA 3VOZA 3LY3A 1TF1A 1WA9A 4I3IA 2K31A 4GJ4A 4R4SA 2XF3A 4E6XA 3MKEA 4GHIB 4HHDA 3P09A 4BD1A 1E25A 4L9GA 1Y54A 3MQ0A 3PBTA 2V0WA 4QB8A 3NCKA 2ZM8A 3DWKA 3CITA 4R3AA 3S4XA 5BOHA 4JBFA 5F83A 3WS2A 4DKIA 3NY4A 4R23A 3JVVA 3MR0A 1CJFA 1BUEA 3IX3A 4Y0UA 2IA2A 3QP5A 3T4TA 4LCMA 3ITBA 2ZMAA 3HLGA 1VETA 1O7EA 4C3QA 4LCLA 3JVUA 5FL3A 1G5UA 4K0WA 1ONGA 3T4KA 1K54A 2H5SA 3P98A 2M7UA 5KIZA 5M18A 1HTZA 2VLGA 5IU1A 4EQIA 3UB5P 3A3DA 3ZVTA 1KVMA 4LFUA 3FYZA 2V8FA 5HDDA 4HI4A 3V67A 3WS1A 4S2OA 4BBTA 2ZOHA 3ICYA 3AGFA 3K2NA 2KLIA 3D3OA 4NG2A 4HIAA 2X71A 4LLOB 1NYMA 3EEAA 2ZL1A 3UE6A 3GVBA 2YKHA 3MFXA 3N8LA 1WYCA 2HDSA 2WKQA 2M7VA 3KSHA 5HD5A 3LCEA 1YMXA 1PZOA 4E3MA 3DWZA 2EFUA 3IS2B 1OJGA 4QY5A 3A0VA 2NUPC 1LSVA 3W4PA 1SKOB 2K7SA 1DY6A 3G4PA 4UA7A 2HDUA 5HAQA 1GSVA 1ZG4A 3A3JA 1EROA 1SDNA 2HP9A 1JNUA 4HQAA 3FKVA 2HZ5A 4BENA 1BSGA 3S7QA 4KQRA 2GZAA 1ZTUA 4FSFA 4CLCD 4KZ4A 1YM1A 3IF6B 4OLGA 3ZG8B 2W1RA 1P97A 2VKSA 3A3EA 3NBLA 4BL3A 3MZEA 5TFQA 4EESA 2PD7A 2QYBA 2B18A 2PRFA 3RFBA 4N9LA 1FCOA 4EBPA 2W1TA 3GTCA 1EWZA 4BQMA 4R4RA 2JKTI 3G2YA 1ES4A 2W27A 4ZBEA 1FCNA 1AWIA 3H7WA 5E2HA 3LIEA 3GRJA 3IF6C 2VV6A 5GLBA 5FATA 1Q2QA 2Y2GA 4CQHA 1MPLA 4X1MA 1YSQA 3QNCA 1YMSA 1DP8A 2OWHA 3LIDA 4WL9A 2L1MA 2W3EA 4F3LA 2Y2MA 1W63M 2G2UA 2PD8A 1XP4A 2ZJ9A 2WZZA 3UMDA 1KGEA 3LI9A 4DE2A 2IWBA 4JF5A 3HUOA 3EWKA 1XX2A 3FV7A 1RGZA 3AGDA 1CK3A 3EEHA 5MC7A 2Y79A 3UNWA 3UE1A 3SOIA 4CPKA 2HDRA 2P74A 3OZHA 4X1LA 4S2MA 4GZBA 1ERQA 1V9YA 2ZC5B 5FA7A 4HNBA 3T4QA 4S2NA 1DP6A 3OC2A 2J7VA 4HEFA 1DP9A 1YLTA 2VGKA 3LUQA 4Y7PA 3Q7VA 4JXWA 3FC7A 3QP2A 1PWDA 3VE4A 1YT4A 4Y13A 3W8KA 1I2WA 1MC0A 3OLOA 4KG2A 3BLMA 1ERMA 5M1AA 4Y0TA 4P0MA 3GMWA 1BULA 1FOFA 4MN5A 2HDQA 4HJ6A 5FI6A 5GL9A 2XSSA 3M2JA 4UA6A 5EV0A 1YQSA 2EA9A 3F1OB 3HUMA 1BZAA 3M6BA 2VJWA 3MKFA 4U3TA 2O0YA 2GX5A 1NJ4A 4KZ9A 1V9ZA 4UAAA 1RP5A 3BEBA 3CG5A 4NXEA 1OTEA 2WAEA 3VOLA 1YLPA 3VP3A 3OPPA 1HVBA 1TS0A 3JYIA 5G18A 2WK0A 3F1NB 5L8MA 3WWXA 1IEMA 4R6LA 1K6SA 2A24A 2H10A 5F69A 4FH2A 1N9OA 3MSHA 4DXCA 4NXBA 3U2AA 3BYDA 5TBMA 1G6OA 3DAVA 1PI4A 3OCLA 1IOUA 1ZHHB 2ZQDA 4YINA 3PBSA 5KZHA 3B3XA 4GKUA 3ZDJA 1W8QA 1DRMA 1PWCA 2CC1A 2J9PA 2WGVA 3OBFA 3LY4A 1DJAA 4HJ3A 5FQJA 3A3IA 4EEPA 4OQ0A 1ALQA 1D1JA 4MBHA 5FQQA 3EGDC 1PWGA 1PYYA 5FAOA 4N1XA 2ZQCA 3MXQA 2JE5A 3L7HA 2C6WB 2DNSA 3E4PA 1T1AA 1I2SA 2L0WA 5FEFA 5HDSA 3FG8A 3DBAA 4QU3A 4GCZA 3E0YA 5KMWA 1S67L 4QJGA 3IXGA 4O0PA 2HP5A 3IX8A 5GHYA 4X6TA 2FZ0A 2JCHA 3CUEC 2IWDA 1H0MA 4K0XA 1N4OA 3S22A 2VV8A 1TS7A 3TOIA 3DW0A 3FPWA 4ZJ3A 1OT9A 2AVXA 3T1SA 2QWSA 2V2FF 1BLSA 5DFYA 3KSFA 5M19A 3WRTA 4CLCA 1UGUA 1XKZA 1K0KA 3R7WA 2XLNA 3TE8A 2BASA 3CLOA 4XT2A 1JTDA 4CLCE 4IHQA 4MEZA 4DDYA 3RXXA 4DJ3A 1PFLA 2WZXA 2OAQ1 1AXBA 4O8GA 3F1PA 1N9LA 2CMNA 4EQ1A 2Z6DA 3PAEA 5AJGA 4WELA 1OTDA 2XROA 5CHUA 5DJTA 2ZMFA 2M1CA 1PNEA 4O7DA 4LENA 4UQIM 3BFDA 3KYEA 4KZBA 3S7NA 1SKFA 4NK3A 2Q0OA 4ZJ2A 4AFIA 4R3BA 4KZ7A 2W0NA 1W63Q 1L3LA 4QHCA 4G3VA 3P7NA 3HLBA 4KQQA 5FSRA 1PW1A 1NY0A 1NRJA 5EVIB 3UPNA 4UEYA 3T4OA 2Q9NA 4MLLA 4OKPA 4WBGA 2P08A 1FCMA 4KZ3A 4I38A 4QPRA 4L0LA 4Q0IA 1HLUP 4E3OA 2ZC6B 1GA0A 5CHJA 2A3UA 2J3WA 4EXOA 3B33A 5EVIC 1VHMA 2EXBA 1FSWA 5EFWA 4GN2A 3MXSA 1P0ZA 2WAFA 2KDKA 1ODVA 2O9CA 5C5KA 3LI8A 1F9IA 2Y2HA 3D4FA 1BYWA 4RX2A 3LIFA 1KDSA 2GNXA 3H82B 2RL3A 1L0GA 2H0YA 4ARZB 2WKEA 2Y2QA 3O88A 4OLDA 4LV2A 2PU4A 4O01A 4OPZA 3LEQA 4B9OA 3CPTB 4NXGA 3M6HA 3QHYA 4OQIA 4KZ8A 1LL5A 1GSXA 2X02A 5F1GA 4D2OA 4E3IA 3LICA 4GDNA 3BQ8A 4ZRRA 3FWLA 3MZFA 4KQDA 1YSPA 2WKIA 2O99A 3PBQA 2W3DA 4P6BA 4PKYG 3UB6A 2XK1A 4GS9B 3ZQ5A 4E04A 2JKFA 4BBVA 3HL9A 5TR7A 5HL6A 4G3KA 4OPQA 3IS2A 4HJ4A 5FEGA 2K2NA 5F5YA 1MZUA 3VOYA 1K25A 1SKOA 4DRTA 2V20A 2I9VA 4Y0OA 4IVIA 4JGPA 3VP4A 4DE0A 4PMAA 5CTMA 2Y2NA 1CI9A 1XA7A 3A3FA 1U60A 1JWZA 4GLQA 3IXBA 5E2EA 4LV0A 3GSGA 1VEUA 3IHAA 2OV5A 5KSCA 1FILA 4R1GA 2J3TC 3GQZA 3IF6A 1KE3A 3N4IA 1YLZA 3LFVA 2ZQ8A 1KGFA 2WGIA 2ACGA 5HAIA 3UE0A 3MXRA 3HBRA 3G35A 4A5RA 5CGWA 2J9OA 4UA9A 4B4XA 3D72A 5HAPA 5KSHA 1P9RA 4F94A 4FTXA 3DTKA 5HSQA 3BFFA 3TSGA 4HOIA 4H6JB 1FR6A 3EGXC 4N9KA 2WGWB 4HESA 4OOMA 1NRFA 1TDLA 2D01A 1NZUA 1D7EA 4UHUA 3Q07A 4JGQA 4DE3A 1VETB 4JXVA 1HD8A 3B47A 1YLJA 3E4QA 4UQIS 3MJQA 1K38A 5K5BA 3BFEA 5EOEA 2B95A 5DTTA 4BBUA 2PR5A 1XA1A 3W4QA 4FD8A 2ZC4B 3JPUA 3VP1A 4YWZA 5HX9A 2UV0E 2GJ3A 3BQAA 3TRCA 4RA7A 4X68A 2ZC7A 2WKRA 1JWPA 5I5LA 3V39A 1J9MA 1TVFA 4JPMA 2XQZA 3E4OA 5A91A 1ESIA 2BLSA 2J8YA 3UN7A 3ZCZA 2ZOIA 3V50A 1KE4A 1KVLA 2IWCA 3K3CA 3LGOA 3UE3A 4YFMA 1FSYA 5CGXA 2V0UA 4C6YA 2QMIA 1OTIA 4OONA 2ZM0A 3T1XA 2ZL1B 2JN7A 4MMNA 4R0QA 1N9BA 2Y2LA 1JTGA 2PYRA 5DJUA 4M4XA 3VP2A 4WYYA 4MN6A 3OCNA 1ONHA 1E4DA 4KUOA 4PHTA 4C75A 3GR2A 2HGVA 3C8CA 4KZ5A 2OLUA 4JF4A 4P85A 4JGOA 4WMCA 4DMZA 3G6OA 5DKKA 1NLZA 1CEGA 5CHMA 2EXAA 4ZJ1A 3O87A 4PM9A 5F1FA 3VSLA 3T12B 4ETXA 4EETB 5J8XA 1MXOA 3NDEA 3FZCA 1Y28A 1E3UA 1CEFA 4B88A 2ZM2A 1GCEA 3NC8A 4IUKA 5HWTA 1MWRA 2W1TB 5HD3A 2EFXA 2JKRM 2KX6A 3UDXA 1S4SA 2G7UA 3E2LA 3C38A 4IBXA 1JVJA 1Z09A 4HH3A 3H7WB 4X53A 1EI5A 1KGGA 1TS6A 3UB8A 4E6WA 3FPVA 3LEZA 2XFTA 1GSWA 3OPHA 4ZAMA 4D60A 2V1ZA 1PZPA 3G31A 4KG6A 1GHMA 5GLAA 5IT5A 4KZAA
chains in the Genus database with same CATH topology
1YPRA 3CHWP 1K0KA 1CJFA 3U4LP 3NULA 3MSHA 3CPTA 4FTXA 3MS6A 1SKOB 4X1LA 3DAVA 5EVEA 1PFLA 1VETA 2PBDP 1CF0A 4X25A 3LEQA 5EM1A 2BTFP 2HZ5A 3T1QB 3CPTB 3T1RA 4ESPA 2E8JA 3L9KA 1G5UA 3NECA 1VETB 1PNEA 1A0KA 2PAVP 2JKGA 4FUWA 2PRFA 2VK3A 1SZVA 3KYEA 1D1JA 2B95A 3T12B 3L7HA 3UB5P 2V8FA 2JKFA 1AWIA 5FEFA 1F2KA 4QWOA 5EV0A 1PRQA 1CQAA 5FEGA 1SKOA 5EM0A 1FIKA 4X1MA 1Z09A 2V8CA 1HLUP 3LGOA 1J3WA 2ZL1A 1VEUA 1ACFA 1FILA 1Y4OA 4D60A 5FDSA 3T1XA 3D9YA 3T1SA 2ACGA 2ZL1B 1VEUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YPR A;  3CHW P;  1K0K A;  1CJF A;  3U4L P;  3NUL A;  3MSH A;  3CPT A;  4FTX A;  3MS6 A;  1SKO B;  4X1L A;  3DAV A;  5EVE A;  1PFL A;  1VET A;  2PBD P;  1CF0 A;  4X25 A;  3LEQ A;  5EM1 A;  2BTF P;  2HZ5 A;  3T1Q B;  3CPT B;  3T1R A;  4ESP A;  2E8J A;  3L9K A;  1G5U A;  3NEC A;  1VET B;  1PNE A;  1A0K A;  2PAV P;  2JKG A;  4FUW A;  2PRF A;  2VK3 A;  1SZV A;  3KYE A;  1D1J A;  2B95 A;  3T12 B;  3L7H A;  3UB5 P;  2V8F A;  2JKF A;  1AWI A;  5FEF A;  1F2K A;  4QWO A;  5EV0 A;  1PRQ A;  1CQA A;  5FEG A;  1SKO A;  5EM0 A;  1FIK A;  4X1M A;  1Z09 A;  2V8C A;  1HLU P;  3LGO A;  1J3W A;  2ZL1 A;  1VEU A;  1ACF A;  1FIL A;  1Y4O A;  4D60 A;  5FDS A;  3T1X A;  3D9Y A;  3T1S A;  2ACG A;  2ZL1 B;  1VEU B; 
#chains in the Genus database with same CATH topology
 3ZGA B;  1MKI A;  4OPR A;  1S6R A;  3NUL A;  4E3K A;  1D06 A;  5DVA A;  2E8I A;  3QP6 A;  5HPF A;  1LT0 A;  4IED A;  5F82 A;  4RQ9 A;  2NUT C;  4GW9 A;  4WUJ A;  1BLH A;  2OSU A;  1H5X A;  5FQI A;  2HF6 A;  4S2L A;  2XH9 A;  3NEC A;  3UDI A;  1SZV A;  4BL2 A;  3B42 A;  2QPN A;  1FR1 A;  1K55 C;  2HP6 A;  3G30 A;  5G4Z A;  3Q7V B;  3NOP C;  2XD5 A;  2P9V B;  2QJ7 A;  2H28 A;  1H8M A;  2Y2O A;  4OVD A;  1L2S A;  3BRM A;  3EQV A;  1SDE A;  3Q7Z A;  4WZ5 A;  3MQQ A;  1GHP A;  2OLV A;  1OJ5 A;  2ZBB A;  1XJ4 A;  5CX7 A;  1DJC A;  4DN0 A;  3Q81 A;  3MBZ A;  3A0R A;  4B93 A;  3ZNY A;  5L2F A;  3MMH A;  1IKI A;  5E43 A;  5AQ9 A;  1YAX A;  4KG5 A;  2ZMV A;  3RJU A;  3G2Z A;  5CEB A;  4OOY A;  1LSW A;  4MCW A;  3ULF A;  1OTB A;  5TGF A;  4U0X A;  2ZC3 B;  5A90 A;  2D02 A;  1IYO A;  4HBT A;  5U47 A;  3PBO A;  3D9Y A;  5EEC A;  4ZTK A;  4MN7 A;  4OQG A;  2Y59 A;  5IHV A;  3NJA A;  3DTI A;  5CXW A;  4YNR A;  3O86 A;  5I94 A;  3HCY A;  3E2K A;  4HP4 A;  5EVI A;  2VA0 A;  1K6R A;  2A24 B;  5DF8 A;  3VP0 A;  1CF0 A;  4OQH A;  3C2W A;  3C30 A;  4R70 A;  2BTF P;  3T1Q B;  4I5S A;  3HVF A;  1PW8 A;  1YLY A;  3DTE A;  3BLS A;  2E8J A;  2PR6 A;  4DJ2 A;  1XFQ A;  2HPB A;  5FAQ A;  2JKG A;  4PM6 A;  2XR0 A;  1XJ6 A;  4HH2 A;  5L10 A;  3BWL A;  5J3W A;  5GHX A;  3UDF A;  1MY8 A;  3HJK A;  1WYB A;  1OT6 A;  2Y2K A;  4GHI A;  4XUZ A;  1YLW A;  5AVF A;  4Y2F A;  3SH7 A;  4ZDX A;  2XA7 M;  3NOU C;  1EW0 A;  1KDW A;  3H82 A;  4PM7 A;  2QZ6 A;  3BFC A;  2ZQ9 A;  2QKP A;  1BTL A;  4KZ6 A;  1GA9 A;  4WMC D;  1J3W A;  4EBN A;  4P87 A;  5A92 A;  1K4F A;  3N8R A;  4QD4 A;  4JKT A;  4LRY C;  1ZG6 A;  2DCF A;  3IX4 A;  4LRZ E;  3V3S A;  1FQG A;  1OME A;  1MWT A;  3N6I A;  3IQA A;  1E3U D;  3ZG9 B;  5DTS A;  3U4L P;  3FKW A;  4EV4 A;  3S7P A;  4JF6 A;  5CEC A;  3KO6 A;  1SHV A;  3IWI A;  2FFY A;  1XGI A;  4Y3I A;  4CLC B;  2XFS A;  1IYS A;  1TS8 A;  4MDZ A;  2EX2 A;  3UME A;  4JLF A;  2VV7 A;  4XT2 B;  3T1R A;  1M6K A;  1LI9 A;  1L0D A;  4KQO A;  4ESP A;  4RVA A;  3TW8 A;  1K56 A;  2R9X A;  3UO9 A;  4NEE D;  4Y15 A;  3F1P B;  3BEC A;  2VZW A;  4GB7 A;  4FUW A;  1LLB A;  1QME A;  2Q9M A;  4KEN B;  3VSK A;  3IXH A;  4NXF A;  4R3J A;  1VM1 A;  4LV1 A;  2WKH A;  3IHB A;  4CLC C;  1ZC2 A;  1S0W A;  5FQM A;  3IBJ A;  4LV3 A;  4S2J A;  4WF0 A;  2JKR I;  3BY8 A;  4FH4 A;  3I7J A;  4IBR A;  2EX6 A;  2XEP A;  3HUN A;  3WS4 A;  2QJ5 A;  2Y2J A;  4RYE A;  2PBY A;  3C7U A;  3ZG7 B;  3VFH A;  3IH9 A;  5JYO A;  1CI8 A;  4BD0 A;  4L9F A;  4H6J A;  4BJP A;  1PIO A;  4KUK A;  3Q82 A;  2WGW A;  1SCW A;  2A2L A;  5A8B A;  3RH8 B;  1HZO A;  3ZHH A;  3KYQ A;  1Z6F A;  1ACF A;  3IF5 A;  3UB9 A;  5HDC A;  3VE3 A;  3RTY A;  3T4J A;  2OAP 1;  4H8R A;  3KX0 X;  1W7F A;  1BLP A;  5AQA A;  2XD1 A;  1N9N A;  5EPH A;  1NZO A;  4OPY A;  4IJG A;  2Y91 A;  3MS6 A;  3CAX A;  4WM9 A;  2ZLY A;  4B4Z A;  3W2Z A;  2HV1 A;  4Z1W A;  4LRX C;  5EVE A;  3EQU A;  1T1B A;  5EE8 A;  3UB7 A;  1LSX A;  5EM1 A;  1UWP X;  4HP9 A;  2XGN A;  4EBL A;  2DRW A;  1M40 A;  1O07 A;  2JC7 A;  5HFO A;  3CWF A;  3W4O A;  4EER A;  2O9A A;  2PAV P;  3SS4 A;  4EW7 A;  1K57 C;  5L09 A;  3CI6 A;  4EUZ A;  3PBR A;  4BLM A;  4IUH A;  2PHY A;  1W8Y A;  3NI9 A;  1OTA A;  2V9A A;  5GLD A;  3T4L A;  3ZG5 A;  1ES3 A;  4GNU A;  2PDR A;  3NIA A;  1F2K A;  1L0F A;  1PRQ A;  4N1H A;  1RGY A;  2WYX A;  2XA7 S;  1WE4 A;  5EVI D;  4GOG A;  4Q0H A;  4EEU A;  4GDB A;  2V8C A;  2WAD A;  3UPP A;  5AQ7 A;  1MKM A;  3CMZ A;  5IS1 A;  5D3O A;  4GD8 A;  4WN5 A;  1G6A A;  4EWF A;  3C4O A;  3SH8 A;  3VMA A;  1YKD A;  1XPB A;  4NET A;  1KE0 A;  2B02 A;  4XUX A;  4R38 A;  2Y55 A;  2WUQ A;  2EX9 A;  1VEU B;  4PPR A;  3BM6 A;  3BY9 A;  2HJ9 C;  2EWW A;  5EVL A;  3PYP A;  2VEA A;  1NWZ A;  1STZ A;  4MBF A;  3WRZ A;  4P6Z M;  2FH5 A;  2P04 A;  1KOU A;  3LYX A;  1K54 C;  3LR5 A;  3DTM A;  1TD5 A;  3ZNT A;  5CER A;  5L07 A;  5DKL A;  4HBU A;  3SW1 A;  4WEK A;  4WZ4 A;  4K91 A;  3N7W A;  3GDI A;  1S4R A;  2A49 A;  3L9K A;  1K4E A;  5CRF A;  2W3F A;  4E3N A;  2YKF A;  4JXG A;  3G34 A;  2JBF A;  3ITA A;  4LGW A;  4ME4 A;  2J80 A;  1ESU A;  1S1Z A;  1NXY A;  2OWJ A;  5DFX A;  3F1O A;  3SZT A;  2Z2M B;  3IWQ A;  5CTN A;  1VB6 A;  4I39 A;  3V5M A;  2V1A A;  5FI7 A;  2O9B A;  2I72 A;  2EWV A;  2J3T D;  1DJB A;  4X69 A;  2PYP A;  3E98 A;  3QP4 A;  2V1B A;  4BMW A;  1K55 A;  1TEM A;  2EX8 A;  3OPR A;  5FQ9 A;  1G28 A;  1W5D A;  2W3G A;  3C4P A;  4DE1 A;  3F1N A;  1K56 D;  3T50 A;  3PHY A;  4LPZ A;  4S2P A;  3N8S A;  4I3A A;  4Q8I A;  1ES5 A;  2ZQ7 A;  5HWV A;  4FCF A;  4Y5F A;  1Q2P A;  4EUV A;  3WS5 A;  5TJJ A;  2P9V A;  2QHK A;  4YOF A;  5HAR A;  2LB9 A;  2XRN A;  3MF0 A;  1F98 A;  4II7 A;  3PR6 A;  4X55 A;  2RCX A;  5CGS A;  2PBD P;  3ZVW A;  1QMF A;  3CZD A;  4F3L B;  4X25 A;  3P01 A;  5EUA A;  1ES2 A;  3IWO A;  3HLW A;  3CUE A;  4MBK A;  3BJN A;  5G4Y A;  3AGE A;  2VGL M;  5LBR A;  3HLC A;  3QP8 A;  1LHY A;  1P9W A;  2VK3 A;  4HY8 A;  4K08 A;  1JWV A;  3MQO A;  3LIA A;  3M2K A;  3LIB A;  1XJ2 A;  1UWN X;  2FFF B;  2JHE A;  1RCJ A;  5E2F A;  2PT7 A;  4Z9Q A;  1GHI A;  3MZD A;  3LR0 A;  5J4E A;  5GLC A;  1F5M A;  1CQA A;  2Y2P A;  2INW A;  2ZD8 A;  2X01 A;  1FIK A;  3ZFZ A;  2W3H A;  5GHZ A;  4E3L A;  2UWX A;  5AQB A;  4G3W A;  2KOI A;  4Q0J A;  3BFG A;  4GD6 A;  3HLE A;  3SS5 A;  4ID4 A;  1XXM A;  2LB5 A;  2ZQA A;  4JGR A;  3HLF A;  3S7O A;  1H8Y A;  4OH0 A;  4QY6 A;  3IBR A;  1ZKJ A;  3TG9 A;  5FDS A;  4DF6 A;  1LI0 A;  3C5A A;  3KSI A;  2OOL A;  3PXP A;  5FAS A;  4S2N C;  3IT9 A;  5HL1 A;  1G68 A;  3HJI A;  2WKP A;  2Y2I A;  3IH8 A;  4P6Z S;  3PTE A;  3A0S A;  3O3V A;  4PAU A;  3ZG0 A;  1H8Z A;  1OPX A;  5J7E A;  2BG1 A;  1T18 A;  3LO7 A;  2P7J A;  1PI5 A;  5FAP A;  5E2G A;  4E3J A;  3R4K A;  3UY6 A;  3K3D A;  3VV4 A;  4U0T A;  1NLY A;  3C7V A;  1BLC A;  1A0K A;  4ETZ A;  2VX8 A;  3VFF A;  3MFD A;  3H9W A;  4L9E A;  1I5Q A;  3LR4 A;  3TJZ C;  3KSG A;  5JYP A;  3HRE A;  5A93 A;  3QP1 A;  1MWS A;  5TBM B;  4X56 A;  3S1Y A;  3RXW A;  1XJ3 A;  4JXS A;  3NHQ A;  3OOV A;  4QWO A;  1IYQ A;  1S66 L;  3O5Y A;  5AVE A;  1IEL A;  2JKT M;  3SH9 A;  3LR3 A;  5EM0 A;  4Y17 A;  3T4S A;  1T19 A;  4FOF A;  5DF9 A;  2PU2 A;  3V3R A;  1MWU A;  2Z6C A;  3KYZ A;  4PM8 A;  4S2I A;  2HJE A;  1VQQ A;  1C3B A;  3G32 A;  1NYY A;  1Y4O A;  2GDN A;  1XGJ A;  3IXD A;  1T1C A;  3ZYT A;  1LL9 A;  1MBL A;  4N92 A;  4DXB A;  5HZH A;  4ARZ A;  3QNB A;  4OP8 A;  1YPR A;  3PAG A;  3CHW P;  4EU0 A;  4WZ5 C;  4IVK A;  3UPO A;  5FDH A;  3CPT A;  2MJ6 A;  5F6A A;  2Y8H A;  3EOI A;  1IYP A;  4BWI A;  4DDS A;  5HWW A;  3WS0 A;  1S1Y A;  5EOO A;  4MNR A;  5DTK A;  5HW3 A;  1W79 A;  4WLA A;  4CJN A;  4XXR A;  4OOL A;  3NDG A;  1TDG A;  5DF7 A;  2Y4A A;  4S2K A;  2L4R A;  4WEJ A;  1LL8 A;  2C5W B;  2VGL S;  5FQK A;  3GEC A;  4RX3 A;  4OP5 A;  3GV9 A;  5HPI A;  3PBN A;  4GS9 A;  4NKP A;  1IKG A;  2VGJ A;  5F68 A;  3Q1F A;  3CJM A;  1H3Q A;  1L0E A;  2Z2L B;  5CED A;  3OPL A;  2B5R A;  2R9W A;  3R7W B;  3SS3 A;  3ISG A;  3HLD A;  4M3K A;  4PKY A;  1BT5 A;  2H0T A;  1XFN A;  2DMW A;  1IFQ A;  4I3J A;  3NOT C;  5FI2 A;  3BW6 A;  4PM5 A;  1K57 A;  2R78 A;  2XDM A;  1X0O A;  2G2W A;  3VOZ A;  3LY3 A;  1TF1 A;  1WA9 A;  4I3I A;  2K31 A;  4GJ4 A;  4R4S A;  2XF3 A;  4E6X A;  3MKE A;  4GHI B;  4HHD A;  3P09 A;  4BD1 A;  1E25 A;  4L9G A;  1Y54 A;  3MQ0 A;  3PBT A;  2V0W A;  4QB8 A;  3NCK A;  2ZM8 A;  3DWK A;  3CIT A;  4R3A A;  3S4X A;  5BOH A;  4JBF A;  5F83 A;  3WS2 A;  4DKI A;  3NY4 A;  4R23 A;  3JVV A;  3MR0 A;  1CJF A;  1BUE A;  3IX3 A;  4Y0U A;  2IA2 A;  3QP5 A;  3T4T A;  4LCM A;  3ITB A;  2ZMA A;  3HLG A;  1VET A;  1O7E A;  4C3Q A;  4LCL A;  3JVU A;  5FL3 A;  1G5U A;  4K0W A;  1ONG A;  3T4K A;  1K54 A;  2H5S A;  3P98 A;  2M7U A;  5KIZ A;  5M18 A;  1HTZ A;  2VLG A;  5IU1 A;  4EQI A;  3UB5 P;  3A3D A;  3ZVT A;  1KVM A;  4LFU A;  3FYZ A;  2V8F A;  5HDD A;  4HI4 A;  3V67 A;  3WS1 A;  4S2O A;  4BBT A;  2ZOH A;  3ICY A;  3AGF A;  3K2N A;  2KLI A;  3D3O A;  4NG2 A;  4HIA A;  2X71 A;  4LLO B;  1NYM A;  3EEA A;  2ZL1 A;  3UE6 A;  3GVB A;  2YKH A;  3MFX A;  3N8L A;  1WYC A;  2HDS A;  2WKQ A;  2M7V A;  3KSH A;  5HD5 A;  3LCE A;  1YMX A;  1PZO A;  4E3M A;  3DWZ A;  2EFU A;  3IS2 B;  1OJG A;  4QY5 A;  3A0V A;  2NUP C;  1LSV A;  3W4P A;  1SKO B;  2K7S A;  1DY6 A;  3G4P A;  4UA7 A;  2HDU A;  5HAQ A;  1GSV A;  1ZG4 A;  3A3J A;  1ERO A;  1SDN A;  2HP9 A;  1JNU A;  4HQA A;  3FKV A;  2HZ5 A;  4BEN A;  1BSG A;  3S7Q A;  4KQR A;  2GZA A;  1ZTU A;  4FSF A;  4CLC D;  4KZ4 A;  1YM1 A;  3IF6 B;  4OLG A;  3ZG8 B;  2W1R A;  1P97 A;  2VKS A;  3A3E A;  3NBL A;  4BL3 A;  3MZE A;  5TFQ A;  4EES A;  2PD7 A;  2QYB A;  2B18 A;  2PRF A;  3RFB A;  4N9L A;  1FCO A;  4EBP A;  2W1T A;  3GTC A;  1EWZ A;  4BQM A;  4R4R A;  2JKT I;  3G2Y A;  1ES4 A;  2W27 A;  4ZBE A;  1FCN A;  1AWI A;  3H7W A;  5E2H A;  3LIE A;  3GRJ A;  3IF6 C;  2VV6 A;  5GLB A;  5FAT A;  1Q2Q A;  2Y2G A;  4CQH A;  1MPL A;  4X1M A;  1YSQ A;  3QNC A;  1YMS A;  1DP8 A;  2OWH A;  3LID A;  4WL9 A;  2L1M A;  2W3E A;  4F3L A;  2Y2M A;  1W63 M;  2G2U A;  2PD8 A;  1XP4 A;  2ZJ9 A;  2WZZ A;  3UMD A;  1KGE A;  3LI9 A;  4DE2 A;  2IWB A;  4JF5 A;  3HUO A;  3EWK A;  1XX2 A;  3FV7 A;  1RGZ A;  3AGD A;  1CK3 A;  3EEH A;  5MC7 A;  2Y79 A;  3UNW A;  3UE1 A;  3SOI A;  4CPK A;  2HDR A;  2P74 A;  3OZH A;  4X1L A;  4S2M A;  4GZB A;  1ERQ A;  1V9Y A;  2ZC5 B;  5FA7 A;  4HNB A;  3T4Q A;  4S2N A;  1DP6 A;  3OC2 A;  2J7V A;  4HEF A;  1DP9 A;  1YLT A;  2VGK A;  3LUQ A;  4Y7P A;  3Q7V A;  4JXW A;  3FC7 A;  3QP2 A;  1PWD A;  3VE4 A;  1YT4 A;  4Y13 A;  3W8K A;  1I2W A;  1MC0 A;  3OLO A;  4KG2 A;  3BLM A;  1ERM A;  5M1A A;  4Y0T A;  4P0M A;  3GMW A;  1BUL A;  1FOF A;  4MN5 A;  2HDQ A;  4HJ6 A;  5FI6 A;  5GL9 A;  2XSS A;  3M2J A;  4UA6 A;  5EV0 A;  1YQS A;  2EA9 A;  3F1O B;  3HUM A;  1BZA A;  3M6B A;  2VJW A;  3MKF A;  4U3T A;  2O0Y A;  2GX5 A;  1NJ4 A;  4KZ9 A;  1V9Z A;  4UAA A;  1RP5 A;  3BEB A;  3CG5 A;  4NXE A;  1OTE A;  2WAE A;  3VOL A;  1YLP A;  3VP3 A;  3OPP A;  1HVB A;  1TS0 A;  3JYI A;  5G18 A;  2WK0 A;  3F1N B;  5L8M A;  3WWX A;  1IEM A;  4R6L A;  1K6S A;  2A24 A;  2H10 A;  5F69 A;  4FH2 A;  1N9O A;  3MSH A;  4DXC A;  4NXB A;  3U2A A;  3BYD A;  5TBM A;  1G6O A;  3DAV A;  1PI4 A;  3OCL A;  1IOU A;  1ZHH B;  2ZQD A;  4YIN A;  3PBS A;  5KZH A;  3B3X A;  4GKU A;  3ZDJ A;  1W8Q A;  1DRM A;  1PWC A;  2CC1 A;  2J9P A;  2WGV A;  3OBF A;  3LY4 A;  1DJA A;  4HJ3 A;  5FQJ A;  3A3I A;  4EEP A;  4OQ0 A;  1ALQ A;  1D1J A;  4MBH A;  5FQQ A;  3EGD C;  1PWG A;  1PYY A;  5FAO A;  4N1X A;  2ZQC A;  3MXQ A;  2JE5 A;  3L7H A;  2C6W B;  2DNS A;  3E4P A;  1T1A A;  1I2S A;  2L0W A;  5FEF A;  5HDS A;  3FG8 A;  3DBA A;  4QU3 A;  4GCZ A;  3E0Y A;  5KMW A;  1S67 L;  4QJG A;  3IXG A;  4O0P A;  2HP5 A;  3IX8 A;  5GHY A;  4X6T A;  2FZ0 A;  2JCH A;  3CUE C;  2IWD A;  1H0M A;  4K0X A;  1N4O A;  3S22 A;  2VV8 A;  1TS7 A;  3TOI A;  3DW0 A;  3FPW A;  4ZJ3 A;  1OT9 A;  2AVX A;  3T1S A;  2QWS A;  2V2F F;  1BLS A;  5DFY A;  3KSF A;  5M19 A;  3WRT A;  4CLC A;  1UGU A;  1XKZ A;  1K0K A;  3R7W A;  2XLN A;  3TE8 A;  2BAS A;  3CLO A;  4XT2 A;  1JTD A;  4CLC E;  4IHQ A;  4MEZ A;  4DDY A;  3RXX A;  4DJ3 A;  1PFL A;  2WZX A;  2OAQ 1;  1AXB A;  4O8G A;  3F1P A;  1N9L A;  2CMN A;  4EQ1 A;  2Z6D A;  3PAE A;  5AJG A;  4WEL A;  1OTD A;  2XRO A;  5CHU A;  5DJT A;  2ZMF A;  2M1C A;  1PNE A;  4O7D A;  4LEN A;  4UQI M;  3BFD A;  3KYE A;  4KZB A;  3S7N A;  1SKF A;  4NK3 A;  2Q0O A;  4ZJ2 A;  4AFI A;  4R3B A;  4KZ7 A;  2W0N A;  1W63 Q;  1L3L A;  4QHC A;  4G3V A;  3P7N A;  3HLB A;  4KQQ A;  5FSR A;  1PW1 A;  1NY0 A;  1NRJ A;  5EVI B;  3UPN A;  4UEY A;  3T4O A;  2Q9N A;  4MLL A;  4OKP A;  4WBG A;  2P08 A;  1FCM A;  4KZ3 A;  4I38 A;  4QPR A;  4L0L A;  4Q0I A;  1HLU P;  4E3O A;  2ZC6 B;  1GA0 A;  5CHJ A;  2A3U A;  2J3W A;  4EXO A;  3B33 A;  5EVI C;  1VHM A;  2EXB A;  1FSW A;  5EFW A;  4GN2 A;  3MXS A;  1P0Z A;  2WAF A;  2KDK A;  1ODV A;  2O9C A;  5C5K A;  3LI8 A;  1F9I A;  2Y2H A;  3D4F A;  1BYW A;  4RX2 A;  3LIF A;  1KDS A;  2GNX A;  3H82 B;  2RL3 A;  1L0G A;  2H0Y A;  4ARZ B;  2WKE A;  2Y2Q A;  3O88 A;  4OLD A;  4LV2 A;  2PU4 A;  4O01 A;  4OPZ A;  3LEQ A;  4B9O A;  3CPT B;  4NXG A;  3M6H A;  3QHY A;  4OQI A;  4KZ8 A;  1LL5 A;  1GSX A;  2X02 A;  5F1G A;  4D2O A;  4E3I A;  3LIC A;  4GDN A;  3BQ8 A;  4ZRR A;  3FWL A;  3MZF A;  4KQD A;  1YSP A;  2WKI A;  2O99 A;  3PBQ A;  2W3D A;  4P6B A;  4PKY G;  3UB6 A;  2XK1 A;  4GS9 B;  3ZQ5 A;  4E04 A;  2JKF A;  4BBV A;  3HL9 A;  5TR7 A;  5HL6 A;  4G3K A;  4OPQ A;  3IS2 A;  4HJ4 A;  5FEG A;  2K2N A;  5F5Y A;  1MZU A;  3VOY A;  1K25 A;  1SKO A;  4DRT A;  2V20 A;  2I9V A;  4Y0O A;  4IVI A;  4JGP A;  3VP4 A;  4DE0 A;  4PMA A;  5CTM A;  2Y2N A;  1CI9 A;  1XA7 A;  3A3F A;  1U60 A;  1JWZ A;  4GLQ A;  3IXB A;  5E2E A;  4LV0 A;  3GSG A;  1VEU A;  3IHA A;  2OV5 A;  5KSC A;  1FIL A;  4R1G A;  2J3T C;  3GQZ A;  3IF6 A;  1KE3 A;  3N4I A;  1YLZ A;  3LFV A;  2ZQ8 A;  1KGF A;  2WGI A;  2ACG A;  5HAI A;  3UE0 A;  3MXR A;  3HBR A;  3G35 A;  4A5R A;  5CGW A;  2J9O A;  4UA9 A;  4B4X A;  3D72 A;  5HAP A;  5KSH A;  1P9R A;  4F94 A;  4FTX A;  3DTK A;  5HSQ A;  3BFF A;  3TSG A;  4HOI A;  4H6J B;  1FR6 A;  3EGX C;  4N9K A;  2WGW B;  4HES A;  4OOM A;  1NRF A;  1TDL A;  2D01 A;  1NZU A;  1D7E A;  4UHU A;  3Q07 A;  4JGQ A;  4DE3 A;  1VET B;  4JXV A;  1HD8 A;  3B47 A;  1YLJ A;  3E4Q A;  4UQI S;  3MJQ A;  1K38 A;  5K5B A;  3BFE A;  5EOE A;  2B95 A;  5DTT A;  4BBU A;  2PR5 A;  1XA1 A;  3W4Q A;  4FD8 A;  2ZC4 B;  3JPU A;  3VP1 A;  4YWZ A;  5HX9 A;  2UV0 E;  2GJ3 A;  3BQA A;  3TRC A;  4RA7 A;  4X68 A;  2ZC7 A;  2WKR A;  1JWP A;  5I5L A;  3V39 A;  1J9M A;  1TVF A;  4JPM A;  2XQZ A;  3E4O A;  5A91 A;  1ESI A;  2BLS A;  2J8Y A;  3UN7 A;  3ZCZ A;  2ZOI A;  3V50 A;  1KE4 A;  1KVL A;  2IWC A;  3K3C A;  3LGO A;  3UE3 A;  4YFM A;  1FSY A;  5CGX A;  2V0U A;  4C6Y A;  2QMI A;  1OTI A;  4OON A;  2ZM0 A;  3T1X A;  2ZL1 B;  2JN7 A;  4MMN A;  4R0Q A;  1N9B A;  2Y2L A;  1JTG A;  2PYR A;  5DJU A;  4M4X A;  3VP2 A;  4WYY A;  4MN6 A;  3OCN A;  1ONH A;  1E4D A;  4KUO A;  4PHT A;  4C75 A;  3GR2 A;  2HGV A;  3C8C A;  4KZ5 A;  2OLU A;  4JF4 A;  4P85 A;  4JGO A;  4WMC A;  4DMZ A;  3G6O A;  5DKK A;  1NLZ A;  1CEG A;  5CHM A;  2EXA A;  4ZJ1 A;  3O87 A;  4PM9 A;  5F1F A;  3VSL A;  3T12 B;  4ETX A;  4EET B;  5J8X A;  1MXO A;  3NDE A;  3FZC A;  1Y28 A;  1E3U A;  1CEF A;  4B88 A;  2ZM2 A;  1GCE A;  3NC8 A;  4IUK A;  5HWT A;  1MWR A;  2W1T B;  5HD3 A;  2EFX A;  2JKR M;  2KX6 A;  3UDX A;  1S4S A;  2G7U A;  3E2L A;  3C38 A;  4IBX A;  1JVJ A;  1Z09 A;  4HH3 A;  3H7W B;  4X53 A;  1EI5 A;  1KGG A;  1TS6 A;  3UB8 A;  4E6W A;  3FPV A;  3LEZ A;  2XFT A;  1GSW A;  3OPH A;  4ZAM A;  4D60 A;  2V1Z A;  1PZP A;  3G31 A;  4KG6 A;  1GHM A;  5GLA A;  5IT5 A;  4KZA A; 
#chains in the Genus database with same CATH homology
 1YPR A;  3CHW P;  1K0K A;  1CJF A;  3U4L P;  3NUL A;  3MSH A;  3CPT A;  4FTX A;  3MS6 A;  1SKO B;  4X1L A;  3DAV A;  5EVE A;  1PFL A;  1VET A;  2PBD P;  1CF0 A;  4X25 A;  3LEQ A;  5EM1 A;  2BTF P;  2HZ5 A;  3T1Q B;  3CPT B;  3T1R A;  4ESP A;  2E8J A;  3L9K A;  1G5U A;  3NEC A;  1VET B;  1PNE A;  1A0K A;  2PAV P;  2JKG A;  4FUW A;  2PRF A;  2VK3 A;  1SZV A;  3KYE A;  1D1J A;  2B95 A;  3T12 B;  3L7H A;  3UB5 P;  2V8F A;  2JKF A;  1AWI A;  5FEF A;  1F2K A;  4QWO A;  5EV0 A;  1PRQ A;  1CQA A;  5FEG A;  1SKO A;  5EM0 A;  1FIK A;  4X1M A;  1Z09 A;  2V8C A;  1HLU P;  3LGO A;  1J3W A;  2ZL1 A;  1VEU A;  1ACF A;  1FIL A;  1Y4O A;  4D60 A;  5FDS A;  3T1X A;  3D9Y A;  3T1S A;  2ACG A;  2ZL1 B;  1VEU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...