5FFAA

Copm (with an n-terminal his-tag) in the apo form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
152
structure length
135
Chain Sequence
WTDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWFKRPVPAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopM
publication title Structural basis for copper/silver binding by the Synechocystis metallochaperone CopM
doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 58
structure length 135
sequence length 152
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5ffaA00
2ZA7A 1NF6A 3E2CA 5AXSA 1XZ3A 2CHIA 2FG8A 2Y3QA 3Q4RA 2V2PA 4MY7A 2GS4A 3EGMA 4ERUA 2ZG7X 1LKPA 1B71A 4A25A 2CN6A 4LYXA 4DZ0A 3E1MA 4U3GA 4LQJA 3HL1A 2UX1A 1GWGA 2FZFA 4PG0A 5LG2A 5ERKA 3T9JA 3WNWA 2Z5PA 5HJHA 1VEQA 3QB9A 3UOFA 3H7GA 3EZUA 3SIDA 2RBDA 3R2RA 2CIHA 3BVKA 4DASA 4YKHA 5GU2X 2JD60 3BVLA 3QHBA 3U90A 5D8PA 4ZKHA 3O7SA 1JKVA 2FFXJ 4ZL6A 1BFRA 2V2LA 3F33A 1MOJA 4TODA 5E2DA 5K53A 2WLUA 1QYBA 2V2IA 4XKSA 1S3QA 4KVRA 1R03A 2QQYA 3AF9X 3Q4QA 2YW6A 5FFCA 2CF7A 1DVBA 3E1OA 2VXXA 3KA9A 1S2ZA 4AM5A 4CMYV 3QD8A 3FVBA 3R2OA 3AJOA 5GU1X 1Z4AA 1XZ1A 1SQ3A 1Z6OA 3NP2X 3QZ3A 1ZS3A 3PW8C 2CLBA 1JI4A 4Y08A 4M35A 3PW1B 4TW3A 2ITBA 4CY9A 3A9QA 3F32A 3R2SA 5HQOA 2VZBA 2W0OA 1S30A 3AJQA 1O9RA 1SOFA 5JKLG 4M33A 3ERZA 2QF9A 2V2SA 3AJPA 3KWOA 1VEIA 5LS9A 2CN7A 5D8RA 4KVQA 2YJJA 3O7RA 3WVWA 3FSEA 2CEIA 5JKLA 4TOBA 4EVBA 1IERA 4CVTA 3FI6A 4M34A 1DATA 2XKQA 5FFEA 2XJMA 2V2JA 2F7NA 4RC5A 4IXKA 1L8IA 4ZKXA 3KA8A 3KX9A 3R2HA 5JKMA 3PZAA 5FFAA 1BCFA 2D5KA 3AK8A 4ZL5A 3SE1A 4ITTA 2V15A 5LBHA 3UNOA 4LYUA 3PVYB 4ETRA 5J93A 3UOIA 4DI0A 3PWFA 4II4B 4RC5B 3F35A 1LB3A 2Z90A 4PGKA 4TOGA 3SH6A 1F30A 5E1UA 5LG8A 4E6KA 4RC6A 2BW1A 5FEJA 4CVPA 2X170 4OYNA 3E1JA 4PG1A 3RD0A 1AEWA 3F38A 1TKOA 1RCEA 5C6FA 5GU3X 4EVDA 1JIGA 4RC6B 1UVHA 2PYBA 1VJXA 3NP0X 3R2LA 5CZUA 3R2KA 2WTLA 2G4HA 1L8HA 4MUDA 1TKPA 1NFVA 3QHCA 3PW1A 4RC7A 2C2FA 3AF8X 4EVEA 1EUMA 4TOFA 3BVFA 4M32A 4LQNA 2Z5QA 4CYAA 2ZA8A 2OH3A 4TOAA 4PGIA 5J8WA 2IU2A 3E1QA 3F39A 5D8XA 3KXUA 3BT5A 2GYQA 4RC7B 1ZUJA 2C2JA 3F37A 4CYBA 4LPNA 5J9VA 4ZLWA 1JKUA 4XKTA 5IX6A 2FJCA 4DYXA 2IY4A 4XKUA 5FFDA 3E1NA 3IS8A 3RGDA 4XGSA 3AK9A 1YUZA 4R42A 2V2RA 1JYBA 2JD70 2YW7A 5I4JA 3Q4NA 1JGCA 1H96A 3KA6A 3GVYA 4TOHA 2V2NA 3F34A 2V2MA 3ISEA 3QVDA 5JKMG 1TJOA 3PVYA 1DPSA 4ZTTA 1MFRA 1RCIA 4II4A 2FG4A 3F36A 2CLUA 3MPSA 4ML5A 4EVCA 3VNXA 2BJYA 1OTKA 2XJNA 1QGHA 4ZJKA 1LKOA 2YJKA 2ZG9X 3PWQA 4RC8A 4TO9A 2C6RA 4LQHA 1O9IA 2CHPA 4AM2A 1NNQA 1N1QA 3GHQA 1YUXA 3PVRA 2OC5A 3PW8A 4LPJA 1JREA 1RYTA 1IESA 1JI5A 4QUWA 2Z6MA 1RCGA 2XGWA 4REUA 3OJ5A 3AF7X 1BG7A 3BVEA 4IWKA 3R2MA 2FHAA 3PVRB 2FKZA 1RCCA 3EZ0A 1KRQA 1JTSA 3RE7A 2HR5A 1RCDA 2JD80 3E6SA 2V2OA 2BK6A 2HTNA 4KVSA 2VXIA 4DYZA 5CMRA 5GOUA 4MKUA 4TOCA 3E1LA 4DE6A 3IQ1A 1J30A 5FFBA 4ISPA 3TA8A 1LKMA 3PVTA 4AM4A 4MN9A 5D8QA 1NF4A 5D8SA 4MJYA 1TK6A 2FL0A 4DYYA 3GE4A 4ITWA 4P18A 4TOEA 5D8OA 5J8SA 3PVTB 3NOZX 5HJFA 1FHAA 2WLAA 2ZG8X 5GU0X 4IWJA 5CMQA 2C2UA 5JACA 3OGHA 2BKCA 4Z3BA 5K52A 3PWQC 1VLGA 3HIUA 4CVRA 2GYDA 4LQVA 3ISFA 3Q4OA 1VELA 5ERJA 3SHXA 2XJOA 1Z6OM 3WVUA 3ES3A 2C41A 4ISMA 1UMNA 4Z5SA 2IB0A 4ZKWA 4ZMCA 3E6RA 4CMYA 5D8YA 3RAVA 3RBCA 5GN8A 3BKNA 3WVVA 3E1PA 4CVSA 2ZA6A 2ZURX 2Z5RA 1F33A 1HRSA 4DYUA 3IS7A 1YV1A 3A68A 4LPMA 3BVIA 3KA4A 3KA3A 5GN8B
chains in the Genus database with same CATH superfamily
2ZA7A 1NF6A 3E2CA 3JZ9A 3L0MA 5AXSA 1XZ3A 2CHIA 2FG8A 2Y3QA 3Q4RA 2V2PA 4MY7A 2GS4A 3EGMA 4ERUA 2ZG7X 1LKPA 1B71A 4A25A 2CN6A 4LYXA 4DZ0A 3E1MA 4U3GA 4LQJA 3HL1A 2UX1A 1GWGA 2FZFA 4PG0A 5LG2A 5ERKA 3T9JA 3WNWA 2Z5PA 5HJHA 1VEQA 3QB9A 3UOFA 3H7GA 3EZUA 3SIDA 2RBDA 3R2RA 2CIHA 3BVKA 3N6OA 4DASA 4YKHA 5GU2X 2JD60 3BVLA 3QHBA 3U90A 5D8PA 4ZKHA 3O7SA 1JKVA 2FFXJ 4ZL6A 1BFRA 2V2LA 3F33A 1MOJA 4TODA 5E2DA 5K53A 2WLUA 1QYBA 2V2IA 4XKSA 1S3QA 4KVRA 2N02A 1R03A 2QQYA 3AF9X 3Q4QA 2WWXB 3UFBA 2YW6A 5FFCA 2CF7A 1DVBA 3E1OA 2VXXA 3KA9A 1S2ZA 4AM5A 4CMYV 2V8TA 3QD8A 3FVBA 3R2OA 3AJOA 4W4LB 5GU1X 1Z4AA 1XZ1A 1SQ3A 1Z6OA 3NP2X 3QZ3A 2OKCA 1ZS3A 3PW8C 2CLBA 1JI4A 4Y08A 3KHKA 4M35A 3PW1B 4X0JA 4TW3A 2ITBA 4CY9A 3A9QA 3F32A 3R2SA 5HQOA 2VZBA 2W0OA 1S30A 3AJQA 1O9RA 1SOFA 5JKLG 3GGYA 4M33A 3ERZA 2QF9A 2V2SA 3AJPA 3KWOA 1VEIA 3D19A 5LS9A 2CN7A 5D8RA 4KVQA 2YJJA 2V8UA 3O7RA 3WVWA 3FSEA 3C1ZA 2CEIA 5JKLA 4TOBA 4EVBA 4MXPA 1IERA 4CVTA 5JDOA 3FI6A 4M34A 1DATA 2XKQA 5FFEA 2XJMA 2V2JA 2F7NA 4RC5A 4IXKA 5HU6D 1L8IA 4ZKXA 3KA8A 3KX9A 3FRSA 3R2HA 5JKMA 3PZAA 5FFAA 1BCFA 2D5KA 3C1YA 3AK8A 4ZL5A 3SE1A 4ITTA 4E40A 2V15A 5LBHA 3UNOA 4LYUA 3PVYB 4ETRA 5J93A 5JDOB 3UOIA 4DI0A 3PWFA 4II4B 4RC5B 3F35A 1LB3A 2Z90A 3KDQA 4PGKA 4TOGA 3SH6A 1F30A 5E1UA 5LG8A 3FRRA 3GGZA 4E6KA 4RC6A 2BW1A 5FEJA 4CVPA 2X170 4OYNA 3VV9A 3E1JA 4PG1A 4WJG4 3RD0A 1AEWA 3F38A 1TKOA 2MGYA 1RCEA 5C6FA 5GU3X 4EVDA 1JIGA 4RC6B 1UVHA 2PYBA 1VJXA 3NP0X 3R2LA 5CZUA 3R2KA 2WTLA 2G4HA 1L8HA 4MUDA 1TKPA 1NFVA 3QHCA 3PW1A 4RC7A 2C2FA 3AF8X 4EVEA 1EUMA 4TOFA 3BVFA 4M32A 4LQNA 2Z5QA 4CYAA 2ZA8A 2OH3A 4TOAA 4PGIA 5J8WA 2IU2A 3E1QA 3F39A 5D8XA 3KXUA 2AR0A 3BT5A 2GYQA 4RC7B 1ZUJA 2C2JA 3F37A 4CYBA 4LPNA 5J9VA 4ZLWA 3C21A 1JKUA 4XKTA 5IX6A 2FJCA 4DYXA 2IY4A 4XKUA 5FFDA 3E1NA 3IS8A 3RGDA 4XGSA 3AK9A 1YUZA 4R42A 2V2RA 1JYBA 2JD70 2YW7A 5I4JA 3Q4NA 1JGCA 1H96A 4YVZA 3KA6A 3W54A 3GVYA 4TOHA 2V2NA 3F34A 2V2MA 3ISEA 3QVDA 5JKMG 1TJOA 3M6JA 3PVYA 1DPSA 4ZTTA 1MFRA 1RCIA 4II4A 4YXMA 2FG4A 3F36A 2CLUA 3MPSA 4ML5A 4W4KB 4EVCA 3VNXA 2BJYA 1OTKA 2XJNA 3VVAA 1QGHA 4ZJKA 1LKOA 2YJKA 2ZG9X 3PWQA 4RC8A 4TO9A 2C6RA 4LQHA 1O9IA 2CHPA 4AM2A 1NNQA 1N1QA 3GHQA 1YUXA 3PVRA 2OC5A 3PW8A 4LPJA 1JREA 1RYTA 1IESA 1JI5A 4QUWA 2Z6MA 1RCGA 2Y44A 2XGWA 4REUA 3OJ5A 2CWLA 1BG7A 3AF7X 4IWKA 3BVEA 3R2MA 2FHAA 3C23A 3PVRB 2FKZA 1RCCA 3EZ0A 1KRQA 1JTSA 3RE7A 2HR5A 1RCDA 2JD80 3E6SA 2V2OA 2BK6A 2HTNA 4KVSA 2VXIA 4DYZA 5CMRA 5GOUA 4MKUA 4TOCA 3E1LA 3V3KB 4DE6A 3IQ1A 1J30A 4KXRB 5FFBA 4ISPA 3TA8A 1LKMA 3PVTA 4AM4A 4MN9A 5D8QA 1NF4A 5D8SA 2G38B 4MJYA 1TK6A 2FL0A 4DYYA 3GE4A 4ITWA 3DBYA 4P18A 4TOEA 5D8OA 5J8SA 3LKDA 3PVTB 3NOZX 5HJFA 1FHAA 2WLAA 2ZG8X 5GU0X 4IWJA 5CMQA 2C2UA 5JACA 3OGHA 2BKCA 4Z3BA 5K52A 3PWQC 1VLGA 3HIUA 4CVRA 2GYDA 4LQVA 3ISFA 3Q4OA 1VELA 5ERJA 3SHXA 2XJOA 1Z6OM 3WVUA 3ES3A 2C41A 4ISMA 1UMNA 4Z5SA 2IB0A 4ZKWA 4ZMCA 3E6RA 4CMYA 5D8YA 3RAVA 3RBCA 5GN8A 3BKNA 3WVVA 3E1PA 4CVSA 2ZA6A 2ZURX 2Z5RA 1F33A 1HRSA 4DYUA 3IS7A 3JZAB 1YV1A 4YXJA 3A68A 4LPMA 3BVIA 3KA4A 3KA3A 5GN8B
chains in the Genus database with same CATH topology
2ZA7A 1NF6A 3E2CA 3JZ9A 3L0MA 5AXSA 1XZ3A 2CHIA 2FG8A 2Y3QA 3Q4RA 2V2PA 4MY7A 2GS4A 3EGMA 4ERUA 2ZG7X 1LKPA 1B71A 4A25A 2CN6A 4LYXA 4DZ0A 3E1MA 4U3GA 4LQJA 3HL1A 2UX1A 1GWGA 2FZFA 4PG0A 5LG2A 5ERKA 3T9JA 3WNWA 2Z5PA 5HJHA 1VEQA 3QB9A 3UOFA 3H7GA 3EZUA 3SIDA 2RBDA 3R2RA 2CIHA 3BVKA 3N6OA 4DASA 4YKHA 5GU2X 2JD60 3BVLA 3QHBA 3U90A 5D8PA 4ZKHA 3O7SA 1JKVA 2FFXJ 4ZL6A 1BFRA 2V2LA 3F33A 1MOJA 4TODA 5E2DA 5K53A 2WLUA 1QYBA 2V2IA 4XKSA 1S3QA 4KVRA 2N02A 1R03A 2QQYA 3AF9X 3Q4QA 2WWXB 3UFBA 2YW6A 5FFCA 2CF7A 1DVBA 3E1OA 2VXXA 3KA9A 1S2ZA 4AM5A 4CMYV 2V8TA 3QD8A 3FVBA 3R2OA 3AJOA 4W4LB 5GU1X 1Z4AA 1XZ1A 1SQ3A 1Z6OA 3NP2X 3QZ3A 2OKCA 1ZS3A 3PW8C 2CLBA 1JI4A 4Y08A 3KHKA 4M35A 3PW1B 4X0JA 4TW3A 2ITBA 4CY9A 3A9QA 3F32A 3R2SA 5HQOA 2VZBA 2W0OA 1S30A 3AJQA 1O9RA 1SOFA 5JKLG 3GGYA 4M33A 3ERZA 2QF9A 2V2SA 3AJPA 3KWOA 1VEIA 3D19A 5LS9A 2CN7A 5D8RA 4KVQA 2YJJA 2V8UA 3O7RA 3WVWA 3FSEA 3C1ZA 2CEIA 5JKLA 4TOBA 4EVBA 4MXPA 1IERA 4CVTA 5JDOA 3FI6A 4M34A 1DATA 2XKQA 5FFEA 2XJMA 2V2JA 2F7NA 4RC5A 4IXKA 5HU6D 1L8IA 4ZKXA 3KA8A 3KX9A 3FRSA 3R2HA 5JKMA 3PZAA 5FFAA 1BCFA 2D5KA 3C1YA 3AK8A 4ZL5A 3SE1A 4ITTA 4E40A 2V15A 5LBHA 3UNOA 4LYUA 3PVYB 4ETRA 5J93A 5JDOB 3UOIA 4DI0A 3PWFA 4II4B 4RC5B 3F35A 1LB3A 2Z90A 3KDQA 4PGKA 4TOGA 3SH6A 1F30A 5E1UA 5LG8A 3FRRA 3GGZA 4E6KA 4RC6A 2BW1A 5FEJA 4CVPA 2X170 4OYNA 3VV9A 3E1JA 4PG1A 4WJG4 3RD0A 1AEWA 3F38A 1TKOA 2MGYA 1RCEA 5C6FA 5GU3X 4EVDA 1JIGA 4RC6B 1UVHA 2PYBA 1VJXA 3NP0X 3R2LA 5CZUA 3R2KA 2WTLA 2G4HA 1L8HA 4MUDA 1TKPA 1NFVA 3QHCA 3PW1A 4RC7A 2C2FA 3AF8X 4EVEA 1EUMA 4TOFA 3BVFA 4M32A 4LQNA 2Z5QA 4CYAA 2ZA8A 2OH3A 4TOAA 4PGIA 5J8WA 2IU2A 3E1QA 3F39A 5D8XA 3KXUA 2AR0A 3BT5A 2GYQA 4RC7B 1ZUJA 2C2JA 3F37A 4CYBA 4LPNA 5J9VA 4ZLWA 3C21A 1JKUA 4XKTA 5IX6A 2FJCA 4DYXA 2IY4A 4XKUA 5FFDA 3E1NA 3IS8A 3RGDA 4XGSA 3AK9A 1YUZA 4R42A 2V2RA 1JYBA 2JD70 2YW7A 5I4JA 3Q4NA 1JGCA 1H96A 4YVZA 3KA6A 3W54A 3GVYA 4TOHA 2V2NA 3F34A 2V2MA 3ISEA 3QVDA 5JKMG 1TJOA 3M6JA 3PVYA 1DPSA 4ZTTA 1MFRA 1RCIA 4II4A 4YXMA 2FG4A 3F36A 2CLUA 3MPSA 4ML5A 4W4KB 4EVCA 3VNXA 2BJYA 1OTKA 2XJNA 3VVAA 1QGHA 4ZJKA 1LKOA 2YJKA 2ZG9X 3PWQA 4RC8A 4TO9A 2C6RA 4LQHA 1O9IA 2CHPA 4AM2A 1NNQA 1N1QA 3GHQA 1YUXA 3PVRA 2OC5A 3PW8A 4LPJA 1JREA 1RYTA 1IESA 1JI5A 4QUWA 2Z6MA 1RCGA 2Y44A 2XGWA 4REUA 3OJ5A 2CWLA 1BG7A 3AF7X 4IWKA 3BVEA 3R2MA 2FHAA 3C23A 3PVRB 2FKZA 1RCCA 3EZ0A 1KRQA 1JTSA 3RE7A 2HR5A 1RCDA 2JD80 3E6SA 2V2OA 2BK6A 2HTNA 4KVSA 2VXIA 4DYZA 5CMRA 5GOUA 4MKUA 4TOCA 3E1LA 3V3KB 4DE6A 3IQ1A 1J30A 4KXRB 5FFBA 4ISPA 3TA8A 1LKMA 3PVTA 4AM4A 4MN9A 5D8QA 1NF4A 5D8SA 2G38B 4MJYA 1TK6A 2FL0A 4DYYA 3GE4A 4ITWA 3DBYA 4P18A 4TOEA 5D8OA 5J8SA 3LKDA 3PVTB 3NOZX 5HJFA 1FHAA 2WLAA 2ZG8X 5GU0X 4IWJA 5CMQA 2C2UA 5JACA 3OGHA 2BKCA 4Z3BA 5K52A 3PWQC 1VLGA 3HIUA 4CVRA 2GYDA 4LQVA 3ISFA 3Q4OA 1VELA 5ERJA 3SHXA 2XJOA 1Z6OM 3WVUA 3ES3A 2C41A 4ISMA 1UMNA 4Z5SA 2IB0A 4ZKWA 4ZMCA 3E6RA 4CMYA 5D8YA 3RAVA 3RBCA 5GN8A 3BKNA 3WVVA 3E1PA 4CVSA 2ZA6A 2ZURX 2Z5RA 1F33A 1HRSA 4DYUA 3IS7A 3JZAB 1YV1A 4YXJA 3A68A 4LPMA 3BVIA 3KA4A 3KA3A 5GN8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA7 A;  1NF6 A;  3E2C A;  5AXS A;  1XZ3 A;  2CHI A;  2FG8 A;  2Y3Q A;  3Q4R A;  2V2P A;  4MY7 A;  2GS4 A;  3EGM A;  4ERU A;  2ZG7 X;  1LKP A;  1B71 A;  4A25 A;  2CN6 A;  4LYX A;  4DZ0 A;  3E1M A;  4U3G A;  4LQJ A;  3HL1 A;  2UX1 A;  1GWG A;  2FZF A;  4PG0 A;  5LG2 A;  5ERK A;  3T9J A;  3WNW A;  2Z5P A;  5HJH A;  1VEQ A;  3QB9 A;  3UOF A;  3H7G A;  3EZU A;  3SID A;  2RBD A;  3R2R A;  2CIH A;  3BVK A;  4DAS A;  4YKH A;  5GU2 X;  2JD6 0;  3BVL A;  3QHB A;  3U90 A;  5D8P A;  4ZKH A;  3O7S A;  1JKV A;  2FFX J;  4ZL6 A;  1BFR A;  2V2L A;  3F33 A;  1MOJ A;  4TOD A;  5E2D A;  5K53 A;  2WLU A;  1QYB A;  2V2I A;  4XKS A;  1S3Q A;  4KVR A;  1R03 A;  2QQY A;  3AF9 X;  3Q4Q A;  2YW6 A;  5FFC A;  2CF7 A;  1DVB A;  3E1O A;  2VXX A;  3KA9 A;  1S2Z A;  4AM5 A;  4CMY V;  3QD8 A;  3FVB A;  3R2O A;  3AJO A;  5GU1 X;  1Z4A A;  1XZ1 A;  1SQ3 A;  1Z6O A;  3NP2 X;  3QZ3 A;  1ZS3 A;  3PW8 C;  2CLB A;  1JI4 A;  4Y08 A;  4M35 A;  3PW1 B;  4TW3 A;  2ITB A;  4CY9 A;  3A9Q A;  3F32 A;  3R2S A;  5HQO A;  2VZB A;  2W0O A;  1S30 A;  3AJQ A;  1O9R A;  1SOF A;  5JKL G;  4M33 A;  3ERZ A;  2QF9 A;  2V2S A;  3AJP A;  3KWO A;  1VEI A;  5LS9 A;  2CN7 A;  5D8R A;  4KVQ A;  2YJJ A;  3O7R A;  3WVW A;  3FSE A;  2CEI A;  5JKL A;  4TOB A;  4EVB A;  1IER A;  4CVT A;  3FI6 A;  4M34 A;  1DAT A;  2XKQ A;  5FFE A;  2XJM A;  2V2J A;  2F7N A;  4RC5 A;  4IXK A;  1L8I A;  4ZKX A;  3KA8 A;  3KX9 A;  3R2H A;  5JKM A;  3PZA A;  5FFA A;  1BCF A;  2D5K A;  3AK8 A;  4ZL5 A;  3SE1 A;  4ITT A;  2V15 A;  5LBH A;  3UNO A;  4LYU A;  3PVY B;  4ETR A;  5J93 A;  3UOI A;  4DI0 A;  3PWF A;  4II4 B;  4RC5 B;  3F35 A;  1LB3 A;  2Z90 A;  4PGK A;  4TOG A;  3SH6 A;  1F30 A;  5E1U A;  5LG8 A;  4E6K A;  4RC6 A;  2BW1 A;  5FEJ A;  4CVP A;  2X17 0;  4OYN A;  3E1J A;  4PG1 A;  3RD0 A;  1AEW A;  3F38 A;  1TKO A;  1RCE A;  5C6F A;  5GU3 X;  4EVD A;  1JIG A;  4RC6 B;  1UVH A;  2PYB A;  1VJX A;  3NP0 X;  3R2L A;  5CZU A;  3R2K A;  2WTL A;  2G4H A;  1L8H A;  4MUD A;  1TKP A;  1NFV A;  3QHC A;  3PW1 A;  4RC7 A;  2C2F A;  3AF8 X;  4EVE A;  1EUM A;  4TOF A;  3BVF A;  4M32 A;  4LQN A;  2Z5Q A;  4CYA A;  2ZA8 A;  2OH3 A;  4TOA A;  4PGI A;  5J8W A;  2IU2 A;  3E1Q A;  3F39 A;  5D8X A;  3KXU A;  3BT5 A;  2GYQ A;  4RC7 B;  1ZUJ A;  2C2J A;  3F37 A;  4CYB A;  4LPN A;  5J9V A;  4ZLW A;  1JKU A;  4XKT A;  5IX6 A;  2FJC A;  4DYX A;  2IY4 A;  4XKU A;  5FFD A;  3E1N A;  3IS8 A;  3RGD A;  4XGS A;  3AK9 A;  1YUZ A;  4R42 A;  2V2R A;  1JYB A;  2JD7 0;  2YW7 A;  5I4J A;  3Q4N A;  1JGC A;  1H96 A;  3KA6 A;  3GVY A;  4TOH A;  2V2N A;  3F34 A;  2V2M A;  3ISE A;  3QVD A;  5JKM G;  1TJO A;  3PVY A;  1DPS A;  4ZTT A;  1MFR A;  1RCI A;  4II4 A;  2FG4 A;  3F36 A;  2CLU A;  3MPS A;  4ML5 A;  4EVC A;  3VNX A;  2BJY A;  1OTK A;  2XJN A;  1QGH A;  4ZJK A;  1LKO A;  2YJK A;  2ZG9 X;  3PWQ A;  4RC8 A;  4TO9 A;  2C6R A;  4LQH A;  1O9I A;  2CHP A;  4AM2 A;  1NNQ A;  1N1Q A;  3GHQ A;  1YUX A;  3PVR A;  2OC5 A;  3PW8 A;  4LPJ A;  1JRE A;  1RYT A;  1IES A;  1JI5 A;  4QUW A;  2Z6M A;  1RCG A;  2XGW A;  4REU A;  3OJ5 A;  3AF7 X;  1BG7 A;  3BVE A;  4IWK A;  3R2M A;  2FHA A;  3PVR B;  2FKZ A;  1RCC A;  3EZ0 A;  1KRQ A;  1JTS A;  3RE7 A;  2HR5 A;  1RCD A;  2JD8 0;  3E6S A;  2V2O A;  2BK6 A;  2HTN A;  4KVS A;  2VXI A;  4DYZ A;  5CMR A;  5GOU A;  4MKU A;  4TOC A;  3E1L A;  4DE6 A;  3IQ1 A;  1J30 A;  5FFB A;  4ISP A;  3TA8 A;  1LKM A;  3PVT A;  4AM4 A;  4MN9 A;  5D8Q A;  1NF4 A;  5D8S A;  4MJY A;  1TK6 A;  2FL0 A;  4DYY A;  3GE4 A;  4ITW A;  4P18 A;  4TOE A;  5D8O A;  5J8S A;  3PVT B;  3NOZ X;  5HJF A;  1FHA A;  2WLA A;  2ZG8 X;  5GU0 X;  4IWJ A;  5CMQ A;  2C2U A;  5JAC A;  3OGH A;  2BKC A;  4Z3B A;  5K52 A;  3PWQ C;  1VLG A;  3HIU A;  4CVR A;  2GYD A;  4LQV A;  3ISF A;  3Q4O A;  1VEL A;  5ERJ A;  3SHX A;  2XJO A;  1Z6O M;  3WVU A;  3ES3 A;  2C41 A;  4ISM A;  1UMN A;  4Z5S A;  2IB0 A;  4ZKW A;  4ZMC A;  3E6R A;  4CMY A;  5D8Y A;  3RAV A;  3RBC A;  5GN8 A;  3BKN A;  3WVV A;  3E1P A;  4CVS A;  2ZA6 A;  2ZUR X;  2Z5R A;  1F33 A;  1HRS A;  4DYU A;  3IS7 A;  1YV1 A;  3A68 A;  4LPM A;  3BVI A;  3KA4 A;  3KA3 A;  5GN8 B; 
#chains in the Genus database with same CATH topology
 2ZA7 A;  1NF6 A;  3E2C A;  3JZ9 A;  3L0M A;  5AXS A;  1XZ3 A;  2CHI A;  2FG8 A;  2Y3Q A;  3Q4R A;  2V2P A;  4MY7 A;  2GS4 A;  3EGM A;  4ERU A;  2ZG7 X;  1LKP A;  1B71 A;  4A25 A;  2CN6 A;  4LYX A;  4DZ0 A;  3E1M A;  4U3G A;  4LQJ A;  3HL1 A;  2UX1 A;  1GWG A;  2FZF A;  4PG0 A;  5LG2 A;  5ERK A;  3T9J A;  3WNW A;  2Z5P A;  5HJH A;  1VEQ A;  3QB9 A;  3UOF A;  3H7G A;  3EZU A;  3SID A;  2RBD A;  3R2R A;  2CIH A;  3BVK A;  3N6O A;  4DAS A;  4YKH A;  5GU2 X;  2JD6 0;  3BVL A;  3QHB A;  3U90 A;  5D8P A;  4ZKH A;  3O7S A;  1JKV A;  2FFX J;  4ZL6 A;  1BFR A;  2V2L A;  3F33 A;  1MOJ A;  4TOD A;  5E2D A;  5K53 A;  2WLU A;  1QYB A;  2V2I A;  4XKS A;  1S3Q A;  4KVR A;  2N02 A;  1R03 A;  2QQY A;  3AF9 X;  3Q4Q A;  2WWX B;  3UFB A;  2YW6 A;  5FFC A;  2CF7 A;  1DVB A;  3E1O A;  2VXX A;  3KA9 A;  1S2Z A;  4AM5 A;  4CMY V;  2V8T A;  3QD8 A;  3FVB A;  3R2O A;  3AJO A;  4W4L B;  5GU1 X;  1Z4A A;  1XZ1 A;  1SQ3 A;  1Z6O A;  3NP2 X;  3QZ3 A;  2OKC A;  1ZS3 A;  3PW8 C;  2CLB A;  1JI4 A;  4Y08 A;  3KHK A;  4M35 A;  3PW1 B;  4X0J A;  4TW3 A;  2ITB A;  4CY9 A;  3A9Q A;  3F32 A;  3R2S A;  5HQO A;  2VZB A;  2W0O A;  1S30 A;  3AJQ A;  1O9R A;  1SOF A;  5JKL G;  3GGY A;  4M33 A;  3ERZ A;  2QF9 A;  2V2S A;  3AJP A;  3KWO A;  1VEI A;  3D19 A;  5LS9 A;  2CN7 A;  5D8R A;  4KVQ A;  2YJJ A;  2V8U A;  3O7R A;  3WVW A;  3FSE A;  3C1Z A;  2CEI A;  5JKL A;  4TOB A;  4EVB A;  4MXP A;  1IER A;  4CVT A;  5JDO A;  3FI6 A;  4M34 A;  1DAT A;  2XKQ A;  5FFE A;  2XJM A;  2V2J A;  2F7N A;  4RC5 A;  4IXK A;  5HU6 D;  1L8I A;  4ZKX A;  3KA8 A;  3KX9 A;  3FRS A;  3R2H A;  5JKM A;  3PZA A;  5FFA A;  1BCF A;  2D5K A;  3C1Y A;  3AK8 A;  4ZL5 A;  3SE1 A;  4ITT A;  4E40 A;  2V15 A;  5LBH A;  3UNO A;  4LYU A;  3PVY B;  4ETR A;  5J93 A;  5JDO B;  3UOI A;  4DI0 A;  3PWF A;  4II4 B;  4RC5 B;  3F35 A;  1LB3 A;  2Z90 A;  3KDQ A;  4PGK A;  4TOG A;  3SH6 A;  1F30 A;  5E1U A;  5LG8 A;  3FRR A;  3GGZ A;  4E6K A;  4RC6 A;  2BW1 A;  5FEJ A;  4CVP A;  2X17 0;  4OYN A;  3VV9 A;  3E1J A;  4PG1 A;  4WJG 4;  3RD0 A;  1AEW A;  3F38 A;  1TKO A;  2MGY A;  1RCE A;  5C6F A;  5GU3 X;  4EVD A;  1JIG A;  4RC6 B;  1UVH A;  2PYB A;  1VJX A;  3NP0 X;  3R2L A;  5CZU A;  3R2K A;  2WTL A;  2G4H A;  1L8H A;  4MUD A;  1TKP A;  1NFV A;  3QHC A;  3PW1 A;  4RC7 A;  2C2F A;  3AF8 X;  4EVE A;  1EUM A;  4TOF A;  3BVF A;  4M32 A;  4LQN A;  2Z5Q A;  4CYA A;  2ZA8 A;  2OH3 A;  4TOA A;  4PGI A;  5J8W A;  2IU2 A;  3E1Q A;  3F39 A;  5D8X A;  3KXU A;  2AR0 A;  3BT5 A;  2GYQ A;  4RC7 B;  1ZUJ A;  2C2J A;  3F37 A;  4CYB A;  4LPN A;  5J9V A;  4ZLW A;  3C21 A;  1JKU A;  4XKT A;  5IX6 A;  2FJC A;  4DYX A;  2IY4 A;  4XKU A;  5FFD A;  3E1N A;  3IS8 A;  3RGD A;  4XGS A;  3AK9 A;  1YUZ A;  4R42 A;  2V2R A;  1JYB A;  2JD7 0;  2YW7 A;  5I4J A;  3Q4N A;  1JGC A;  1H96 A;  4YVZ A;  3KA6 A;  3W54 A;  3GVY A;  4TOH A;  2V2N A;  3F34 A;  2V2M A;  3ISE A;  3QVD A;  5JKM G;  1TJO A;  3M6J A;  3PVY A;  1DPS A;  4ZTT A;  1MFR A;  1RCI A;  4II4 A;  4YXM A;  2FG4 A;  3F36 A;  2CLU A;  3MPS A;  4ML5 A;  4W4K B;  4EVC A;  3VNX A;  2BJY A;  1OTK A;  2XJN A;  3VVA A;  1QGH A;  4ZJK A;  1LKO A;  2YJK A;  2ZG9 X;  3PWQ A;  4RC8 A;  4TO9 A;  2C6R A;  4LQH A;  1O9I A;  2CHP A;  4AM2 A;  1NNQ A;  1N1Q A;  3GHQ A;  1YUX A;  3PVR A;  2OC5 A;  3PW8 A;  4LPJ A;  1JRE A;  1RYT A;  1IES A;  1JI5 A;  4QUW A;  2Z6M A;  1RCG A;  2Y44 A;  2XGW A;  4REU A;  3OJ5 A;  2CWL A;  1BG7 A;  3AF7 X;  4IWK A;  3BVE A;  3R2M A;  2FHA A;  3C23 A;  3PVR B;  2FKZ A;  1RCC A;  3EZ0 A;  1KRQ A;  1JTS A;  3RE7 A;  2HR5 A;  1RCD A;  2JD8 0;  3E6S A;  2V2O A;  2BK6 A;  2HTN A;  4KVS A;  2VXI A;  4DYZ A;  5CMR A;  5GOU A;  4MKU A;  4TOC A;  3E1L A;  3V3K B;  4DE6 A;  3IQ1 A;  1J30 A;  4KXR B;  5FFB A;  4ISP A;  3TA8 A;  1LKM A;  3PVT A;  4AM4 A;  4MN9 A;  5D8Q A;  1NF4 A;  5D8S A;  2G38 B;  4MJY A;  1TK6 A;  2FL0 A;  4DYY A;  3GE4 A;  4ITW A;  3DBY A;  4P18 A;  4TOE A;  5D8O A;  5J8S A;  3LKD A;  3PVT B;  3NOZ X;  5HJF A;  1FHA A;  2WLA A;  2ZG8 X;  5GU0 X;  4IWJ A;  5CMQ A;  2C2U A;  5JAC A;  3OGH A;  2BKC A;  4Z3B A;  5K52 A;  3PWQ C;  1VLG A;  3HIU A;  4CVR A;  2GYD A;  4LQV A;  3ISF A;  3Q4O A;  1VEL A;  5ERJ A;  3SHX A;  2XJO A;  1Z6O M;  3WVU A;  3ES3 A;  2C41 A;  4ISM A;  1UMN A;  4Z5S A;  2IB0 A;  4ZKW A;  4ZMC A;  3E6R A;  4CMY A;  5D8Y A;  3RAV A;  3RBC A;  5GN8 A;  3BKN A;  3WVV A;  3E1P A;  4CVS A;  2ZA6 A;  2ZUR X;  2Z5R A;  1F33 A;  1HRS A;  4DYU A;  3IS7 A;  3JZA B;  1YV1 A;  4YXJ A;  3A68 A;  4LPM A;  3BVI A;  3KA4 A;  3KA3 A;  5GN8 B; 
#chains in the Genus database with same CATH homology
 2ZA7 A;  1NF6 A;  3E2C A;  3JZ9 A;  3L0M A;  5AXS A;  1XZ3 A;  2CHI A;  2FG8 A;  2Y3Q A;  3Q4R A;  2V2P A;  4MY7 A;  2GS4 A;  3EGM A;  4ERU A;  2ZG7 X;  1LKP A;  1B71 A;  4A25 A;  2CN6 A;  4LYX A;  4DZ0 A;  3E1M A;  4U3G A;  4LQJ A;  3HL1 A;  2UX1 A;  1GWG A;  2FZF A;  4PG0 A;  5LG2 A;  5ERK A;  3T9J A;  3WNW A;  2Z5P A;  5HJH A;  1VEQ A;  3QB9 A;  3UOF A;  3H7G A;  3EZU A;  3SID A;  2RBD A;  3R2R A;  2CIH A;  3BVK A;  3N6O A;  4DAS A;  4YKH A;  5GU2 X;  2JD6 0;  3BVL A;  3QHB A;  3U90 A;  5D8P A;  4ZKH A;  3O7S A;  1JKV A;  2FFX J;  4ZL6 A;  1BFR A;  2V2L A;  3F33 A;  1MOJ A;  4TOD A;  5E2D A;  5K53 A;  2WLU A;  1QYB A;  2V2I A;  4XKS A;  1S3Q A;  4KVR A;  2N02 A;  1R03 A;  2QQY A;  3AF9 X;  3Q4Q A;  2WWX B;  3UFB A;  2YW6 A;  5FFC A;  2CF7 A;  1DVB A;  3E1O A;  2VXX A;  3KA9 A;  1S2Z A;  4AM5 A;  4CMY V;  2V8T A;  3QD8 A;  3FVB A;  3R2O A;  3AJO A;  4W4L B;  5GU1 X;  1Z4A A;  1XZ1 A;  1SQ3 A;  1Z6O A;  3NP2 X;  3QZ3 A;  2OKC A;  1ZS3 A;  3PW8 C;  2CLB A;  1JI4 A;  4Y08 A;  3KHK A;  4M35 A;  3PW1 B;  4X0J A;  4TW3 A;  2ITB A;  4CY9 A;  3A9Q A;  3F32 A;  3R2S A;  5HQO A;  2VZB A;  2W0O A;  1S30 A;  3AJQ A;  1O9R A;  1SOF A;  5JKL G;  3GGY A;  4M33 A;  3ERZ A;  2QF9 A;  2V2S A;  3AJP A;  3KWO A;  1VEI A;  3D19 A;  5LS9 A;  2CN7 A;  5D8R A;  4KVQ A;  2YJJ A;  2V8U A;  3O7R A;  3WVW A;  3FSE A;  3C1Z A;  2CEI A;  5JKL A;  4TOB A;  4EVB A;  4MXP A;  1IER A;  4CVT A;  5JDO A;  3FI6 A;  4M34 A;  1DAT A;  2XKQ A;  5FFE A;  2XJM A;  2V2J A;  2F7N A;  4RC5 A;  4IXK A;  5HU6 D;  1L8I A;  4ZKX A;  3KA8 A;  3KX9 A;  3FRS A;  3R2H A;  5JKM A;  3PZA A;  5FFA A;  1BCF A;  2D5K A;  3C1Y A;  3AK8 A;  4ZL5 A;  3SE1 A;  4ITT A;  4E40 A;  2V15 A;  5LBH A;  3UNO A;  4LYU A;  3PVY B;  4ETR A;  5J93 A;  5JDO B;  3UOI A;  4DI0 A;  3PWF A;  4II4 B;  4RC5 B;  3F35 A;  1LB3 A;  2Z90 A;  3KDQ A;  4PGK A;  4TOG A;  3SH6 A;  1F30 A;  5E1U A;  5LG8 A;  3FRR A;  3GGZ A;  4E6K A;  4RC6 A;  2BW1 A;  5FEJ A;  4CVP A;  2X17 0;  4OYN A;  3VV9 A;  3E1J A;  4PG1 A;  4WJG 4;  3RD0 A;  1AEW A;  3F38 A;  1TKO A;  2MGY A;  1RCE A;  5C6F A;  5GU3 X;  4EVD A;  1JIG A;  4RC6 B;  1UVH A;  2PYB A;  1VJX A;  3NP0 X;  3R2L A;  5CZU A;  3R2K A;  2WTL A;  2G4H A;  1L8H A;  4MUD A;  1TKP A;  1NFV A;  3QHC A;  3PW1 A;  4RC7 A;  2C2F A;  3AF8 X;  4EVE A;  1EUM A;  4TOF A;  3BVF A;  4M32 A;  4LQN A;  2Z5Q A;  4CYA A;  2ZA8 A;  2OH3 A;  4TOA A;  4PGI A;  5J8W A;  2IU2 A;  3E1Q A;  3F39 A;  5D8X A;  3KXU A;  2AR0 A;  3BT5 A;  2GYQ A;  4RC7 B;  1ZUJ A;  2C2J A;  3F37 A;  4CYB A;  4LPN A;  5J9V A;  4ZLW A;  3C21 A;  1JKU A;  4XKT A;  5IX6 A;  2FJC A;  4DYX A;  2IY4 A;  4XKU A;  5FFD A;  3E1N A;  3IS8 A;  3RGD A;  4XGS A;  3AK9 A;  1YUZ A;  4R42 A;  2V2R A;  1JYB A;  2JD7 0;  2YW7 A;  5I4J A;  3Q4N A;  1JGC A;  1H96 A;  4YVZ A;  3KA6 A;  3W54 A;  3GVY A;  4TOH A;  2V2N A;  3F34 A;  2V2M A;  3ISE A;  3QVD A;  5JKM G;  1TJO A;  3M6J A;  3PVY A;  1DPS A;  4ZTT A;  1MFR A;  1RCI A;  4II4 A;  4YXM A;  2FG4 A;  3F36 A;  2CLU A;  3MPS A;  4ML5 A;  4W4K B;  4EVC A;  3VNX A;  2BJY A;  1OTK A;  2XJN A;  3VVA A;  1QGH A;  4ZJK A;  1LKO A;  2YJK A;  2ZG9 X;  3PWQ A;  4RC8 A;  4TO9 A;  2C6R A;  4LQH A;  1O9I A;  2CHP A;  4AM2 A;  1NNQ A;  1N1Q A;  3GHQ A;  1YUX A;  3PVR A;  2OC5 A;  3PW8 A;  4LPJ A;  1JRE A;  1RYT A;  1IES A;  1JI5 A;  4QUW A;  2Z6M A;  1RCG A;  2Y44 A;  2XGW A;  4REU A;  3OJ5 A;  2CWL A;  1BG7 A;  3AF7 X;  4IWK A;  3BVE A;  3R2M A;  2FHA A;  3C23 A;  3PVR B;  2FKZ A;  1RCC A;  3EZ0 A;  1KRQ A;  1JTS A;  3RE7 A;  2HR5 A;  1RCD A;  2JD8 0;  3E6S A;  2V2O A;  2BK6 A;  2HTN A;  4KVS A;  2VXI A;  4DYZ A;  5CMR A;  5GOU A;  4MKU A;  4TOC A;  3E1L A;  3V3K B;  4DE6 A;  3IQ1 A;  1J30 A;  4KXR B;  5FFB A;  4ISP A;  3TA8 A;  1LKM A;  3PVT A;  4AM4 A;  4MN9 A;  5D8Q A;  1NF4 A;  5D8S A;  2G38 B;  4MJY A;  1TK6 A;  2FL0 A;  4DYY A;  3GE4 A;  4ITW A;  3DBY A;  4P18 A;  4TOE A;  5D8O A;  5J8S A;  3LKD A;  3PVT B;  3NOZ X;  5HJF A;  1FHA A;  2WLA A;  2ZG8 X;  5GU0 X;  4IWJ A;  5CMQ A;  2C2U A;  5JAC A;  3OGH A;  2BKC A;  4Z3B A;  5K52 A;  3PWQ C;  1VLG A;  3HIU A;  4CVR A;  2GYD A;  4LQV A;  3ISF A;  3Q4O A;  1VEL A;  5ERJ A;  3SHX A;  2XJO A;  1Z6O M;  3WVU A;  3ES3 A;  2C41 A;  4ISM A;  1UMN A;  4Z5S A;  2IB0 A;  4ZKW A;  4ZMC A;  3E6R A;  4CMY A;  5D8Y A;  3RAV A;  3RBC A;  5GN8 A;  3BKN A;  3WVV A;  3E1P A;  4CVS A;  2ZA6 A;  2ZUR X;  2Z5R A;  1F33 A;  1HRS A;  4DYU A;  3IS7 A;  3JZA B;  1YV1 A;  4YXJ A;  3A68 A;  4LPM A;  3BVI A;  3KA4 A;  3KA3 A;  5GN8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...