5FFAA

Copm (with an n-terminal his-tag) in the apo form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
152
structure length
135
Chain Sequence
WTDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWFKRPVPAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for copper/silver binding by the Synechocystis metallochaperone CopM
doi rcsb
molecule keywords CopM
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 58
structure length 135
sequence length 152
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5ffaA00
3PW1B 1F30A 4TOEA 4RC5B 3ISFA 1KRQA 2FZFA 2IB0A 5D8OA 5CMRA 3O7RA 5JKLG 2Y3QA 2ZURX 2WLUA 3IQ1A 2CHIA 3SHXA 1BFRA 2FKZA 3RE7A 4TOBA 5FFEA 2FFXJ 4M33A 3F34A 1O9IA 1H96A 3BVLA 4MY7A 1QYBA 3QD8A 5D8QA 5D8YA 1F33A 2BK6A 2Z5QA 3FVBA 4DYYA 4II4B 3T9JA 3QHBA 2FHAA 1UMNA 5FFDA 1JTSA 1NNQA 1FHAA 5ERJA 1JIGA 5IX6A 2RBDA 3BVEA 1NF4A 4DE6A 4ZKWA 2D5KA 2GS4A 1HRSA 4AM2A 3E1OA 2QF9A 1TJOA 4ETRA 3PZAA 4M32A 4DYUA 3PVYA 3F37A 1L8IA 2ZA8A 4Z5SA 5D8PA 2CLUA 4LYUA 2X170 3KA3A 3F33A 1J30A 5LG8A 4PG1A 3SH6A 2UX1A 3A68A 2GYDA 4CYAA 1N1QA 2Z5RA 5CMQA 5JKMG 3TA8A 4RC7B 5LG2A 3AJQA 4ISMA 4RC8A 3AF8X 4ZKHA 2V2PA 2WLAA 4RC5A 4XGSA 3BVIA 4TW3A 4MUDA 3ISEA 2VZBA 3PWFA 3F32A 2YJJA 3AK9A 3HIUA 4LQHA 1LB3A 4PGIA 3E1QA 1TKOA 3EZ0A 1RCCA 5GU0X 3RGDA 4TOCA 5D8SA 5FFBA 5FFAA 1B71A 2CN6A 5E2DA 3BVKA 4LPMA 5GU1X 5J8WA 4YKHA 1R03A 3F35A 3RBCA 3GVYA 1JREA 3PW8A 3NP2X 4RC6A 3KXUA 3OJ5A 4TO9A 2C2FA 3E2CA 4LYXA 3R2LA 1DATA 2JD80 3FI6A 4CVRA 4CMYA 2V2SA 5HQOA 3RD0A 1LKOA 2HR5A 4MJYA 4EVBA 4CVSA 5K53A 2PYBA 2OH3A 4EVCA 1RYTA 4PG0A 3AK8A 1JKVA 3E1LA 1TK6A 3BKNA 1O9RA 1S2ZA 3QVDA 2FJCA 2BKCA 1S30A 4CY9A 1S3QA 1VEIA 1XZ1A 1VLGA 2XGWA 3E1PA 3Q4RA 2CLBA 4IWJA 5J8SA 3KA9A 2GYQA 1ZS3A 1IERA 3ES3A 3RAVA 4Z3BA 5J9VA 3NP0X 3PVRA 4OYNA 4CMYV 1DPSA 4ZL6A 2ITBA 2C41A 4QUWA 1RCIA 4LPJA 2VXXA 4XKSA 3HL1A 2YW7A 3PVTA 3U90A 2CF7A 4REUA 2HTNA 2ZG8X 4ZKXA 1EUMA 3BT5A 2YJKA 5J93A 1LKPA 3PW1A 4TODA 3NOZX 2C6RA 1OTKA 4DASA 3IS8A 5GN8B 2CEIA 3WNWA 2ZA7A 2OC5A 2ZG9X 2ZG7X 1NFVA 5GOUA 3WVVA 2V2RA 2JD60 4DYZA 2CIHA 3ERZA 3QB9A 3QZ3A 4CVPA 3AJOA 3KA6A 3R2HA 5I4JA 4LPNA 4ZMCA 5D8RA 4KVQA 2IU2A 4ZJKA 4IXKA 1MFRA 5JKLA 1Z6OA 1Z6OM 1RCDA 1DVBA 5E1UA 4LQNA 4P18A 5LS9A 1RCGA 4II4A 2JD70 3E1JA 3MPSA 5K52A 1IESA 2V2IA 4DI0A 3VNXA 3EZUA 3SE1A 4ZLWA 5ERKA 4R42A 2XJMA 2V2JA 1YUZA 4AM5A 4ZL5A 4ITWA 3E6SA 4AM4A 4EVDA 3E1MA 1LKMA 3IS7A 3OGHA 4ITTA 4XKTA 5FFCA 2V2LA 3UOIA 1RCEA 3A9QA 3KA4A 2C2UA 4MKUA 3GHQA 5FEJA 2F7NA 4ZTTA 4CVTA 5D8XA 1L8HA 1Z4AA 4TOGA 5GU2X 3WVWA 1SOFA 3PW8C 4MN9A 2VXIA 2XKQA 4E6KA 1XZ3A 2WTLA 2FL0A 4ISPA 2V15A 5C6FA 1MOJA 3KA8A 1GWGA 5JACA 4CYBA 1JGCA 1JKUA 4KVSA 2W0OA 4RC7A 4RC6B 1BCFA 4ML5A 1VJXA 4ERUA 4DYXA 2XJOA 5GU3X 4XKUA 4LQJA 3AF7X 5GN8A 2YW6A 1ZUJA 3SIDA 2Z6MA 4IWKA 2V2NA 2ZA6A 1UVHA 5JKMA 2V2OA 2FG4A 2IY4A 3E1NA 3AF9X 3R2RA 3E6RA 3UOFA 3Q4NA 3F36A 3Q4QA 3KX9A 1VELA 1TKPA 4KVRA 1AEWA 3R2MA 1BG7A 3F39A 4M35A 1VEQA 2C2JA 4Y08A 3PWQA 5HJHA 1YV1A 5CZUA 3O7SA 2Z5PA 2CN7A 1JI4A 2G4HA 3H7GA 3GE4A 3AJPA 3F38A 1JYBA 4U3GA 1SQ3A 2FG8A 4TOAA 5AXSA 3PVRB 3R2OA 4A25A 4M34A 1QGHA 3PVYB 3QHCA 4PGKA 3EGMA 3Q4OA 3UNOA 4LQVA 4DZ0A 2CHPA 3R2SA 3FSEA 1YUXA 2Z90A 3KWOA 3PWQC 3BVFA 2QQYA 3R2KA 1NF6A 3WVUA 3PVTB 2V2MA 5HJFA 2BW1A 4TOHA 2BJYA 1JI5A 4TOFA 4EVEA 5LBHA 2XJNA
chains in the Genus database with same CATH superfamily
3PW1B 1F30A 4TOEA 4RC5B 3ISFA 1KRQA 2FZFA 2IB0A 5D8OA 5CMRA 3VVAA 3O7RA 5JKLG 2Y3QA 2ZURX 2WLUA 3IQ1A 4YXJA 2CHIA 3SHXA 1BFRA 2FKZA 3RE7A 4TOBA 3C1ZA 5FFEA 2FFXJ 4M33A 3F34A 1O9IA 1H96A 3BVLA 4MY7A 5JDOA 1QYBA 3QD8A 5D8QA 5D8YA 1F33A 2BK6A 2Z5QA 3FVBA 4DYYA 4II4B 3T9JA 3QHBA 4W4KB 2FHAA 3L0MA 1UMNA 5FFDA 1JTSA 3GGZA 1NNQA 1FHAA 5ERJA 1JIGA 5IX6A 2RBDA 3BVEA 1NF4A 4KXRB 4DE6A 4ZKWA 2D5KA 2GS4A 1HRSA 4AM2A 3E1OA 2QF9A 3KHKA 1TJOA 4ETRA 3PZAA 4M32A 4DYUA 3PVYA 4X0JA 3F37A 1L8IA 2ZA8A 4YXMA 4Z5SA 5D8PA 2CLUA 4LYUA 4MXPA 2X170 3KA3A 3F33A 1J30A 5LG8A 4PG1A 3SH6A 2UX1A 3UFBA 3A68A 2GYDA 4CYAA 1N1QA 2Z5RA 5CMQA 2WWXB 5JKMG 3C21A 3TA8A 4RC7B 5LG2A 3AJQA 4ISMA 4RC8A 3AF8X 4ZKHA 2V2PA 2WLAA 4RC5A 4XGSA 3BVIA 4TW3A 4MUDA 3ISEA 2VZBA 3PWFA 3F32A 2YJJA 3AK9A 3HIUA 4LQHA 1LB3A 4PGIA 3E1QA 1TKOA 3EZ0A 1RCCA 5GU0X 3RGDA 4TOCA 5D8SA 5FFBA 5FFAA 1B71A 2CN6A 5E2DA 3BVKA 4LPMA 5GU1X 5J8WA 4YKHA 1R03A 3F35A 3RBCA 3JZAB 3GVYA 1JREA 3PW8A 3NP2X 4RC6A 3KXUA 3OJ5A 4TO9A 2C2FA 3E2CA 4LYXA 3R2LA 2V8TA 1DATA 2JD80 3FI6A 4CVRA 3FRSA 4CMYA 2V2SA 5HQOA 3RD0A 1LKOA 2HR5A 4MJYA 4EVBA 4CVSA 5K53A 2PYBA 2OH3A 4EVCA 3W54A 1RYTA 4PG0A 3AK8A 1JKVA 3E1LA 1TK6A 3JZ9A 3BKNA 2G38B 1O9RA 1S2ZA 3C1YA 3N6OA 3QVDA 2FJCA 2BKCA 1S30A 4CY9A 1S3QA 1VEIA 1XZ1A 1VLGA 2XGWA 3E1PA 3Q4RA 2CLBA 4IWJA 5J8SA 3KA9A 2GYQA 1ZS3A 1IERA 3ES3A 3RAVA 4Z3BA 3D19A 5J9VA 3NP0X 3PVRA 4OYNA 4CMYV 1DPSA 4ZL6A 2OKCA 2ITBA 2C41A 2Y44A 4QUWA 1RCIA 4LPJA 2VXXA 3DBYA 4XKSA 3HL1A 2YW7A 3PVTA 5JDOB 3U90A 2CF7A 4REUA 2HTNA 2ZG8X 4ZKXA 1EUMA 3BT5A 2YJKA 5J93A 1LKPA 3PW1A 4TODA 3NOZX 2C6RA 1OTKA 4DASA 3IS8A 5GN8B 2CEIA 3WNWA 2ZA7A 2OC5A 2ZG9X 2ZG7X 1NFVA 5GOUA 3WVVA 2V2RA 2JD60 4DYZA 2CIHA 3ERZA 3QB9A 3QZ3A 4CVPA 3AJOA 3KA6A 3R2HA 5I4JA 4LPNA 4E40A 4ZMCA 5D8RA 4KVQA 2IU2A 4ZJKA 4IXKA 1MFRA 5JKLA 1Z6OA 1Z6OM 1RCDA 1DVBA 5E1UA 4LQNA 4P18A 5LS9A 1RCGA 4II4A 2JD70 3E1JA 3MPSA 5K52A 1IESA 2V2IA 4DI0A 3VNXA 3EZUA 3SE1A 4ZLWA 5ERKA 4R42A 2XJMA 3LKDA 2V2JA 1YUZA 4AM5A 4ZL5A 4ITWA 3E6SA 4AM4A 4EVDA 3E1MA 1LKMA 3IS7A 3OGHA 4ITTA 4XKTA 5FFCA 2V2LA 3UOIA 1RCEA 3A9QA 3KA4A 2C2UA 4MKUA 3GHQA 5FEJA 2F7NA 4ZTTA 4CVTA 5D8XA 1L8HA 1Z4AA 4TOGA 5GU2X 3WVWA 1SOFA 3PW8C 4MN9A 2VXIA 2XKQA 4E6KA 1XZ3A 3VV9A 2WTLA 2FL0A 4ISPA 2V15A 5C6FA 1MOJA 3KA8A 1GWGA 5JACA 4CYBA 5HU6D 1JGCA 3FRRA 1JKUA 4KVSA 2W0OA 2N02A 4RC7A 4RC6B 1BCFA 4ML5A 1VJXA 4ERUA 4DYXA 2XJOA 5GU3X 4XKUA 4LQJA 3AF7X 5GN8A 2YW6A 1ZUJA 3SIDA 2AR0A 2Z6MA 4IWKA 3V3KB 2V2NA 2ZA6A 1UVHA 5JKMA 3C23A 2V2OA 2FG4A 2IY4A 3E1NA 3AF9X 2CWLA 3R2RA 3E6RA 3UOFA 3Q4NA 3F36A 3Q4QA 3KX9A 1VELA 4YVZA 1TKPA 4KVRA 1AEWA 3R2MA 1BG7A 3F39A 4M35A 1VEQA 2C2JA 4Y08A 3PWQA 5HJHA 1YV1A 5CZUA 3O7SA 2Z5PA 2CN7A 1JI4A 2G4HA 3H7GA 3GE4A 3AJPA 3GGYA 2MGYA 3F38A 1JYBA 4U3GA 4W4LB 1SQ3A 2FG8A 4WJG4 4TOAA 5AXSA 3PVRB 3R2OA 4A25A 4M34A 1QGHA 3KDQA 3PVYB 3QHCA 4PGKA 3EGMA 3Q4OA 3UNOA 4LQVA 4DZ0A 2CHPA 3R2SA 3FSEA 1YUXA 2Z90A 3KWOA 3PWQC 3BVFA 2QQYA 3R2KA 3M6JA 1NF6A 3WVUA 3PVTB 2V2MA 5HJFA 2BW1A 4TOHA 2BJYA 2V8UA 1JI5A 4TOFA 4EVEA 5LBHA 2XJNA
chains in the Genus database with same CATH topology
3PW1B 1F30A 4TOEA 4RC5B 3ISFA 1KRQA 2FZFA 2IB0A 5D8OA 5CMRA 3VVAA 3O7RA 5JKLG 2Y3QA 2ZURX 2WLUA 3IQ1A 4YXJA 2CHIA 3SHXA 1BFRA 2FKZA 3RE7A 4TOBA 3C1ZA 5FFEA 2FFXJ 4M33A 3F34A 1O9IA 1H96A 3BVLA 4MY7A 5JDOA 1QYBA 3QD8A 5D8QA 5D8YA 1F33A 2BK6A 2Z5QA 3FVBA 4DYYA 4II4B 3T9JA 3QHBA 4W4KB 2FHAA 3L0MA 1UMNA 5FFDA 1JTSA 3GGZA 1NNQA 1FHAA 5ERJA 1JIGA 5IX6A 2RBDA 3BVEA 1NF4A 4KXRB 4DE6A 4ZKWA 2D5KA 2GS4A 1HRSA 4AM2A 3E1OA 2QF9A 3KHKA 1TJOA 4ETRA 3PZAA 4M32A 4DYUA 3PVYA 4X0JA 3F37A 1L8IA 2ZA8A 4YXMA 4Z5SA 5D8PA 2CLUA 4LYUA 4MXPA 2X170 3KA3A 3F33A 1J30A 5LG8A 4PG1A 3SH6A 2UX1A 3UFBA 3A68A 2GYDA 4CYAA 1N1QA 2Z5RA 5CMQA 2WWXB 5JKMG 3C21A 3TA8A 4RC7B 5LG2A 3AJQA 4ISMA 4RC8A 3AF8X 4ZKHA 2V2PA 2WLAA 4RC5A 4XGSA 3BVIA 4TW3A 4MUDA 3ISEA 2VZBA 3PWFA 3F32A 2YJJA 3AK9A 3HIUA 4LQHA 1LB3A 4PGIA 3E1QA 1TKOA 3EZ0A 1RCCA 5GU0X 3RGDA 4TOCA 5D8SA 5FFBA 5FFAA 1B71A 2CN6A 5E2DA 3BVKA 4LPMA 5GU1X 5J8WA 4YKHA 1R03A 3F35A 3RBCA 3JZAB 3GVYA 1JREA 3PW8A 3NP2X 4RC6A 3KXUA 3OJ5A 4TO9A 2C2FA 3E2CA 4LYXA 3R2LA 2V8TA 1DATA 2JD80 3FI6A 4CVRA 3FRSA 4CMYA 2V2SA 5HQOA 3RD0A 1LKOA 2HR5A 4MJYA 4EVBA 4CVSA 5K53A 2PYBA 2OH3A 4EVCA 3W54A 1RYTA 4PG0A 3AK8A 1JKVA 3E1LA 1TK6A 3JZ9A 3BKNA 2G38B 1O9RA 1S2ZA 3C1YA 3N6OA 3QVDA 2FJCA 2BKCA 1S30A 4CY9A 1S3QA 1VEIA 1XZ1A 1VLGA 2XGWA 3E1PA 3Q4RA 2CLBA 4IWJA 5J8SA 3KA9A 2GYQA 1ZS3A 1IERA 3ES3A 3RAVA 4Z3BA 3D19A 5J9VA 3NP0X 3PVRA 4OYNA 4CMYV 1DPSA 4ZL6A 2OKCA 2ITBA 2C41A 2Y44A 4QUWA 1RCIA 4LPJA 2VXXA 3DBYA 4XKSA 3HL1A 2YW7A 3PVTA 5JDOB 3U90A 2CF7A 4REUA 2HTNA 2ZG8X 4ZKXA 1EUMA 3BT5A 2YJKA 5J93A 1LKPA 3PW1A 4TODA 3NOZX 2C6RA 1OTKA 4DASA 3IS8A 5GN8B 2CEIA 3WNWA 2ZA7A 2OC5A 2ZG9X 2ZG7X 1NFVA 5GOUA 3WVVA 2V2RA 2JD60 4DYZA 2CIHA 3ERZA 3QB9A 3QZ3A 4CVPA 3AJOA 3KA6A 3R2HA 5I4JA 4LPNA 4E40A 4ZMCA 5D8RA 4KVQA 2IU2A 4ZJKA 4IXKA 1MFRA 5JKLA 1Z6OA 1Z6OM 1RCDA 1DVBA 5E1UA 4LQNA 4P18A 5LS9A 1RCGA 4II4A 2JD70 3E1JA 3MPSA 5K52A 1IESA 2V2IA 4DI0A 3VNXA 3EZUA 3SE1A 4ZLWA 5ERKA 4R42A 2XJMA 3LKDA 2V2JA 1YUZA 4AM5A 4ZL5A 4ITWA 3E6SA 4AM4A 4EVDA 3E1MA 1LKMA 3IS7A 3OGHA 4ITTA 4XKTA 5FFCA 2V2LA 3UOIA 1RCEA 3A9QA 3KA4A 2C2UA 4MKUA 3GHQA 5FEJA 2F7NA 4ZTTA 4CVTA 5D8XA 1L8HA 1Z4AA 4TOGA 5GU2X 3WVWA 1SOFA 3PW8C 4MN9A 2VXIA 2XKQA 4E6KA 1XZ3A 3VV9A 2WTLA 2FL0A 4ISPA 2V15A 5C6FA 1MOJA 3KA8A 1GWGA 5JACA 4CYBA 5HU6D 1JGCA 3FRRA 1JKUA 4KVSA 2W0OA 2N02A 4RC7A 4RC6B 1BCFA 4ML5A 1VJXA 4ERUA 4DYXA 2XJOA 5GU3X 4XKUA 4LQJA 3AF7X 5GN8A 2YW6A 1ZUJA 3SIDA 2AR0A 2Z6MA 4IWKA 3V3KB 2V2NA 2ZA6A 1UVHA 5JKMA 3C23A 2V2OA 2FG4A 2IY4A 3E1NA 3AF9X 2CWLA 3R2RA 3E6RA 3UOFA 3Q4NA 3F36A 3Q4QA 3KX9A 1VELA 4YVZA 1TKPA 4KVRA 1AEWA 3R2MA 1BG7A 3F39A 4M35A 1VEQA 2C2JA 4Y08A 3PWQA 5HJHA 1YV1A 5CZUA 3O7SA 2Z5PA 2CN7A 1JI4A 2G4HA 3H7GA 3GE4A 3AJPA 3GGYA 2MGYA 3F38A 1JYBA 4U3GA 4W4LB 1SQ3A 2FG8A 4WJG4 4TOAA 5AXSA 3PVRB 3R2OA 4A25A 4M34A 1QGHA 3KDQA 3PVYB 3QHCA 4PGKA 3EGMA 3Q4OA 3UNOA 4LQVA 4DZ0A 2CHPA 3R2SA 3FSEA 1YUXA 2Z90A 3KWOA 3PWQC 3BVFA 2QQYA 3R2KA 3M6JA 1NF6A 3WVUA 3PVTB 2V2MA 5HJFA 2BW1A 4TOHA 2BJYA 2V8UA 1JI5A 4TOFA 4EVEA 5LBHA 2XJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW1 B;  1F30 A;  4TOE A;  4RC5 B;  3ISF A;  1KRQ A;  2FZF A;  2IB0 A;  5D8O A;  5CMR A;  3O7R A;  5JKL G;  2Y3Q A;  2ZUR X;  2WLU A;  3IQ1 A;  2CHI A;  3SHX A;  1BFR A;  2FKZ A;  3RE7 A;  4TOB A;  5FFE A;  2FFX J;  4M33 A;  3F34 A;  1O9I A;  1H96 A;  3BVL A;  4MY7 A;  1QYB A;  3QD8 A;  5D8Q A;  5D8Y A;  1F33 A;  2BK6 A;  2Z5Q A;  3FVB A;  4DYY A;  4II4 B;  3T9J A;  3QHB A;  2FHA A;  1UMN A;  5FFD A;  1JTS A;  1NNQ A;  1FHA A;  5ERJ A;  1JIG A;  5IX6 A;  2RBD A;  3BVE A;  1NF4 A;  4DE6 A;  4ZKW A;  2D5K A;  2GS4 A;  1HRS A;  4AM2 A;  3E1O A;  2QF9 A;  1TJO A;  4ETR A;  3PZA A;  4M32 A;  4DYU A;  3PVY A;  3F37 A;  1L8I A;  2ZA8 A;  4Z5S A;  5D8P A;  2CLU A;  4LYU A;  2X17 0;  3KA3 A;  3F33 A;  1J30 A;  5LG8 A;  4PG1 A;  3SH6 A;  2UX1 A;  3A68 A;  2GYD A;  4CYA A;  1N1Q A;  2Z5R A;  5CMQ A;  5JKM G;  3TA8 A;  4RC7 B;  5LG2 A;  3AJQ A;  4ISM A;  4RC8 A;  3AF8 X;  4ZKH A;  2V2P A;  2WLA A;  4RC5 A;  4XGS A;  3BVI A;  4TW3 A;  4MUD A;  3ISE A;  2VZB A;  3PWF A;  3F32 A;  2YJJ A;  3AK9 A;  3HIU A;  4LQH A;  1LB3 A;  4PGI A;  3E1Q A;  1TKO A;  3EZ0 A;  1RCC A;  5GU0 X;  3RGD A;  4TOC A;  5D8S A;  5FFB A;  5FFA A;  1B71 A;  2CN6 A;  5E2D A;  3BVK A;  4LPM A;  5GU1 X;  5J8W A;  4YKH A;  1R03 A;  3F35 A;  3RBC A;  3GVY A;  1JRE A;  3PW8 A;  3NP2 X;  4RC6 A;  3KXU A;  3OJ5 A;  4TO9 A;  2C2F A;  3E2C A;  4LYX A;  3R2L A;  1DAT A;  2JD8 0;  3FI6 A;  4CVR A;  4CMY A;  2V2S A;  5HQO A;  3RD0 A;  1LKO A;  2HR5 A;  4MJY A;  4EVB A;  4CVS A;  5K53 A;  2PYB A;  2OH3 A;  4EVC A;  1RYT A;  4PG0 A;  3AK8 A;  1JKV A;  3E1L A;  1TK6 A;  3BKN A;  1O9R A;  1S2Z A;  3QVD A;  2FJC A;  2BKC A;  1S30 A;  4CY9 A;  1S3Q A;  1VEI A;  1XZ1 A;  1VLG A;  2XGW A;  3E1P A;  3Q4R A;  2CLB A;  4IWJ A;  5J8S A;  3KA9 A;  2GYQ A;  1ZS3 A;  1IER A;  3ES3 A;  3RAV A;  4Z3B A;  5J9V A;  3NP0 X;  3PVR A;  4OYN A;  4CMY V;  1DPS A;  4ZL6 A;  2ITB A;  2C41 A;  4QUW A;  1RCI A;  4LPJ A;  2VXX A;  4XKS A;  3HL1 A;  2YW7 A;  3PVT A;  3U90 A;  2CF7 A;  4REU A;  2HTN A;  2ZG8 X;  4ZKX A;  1EUM A;  3BT5 A;  2YJK A;  5J93 A;  1LKP A;  3PW1 A;  4TOD A;  3NOZ X;  2C6R A;  1OTK A;  4DAS A;  3IS8 A;  5GN8 B;  2CEI A;  3WNW A;  2ZA7 A;  2OC5 A;  2ZG9 X;  2ZG7 X;  1NFV A;  5GOU A;  3WVV A;  2V2R A;  2JD6 0;  4DYZ A;  2CIH A;  3ERZ A;  3QB9 A;  3QZ3 A;  4CVP A;  3AJO A;  3KA6 A;  3R2H A;  5I4J A;  4LPN A;  4ZMC A;  5D8R A;  4KVQ A;  2IU2 A;  4ZJK A;  4IXK A;  1MFR A;  5JKL A;  1Z6O A;  1Z6O M;  1RCD A;  1DVB A;  5E1U A;  4LQN A;  4P18 A;  5LS9 A;  1RCG A;  4II4 A;  2JD7 0;  3E1J A;  3MPS A;  5K52 A;  1IES A;  2V2I A;  4DI0 A;  3VNX A;  3EZU A;  3SE1 A;  4ZLW A;  5ERK A;  4R42 A;  2XJM A;  2V2J A;  1YUZ A;  4AM5 A;  4ZL5 A;  4ITW A;  3E6S A;  4AM4 A;  4EVD A;  3E1M A;  1LKM A;  3IS7 A;  3OGH A;  4ITT A;  4XKT A;  5FFC A;  2V2L A;  3UOI A;  1RCE A;  3A9Q A;  3KA4 A;  2C2U A;  4MKU A;  3GHQ A;  5FEJ A;  2F7N A;  4ZTT A;  4CVT A;  5D8X A;  1L8H A;  1Z4A A;  4TOG A;  5GU2 X;  3WVW A;  1SOF A;  3PW8 C;  4MN9 A;  2VXI A;  2XKQ A;  4E6K A;  1XZ3 A;  2WTL A;  2FL0 A;  4ISP A;  2V15 A;  5C6F A;  1MOJ A;  3KA8 A;  1GWG A;  5JAC A;  4CYB A;  1JGC A;  1JKU A;  4KVS A;  2W0O A;  4RC7 A;  4RC6 B;  1BCF A;  4ML5 A;  1VJX A;  4ERU A;  4DYX A;  2XJO A;  5GU3 X;  4XKU A;  4LQJ A;  3AF7 X;  5GN8 A;  2YW6 A;  1ZUJ A;  3SID A;  2Z6M A;  4IWK A;  2V2N A;  2ZA6 A;  1UVH A;  5JKM A;  2V2O A;  2FG4 A;  2IY4 A;  3E1N A;  3AF9 X;  3R2R A;  3E6R A;  3UOF A;  3Q4N A;  3F36 A;  3Q4Q A;  3KX9 A;  1VEL A;  1TKP A;  4KVR A;  1AEW A;  3R2M A;  1BG7 A;  3F39 A;  4M35 A;  1VEQ A;  2C2J A;  4Y08 A;  3PWQ A;  5HJH A;  1YV1 A;  5CZU A;  3O7S A;  2Z5P A;  2CN7 A;  1JI4 A;  2G4H A;  3H7G A;  3GE4 A;  3AJP A;  3F38 A;  1JYB A;  4U3G A;  1SQ3 A;  2FG8 A;  4TOA A;  5AXS A;  3PVR B;  3R2O A;  4A25 A;  4M34 A;  1QGH A;  3PVY B;  3QHC A;  4PGK A;  3EGM A;  3Q4O A;  3UNO A;  4LQV A;  4DZ0 A;  2CHP A;  3R2S A;  3FSE A;  1YUX A;  2Z90 A;  3KWO A;  3PWQ C;  3BVF A;  2QQY A;  3R2K A;  1NF6 A;  3WVU A;  3PVT B;  2V2M A;  5HJF A;  2BW1 A;  4TOH A;  2BJY A;  1JI5 A;  4TOF A;  4EVE A;  5LBH A;  2XJN A; 
#chains in the Genus database with same CATH topology
 3PW1 B;  1F30 A;  4TOE A;  4RC5 B;  3ISF A;  1KRQ A;  2FZF A;  2IB0 A;  5D8O A;  5CMR A;  3VVA A;  3O7R A;  5JKL G;  2Y3Q A;  2ZUR X;  2WLU A;  3IQ1 A;  4YXJ A;  2CHI A;  3SHX A;  1BFR A;  2FKZ A;  3RE7 A;  4TOB A;  3C1Z A;  5FFE A;  2FFX J;  4M33 A;  3F34 A;  1O9I A;  1H96 A;  3BVL A;  4MY7 A;  5JDO A;  1QYB A;  3QD8 A;  5D8Q A;  5D8Y A;  1F33 A;  2BK6 A;  2Z5Q A;  3FVB A;  4DYY A;  4II4 B;  3T9J A;  3QHB A;  4W4K B;  2FHA A;  3L0M A;  1UMN A;  5FFD A;  1JTS A;  3GGZ A;  1NNQ A;  1FHA A;  5ERJ A;  1JIG A;  5IX6 A;  2RBD A;  3BVE A;  1NF4 A;  4KXR B;  4DE6 A;  4ZKW A;  2D5K A;  2GS4 A;  1HRS A;  4AM2 A;  3E1O A;  2QF9 A;  3KHK A;  1TJO A;  4ETR A;  3PZA A;  4M32 A;  4DYU A;  3PVY A;  4X0J A;  3F37 A;  1L8I A;  2ZA8 A;  4YXM A;  4Z5S A;  5D8P A;  2CLU A;  4LYU A;  4MXP A;  2X17 0;  3KA3 A;  3F33 A;  1J30 A;  5LG8 A;  4PG1 A;  3SH6 A;  2UX1 A;  3UFB A;  3A68 A;  2GYD A;  4CYA A;  1N1Q A;  2Z5R A;  5CMQ A;  2WWX B;  5JKM G;  3C21 A;  3TA8 A;  4RC7 B;  5LG2 A;  3AJQ A;  4ISM A;  4RC8 A;  3AF8 X;  4ZKH A;  2V2P A;  2WLA A;  4RC5 A;  4XGS A;  3BVI A;  4TW3 A;  4MUD A;  3ISE A;  2VZB A;  3PWF A;  3F32 A;  2YJJ A;  3AK9 A;  3HIU A;  4LQH A;  1LB3 A;  4PGI A;  3E1Q A;  1TKO A;  3EZ0 A;  1RCC A;  5GU0 X;  3RGD A;  4TOC A;  5D8S A;  5FFB A;  5FFA A;  1B71 A;  2CN6 A;  5E2D A;  3BVK A;  4LPM A;  5GU1 X;  5J8W A;  4YKH A;  1R03 A;  3F35 A;  3RBC A;  3JZA B;  3GVY A;  1JRE A;  3PW8 A;  3NP2 X;  4RC6 A;  3KXU A;  3OJ5 A;  4TO9 A;  2C2F A;  3E2C A;  4LYX A;  3R2L A;  2V8T A;  1DAT A;  2JD8 0;  3FI6 A;  4CVR A;  3FRS A;  4CMY A;  2V2S A;  5HQO A;  3RD0 A;  1LKO A;  2HR5 A;  4MJY A;  4EVB A;  4CVS A;  5K53 A;  2PYB A;  2OH3 A;  4EVC A;  3W54 A;  1RYT A;  4PG0 A;  3AK8 A;  1JKV A;  3E1L A;  1TK6 A;  3JZ9 A;  3BKN A;  2G38 B;  1O9R A;  1S2Z A;  3C1Y A;  3N6O A;  3QVD A;  2FJC A;  2BKC A;  1S30 A;  4CY9 A;  1S3Q A;  1VEI A;  1XZ1 A;  1VLG A;  2XGW A;  3E1P A;  3Q4R A;  2CLB A;  4IWJ A;  5J8S A;  3KA9 A;  2GYQ A;  1ZS3 A;  1IER A;  3ES3 A;  3RAV A;  4Z3B A;  3D19 A;  5J9V A;  3NP0 X;  3PVR A;  4OYN A;  4CMY V;  1DPS A;  4ZL6 A;  2OKC A;  2ITB A;  2C41 A;  2Y44 A;  4QUW A;  1RCI A;  4LPJ A;  2VXX A;  3DBY A;  4XKS A;  3HL1 A;  2YW7 A;  3PVT A;  5JDO B;  3U90 A;  2CF7 A;  4REU A;  2HTN A;  2ZG8 X;  4ZKX A;  1EUM A;  3BT5 A;  2YJK A;  5J93 A;  1LKP A;  3PW1 A;  4TOD A;  3NOZ X;  2C6R A;  1OTK A;  4DAS A;  3IS8 A;  5GN8 B;  2CEI A;  3WNW A;  2ZA7 A;  2OC5 A;  2ZG9 X;  2ZG7 X;  1NFV A;  5GOU A;  3WVV A;  2V2R A;  2JD6 0;  4DYZ A;  2CIH A;  3ERZ A;  3QB9 A;  3QZ3 A;  4CVP A;  3AJO A;  3KA6 A;  3R2H A;  5I4J A;  4LPN A;  4E40 A;  4ZMC A;  5D8R A;  4KVQ A;  2IU2 A;  4ZJK A;  4IXK A;  1MFR A;  5JKL A;  1Z6O A;  1Z6O M;  1RCD A;  1DVB A;  5E1U A;  4LQN A;  4P18 A;  5LS9 A;  1RCG A;  4II4 A;  2JD7 0;  3E1J A;  3MPS A;  5K52 A;  1IES A;  2V2I A;  4DI0 A;  3VNX A;  3EZU A;  3SE1 A;  4ZLW A;  5ERK A;  4R42 A;  2XJM A;  3LKD A;  2V2J A;  1YUZ A;  4AM5 A;  4ZL5 A;  4ITW A;  3E6S A;  4AM4 A;  4EVD A;  3E1M A;  1LKM A;  3IS7 A;  3OGH A;  4ITT A;  4XKT A;  5FFC A;  2V2L A;  3UOI A;  1RCE A;  3A9Q A;  3KA4 A;  2C2U A;  4MKU A;  3GHQ A;  5FEJ A;  2F7N A;  4ZTT A;  4CVT A;  5D8X A;  1L8H A;  1Z4A A;  4TOG A;  5GU2 X;  3WVW A;  1SOF A;  3PW8 C;  4MN9 A;  2VXI A;  2XKQ A;  4E6K A;  1XZ3 A;  3VV9 A;  2WTL A;  2FL0 A;  4ISP A;  2V15 A;  5C6F A;  1MOJ A;  3KA8 A;  1GWG A;  5JAC A;  4CYB A;  5HU6 D;  1JGC A;  3FRR A;  1JKU A;  4KVS A;  2W0O A;  2N02 A;  4RC7 A;  4RC6 B;  1BCF A;  4ML5 A;  1VJX A;  4ERU A;  4DYX A;  2XJO A;  5GU3 X;  4XKU A;  4LQJ A;  3AF7 X;  5GN8 A;  2YW6 A;  1ZUJ A;  3SID A;  2AR0 A;  2Z6M A;  4IWK A;  3V3K B;  2V2N A;  2ZA6 A;  1UVH A;  5JKM A;  3C23 A;  2V2O A;  2FG4 A;  2IY4 A;  3E1N A;  3AF9 X;  2CWL A;  3R2R A;  3E6R A;  3UOF A;  3Q4N A;  3F36 A;  3Q4Q A;  3KX9 A;  1VEL A;  4YVZ A;  1TKP A;  4KVR A;  1AEW A;  3R2M A;  1BG7 A;  3F39 A;  4M35 A;  1VEQ A;  2C2J A;  4Y08 A;  3PWQ A;  5HJH A;  1YV1 A;  5CZU A;  3O7S A;  2Z5P A;  2CN7 A;  1JI4 A;  2G4H A;  3H7G A;  3GE4 A;  3AJP A;  3GGY A;  2MGY A;  3F38 A;  1JYB A;  4U3G A;  4W4L B;  1SQ3 A;  2FG8 A;  4WJG 4;  4TOA A;  5AXS A;  3PVR B;  3R2O A;  4A25 A;  4M34 A;  1QGH A;  3KDQ A;  3PVY B;  3QHC A;  4PGK A;  3EGM A;  3Q4O A;  3UNO A;  4LQV A;  4DZ0 A;  2CHP A;  3R2S A;  3FSE A;  1YUX A;  2Z90 A;  3KWO A;  3PWQ C;  3BVF A;  2QQY A;  3R2K A;  3M6J A;  1NF6 A;  3WVU A;  3PVT B;  2V2M A;  5HJF A;  2BW1 A;  4TOH A;  2BJY A;  2V8U A;  1JI5 A;  4TOF A;  4EVE A;  5LBH A;  2XJN A; 
#chains in the Genus database with same CATH homology
 3PW1 B;  1F30 A;  4TOE A;  4RC5 B;  3ISF A;  1KRQ A;  2FZF A;  2IB0 A;  5D8O A;  5CMR A;  3VVA A;  3O7R A;  5JKL G;  2Y3Q A;  2ZUR X;  2WLU A;  3IQ1 A;  4YXJ A;  2CHI A;  3SHX A;  1BFR A;  2FKZ A;  3RE7 A;  4TOB A;  3C1Z A;  5FFE A;  2FFX J;  4M33 A;  3F34 A;  1O9I A;  1H96 A;  3BVL A;  4MY7 A;  5JDO A;  1QYB A;  3QD8 A;  5D8Q A;  5D8Y A;  1F33 A;  2BK6 A;  2Z5Q A;  3FVB A;  4DYY A;  4II4 B;  3T9J A;  3QHB A;  4W4K B;  2FHA A;  3L0M A;  1UMN A;  5FFD A;  1JTS A;  3GGZ A;  1NNQ A;  1FHA A;  5ERJ A;  1JIG A;  5IX6 A;  2RBD A;  3BVE A;  1NF4 A;  4KXR B;  4DE6 A;  4ZKW A;  2D5K A;  2GS4 A;  1HRS A;  4AM2 A;  3E1O A;  2QF9 A;  3KHK A;  1TJO A;  4ETR A;  3PZA A;  4M32 A;  4DYU A;  3PVY A;  4X0J A;  3F37 A;  1L8I A;  2ZA8 A;  4YXM A;  4Z5S A;  5D8P A;  2CLU A;  4LYU A;  4MXP A;  2X17 0;  3KA3 A;  3F33 A;  1J30 A;  5LG8 A;  4PG1 A;  3SH6 A;  2UX1 A;  3UFB A;  3A68 A;  2GYD A;  4CYA A;  1N1Q A;  2Z5R A;  5CMQ A;  2WWX B;  5JKM G;  3C21 A;  3TA8 A;  4RC7 B;  5LG2 A;  3AJQ A;  4ISM A;  4RC8 A;  3AF8 X;  4ZKH A;  2V2P A;  2WLA A;  4RC5 A;  4XGS A;  3BVI A;  4TW3 A;  4MUD A;  3ISE A;  2VZB A;  3PWF A;  3F32 A;  2YJJ A;  3AK9 A;  3HIU A;  4LQH A;  1LB3 A;  4PGI A;  3E1Q A;  1TKO A;  3EZ0 A;  1RCC A;  5GU0 X;  3RGD A;  4TOC A;  5D8S A;  5FFB A;  5FFA A;  1B71 A;  2CN6 A;  5E2D A;  3BVK A;  4LPM A;  5GU1 X;  5J8W A;  4YKH A;  1R03 A;  3F35 A;  3RBC A;  3JZA B;  3GVY A;  1JRE A;  3PW8 A;  3NP2 X;  4RC6 A;  3KXU A;  3OJ5 A;  4TO9 A;  2C2F A;  3E2C A;  4LYX A;  3R2L A;  2V8T A;  1DAT A;  2JD8 0;  3FI6 A;  4CVR A;  3FRS A;  4CMY A;  2V2S A;  5HQO A;  3RD0 A;  1LKO A;  2HR5 A;  4MJY A;  4EVB A;  4CVS A;  5K53 A;  2PYB A;  2OH3 A;  4EVC A;  3W54 A;  1RYT A;  4PG0 A;  3AK8 A;  1JKV A;  3E1L A;  1TK6 A;  3JZ9 A;  3BKN A;  2G38 B;  1O9R A;  1S2Z A;  3C1Y A;  3N6O A;  3QVD A;  2FJC A;  2BKC A;  1S30 A;  4CY9 A;  1S3Q A;  1VEI A;  1XZ1 A;  1VLG A;  2XGW A;  3E1P A;  3Q4R A;  2CLB A;  4IWJ A;  5J8S A;  3KA9 A;  2GYQ A;  1ZS3 A;  1IER A;  3ES3 A;  3RAV A;  4Z3B A;  3D19 A;  5J9V A;  3NP0 X;  3PVR A;  4OYN A;  4CMY V;  1DPS A;  4ZL6 A;  2OKC A;  2ITB A;  2C41 A;  2Y44 A;  4QUW A;  1RCI A;  4LPJ A;  2VXX A;  3DBY A;  4XKS A;  3HL1 A;  2YW7 A;  3PVT A;  5JDO B;  3U90 A;  2CF7 A;  4REU A;  2HTN A;  2ZG8 X;  4ZKX A;  1EUM A;  3BT5 A;  2YJK A;  5J93 A;  1LKP A;  3PW1 A;  4TOD A;  3NOZ X;  2C6R A;  1OTK A;  4DAS A;  3IS8 A;  5GN8 B;  2CEI A;  3WNW A;  2ZA7 A;  2OC5 A;  2ZG9 X;  2ZG7 X;  1NFV A;  5GOU A;  3WVV A;  2V2R A;  2JD6 0;  4DYZ A;  2CIH A;  3ERZ A;  3QB9 A;  3QZ3 A;  4CVP A;  3AJO A;  3KA6 A;  3R2H A;  5I4J A;  4LPN A;  4E40 A;  4ZMC A;  5D8R A;  4KVQ A;  2IU2 A;  4ZJK A;  4IXK A;  1MFR A;  5JKL A;  1Z6O A;  1Z6O M;  1RCD A;  1DVB A;  5E1U A;  4LQN A;  4P18 A;  5LS9 A;  1RCG A;  4II4 A;  2JD7 0;  3E1J A;  3MPS A;  5K52 A;  1IES A;  2V2I A;  4DI0 A;  3VNX A;  3EZU A;  3SE1 A;  4ZLW A;  5ERK A;  4R42 A;  2XJM A;  3LKD A;  2V2J A;  1YUZ A;  4AM5 A;  4ZL5 A;  4ITW A;  3E6S A;  4AM4 A;  4EVD A;  3E1M A;  1LKM A;  3IS7 A;  3OGH A;  4ITT A;  4XKT A;  5FFC A;  2V2L A;  3UOI A;  1RCE A;  3A9Q A;  3KA4 A;  2C2U A;  4MKU A;  3GHQ A;  5FEJ A;  2F7N A;  4ZTT A;  4CVT A;  5D8X A;  1L8H A;  1Z4A A;  4TOG A;  5GU2 X;  3WVW A;  1SOF A;  3PW8 C;  4MN9 A;  2VXI A;  2XKQ A;  4E6K A;  1XZ3 A;  3VV9 A;  2WTL A;  2FL0 A;  4ISP A;  2V15 A;  5C6F A;  1MOJ A;  3KA8 A;  1GWG A;  5JAC A;  4CYB A;  5HU6 D;  1JGC A;  3FRR A;  1JKU A;  4KVS A;  2W0O A;  2N02 A;  4RC7 A;  4RC6 B;  1BCF A;  4ML5 A;  1VJX A;  4ERU A;  4DYX A;  2XJO A;  5GU3 X;  4XKU A;  4LQJ A;  3AF7 X;  5GN8 A;  2YW6 A;  1ZUJ A;  3SID A;  2AR0 A;  2Z6M A;  4IWK A;  3V3K B;  2V2N A;  2ZA6 A;  1UVH A;  5JKM A;  3C23 A;  2V2O A;  2FG4 A;  2IY4 A;  3E1N A;  3AF9 X;  2CWL A;  3R2R A;  3E6R A;  3UOF A;  3Q4N A;  3F36 A;  3Q4Q A;  3KX9 A;  1VEL A;  4YVZ A;  1TKP A;  4KVR A;  1AEW A;  3R2M A;  1BG7 A;  3F39 A;  4M35 A;  1VEQ A;  2C2J A;  4Y08 A;  3PWQ A;  5HJH A;  1YV1 A;  5CZU A;  3O7S A;  2Z5P A;  2CN7 A;  1JI4 A;  2G4H A;  3H7G A;  3GE4 A;  3AJP A;  3GGY A;  2MGY A;  3F38 A;  1JYB A;  4U3G A;  4W4L B;  1SQ3 A;  2FG8 A;  4WJG 4;  4TOA A;  5AXS A;  3PVR B;  3R2O A;  4A25 A;  4M34 A;  1QGH A;  3KDQ A;  3PVY B;  3QHC A;  4PGK A;  3EGM A;  3Q4O A;  3UNO A;  4LQV A;  4DZ0 A;  2CHP A;  3R2S A;  3FSE A;  1YUX A;  2Z90 A;  3KWO A;  3PWQ C;  3BVF A;  2QQY A;  3R2K A;  3M6J A;  1NF6 A;  3WVU A;  3PVT B;  2V2M A;  5HJF A;  2BW1 A;  4TOH A;  2BJY A;  2V8U A;  1JI5 A;  4TOF A;  4EVE A;  5LBH A;  2XJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...