5FGCE

Three dimensional structure of broadly neutralizing human anti - hepatitis c virus (hcv) glycoprotein e2 fab fragment hc33.8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
225
Chain Sequence
b'EVQLVESGGGLAQPGESLRLSCAASGFNFYTYAMTWVRQAPGKGLEWVSASSSTDGTTYYADSVKGRFTISRDNSKNILYLQMNSLKAEDTATYYCARAVVFTDSSAYYYSKYFDYWSQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Response to Hypervariable Region 1 Interferes with Broadly Neutralizing Antibodies to Hepatitis C Virus.
pubmed doi rcsb
molecule keywords Genome polyprotein
source organism Homo sapiens
molecule tags Viral protein
total genus 46
structure length 225
sequence length 230
ec nomenclature
pdb deposition date 2015-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgcE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgcE01
3GMNA 1QEWA 4M7KL 3S8WA 4LRIC 4Y5VA 5EUOE 1E28B 2FX7L 5T3XL 1UM4L 1N6QH 1JUFB 3MV7A 4HKBA 2P5WA 3INUL 4PJEA 3GMRB 2BNUB 3QH3A 1FDLH 4JFFB 3HR5A 2UY6A 4L5FL 3JV4B 1UWGL 2W0FA 4ODHL 1U0QA 1HOCB 3RVUD 2ZCKL 3NIFE 4M6OL 2Z35B 2MKWA 5ETUB 5DEZA 4PREA 3KLAB 2X44D 4NUJB 5ITFB 3U0TA 2QHRH 3F12B 4WV1C 4X6DB 3T0EC 4U6TA 5IT2H 4JM4H 2N4IA 5FO7A 2J8HA 3N1QC 4U6HA 3RHWK 3SHSA 5ISZE 3FB5B 3IDYB 4IS6A 5FA4A 4U6YA 3ARXA 3QDGA 1YN7B 3G9AB 1J8KA 3L3JA 2FL5B 3C60B 2NY5L 4R8WL 3ZHDA 4IOFC 2H9GB 3MLRL 4E42A 3OKMB 4BKLB 3MRJA 1RHFA 5LBSL 4HX1B 4HFWB 5D1XD 1LE5B 4OLYH 1DBJL 3VWJC 2IH1B 5AG8A 1EEZA 5HHME 4QEGA 1A3RH 1JF6A 3BZFB 3HRZA 3CX5J 5GGRY 4PGDA 4EI6B 3BSZL 5IOPA 5CAYB 1WGOA 4XXCC 1AXSA 1GAFH 1EJ6A 2DYPB 3EBAA 5JIHA 3GRWA 5HJ3B 2Y4SA 1F45A 2ZOKB 3CUPB 4G8FA 5F1IA 3CDGA 4P2OA 2F74A 3OG4B 1LGVA 2X10A 3EYQC 2G5RA 1Z3GH 2G2RA 5DR5H 1PVHA 1DVFD 4ZFOL 1PKQA 4Q2ZA 1X6LA 4U0RB 1DQLH 3VFGH 1U91B 3QULA 3VRLF 1AFVH 1JNLL 4KHXL 4HUUB 1DFBL 4Z6AT 1U6AL 4JO1H 4Y4HC 3GNMH 4EZMA 5ITBL 4YDVB 4Q9CA 1T22B 4U3CA 4F8TA 5CGTA 2A83B 4YEEA 2QQKH 4P5TC 4ZXBC 4QCIB 1H8OA 5EB9A 1H3UA 5D7JD 4LNVA 3GSQB 3L3HB 3OR6A 5IBTL 5D96B 1FYHB 2A74A 2B4CL 3QI9C 4QXTB 1T7ZA 4NNXA 5I8OL 2QR0B 2IAMD 3TO4A 1UJTA 3M07A 2R0ZL 4K3JH 5A43C 1F6AA 3U30C 1CI5A 2VL5A 3MOQA 4P4KD 4QHNB 5HYEA 1ZA6B 4J8RA 2FIKA 4J23A 4JEGB 4IJ3B 5T1KA 1CLOH 2W60A 4ZSOB 3BPCB 5DD5H 3D0VB 3VGGA 4AZ8A 1INEH 3T4YB 3U7AA 3P0VL 4K7PX 3OR7A 4P5KA 3RX7A 1OAXL 5DUBA 5CEXA 1DQTA 4XC1L 3SDXB 3PWLB 1KJ3H 1QNZL 3W82A 3B9KB 1JK8B 5I2IB 2ATPB 4Y4FD 4Y19D 3F7PC 3ESUF 5CJQH 3AXLA 5DUML 3VXUD 2WBJB 5J13C 2Z8VC 4PJCA 3VMOA 3NZ8B 2IMNA 3FOMA 1GHFH 2XWTB 4LRNH 4GXVH 4G8IB 5FUOL 1HNFA 4JAMB 5TDPA 1HEZA 1MCSA 1XR8B 1HYRC 2BX5A 2VXQH 4OBRA 5FCSH 3GJFB 1KSRA 4UTBH 4FQLL 5FGBC 1Z6JT 4LMQI 1KLGB 3S34L 5DRWB 4AYFA 4D2NA 5ICXA 3WDHA 4EI5A 3QDJA 1SHMA 2FLBT 3QG6B 4X9BA 2WBWB 1KPUB 3TA3B 3SBWC 5EG6C 1YPZB 1HXMA 4LSPL 4XRCA 1DL7H 2HP4A 3CFDA 4KGJA 5DK0B 2JB5L 3GSXA 1SJHA 2FD6H 1LD9B 3WFHB 3MZGB 1WAAA 2R4SL 2BVPA 4QRRD 3WLWC 3T2QA 5IQ9B 1ZHKB 2AVGA 1YYLH 4XBEL 1MWAL 2OLDA 3WKMH 2DD8H 4LLMA 1ZGLB 4ONFH 4O2EB 3UROR 2PXYA 1CGYA 3VD7A 5A40E 1E4KA 2XNAA 5L9DH 1I8KB 5F9WC 1UZ8A 1MCWM 1ZOXA 5SX5H 1QHPA 2XA3A 4XP5L 5M94B 4TVPL 3L95B 2FCBA 4DVBB 2GFBA 4K7PY 5D7SL 1DE4B 4WTZG 2MCPH 2BVYA 3FOLB 3GHEH 5C0BD 5FHBH 1HWHB 2BNRA 1N5YL 5JQ6L 4JFHD 2DM4A 3IDIB 3V8OA 3ECBB 4NO2A 5SX4I 1EX0A 4ISVB 5LG1A 1SQ2N 3ELAT 1JN6A 3N06B 4OD1H 3QNZA 1HXYB 1E4XH 1WFTA 3OKOA 3VXRE 5DQJA 1B6DA 1VADA 3VGHA 1IGCH 2GJ6E 4G43A 3SDAA 4I2XE 2R9HD 3VRIB 3UCRA 2EIZB 4HT1L 1IBGH 3I3BA 2NTFB 4JLRA 1RJZA 1ZS8B 3P11H 1AGBA 1MCEA 1Q9WB 5KOMC 2VLKA 3JV6A 3C8KB 2CMRH 3SDCB 3EJZC 4Q9QL 1XGTA 4HS8H 4LQ1A 4JFYB 1ZVSA 4Z7VF 4O9HL 1U3ZA 2OQJB 2NXYD 5CD3B 5E6YA 2F5AH 4FFYL 4DGIH 3SN6N 1ZSDA 3ZE1F 4LAQL 5I74C 3JZ7A 2AEWA 4NQSA 4G6KL 1ONQB 4WW2B 2Z91B 4LLYB 4YNYA 4NFBA 1NBZB 3G6JA 2V17H 2X4RB 3CFJA 1RUMH 1U92B 3CU1A 3FT3B 1Q0YL 3VXSA 4O4YH 2FEEL 3R0MA 5K59F 5ADPH 5E6IC 1JNNH 3R06A 4YDIL 5DJYA 2I9TA 1TZGH 2Q1EA 1C16A 1EFXD 2AXJA 35C8H 2Y36L 4MSWA 1B2WH 4Z78B 2FJGA 2YPLB 3CCHB 5C2UB 1FL3A 2ZCHH 4BH7A 1LHZA 1S9YA 4KI1A 4EBQL 2FO1A 1QPPA 3P4MB 1U2CA 2FDBP 5MI0B 4RGND 4P23D 4NKIL 4APQD 5ESAA 3K2MC 5IMOB 4JE4B 5MP6L 4YHML 2DQUH 3X14B 3N50A 4YJZL 1JGUL 4ODWB 1VERA 4PJIF 4IHOA 4Q6IC 5ILTH 1C12A 3G08B 4YPJA 3KPMB 4AH2A 2PYFB 4JPIB 4JFEB 4ODTL 1D5MA 4LDOB 4OGYL 2VDOH 5FHAH 3DUHA 1AI1H 1FO0L 2FGZA 4IDLA 1TPXB 1QO3B 4ZTOL 3MRIB 4QO1A 5H35B 5EIQA 1TJGL 3BH8A 3WV0A 1MFDH 1H15A 3WIIL 1NFIA 5ACMA 5B4MC 3JV0A 3DPBA 5E8NA 1U8LA 1AGCA 4YHIA 5TE4H 1AQDB 2Z8RA 3C6SB 2IPTH 4MAYC 1LEKA 4K2UH 4PJ7E 1HQRA 2BVUA 2EZ0C 3LKSB 5F7HA 4HC1L 4ODVH 3LRGA 2FX9H 5KSAC 4MQXC 5K9JL 3LKNA 1CBVH 1AO7B 3T8XA 4YWGL 3SKOA 5FYKD 4MB3A 3GSWA 2HTKD 2DWDB 3H7LA 1FN4A 1GJIA 5D7LA 4GRWB 5DEFA 3WFBH 3O8XA 1D5IL 1AXTL 3KWWB 5L8KB 1OVZA 2AJXH 3HC3H 1L7TL 4TN9A 1IAOB 1I9RH 2XKNA 4YIQB 2P5EB 2NW3A 4JFPA 4WI9A 4JZJC 2GQHA 3O0RH 4G6FD 1J1OL 1L6XA 3TJEL 1IM3B 3PL6C 4HJ0C 4G6JL 4L8SA 3BN9C 3RDTC 1OB1A 2DQFB 3P77B 4OF0A 4RNRA 5D7IE 1F11B 1XF2A 3X3FL 2I5YL 4I0PB 4OGZA 4XNUH 5IF0B 4UUJA 4X4XB 4YHYC 3ARFA 4Z7UB 1BIIB 1FJ1A 3LDBC 3S3JA 4LLVB 1NAMB 3IDXH 3LAFA 3MSPA 4ZAKC 5BQ7A 3BP4A 3H0TA 1WWWX 3N9GH 4KK9D 4AMKL 4DK6A 2MKLC 3MRPA 4FQPA 1NBVH 3RGVA 1UM6H 3QIWA 3IVKB 2JJSA 1KTDA 4IOIB 4NC1E 1NEZB 1JPGA 3MQIA 4U1LB 4WWID 5EUOB 4BH8B 1OAZH 3MRFB 3W39B 4Y5XA 3NPSB 4PV8B 1PKOA 3EYSH 2ITDA 3D2UA 3GGWB 3TVMB 4JVPA 1MREL 2A0LC 4M43H 2G9HA 1TQBB 5D71H 4OI7A 4WY7L 3TBTA 5DXWA 4K8RD 4PJAE 1EGJA 4OUUA 4NO5A 3MYJB 1JF1A 2A1WH 4UAOB 4OCYH 5HHXH 5I30H 4LHUG 4XZUA 3OG6B 3ZYJA 1KEGH 4HCRA 4CVZA 4OZ4A 3IU4H 1H0DB 3U46A 4F9PA 3L3OB 5SV4A 2FYYB 2CO6B 5GS1C 1T83C 3QAZC 1A6WL 5EOTA 3DGGB 3OAZH 5IW6B 3QDMA 4YAQB 4P9HC 1NCWH 3MLZH 4LLUB 3MRLB 5FM8A 5HHMB 3U0PB 4PGCB 4M9PA 2Z93A 5J4MA 1XF4B 1FYTA 2PF6A 3L7EA 5I18H 1B3JA 1S9WB 3GM8A 4JM2F 2O93L 4CDGC 4PR5B 3TWCH 4AEEA 5EIIA 4XP6H 2PR4L 4XP1H 3BVNA 3F5WA 1AKJA 1N2RA 3QP3A 2D9CA 5C3TA 4M1GH 1DDHA 1BMGA 2D0GA 5EOCL 1RQ5A 2JCCF 4LU5H 2EDYA 4JY4B 5CINH 2NLJB 3EGSA 3QXDB 4LHUB 4H88L 1TCRA 3RVTD 1TZHA 3O2WH 4LKCA 1E4WL 3MLXH 3O3BB 2DQDH 5TE6H 3BO8A 3C5ZC 4UBDC 5B3NA 1MAJA 4Q9RH 2Q87A 3JTSA 5I17B 3S5LB 5AWNH 4YO0A 1UB5B 3RWCA 4POZD 4GQ9H 3B2UD 1D6VH 4JQIH 5F1NB 1L9MA 5J1TC 1G0YR 1JNJA 4IOSD 3B9DA 5E24E 3O4LB 1J1XL 4PRNB 1MJ7L 4N8PA 2DMKA 4P4RA 1T5WA 4EUPB 1GOFA 3D9AH 1Z0NA 4TSCH 5C07D 4HMDA 1YNLH 1C5BL 3DXAD 2HJKA 4TVSa 1PGRB 1YEJH 4GW5B 2IFGA 4NCC1 4XMKL 5FYKL 5DVMA 7FABL 4YHKH 2YKLL 4W4NA 1ZV5A 1VEPA 3VWKA 3FQXA 2MOVA 4NHCL 1ZLWH 1BWWA 2BZDA 3DECA 1JTOA 4PJHB 1EEYB 4LP5A 5D2LE 4M3JA 2E5EA 5SWZD 1E4XI 4M7LH 4RMWA 1HWGB 4FP8L 4F33B 3U1SL 4V2BA 2H1PH 2R0WL 2YA2A 3T0BA 3PHOB 1SEQL 1RZGB 2HAZA 4YLQT 5I1DB 3U0WH 3MLPA 2AJVH 5JMOC 4HWZA 4N0CC 4NYLA 5ANME 5CUSL 3MLSH 1R3JA 3GZKA 4YR6A 5E8PB 4U33A 2FATL 5FOBB 1NDGA 4F3FB 1I1FB 4P46C 4I0KA 4LBEA 3SQOH 1PYWB 5GGSA 2AEIT 2W0LA 4D9RD 4PUBH 4QRQA 5D7KD 4OLVL 4Z7VA 1FNGB 4X98B 3EO0B 4WGWB 1RHHA 1C5CL 1NC2D 1ND0B 3L3KA 3I75B 1QG3A 1I8LA 3C9NA 3QA3A 3RVVC 4OF6A 3MJ9L 3I50H 4U1NA 1AGFA 1NUDA 3GIVB 4Y5YC 5HI3C 3UTQA 4GW4B 5IQ7H 5JZ7D 4I8DA 5ALBH 1JMXA 3TN0B 4UT9H 1MCNA 5EZOH 1QYGH 4DVRL 3L9RA 4RIRB 1NCDL 1PLGH 5MEND 5AYUH 5IMKA 2W9DL 3PJSB 4L3EA 1FGNL 1N5AA 4WUKL 4N5ED 4Y16B 4R96B 4KTDH 1Q9LA 2OXGA 3DI2B 1T7WA 1KN2L 4M6AA 3KPSE 1Q1JH 4DZBA 2GUOB 4GRMB 4B0MM 2RGSA 4PD4K 1A47A 2C3XA 2EH8L 2X4PB 3IJHB 2NZ9D 4ZFFA 1OW0A 1YYMH 4QF1B 5IGXH 5DO2D 2UUDK 5I1LB 1DSFH 3DRTA 1YNKH 1OP9A 3QIUB 4X99B 1H3WM 4ZUTA 5I1GL 5I0ZA 4I4WB 5IB1A 4XWOD 4J4PD 1QFOA 4NHUB 1YMMD 4PJIA 5INDB 4OFIA 4ZDHA 3DRQA 1YEEL 2RHEA 2XKSA 1AC0A 4JO3L 1KN4H 4KQ3H 2RCSL 5D72H 2NY7H 1KELH 1IGFH 1OAKL 3BZ4A 5DGRA 3GSNL 4FQHB 5DMKA 2RR3A 3MBED 4ELMF 4DZ8B 4C55A 2Q76A 3IS1X 4PJ8D 5IHBA 5FB8A 4OQ1A 3TNNB 1FH5H 3QHZH 1WIOA 1UXSA 4GUPA 5JOFB 2YPKA 5CP7B 1NGXB 4RFNC 3VXRB 4OSUH 2FO4B 4LAJH 3QHFH 3I02A 3KYAA 1MAMH 5GS2D 3G6JE 2GJ6B 5BVJB 1RJCA 4I2XB 3I2CH 1MHHB 1QP1A 5IFHL 3E2HB 4BZ1H 4PP2A 5FO9A 1FFNB 4XNQA 4QRUB 1NGWB 2BDNH 4L3AA 3QCTL 3U79A 1I3RA 1FFRA 2Q7NA 2XRAL 4OBSA 2CIKB 2ZSWA 3U7WH 5GQBA 3IGAB 3RU8L 3CZFB 1T7VA 2R4RL 1E6JH 1WBZA 2QSCH 4ZUUB 3B6SA 3BKJH 2L7UA 4D0CA 1DUZA 4JRYA 2PTTA 2JE8A 2EE3A 1NLDH 4G7VL 2VXVH 5FKAB 3KHQA 3K3QA 3G5ZA 3T0EE 3O3DB 4JFDA 1C7SA 1JHLL 2JTDA 1GOGA 1FZMB 5CIPA 4Z5RA 4WFGE 1RUKH 4B7LA 3U2SB 1R0AL 4FABH 3L3IA 3ROOB 1FNFA 3QUMA 3CLEL 3OMZA 1AIFA 4GKZA 5F7EL 3BH9A 5KN5A 3BKYH 4FQJH 1MCPL 3FRPA 1X6NA 4NQED 4G8EB 3WHE0 5E8OB 1GIGH 1II4E 1RZKH 1IQDA 4YX2H 4OLWL 1BOGA 3KJ4B 3PP3H 3QPXH 4QT5B 4WO4B 4P3WA 2HFEB 4MQTB 3WN5C 1BX2A 3QUZA 1VPOL 4LVHB 2C3GA 1MCQA 5F9OL 1FSKB 3ZTNL 2BFVL 1NJ9A 4RX4A 3N85L 1LO5B 3QJFB 2GITA 1V3LA 4R0LB 2DQHL 1NQBA 5HDBF 2VZUA 3IFLH 3L1OL 4LCCA 4M7JL 2UV3A 4XCCL 1D3CA 1INDH 5I15L 4O00A 1T1YA 1BAFL 1YECL 4OLXH 5KVFH 4FQXC 1KCKA 1P9MC 1F4WL 3D3VA 1HQ4B 4MMZC 3VRJB 1X7QB 3VFSB 4HQQH 1MPAL 1SEBB 1N8ZB 4L4TE 3SE8H 1HKLL 1EO7A 1VKXA 2MPAH 4FMFA 1CICC 2WLZA 2FR4B 4PJ7B 2EDNA 3A67L 5EFIA 5DT1L 2R39A 4L8BB 1D5BB 2VLJD 3QQ4B 5C08E 5IB2B 1VDGA 4XCNB 4QXUL 4HMCA 3LRSB 3UTSE 4HDIA 3FCTA 1C8PA 3D39E 3U4AA 5HYJE 5LXGH 1EEUA 4G9FD 4JM2A 4PBXA 1U93A 3EYUH 5F89A 2AQ1A 1ZANL 2OS7A 4H1LA 3WNNA 3LS5H 3MRCA 3W11D 4F7MB 3CFEB 3QEHB 2XXCB 1KULA 1PQZA 4OKVA 2ZUYA 3GMNB 3W0WD 1QEWB 2MJWA 1GPOL 3WNPA 1G7JB 4ZOCA 1A1OA 4MVBD 2B2XL 2NZIA 4OUOA 2HMIC 2JCCA 3V95A 1JGDA 4Y2DB 3KYNA 5AUMA 3IDMA 3ORJA 5DZOA 2AJYL 2W0FB 5CJXA 2I27N 4FFWD 2OR7A 1NC4D 2VDQL 5D7IB 1MH5A 4HS3A 1CTNA 4NN5C 2X05A 2D03L 4HW6A 4GH7B 1YDPA 1AC6A 1C08A 1YA5A 3RX5A 3SCMB 1T66C 1XIWC 3QSKB 4HLZH 4LSVH 2IQAA 2YSSA 4U6HB 5FO7B 3KPTA 5GS0C 4XHQA 4LCWD 1CLYH 3MLYH 3OAUH 12E8H 1T1ZB 2GAZA 1IGMH 1OF2A 4NRZA 1T4KA 3L3JB 4NOBA 3H9SA 4IMLA 3BKMH 2CLZB 4KTYA 3MRJB 1N7MH 5EBGA 3ULSB 2VDMH 4OCSL 1T2QL 4C83B 4DN3H 1MCOL 4MA1C 1EEZB 4IIQC 1MHEA 4MXWH 4R4FH 5C0CD 3HRZB 1I85C 5SWSA 1S7VA 1OHQA 4WCYH 1EGJH 4FXKB 4XH2A 4G80A 5BV7B 5IOPB 2FZ3B 3PWPA 1GGCH 3F6LA 3QWOA 3BZEA 4L1DA 1UJ3C 3CDGB 4UU9A 4V1DE 1QR1B 4L29B 5KW9L 1BVLA 4PJAB 5I1EL 4LSQL 4JZOA 4OCWH 5KS9E 2HFGL 1CL7L 4MD0A 4M6ML 2XZAL 4RMUA 5I8EB 4LIQE 2AJUH 3EHBD 1UYWH 2ESVA 3WD5H 1IGYA 3QXTA 4HKZA 5EU3B 4N9OB 4KVCL 1QHOA 5IROA 4A6YB 3TO2B 1UFUA 3HZVA 4OQTA 2XFXB 3ZT6A 3V52L 3REVA 2P8PA 1BGXH 4PFEA 4KVNH 5D1XC 4JFXA 2LAAA 2ATKB 1AHWC 5L88L 5JXEA 4ZNEA 1QRND 2I60H 4KJPD 2BCKA 2E9BA 3DTXA 4JFQA 4QGTA 3GM0A 5D1QA 5GRZA 3SGKA 2FX8L 1DLHA 2W60B 4NBZB 2VNCA 4NQTA 3L5XL 5DFVD 4DUWA 1DVFC 1VFAB 5F3BA 1A7RL 5FYLE 4YZFF 3OR7B 1YMHA 1MIEH 4P5KB 5T1DL 2ZG3A 5DUBB 5IEKB 3WFZA 3DETD 3Q1SL 1CQYA 3C2AH 2CUIA 3LZFH 3LD8B 4X7SH 1OARH 3W81A 5T1LA 4OZHF 4NM4H 4OCNC 4RAHA 3ARDB 4NCC2 4K3EL 5IR1B 4PJCB 1IAKA 4MA7L 1CE6A 3TBYB 1XGPA 5FM4A 5D7JC 4X83A 5FYLH 5TDPB 1HEZB 1QSEA 3PV6A 4QKXB 1RFDH 1CXKA 4ELMA 4JO4H 1GGIH 1WV7T 4GRLC 4WGVB 4XVSL 5KG9B 3DUUA 2H3NB 4EI5B 5D2LB 3QDJB 1YY9D 4W68A 3ULUC 4PRHD 1JGVH 1KC5H 2HT4D 4XCYB 4XRCB 1MVFA 2NY6B 3BWAA 4X0KB 3FFDA 4XVJH 5ANMB 3FRUB 5EU7C 2Y25A 1L4IA 5EO1A 3CFCL 4PRPE 3FN3A 2ZUWA 5DJ2B 2HLAB 2EC9T 3MO1B 4O58L 4OLEA 4RMSA 2FHCA 1XCQB 3UTTE 3VG9B 1UCBL 2HTLC 1FVEB 4FN0A 2E7LC 4K23H 4KAQL 5EU6A 5E9DD 3GMOA 3FO9B 4HF5H 1IM9A 4LKXB 4OIBA 4ALAL 2E6QA 1Q0XL 1LQSR 1V3KA 3PUCA 5GIRB 1KPVA 4ETQA 1UZ8B 4NUGH 4UT7H 1ZXQA 4K71C 5D1ZA 1TTGA 1IAIH 4GAJL 3IAPA 2GFBB 4DTGH 3LEVL 4N68A 2CDFA 2UZIH 2BSRA 4MWFB 4WWKB 1L6ZA 3DARA 2OL3L 4S0TD 2VITA 4DN4H 1Z5LA 3R1GL 1XR9A 2QQLL 1F42A 2EE6A 2EYTB 2XA8L 5IVXF 5I1KH 3NABH 4NO2B 3KPSB 3NCJL 1G7MA 5F96H 5IFJA 1WFNA 5F72S 1JWMB 3G6AB 1EO5A 3WIFA 2HG5A 4FOMA 5DQJB 1VACA 2C3WA 3EDEA 1VADB 2VAJA 1I75A 3QG7L 3UDWC 3ZL4L 1BECA 2VLRE 4G43B 4ZFOA 3C08L 3GI8H 3LH2H 3UJJL 4JLRB 3MJ7A 4M6NL 2R23B 4LHJB 4QRPA 3HNSH 1S5IL 1TVHA 1CK0H 2VLKB 5GISL 1I1AC 2YN3A 2XOTA 5ECJE 2AXFA 3TPUA 1ZVSB 4I5BA 5E4IA 4ZD3H 1NCAH 4AQ1B 4KTEL 4TRPL 2YD6A 4O2FA 1K3IA 2YBRA 5I1CH 3ZSTA 2FECI 1D6EB 3N1MC 4B53A 5HHPA 2C7UA 4GG8A 2GJZA 2P48B 4RFEB 2BY0A 3MXVL 5LVEA 1ZLVK 4PB0H 1MJ8H 5IWLC 5IP4A 1QFWM 1QSZA 4J3TA 4S1QL 3X11B 1S8DA 3GSRA 1CD1A 3VFWA 3PGCA 3FB6A 1BZ7A 5L2KA 3G6JB 3OXRA 4EDXA 3DUSB 5K9OA 3CFJB 5CWSB 4PLJD 5HVFB 3E6FA 3VXSB 4L3CA 5E99L 2I9TB 3MV01 1K2DA 3TZVA 1BBJA 4YDJA 1V7ML 1SY6H 2QADC 4MSWB 5HGAA 3VFTB 4HULB 5DD0H 4PGBA 2F8OA 5GGQH 4JQVC 5E8DH 4C56E 3MR9A 5DJCA 3FZUD 1ZVHA 3EOTH 3PQYE 4MB5A 1SMOA 1YC8A 3VU2A 3RL2B 2X7LA 1P53A 1EFQA 2VE6B 5AD0B 4DGYH 2CIIA 3SJVE 4HSQA 4IRSD 5CIPH 4NQXA 4MD5B 3M8OL 1J5OL 1QBLL 3HAEB 1J1PL 2P47B 5ESAB 4UV4H 3QUMH 3T0EB 3WCYA 3QUYA 4XBGA 2EO1A 4MNHA 2R29H 2APWA 2ZCLL 1NGYA 3WXVH 5IB3A 5T5FL 5TQ2L 5JW5A 1P69B 3LQAL 4AH2B 2CO7B 5JIIA 3ARBA 1E4JA 4LLDB 2VH5L 3ZKXB 4FTVA 1RIVL 1SYSA 5JNYA 2EXYC 2JIXA 3I9GL 1F5WA 4NZUL 2ZKHL 4WFFD 3VWJB 4LL9A 2CJUH 4X6BA 2VZSA 2DWEA 3HB3D 4OM1L 3QUXD 1DEDA 1VGEH 3BH8B 1H15B 1NFIB 1BEYL 4KMTL 3D85D 4HGKC 1R5VA 3BRFA 2OR9L 1IMHC 1T5XA 4M5ZL 2IANE 4JO2L 4YHIB 1KJ2B 4N90E 4MA3B 3UYOD 1T89A 2Q7YA 3DROA 1HQRB 3QWQB 4R26L 3VMNA 3VXPA 3OKNA 4P9HH 1JYWA 4KKBC 4J3UA 1XZ0B 2HWZH 4QXGH 4Y4HB 4LEXL 4X5WA 1W72L 1FN4B 5D7LB 1CFTA 4Y2OA 1MWAA 4OT1H 3IU3B 3PWNB 4HLZG 4Y4KA 4GAGL 3V6OC 2A77L 3TLRA 4ZXBB 3PWUB 5B21A 4WI5A 3T0XA 5GRYA 2Q6WB 2YMXL 2NY4B 4KZDL 4L4TB 4M03A 2NW3B 4D9QD 4JFPB 5K9QI 3T2OA 5KVGH 5D6CB 2V7HA 3ZHLA 3NMEA 4MJ6B 5GGSY 1A4KB 3U30B 3PHQA 4L8SB 5A3IC 1Q9KA 4YE4L 2VMFA 1INQA 4H1LH 4HFUH 5C08B 1BQLL 5FUCC 1TENA 3UTSB 2QL1A 2XZQH 3SKMB 2X4NB 4L8CA 1A0QH 1FJ1B 2AGJH 3F8UB 3D0LA 3WXWH 4JN2B 4PJFE 3H0TB 3RY4A 2R1WA 3KXFD 3EJYD 5DRZB 1MQKH 5K9QG 4RA3A 1I7RA 1KTDB 2YN5A 4N1CA 3PE9A 1JPGB 1KFAH 3LHPH 1P4LA 5BW7A 3F7YB 2ZSVB 4LQFH 1P5VA 5AZ2L 1K6QL 1OTUC 3LQMA 1NCUA 2W92A 5B8CA 5KVEL 4UOJA 1CD9B 1M4KA 1ZEAH 2EXWD 4JCMA 4K55A 2IAMA 1A7OL 5GRWA 5C09D 3RWJB 5FKPB 1B88A 1T0NB 5F6HI 1R3IL 4OZHA 3LV3A 1JBJA 5LCVH 4L4JA 3A6CH 1EJOL 3HE6D 1JYXA 2BC4B 4P4KA 3UBXI 4PTUB 2BHYA 4AJ0A 1FZOA 3ZT7A 3LPFA 1KCVH 3WLBB 4BZ2H 2A9NL 2NY2D 4H8WC 3NACH 1X5FA 2F53A 3MFFB 4CAGA 1BHGA 4HIEA 5CBEB 3K81A 3IJSB 3O2DL 2VAAB 3QDMB 4DCQA 4AK1A 1XCTB 1NBYA 1VFMA 2ZOLB 5FECB 3J8F7 3MRDA 3MJGX 4KK9C 5T1MA 3H2WA 5IMLA 1FYTB 1LWRA 3L7EB 1U8HA 5DGQA 3T3ME 3VDCA 5I71C 4JB9L 4Y4FA 4Y19A 3Q3GB 3TV3H 4P5MA 5TGBA 2NXZD 5HY9A 5E70A 2X4QB 3UPCA 4E41D 1ZHBA 4V1DB 3UBXG 4D3CL 2DB8A 5KS9B 4F9LA 1N2RB 2PYEE 5MHSD 5D93C 5E6ZA 2A73B 3HUJE 5BZWA 3S6CA 1ACYH 5F9WB 1DDHB 3PABA 2DRUA 2YEZB 3VXNB 3AY4C 4OQTH 1P4IL 3KS0H 4K8RC 3EGSB 1MCIA 4JJHA 5CJBA 1TZHB 4OCXL 1M7XA 5CBAA 3BUYB 2DICA 2Q3AA 5DMGD 3DHMA 5DJ0B 3OHXA 4XNYL 1FO0A 3ZHKA 1VFBB 5A1AA 2BSTB 3U7YH 1FIGL 4JGUA 1FZJB 4LSUH 2C1OA 3G5VB 3UTPE 4OM0H 3RVXD 2H2SD 3MBXH 2DI8A 3E6HA 5BS0D 3OZ9L 3O3EA 2Y06H 4R2GB 4U6XA 4AL8H 1A1MA 1CIUA 2FB4H 4QRRA 1IAII 1EAPA 3QXWA 1LE9A 3UBXB 2AJSH 1G7IB 4HXBL 5F9JA 3BT2L 1OGAD 1BLNA 2FEDD 1J8HD 3VWKB 1PY9A 4HC1A 5IVXA 1CFVH 4KV5F 3NA4A 4WEBH 1NLBH 1MRFL 4HV8A 4L9DA 3Q5OA 1S9XA 4EVNB 1JFQH 2DQEH 4G3YL 2JK5B 3X3GH 4PRDA 3RI5F 1JZ6A 4LHQB 2LU7A 3LEXA 4G6MH 3CVIH 3L6FB 4HWZB 3QXAA 4NYLB 1A1NB 5C0BA 1CFSA 1KTLA 1R3JB 1U8NA 1NSNH 1MRDL 2HT2D 4JY6A 1P1ZA 4NPYB 3MV8A 4M3KB 5HD8D 3WSQH 5JUEH 2X4OB 4LBEB 3LSOA 5B38G 5GGSB 3UTOA 5KVDL 3P73B 4U2ZA 2P46B 4XMLL 9CGTA 3DJ9A 1RK1B 1G0XA 3VCLB 4LASL 3CD4A 4KWUA 5DJXB 2VIRB 3BW9A 2UWEE 3QA3B 5F1OB 4NQVB 3KNBB 3T04D 3VDAA 3UTQB 2A9ML 4M7KH 2F54D 2FX7H 4MDJB 5CZXD 5T3XH 2HVJB 4JPKH 4KJYA 1A6VH 4M7ZB 4HJJL 5IHUL 1J7VR 5LQBL 2X4SB 1VEOA 3V5KB 4L5FH 3DX7A 1UWGH 4ODHH 3MNZB 1N5AB 5JMRA 3UTTB 3RFZC 2XZCH 1JPSL 4OJFL 1E6OH 4Q6IB 3GMLA 5C0JA 1BVZA 5B3JE 1WISA 3HZYB 3ZKMC 5KJRH 4N9GB 5DQ9B 5B38B 5HBBA 1BOYA 4YHNB 4JG1L 4UILH 4ZUTB 4U05A 2PW1B 5LBSH 4LLWB 3EW3B 3LKOA 2ZNXA 3TT1L 1EFXA 1UACL 3O6FA 2P8MA 1YEDB 4OAWB 4U1SB 4ZDHB 4X8JA 3IDJA 2DTSA 3OPZH 4P2OD 4OIIL 4MAYB 3D25B 4HS6B 5JZ7C 1MOEA 1BFOA 5I76B 4HUXB 3LIZH 5FF6A 2GCYB 3OB8A 1JF5A 4EXKA 2J12B 4RAUA 4P23A 5CEYB 4APQA 1JGEA 5D70L 3MJ8A 3DX6B 3RL1A 1UXSB 4EDWH 4GUPB 4X9FA 3GHBL 3HRPA 3Q2CA 4S1RL 4R7DA 2CXKA 4N5EC 3STLA 3Q6GL 4MJ5A 1JWUB 1JNLH 4XPAL 3I02B 4H25B 4U1GC 1ITBB 2VLRB 3ARRA 1U6AH 4MA8L 1G6RL 4PP2B 3FRPG 3WHXA 2W9EH 3BUTA 3GK8L 4XNQB 2NZ9C 3C60C 5F7KC 5ITBH 3D48R 4HLJA 4TPRL 4LSSL 5D8JL 1I3RB 1KJMA 2YD7A 3KLDA 4K9EC 4JR9L 2QV2A 3K4DA 4NQDE 4JPVH 4POUB 3CX2A 5IK3B 4J4PC 3RDTB 3D18A 1KT2B 2B4CH 4MCZA 4XPTH 1REIA 5FYJE 3QNYB 4JRYB 5DJ6A 1ZWIB 3KJ6L 2EICA 3NCEB 4D0BB 3NPZB 1NUNB 4KC3B 2Y5EA 5T1KD 1XH3A 4YHYB 4OZGE 1QVOA 3LDBB 2AK1L 2IALB 4H0GA 4M02A 3MBEC 5CIPB 5JOEA 3HN3A 3S96A 4QNPE 3QWRD 3QJHA 1JZ4A 4PJXF 4JCLA 1AIFB 1G7HB 3QQ3A 3P0VH 3F7VB 3MMEA 5FO8B 2BERA 3C8HA 4D0DB 5KN5B 2QQQA 2Y9RT 4ORZC 5E7BA 4CNIA 4C56B 2ADJA 1QNZH 1F90H 3PQYB 3ZDXE 2VC2H 1BOGB 5DUMH 2GSGA 4QWWD 5TPWL 1CDGA 2IGFH 3O11A 1KJVB 5JR1L 1A7PL 5GS0H 3QCVL 5EC2B 2IPKB 4UQ3B 1HINL 1T80A 3A0OA 2DS4A 1UKSA 2FH8A 4G6AC 5C0AA 1N59A 4WU5A 5DD6B 2OJZL 3CDCA 4QHMA 5EULV 5JOPD 1HDMB 4HPYL 2OP4L 3NFSL 2GITB 4H1LG 3S34H 4W4OA 5CMAA 4Z7WF 3EOAA 3QAZB 5C0GB 3VG0H 3DV4A 1U41A 3I6GB 5A16A 2O5YL 3RUGE 1EXUB 5ESVA 3M1BA 5CFHA 1LO0L 3LN9A 5HGHA 2GTWB 4LSPH 1AXIB 3MJ9A 1C1EH 2JB5H 4FG6D 3B9KC 4XI5D 4E0RA 2OK0L 1UEMA 3CH1A 5HHOE 3LPGA 1D5XA 3UJIL 1IL1A 2IANB 4MNQA 1OWWA 3WFDH 1DQDH 1BVKA 4XBEH 5EFIB 2PXYD 5KSBF 4FMKA 4GW1A 4HDIB 3PHSA 2H6PA 3S4SA 4JM2B 3QZWA 1U93B 1S7XA 4U1JA 4O2CB 1HILB 3NN8B 3C5ZB 4PD4J 2C1PA 4QTIL 4XP5H 4O51A 4WUUA 4JDTH 2BNRD 4HIJA 5I0DA 4C54A 3KYMB 4NJAH 5JQ6H 1PBYA 1A1OB 4XNMB 4LDLB 2R56L 3NH7H 2WIMA 1JGDB 4J1UA 4MS8C 1G7LB 3IDMB 4GG6E 1ORQB 2XQBH 3EFDH 3KPNA 3PP4L 3SDAD 3GSNA 1NFDE 2Z92B 3SOBH 1OM3L 4HPOH 4F58H 4XAKE 3R8BB 3QEGH 2H2PD 3HI5L 3ZLQC 2EDKA 4HT1H 4N0FA 1EBPA 1S9VB 4Y8AA 1GGBL 2BJML 4PJFB 2GIYA 4F2MA 5I66B 3HNTL 4CMMB 3SDDD 1OF2B 4NRZB 3ULUE 3TCLA 1WQVT 3H9SB 3JTTB 3GI9H 3KPPB 4KI5F 1BJ1H 2FGWL 3BEVA 4HH9B 5HDLA 1S7QA 2FRGP 3TYGL 4BUHA 3MRGA 5EU7E 3BQUA 5EO0A 1ZGLP 5KANI 3QUKA 5C9JB 4F37K 1XGQA 3F6IA 3VFPA 2WIIB 4FFYH 4P46B 1L7IH 3HI6H 4XH2B 1RUAL 2MQ3A 1PG7W 4XBPA 3SGJA 3QWOB 1MLCA 3VFUA 1TQCB 4HKXB 3WS6C 4KROC 3VXUE 4G6KH 1RZIA 4ZG1A 3DXAA 4BZYA 1OSZA 2ZG2A 4MD0B 5BVPL 5D9SA 2P45B 5F6IC 1V8HA 4Y5YB 5EBWA 4RQQB 4AEIL 1RAMA 2Y36H 2GTZB 5KANG 2FH6A 1IGYB 2R1YB 1DZBA 4GKOA 1GYAA 1BJ8A 3U36A 3B5HA 2CLRA 4EBQH 3EYFA 4ZAKA 1MJUL 1NL0L 1YQVL 5SWZA 3O9WC 3AM8C 1JHTB 2B20A 3C5JA 3REVB 1YEFL 4NKIH 2P8PB 4Q6YA 4YGVB 5CCKH 3P9WB 2R0LL 2KZWA 3MCKB 3G04B 3OGCB 1JGUH 5F1SA 2W65A 3U4EB 2PYEB 1MCFA 2WBJD 1KPRB 3HUJB 4PG2C 5D1QB 3WIHL 3REWB 2HH0L 4OGYH 5DVLA 3MNWB 5GRVL 1FO0H 1NC2A 3IB4A 4KRMB 4BK4A 5C0ND 4ZTOH 2HRPH 3U9UA 1TJGH 1YN6B 3MOAL 4PJGF 1LO2L 3HPLB 4UIMA 5KOVC 2EDWA 2EYSB 1DBAH 1DUYB 3FONB 4MAUL 2UZXB 3KPQA 4AENB 3CVHH 2NY3B 1VHPA 4ENEC 2VDNH 4JFHE 2GK0A 1BFTA 2DLFH 1GOHA 1Y6KR 4RFNB 4Z0BH 1NDMB 3RPIA 2ZP0T 1AD9A 2VR5A 1BFVH 3TH4T 4P2RD 5T3ZD 4WU7A 4YWGH 4ODSH 2VWEC 3ULVD 4M93C 1J0ZA 1GGYA 5KSVB 3SO3C 4X8XA 4ELMB 3B3IA 4UDUB 4KJPC 1AXTH 1BZ9A 4IBLT 3VI3F 5GJSL 4B41A 5EA0H 4DJMA 1H3GA 2X09A 3JWOL 5EBMA 1L7TH 1TPXC 3T65A 3IFPA 1ADQL 3DVGA 5IMMA 5JHLL 8CGTA 2WUBH 3NZHL 5E00B 4K94C 5EN2A 1J1OH 1OT2A 3TJEH 3W9EB 3LN4A 4OGXL 1OAQL 3DETC 6FABH 1TFHA 4TULL 4IRJD 3V6ZA 4ONHA 5CZVL 3MV9E 5E1AA 1H9VA 3BGMA 1Q38A 2XT1B 4PJ8A 5KTEH 1KCUL 1B0GA 3MRHA 1DEEB 5E94A 3GJEB 4NRXB 4U1HB 3RGVD 3QIWD 4FQIL 1A3LH 2GT9A 3TNMA 3TH3T 1TIUA 3W2DH 3JWDC 3H3PL 2L7JA 4DW2H 1KNOA 4OCRL 2WLYA 3CLFL 5MEPA 1B0RA 2CDFB 4QHLB 3WN5B 2BY2A 4M61B 2I26N 4PJXA 1MCKA 4NWTL 3U9PL 1MREH 1KBGL 1YY9C 3FO2B 4JRXE 5EBLA 1Z5LB 2WINA 2R2BB 3KPRD 3SDCD 2HT4C 1GC1C 3FFCE 2ICWB 4WY7H 2YC1A 1WICA 43CAA 1G7MB 4RWHA 3UYRL 3O4OC 1Z2KA 4HK3N 5E2JA 5ACZB 4HHAB 3RIAK 2OTPA 3MRQB 3DOSA 2H32H 4Z76A 3V6OE 3T1FB 4U3HA 4ZFOB 4NP4L 5BJTA 1IRAY 1RIHL 1X3DA 2IF7A 2PN5A 1T6WA 5FCUL 2DLGA 1JNHB 1MRCL 4QRPB 3WL9A 4O02L 5DJDA 3BYYA 4Z7WA 3RTQB 4WEUD 3TBSA 4EQ2A 4OV5A 1CICB 2AXFB 3CXHK 2CDGA 3IAGC 1HYSD 4I5BB 5DI8B 1AKJD 3ARPA 1QRKA 2DBLL 2YPLD 4NC2B 4O2FB 4P59H 5FUCE 2C7UB 4PRIA 1RZJL 5BZDA 1MCBA 4NRYA 5J9PA 5K9KA 5JORB 3NCYP 2Y07H 4PJ5E 4UNVA 5J3HD 4ODUB 4PY7A 1IC4L 1VESA 3CPLB 3SE3A 1R3LA 1S8DB 1TMCB 2BNQA 3C6LC 2VSCA 3DX9A 3ARGA 3GSRB 2AV1A 3FB6B 3LCYA 4JJ5A 5EOCH 4LFHD 5E7FA 3OWEA 3OXRB 5I16B 4EOWH 5K9OB 3DYPA 4KDTA 3VI4F 3BRDA 4JPWL 5CHNB 1OD9A 5KSBA 4YDJB 3I85A 2E27H 3RGHA 2JB6A 4X7TB 5I73C 5HGAB 4PGBB 2OMNA 3VGDA 3MR9B 4NQDB 3HR6A 4GAYA 2XN9A 3PF2A 4LARH 4S1SH 5GJTH 4ZYKB 4TSAL 2HA1A 2W0PA 3V6FA 4TTGA 5JHDE 3ETBF 4ZUSB 2XI9A 4NN5B 3WFCH 1RJYA 3DVIA 4XB8A 5T3ZL 1FNSL 4XMKH 5FYKH 3H8NA 4PV9A 7FABH 1XIWB 3P9MB 3ULVL 3QIBD 2NX5E 4Z7QE 1NGYB 4WHCA 1KIRB 4NHCH 3P9LA 5IB3B 4TOYL 4BFIB 2X2YA 1K5NB 1MCWW 5JPNA 4G9FA 3RY6A 1NAKL 1SMAA 4N8VA 2EKSB 4FTVB 2JIXB 2AV7B 1AO7D 1XF5A 1IGTA 1IARB 4S1DD 3V4UL 3W5MA 4IIQB 4KKCD 3U1SH 1ORSA 5J1AA 1HH9A 4PLJC 4X6BB 1CLZH 1K9TA 4U6VH 1BD2D 3ZDZF 3WUZA 4L9LA 3TGXA 4TNVK 2RQ8A 2VXUL 2RJMA 4FQQB 4L4VD 4XTRC 3DROB 5CILH 2Q7YB 5LWYL 4NKMA 1NC4A 3IETB 3RRQA 3VXPB 4U1MA 2R8SL 3VFRB 1JP5A 3DYOA 3PNWB 3PGFL 4RA0C 1A7QL 1I4FA 4NZTL 4X5WB 4MJIA 3MJ9H 4OD3L 5I1JH 4I0PD 1FL5A 5C8JA 2A6JA 3RUGB 4CVXA 4LCWA 5BOPA 1WVZA 2J88H 5GSVB 1JPST 5DMIH 4LGRB 3UZEA 4KFZC 4TTDD 2OZ4H 4HK0A 2FEEI 2GSIA 1G7PB 5D1XB 3RWHB 1FGNH 1PDKA 2VUYA 3B9EA 1AHWB 4WUKH 1LP9E 1RZFL 1IZKA 2C3HA 3GMMA 4BUGA 1G9NL 1CCZA 3HB3C 3BEWB 2YA1A 3L7FB 4K8RH 2VR9A 1W0YT 5H8DA 1MI5A 4CADB 4LPUA 2OL3A 2EH8H 3V0AC 1ZHNA 4NOFA 4D8PA 4R6UA 1KOAA 4MXQC 3TIDA 3TVMD 2R2HA 1QA9B 4FFZL 1UA6H 4TNVF 1MFEL 1DVFB 3WNKA 1SJEA 1U8JA 3WHE1 4JFZL 5CSZB 4YBQD 1YJDL 2P8LA 2XPGA 2Y5TA 5FV2A 2R1WB 3UTZB 5TH2A 3OB0H 2VB5A 4OZIF 3NCFB 3EO1A 5ISZD 4UOW0 4XWGL 3TN0C 3HC4L 4JO3H 1G1YA 1D9KD 2RCSH 1FLTX 4ZQKA 3Q5YA 1P4LB 4KUZL 3KYOA 1RY7B 2G5BB 5LAXA 5J89A 3AREA 1QQDA 1S7TB 4GG6B 4ORGA 5D7JB 1BM3H 4G8GA 1WBXB 1U3HD 1P7KB 3BXNB 4PJGA 5FA3A 2KDGA 3HNVL 2IAMB 1PEWA 5C07E 1QRNA 4EN3C 3FL7A 1R6VA 5GGTH 3LV3B 1CE1L 4GRLB 3NIDE 1MIML 4HGMA 4P4KB 3THML 5DYOB 3BE1L 4X6EB 3QCTH 4JY5L 1JZ7A 3LS4L 4CBPA 5KAQF 2DKUA 4IDJL 3K8KA 1F4XH 4HIEB 1W2KT 4KKAD 2D3VA 3RU8H 2G75A 4XNXL 3QNXA 2R4RH 5GHWH 3BPNC 5SV3A 5LKNA 2CR6A 2VSDA 4XMPH 2D4DA 3MRDB 5SWZE 5ADOL 4JFDD 5IMLB 4ONGL 5I19L 5HYSA 3RIFK 4Y19B 4P5MB 3GBMH 5HY9B 3VXUB 3CFBA 2EDOA 3IJYB 1JHLH 1CT8A 2ICES 5EPMB 1RU9L 1X5YA 1F3DH 3BPLB 1AGDA 5EOCJ 5IW1A 1N0XL 2KPNA 1T0MB 3ARUA 2V7NB 3CLEH 4D9RE 3FO0L 2F19H 4PY8I 5F7EH 3O81A 3E2HC 1KACB 1HSBA 3VFNA 4WHTB 1HIML 4K71B 2DIBA 4PLKC 1MHCA 1EEQA 2FJFA 4M1DL 3OKDB 5EORL 4JFFE 5HGBA 1OCWH 2F5BL 4U1KB 1P84K 4IMKA 2W59A 1KYOK 5HHNA 3D5OF 2RFXA 1FRGH 1FVDA 1PFCA 2C1OB 5F9OH 3ZTNH 5MENE 5F7MC 3N85H 4NQCD 1AGEB 1G9ML 2DQHH 3CFKB 3GSUA 4P57B 1A1MB 4U6XB 5IB5A 4X9IA 3GMQA 1U9KA 1LE9B 3L1OH 1TXKA 2NXZC 1N6QL 1A6TA 1J12A 3CVHB 4GXUN 5E9DA 4XCCH 1FDLL 5I15H 1MLBB 3RIFF 1H8SA 3D3VD 1BAFH 1YECH 3R8QA 4HV8B 1NAML 1J10A 3ZE2F 3KR3H 3NFNA 1ERNA 1W72A 3MGTA 4ZPTA 3IDGB 4NQUA 2QHRL 4NO0B 5IT2L 5GSRA 1HKLH 1YMME 4PRDB 5IV2A 4K3DH 5AG9A 2HLFD 4H26B 2ITCB 2OTWB 5DD3L 5BO1H 1T1WB 3WEXA 5A2IH 3A67H 1HHKA 1UWEL 1CZ8L 1CFSB 5C0BB 2MWCA 5DT1H 2D7OA 2WANA 1FSKC 2ARJA 1H5BC 3DIFA 5GRJH 3OKLA 1X5XA 3LSOB 5DJ8B 1J18A 2HVKB 4R0LC 4K9EH 2H2SC 1NMBH 2Q8AL 3WNOA 5L6YL 3UPRB 4Z95H 3W5NA 2QADB 3EFFB 3QR2A 1L0YA 3BW9B 3H7BA 3B5TA 3MOBH 5IJKA 1J0HA 3PG2A 1R24A 1Z3GL 4GAFB 5DR5L 4JDZA 2B2XH 3QIUD 2B1AL 1F3JA 1IFHL 4KZEH 1ZLSH 4HIIA 5F88A 2HFFA 1DQLL 4HG4K 2AEQL 2QHLA 4QLRA 5E5MA 3I3EA 2VDQH 4CJ0A 3GNML 4HK3J 2NXYB 1DR9A 2D03H 1M7IA 2AJ3A 5GS2H 4YBLC 2I9LB 2V5MA 3L3DB 5J6GB 2QQKL 3CNKA 4GLRH 2HT2C 5HD8C 1IKNC 5F7YC 1GZQA 1BQUA 4FQCH 4A2MA 1HZHL 4UB0H 1KLUB 4BFBD 4UI2A 1X4XA 4FZEH 4OCSH 2GJ6D 1T2QH 4K3JL 4I9WD 3BD5A 4NJ9L 3PWPD 2P8MB 4NKQB 3PV7A 4NQEE 2H32B 4Y5VC 2Z31A 4WFEE 1JI2A 3O2DA 5EZLB 5C92A 5ALCH 2FNBA 1INEL 4X80L 3NIGE 3JWNC 3FFCB 2C9AA 4IRSA 5EO9A 5KW9H 4GKNA 4PB9L 4RAUB 4H20H 4LSQH 3MRRA 2HFGH 1JGEB 1CL7H 4PJBF 2N7BA 4U3XA 4M6MH 2ESVD 4WHYH 4X4MA 3TYFA 3SPVA 3RWDB 1T20A 5MERA 1U8MB 1XF3A 1GHFL 3MUGB 1OGTA 4LRNL 3HS0B 3VFMB 1YPZE 4GXVL 5HHQB 3GUTB 1BPVA 4HWBL 3V52H 4KXZH 2XWBB 2QSQA 4UTBL 1U8PA 3QUXA 1FV1B 3CU7A 3BOVA 5DVKA 5E2WL 5C0IA 4MCZB 4YPGA 5L88H 1AQKL 2CRMA 4NT6A 7CGTA 5DJ6B 1KCLA 4HIXH 2QLVB 4P2OC 3T3PF 5EU5B 4ZS6C 4PJ5B 5I9QC 4WO4D 3BP7B 2FX8H 5TF1L 1H8NA 2R2EA 3IKCA 1EHXA 1DL7L 3L5WA 4UIKH 5HDQH 2VLJE 3HZKA 1I8MB 1U42A 3K4AA 3S96B 1EHLH 3QJHB 1NGQL 5E95B 2FD6L 2K9UA 3QQ3B 5T1DH 4DKAA 3FQRB 5T1LD 2J8UF 2P43B 1OQOA 1UWXK 4YXHL 1HI6A 2ADJB 1N26A 1WCBA 5HGGS 5ID1A 5GRVK 3HE7A 3D6GA 4K3EH 4QOKE 2GSGB 1K4CB 3W0WE 5J06A 1FGVL 3GMPA 3ILPA 1RMFH 4PBWD 1GZPA 1QSED 4YHZL 1RK0A 2I07A 4G6FB 3KGRA 2BVQB 1PJ9A 3TO4C 1N59B 2CD0A 5HPMA 3HFML 1J9CT 1WC7B 2NX5B 2XYCA 3ALWA 3DI3B 4B7IA 2AJZB 3PDOB 3BDYL 4MXVF 2MCPL 3GHEL 4PJ9D 1K4DB 5FHBL 3EOBB 3EOAB 4XVSH 2CLVA 3DV4B 1GCFA 3RWEA 2HKHH 1DN0A 1QKZL 4I1NB 2VTFA 2C3VA 4EKXA 3BP6A 3M1BB 4OD1L 3IXTA 2VQ1B 2CRYA 2VR4A 3HA0A 1E4XL 1LEGA 1SBSL 3MRBA 3VW3H 4OCMC 1CXIA 1JIBA 1JPFA 4PLOB 5I71B 1IC1A 5IHZA 1CDBA 1CXLA 1HHIB 1IGCL 1EMTL 3BJLA 4XHJD 3CH1B 3VXOA 2J8OA 2NY0C 1D5XB 5FYKU 3MC0A 1VSCA 1IL1B 2IEPA 2Y6SC 5C0CE 4MCYB 4AIZA 1A4JB 1IM9D 4DEPC 3VFOB 3FT2B 1BVKB 3O3AB 5D93B 4MDIA 4M5YL 2FWOA 4WHDA 1EO8H 1LNUA 2BOCA 1IQWL 4Y2DD 1OTTC 4GW1B 3EAKA 3PWJA 1HH6B 5KZCD 2DQJL 1T7XA 3UC0H 5D1ZD 3HE6A 4X6CE 4X7FC 3DBXB 1UKTA 4LSDA 1WAAF 4U1JB 1A7BA 2F5AL 5J8OA 4DGIL 4S2SB 4YHPB 2C1PB 3SCMD 4EI5C 1T1XB 4HIJB 1I9JL 3QO1A 1EV2E 2CK0L 1FG2A 3F7RA 2OL3H 5B39A 3R1GH 3QPQD 4HGWB 1MNUH 3RNQA 4UTAL 2XA8H 1SYVB 5J12C 4O4YL 4URTB 1OPGH 2KZ1B 1JNNL 1RI8A 1VFOA 1TZGL 2HN7A 3IFOB 4J1UB 1Z9MA 1P6FA 4XI5C 1B2WL 4X9GA 2MFNA 4X4YA 3O45B 4E41A 2K7PA 4X6DF 3HMXL 2VLLB 3DVFA 5BRZA 3MUHL 3ZL4H 5IHLB 1WFOA 2DIJA 5HYIA 1BF8A 5FDWA 1FFOA 1KTRL 4N0FB 4PRBB 4JKKA 4M6NH 2P49B 3C09B 2LAGB 1A02N 1V05A 1E4KC 4PS4L 4G9DB 4AG4L 2QKIA 4KU1A 3TCLB 5GISH 1G6RA 3U4BL 4X6FA 5DZLA 5ILTL 4LNRB 5EO0B 1QZ1A 2YUZA 3BGFC 4N0YH 1W0WA 4Y1AA 4TRPH 1ETZA 1XGQB 5HHVH 5AAMA 3VFPB 4KKNA 5F7LB 3MXVH 1AI1L 3VI3E 1QTYT 1QFHA 1XGRA 5D2NA 5L2KD 3VFUB 2XTJC 3QFJA 1JWSA 4OFKA 1P4BL 3DX8B 5BS0A 1I7UA 5C07B 3RX8A 3DXAB 3ZYIA 3HI1A 4K94H 2FBJH 3TZVD 4V2CB 3K1KC 4I18A 5E99H 3SDAC 3STZB 1IEBB 4ZUVB 2IPTL 4GKSA 4K2UL 3WJJA 4MHHI 3U36B 2EDJA 1H3XA 5ENWA 1PSKH 4ODVL 4OGAD 2P5EE 3VFVA 1QUNA 2D7MA 1W0VB 3EYFB 5CEZE 5SWZB 5KSUA 5JW3H 1L9NA 4UQ2B 4PRHE 1VGKB 3M8OH 1J5OH 1QBLH 1J1PH 3NA9L 4ELKA 3ALPA 5IG7A 2EDLA 5JO5A 4UV7L 3JWDH 1XMWA 4J6RH 1VB9A 5DRNA 5IUSA 1MY5A 3T77B 2AJXL 1X5GA 5JW4Q 3MREA 2PO6D 1QR4A 2C4FT 3D69A 2ZWLT 1M05A 1RJLA 4MHHG 3VXMA 5ICYB 1NFKA 5E9DE 3O0RL 3OJVC 3B9VA 4JKLA 4N0UA 4K7PH 4RCAA 4NZUH 2ZKHH 1UB6B 3RZCD 1GC1H 2ENYA 4OM1H 3TJHD 3SDXF 2XWJB 4XNUL 1FAKT 2F54A 4GLRI 4BELD 1F4YL 4UIMB 1JGLH 3FAWA 2H26B 3IDXL 2OR9H 1SJVA 1A7NL 4M5ZH 4JO2H 3KPQB 2QSVA 2XQYG 3EYOB 1NCCH 5MENB 1T04B 1RZKC 5I1AB 4P2QE 5C1MB 4R26H 3VE0B 1UM6L 3RPIB 1S78C 2X4UA 4U1GB 4Z8FH 1CLCA 1F97A 4Y4KD 4LEXH 4X7DC 1A9BB 1OP5H 3EYSL 4KH2A 3IF1B 4TUKL 5E5RB 3ZKXC 2BOBB 4GAGH 4KY1L 1AJ7H 4M43L 2J2ZA 4YDLC 1M6OB 4PJBA 1CL7I 4TVPD 1BF2A 3T65B 5MEQB 1LEIA 5E8EB 1KGCE 5B22A 1WF5A 3FQUB 5CD5D 1YMMB 4YFEA 2A1WL 5EN2B 3AAZA 3HG1A 4KKLD 4QYOA 3S37X 1ZT4B 3CX5K 1IGJA 1WBYB 3VI4E 4YDKL 3ULVF 3PDGA 1JRHH 2XACC 2J3SA 2CPCA 1YUHA 3MBEB 5BV7L 2V2TA 2E9WA 1NCWL 3MLZL 4PJ8B 4KXZI 4YHOL 3V5DA 1B0GB 5E94B 4R4BA 3LKRA 3DSFL 4WHYG 4KK5D 1L0QA 3O8XC 4X7EC 1ZLUH 3ZE0F 1U58B 1U8QA 2WWMD 4KRPD 4FQ2H 4XP6L 3RHWF 3GSOB 4XXDB 4G42A 3WBDA 5DSCA 1PEZA 2HT3D 2ILLA 2NY4C 2Y72A 5MEPB 4BA8A 1B0RB 2YS4A 3O4LE 5AZ2H 1K6QH 4A6YL 4X9HA 4LPWA 5KVEH 4QHUB 5CINL 2J8UA 5MEOA 4L8SC 3O2WL 1QBBA 1A7OH 1LK2A 2DQDL 3DMMA 1DBBL 5TE6L 43CAB 4CU6A 5IB4A 2BP3A 1YNTB 3TBWA 1AR1C 2Z8WC 4CU8A 4Q9RL 3QDAA 2X5PA 2F53D 4GQ9L 5DFWH 3ARFC 4PJHE 4X4ME 1YEHH 1D6VL 4JQIL 4LCUA 2YRZA 3QWRA 3T0VA 4Z76B 5BJTB 2OXHA 2V2WB 4TSCL 1YNLL 3P4NA 3KPLA 2X1WL 2CUMA 4OD2A 3RGVC 3C5SB 3QIWC 2JJSC 1CVSC 4NQEB 2JF1A 1KB5L 1R3HA 5DJAB 1S9KC 1EBAA 4OV5B 5FM5O 4Y5XC 1IVLA 1FZKA 2CDGB 3K7UA 1HSAB 2AK4D 2N56A 1KTKE 1OP3H 1UZ6E 1MUJA 3O2VL 1KCSH 3KDMB 1I8IA 4GBXA 4NRYB 2KQNA 4WW2F 1Y18B 4LGSB 3L3GB 2R69L 4M7LL 5DK3A 4U7SA 5E08H 1AP2A 1R3LB 3GSVA 3HZMB 1X44A 3U0WL 4U7MA 3OSKA 3MLSL 4FNLH 4NSKA 4PTTA 3ZDYF 4OCXH 1KIPA 4F9PC 5HYQB 2VISA 3WIHA 2IFFH 4GJTB 1UM5L 5IKCA 1QSVA 4XNYH 1DJSA 1MCCA 1QLFB 4IOFD 1A22B 3QO0B 4PJDE 1CR9L 1FIGH 4ZUWA 3MROB 1S7RA 3CSYB 3VWJD 1RULL 1HHJB 4NKOB 2X9XA 3AU1B 4D9QE 2PCPB 5F7WC 4OZIE 1RJYB 3IDNB 5ALBL 4TYUA 1E28A 4NKDA 3BT2H 2BNUA 3GMRA 3PGDB 3EYQD 1PZ5A 2VLJB 3CSBA 3L5JA 3P9LB 3B83A 2FSEB 2DM2A 1MRFH 4MNGE 4TQEH 3SDYL 4I48B 4KTDL 2VXTL 3LN5B 5ITFA 3BAEL 3HHRB 3F12A 2APFA 1IGTB 4G3YH 4X6DA 4Y4HD 2L0DA 2E9JA 3KXFE 1YYML 3FB5A 3MV8D 1NH6A 3WUWA 3O6MH 5IGXL 4YFLF 4AIOA 4QOKB 3DYMA 3W0WB 1YN7A 2OJEB 2NNAB 1DSFL 4P5TD 1FFPB 1ADQA 5GGRB 2X1OA 1YNKL 3QQNA 4KROB 4LP4A 5E2UL 1BFSA 2H9GA 4OTXH 4LEOB 4RBPH 3OKMA 3O6KL 2EO9A 2B8OT 4HFWA 4HX1A 4QTHA 1LE5A 4UNTA 5KVDH 3QI9D 4R2GC 2IH1A 4NKMB 4K7FB 1H3VA 4XMLH 5FUZL 1NC4B 5D5ME 3FTGB 3BZFA 4U1MB 1UADC 5F6IB 4LASH 4PIRF 1KN4L 4KQ3L 3QDHA 4RWYL 5GGUA 2DYPA 5C09E 1Z9SA 5D72L 3OL2A 4GRWF 3VWKC 2NY7L 4WNQB 1KELL 1IGFL 5HI5D 1I4FB 2O61B 2ZOKA 3CUPA 2EECA 3UTSD 4NDMB 3D39D 2A6JB 2A9MH 5HYJD 4LCWB 4C57C 3SDDA 3QHZL 3CAFA 1C5DB 3O9WB 4HJJH 5C0DA 3AC0A 1U91A 4LPTA 4OSUL 3QHFL 4HK0B 5DMYA 3AGVA 4NZRH 4HUUA 1I9IH 5DC9B 1RIUL 2Z9TA 1N4XL 4UT6L 1JE6A 1E0OB 2Q8BH 3RNKB 4BZ1L 3QEQE 1JPSH 2BMKB 2YZ8A 4OJFH 5EUKA 4XVTH 5C0CB 2BDNL 2YD3A 3EZJB 1TZIA 4YDVA 4TSBL 2OL3B 1QSFE 1ZHNB 3SE4A 3NVQA 3TIDB 2R2HB 3JUZA 4Z7UF 5F3HB 4OFDA 3GSQA 1E6JL 3L3HA 1ZMYA 4X6CB 4HH8A 4QXTA 3BHBA 2VL4A 1U8JB 2QR0A 3O6FD 2ERJB 2E6PA 3V0VB 2NY1C 25C8L 5TDNA 1I8LC 2P8LB 3TT1H 1U36A 4UDTA 2DL2A 4QHNA 3G5YB 1ZA6A 3EO1B 5EUOF 3K46A 2VKWA 3QXVA 1TCMA 4NGHH 2V5TA 4KPHL 4NCDA 4M7ZC 4OIIH 1RUKL 4ODXB 3BPCA 4WDIB 3D0VA 4TNWK 3I6LD 4I3SH 4E9LA 4FABL 5HYSG 3RWFB 3PWVA 2LU4A 3KYOB 3T4YA 2IPUG 5LAXB 3NIFF 4PGZA 4ZO8A 4FQJL 3OJ2C 5D70H 4TTDC 3MLVL 3SDXA 2BVOB 3PWLA 4BFEA 3MLWL 3GHBH 1GIGL 4S1RH 1UXWB 4PJGB 2P7TB 4M93B 3B9KA 3DVNB 1CQKA 5DK2A 3CXHJ 5GRUL 3SO3B 2ATPA 1QRNB 3ARSA 1OW0C 2WBJA 4MA8H 1G6RH 3NZ8A 4WFHD 3GK8H 3UXFA 1QLEL 3WO4C 2CKBL 4G8IA 1OGAE 4HUWB 1J8HE 1XR8A 1CDIA 3TIEB 3GJFA 3H9HB 4JR9H 5DHVH 4NN6C 3QNXB 1KLGA 2F58H 1ZVYA 2ED7A 3IFLL 5DRWA 4WTWA 3E3QC 1OLZA 3F65A 1FORH 1KCRL 4OLXL 5EU4A 3TA3A 4MJ4A 1CG9A 5KVFL 4HAFA 1X9QA 1AGDB 2X4TB 2HRLA 1BZQK 5DK0A 1NGPH 1KJ2L 3OXSB 2WZPD 1ITCA 1SM3H 2O5ZL 4P2RA 1CFBA 4CW1A 3MCLH 3WFHA 4JHZA 2AXGA 2MPAL 4TUOB 4ZO7A 5IQ9A 1JRHI 1ZHKA 3VFNB 2V9QA 2YD1A 1BQSA 2FJFB 1F2QA 4MLSA 4BQ8A 2ADFL 1ZGLA 2MCG1 3MV7E 2P5WE 4PJEE 1T2JA 5TPWH 4HEME 5JR1H 5HGBB 1X5AA 1A7PH 5C0AD 3EJZD 4P99A 3QCVH 4PRHB 1I8KA 1HINH 5J6HB 1Q72H 2BVTA 3O4OB 3FAXA 2NR6C 4DKEH 2OJZH 3L95A 3O6LH 2YD9A 3NFSH 2AP2A 3CGTA 4IRJA 1AD0B 1GVIA 1U8KB 3FOLA 3MZTA 5DJZA 4LVEA 5T33L 1E27B 3IDIA 3QDGE 5E9DB 3ECBA 3NTCH 3VD4A 1SVZA 2O5YH 4QXWA 4ISVA 5SX5K 3S9DB 2EKJA 1HXYA 1LO0H 1UG9A 4RISL 5E6ID 1NEUA 2OM5A 4MMXC 5L7XH 3IFNH 3MGTB 4MNQD 2ED9A 2OK0H 4POYA 3VRIA 4QRSB 2EIZA 2NTFA 3VD9A 2X42A 1NGZA 2VZ1A 1B4RA 4P3DA 12E8L 1IGML 3LKQA 1HHKB 4P2QB 1Q9WA 3QUZC 3C8KA 4RMTA 3KPRA 2DQCL 3X12A 3SDCA 3C6LB 3DIFB 1PKQE 4PRPD 4JFYA 4DN3L 2OQJA 3UTTD 5CD3A 5DTFA 4WUUD 1I7ZA 1ZHLB 4LCCC 4WCYL 1EGJL 4QTIH 4HJGB 5I73B 3H7BB 3GRWH 3UO1L 3OF6D 1ONQA 4WW2A 4LLYA 3T3PE 1NBZA 4YGAB 2X4RA 4OCWL 1U92A 3FT3A 3RWGA 1J0KA 1F3JB 3ZYZA 4B5EA 2R56H 3M17A 4HIIB 2HFFB 5E5MB 1UYWL 5B4MD 3WD5L 3WS3B 4Z78A 5E4EB 3IXAB 3PP4H 2YPLA 1MVUB 1IILE 1X5IA 1OM3H 3ROLA 2VDPH 2VXSL 3KVQA 4XC3H 3P4OB 1G9EA 4RAVB 5F7DA 2A38A 3P4MA 4F57L 2PTUA 5KSAD 4JQXA 1GGBH 2BJMH 1ES0A 4RGOH 4JM2C 5IMOA 5JPMA 4JVWA 3X14A 1S7SB 3BQUD 5BOZG 4Z77B 1F02I 4LIQL 1P2CA 1MFBL 1DQML 1QFWL 3TYGH 2VLRD 2YPVL 3G08A 3KPMA 2N1KA 4JPIA 4M8QB 2WP3T 4JFEA 4M62H 4ZTPL 1DQJA 4UMGA 1RURL 4PJCE 2RBLA 3CC5B 3GB7B 3ZKQD 4LSRL 1QO3A 2LVCA 4FFVD 2XY1A 5CJXC 4IRSB 4L8DB 1MIEL 4LVNC 5H35A 4KMQA 3PL6D 4HJ0D 3N0PB 2X70B 3MXWL 1M7DA 3MRRB 5C0RH 3IDUA 3Q5TA 1WTGT 2VZ3A 4XPBL 5C71A 1OARL 3QIBA 5FK9B 2V2XB 5JOPE 4NM4L 2A2QT 3SPVB 5E2VH 2P24B 1OTSC 3C6SA 3WE6B 2XY2A 3QDJE 1FPTL 5MERB 2AKRB 4ZAKD 3P40A 2EDEA 1OGTB 1WZ1L 4WW1B 4ZS7H 3SKJL 1A6ZA 1MJUH 1NL0H 1AO7A 5FYLL 5I1HH 1F58L 1HK6A 2IJ0C 4NZJA 1YEFH 1RFDL 2FHBA 1K8DB 1BD2A 1UH2A 3EUUA 4U0QB 5IBLD 1WAAE 2IH3B 4YPGB 4EJ1C 3D85B 3LY6A 4NT6B 3MLUH 2YRLA 1TQCC 2EH7L 3NAAH 5L8LB 1IAOA 4L4VA 5TJWK 3SJVD 2D31B 4JN1H 4YIQA 4HUVA 1WWAX 3WIHH 1P84J 1HHHA 1KYOJ 4XVJL 4PYGA 4JDVB 1J05A 1QFPA 3H42L 2D0FA 2DQFA 3P77A 2XG5A 1F11A 3FQWB 3IRPX 1CU4L 4I0PA 2NYYD 1LK3L 5IF0A 1PY4A 1UVQA 3NFPA 3MOAH 1CGSH 1LO2H 1DBKL 1WITA 2IBBA 3B8SA 4X4XA 4YXKH 4K23L 2W9LA 4PJDB 4Z7UA 4MLIA 5IROC 1BIIA 3T0WA 3W9DB 4LLVA 1NAMA 4HF5L 4BSVB 2BNRE 4J3XA 3RA7H 4MAUH 2E3VA 3BIKB 4AT6B 5KAQG 5JDSB 1KEMH 2VJXA 2XTJE 4EXPX 3RKPA 1GZPB 5IEHB 1RK0B 3SE9H 3SKNB 4OZIB 2GI7A 4NUGL 3WFEL 2QTEA 4EN3B 5JXEC 4U1LA 3LQZB 1NEZA 5EUOA 4BH8A 3OKKB 3MRFA 4C59B 3W39A 4G7YL 2EIEA 4PV8A 4XPGL 4UINH 4U7KA 5D1QC 3GGWA 1CTOA 3SGKC 3TVMA 4MNGB 4DN4L 5IFAH 5F44A 2CLVB 5GJSH 4WJ5B 5I1KL 1DN0B 3JWOH 4JZNB 2VLKE 3OAYH 3BPNB 4PBVC 4F7EB 5F96L 5E56A 1NMAL 1T03L 3IXTB 2B5IC 3KXFB 3MYJA 3QQ9C 1A5FL 5ISZA 4ZFGL 1LEGB 4LOUC 3C5ZD 1U2HA 3CZJA 4ZPVB 3MNVB 4UBDD 1D9KA 4OGXH 1H0DA 1OAQH 2FYYA 2IG2L 1S7WA 4Q74A 3VXOB 3DGGA 3GI8L 4TULH 3P30H 5HDOA 2NY3C 4PJ7F 5IW6A 5CZVH 2P44B 2B7DT 4YAQA 4KGLA 5CGMA 4LLUA 3HNSL 3MRLA 3U0PA 1CK0L 5D5MB 1U3HA 1S7UA 1XF4A 4LLQA 4F15B 4FXLA 4HG4J 5HSFA 1S9WA 3PIQB 5GXBB 1FE8H 1RD6A 3VXSE 5C09B 4ZD3L 1NCAL 1U8OB 1B4JL 1A9EB 1J0IA 2AI0H 4PR5A 4XP4L 3E8UL 3OAZK 1U95B 3MACL 2ZUVA 4PB0L 1HHGA 2E9IA 4OCRH 3CLFH 1CFNB 3L5HA 3QO1B 1FG2B 4OLZL 4NWTH 5A2LH 2UVEA 2F15A 2FBOJ 5I8CA 2NLJA 3RNQB 3QEQB 3TP4A 2VDKH 5C2BL 3O3BA 4FZ8H 4N0CD 2HN7B 3MRMB 5D7IF 32C2A 3UYRH 1SY6L 4R3SB 3FQTB 5KVMC 1QSFB 2NXZB 5I17A 5DD0L 5GGQL 3S5LA 4X4YB 5E8DL 1UB5A 2Q86B 4P46D 1KENL 4XHJC 1K8IB 5C6PB 1K85A 5ESQB 3EOTL 4UZGA 5F1NA 1KF9B 4PRNA 1CFQB 4DGYL 1T21B 2CDEA 4I77L 4NP4H 4EUPA 4XGZB 1JV5B 4RRPA 2ICEA 2EIBA 1MRCH 3ILQC 1X4ZA 3A6BL 3OJDB 3RVVD 1Y6MR 4O02H 4W6XB 2R29L 5D1ZC 1G6RB 5HI3D 1XF1A 4YFDB 3V4VL 3WXVL 4PRID 2NY5C 2DN7A 1EEYA 2DBLH 4I13B 2HKFH 3TFKD 4HWBA 1H5BB 1RZJH 5IVOA 2BNQD 5CKAA 2R2CA 3BPOC 3ARGD 5DHVB 3VJ6B 1EUUA 4HIHB 1XT5A 4F33A 3IAQA 1JI1A 1IC4H 4PJAF 4NQCA 5BS0B 1ZLWK 1RZGA 5I1DA 1VGEL 4HEPG 5IJVB 3HI1B 5D7LE 4DKFL 2BY1A 3GJFH 4HZLB 4NM8L 3V9FA 3FB7B 1P7QD 5E8PA 2E7BA 3H3KA 4JPWH 4F3FA 1I1FA 4I18B 1OGAB 1FBIL 2PYED 2ZUSA 3M45A 5ICZB 1YC7A 1J8HB 1OAYL 2XN9D 1WJ3A 4GKSB 3FHAA 4NFDA 5CJOH 1FNGA 4XVUC 4P9HL 3VRLE 4TSAH 3EJJX 1ND0A 3RTQC 5E03A 3RQ3A 3I75A 5KSUB 1YEKH 1OSPH 3FQNB 4OT1L 4GW4A 1YEGH 5T3ZH 4YBLB 2LVEA 1FNSH 1ED3A 1OD7A 5F1KC 3ULVH 3VD3A 1JPTH 4YHLL 2ZJSH 1YY8B 4RIRA 5TDOB 1DBML 3VA2C 3UTPD 2B4CC 3QEUB 4TOYH 5C6TL 3PJSA 4TUJA 2J4WH 1NAKH 4Y16A 4R96A 4UOW1 3AB0C 1IT9L 3VMPA 5SWQB 2GUOA 4GRMA 1MY7A 5EOQH 5K33A 3V4UH 1I3GH 3TZVC 4KJWC 4Y5VB 4ERSL 3MA7A 4QF1A 3MV7B 4HKBB 2P5WB 2XZQL 4PJEB 3S3PA 4CN1A 3LOWA 3QH3B 1DTUA 2JJTA 2F54B 3HR5B 4MZ3A 4KI5D 2WNGA 3QIUA 2VXUH 2J7LA 4X99A 1IKFL 1IAMA 2AGJL 2CRIA 4I4WA 1KG0A 3WXWL 4OGAC 4PREB 4NHUA 3RWIA 2DKSA 5INDA 5LWYH 4ZOBA 3U0TB 2R8SH 3QUYC 2MQCA 4MJID 1CDJA 2B0SH 3PGFH 4IS6B 5FA4B 1A7QH 4U6YB 2DQIL 3TCXA 2XKUA 4NZTH 3SQBA 3QDGB 4FQHA 4DZ8A 2BRRH 4Q7DA 4LQFL 4WI8A 3ARBC 4E42B 5D2LF 3QDME 5JOFA 5CP7A 1NGXA 3VXRA 3EKCA 3F58H 2FO4A 3KLHC 2YR3A 1LEIB 2KUTA 4KUCD 5BVJA 2GJ6A 1FYTE 4I2XA 4PGDB 1MHHA 3A6CL 1MI5D 1AXSB 3FO1A 1FFNA 2WQ8A 3BIAX 1NGWA 1S3KL 1ULVA 3G5XA 4PGEA 5F1IB 4G8FB 4P2OB 2F74B 4HCRH 1KCVL 4BZ2L 5I9QB 2G2RB 2CIKA 1T89C 3U48A 1PKQB 4Q2ZB 3RVUC 4R90H 3CZFA 4ZUUA 3QULB 1KXTB 1IC7L 1UEYA 4GSDH 3ARYA 3VXTA 2YD2A 3HMXA 5FKAA 3TV3L 2AS5M 1WT5A 3EO9L 3O3DA 4H0HB 4Y4KC 1FZMA 3MYZA 4LSTL 3J7HA 3U2SA 3ARED 1FVCA 4FQXD 4M48H 3T0DA 1BQHA 3ROOA 4U49A 5L0QC 4KUZH 4G8GD 2CR3A 3P2TA 3OR6B 3NOIA 2A74B 4NNXB 4KDWA 3FB8A 3TO4B 3EDFA 5E8OA 1F4HA 2J8UB 2W0KA 2YK1H 1F6AB 2H8PA 5MEOB 2HYMA 2VL5B 3HNVH 4XP9L 4C4KO 1CICD 1LK2B 4J8RB 5DUPH 2FIKB 4M8VA 4XAWL 5IB4B 1CE1H 2P4AB 5T1KB 1MIMH 1N64H 3THMH 1H3PH 4WO4A 2Y7QA 1URLA 1I3VA 4BQBA 5HVHC 3NGBC 2VABA 4JY5H 4KQ4L 3LS4H 5CEXB 2MQ0A 3SO5A 1IJ9A 1ODAA 2Y06L 4QY8A 4AL8L 2FB4L 4OD2B 3PP3K 2CUHA 2AJSL 4A2LA 5ADOH 3AXLB 2NY0B 1R3HB 1Y0LA 1I3UA 4JG0L 4ONGH 5BW7C 5I19H 2EDHA 3FOMB 4DEPB 5CKGA 2IADA 1NLBL 2ENSA 2APXA 2HMID 2L4OA 4NQDD 4RDQF 5B8CC 1HQ4A 3VRJA 1OT1A 1QBML 3TF7C 3VFSA 4Z7VE 1N0XH 1SEBA 2DQEL 5FXCH 4MGXA 2IAMC 1N8ZA 5FYJD 3X3GL 1LO4L 4J3SA 3QRFM 1WUNT 4CU7A 3FO0H 3RZWA 1A2YA 3QCUH 4P4KC 3MJ6A 3Q48A 4JHAL 1HIMH 5ICXB 3JXAA 3ZE1E 4PJ7A 4PJ9A 2WUCH 4PTTB 4GRWH 1NSNL 4BFGA 2O26U 5J57B 4L8BA 1D5BA 3WSQL 3QQ4A 5IB2A 4OZFA 2VISB 4M1DH 4O5LL 4XCNA 5IKCB 1HXMB 2EDRA 3CFDB 3WUWG 2F5BH 2YZ1A 1FCGA 3GSXB 5J12B 1YEIH 5K59E 1SJHB 4L3EE 3MUJA 2BVPB 4F7MA 3BWUC 3CFEA 2VLME 4Y4FC 3QEHA 1SJXA 1G9MH 1QBAA 3BPLC 1G7JA 4LLMB 4R9HA 2EYRA 4JPKL 4NKDB 5ELIA 4XCEA 1A6VL 4F9LC 4CRPA 2PXYB 1PZ5B 2IQ9L 4Y2DA 5D6DA 5DZNA 2XNAB 4OCLC 3OKEA 5L8JB 3DSNA 4Q0XL 1NAMH 5D7IA 1MEXL 2XZCL 3P3YA 4PJIE 4DQOL 1E6OL 1LVEA 5IESL 3OQ3B 1KLFA 4XPFH 3BGFB 3SCMA 1EAJA 5KJRL 4YUEL 2BNRB 3E3QE 4ZODA 3WUWB 5DD3H 5TQ0H 1I9EA 3AVEA 1T1ZA 5HYFA 5EWIL 1UWEH 1CZ8H 2XTJB 1TJIH 4UILL 1JN6B 2GY7B 1M1SA 2CLZA 2W07A 3QNZB 3AUVA 3ULSA 5FGSA 4QTHB 4C83A 5HHOD 3OKOB 1V7NL 3FT4A 3SDAB 2Q8AH 3OPZL 5L6YH 2YUVA 3CXDL 3AS2A 3ME0A 4FXKA 2FZ3A 3HPJA 2ZUQC 5GGUB 1RJZB 2QQNL 1AGBB 3LIZL 1RVFH 1QR1A 1N3NA 3JV6B 4L29A 4RFOH 1LMKA 4PJAA 2BHUA 4U2YA 1XGTB 2AABH 2HJFA 3SDDB 4EDWL 2B1AH 1IFHH 5C0DB 3ZO0A 4EIGB 1FNEA 3FN0L 1TETL 3KYKH 5I8EA 1T6VN 2AEQH 4JRYE 3S37L 4GO6B 1RUQL 1ZSDB 5EU3A 3BGAA 5EUKB 2W9EL 4NQSB 4JFDE 1TZIB 3QRGL 4A6YA 3HKFA 4YNYB 3TO2A 2D2OA 2EEBA 1JMZA 4N1EA 1JJUA 2XFXA 2VN7A 1QLRA 2NPLX 4WEMB 4JPVL 4OF7A 1HZHH 3R06B 5DJYB 3LRHA 5JA9A 1C16B 2ATKA 4XPTL 3BHBB 5M7QA 4XAKD 2FJGB 2Z31D 5TDNB 4Z7NF 3WJLA 3MODL 2R9HC 1FL3B 4GRLD 4UDTB 4NJ9H 1CN4A 4BH7B 5IVZA 4Y0GA 1MHPH 1S9YB 1CGWA 5HI5C 2D0HA 1CF8H 3ULUD 4NNPL 1VFAA 3PWVB 4X80H 1KB5A 1MF2L 4PB9H 5IEKA 2NXYC 5DQDL 4EUPH 5FYJL 4IHOB 1F90L 2HTLD 1C12B 2E8YA 1CYGA 4NQCE 3BD4A 5DK2B 2WAHA 1RZ8A 2VC2L 3ARDA 1D5MB 4CUCA 5IR1A 2PO6A 3CK0L 2IGFL 4YDLB 1TNNA 4KHTL 1FAIH 5GS0L 2D7TL 3TBYA 1PZUB 1CWVA 2X1QA 4BK5A 5BCAA 3D3VE 4HWBH 3RZCA 3RAJL 4RZCA 3O6FC 2O5XL 2DM3A 4JKWA 4PRAA 2OI9C 3OTTA 5E2WH 2MMXA 5E8NB 1U8LB 1AGCB 2K7QA 1AQKH 5KG9A 1WEJL 3VG0L 1LEKB 2H3NA 5D2LA 1KIQA 4P2YA 5EU4B 1CG9B 5C3LD 4RGNC 4P23C 1LDPH 5DURD 4XCYA 4APQC 5TF1H 5KS9F 4H5SA 3LKNB 3T8XB 3SKOB 4X0KA 3GSWB 1TDQA 4M4PA 1C1EL 5ANMA 3FRUA 1NGQH 5DEFB 3O8XB 4P2RB 4RSVA 5DRXA 4CW1B 5DJ2A 2HLAA 3MO1A 1XCQA 3UAJD 1BBDH 1FVEA 2AXGB 5AZEH 3WFDL 1IGIL 3HE7D 4YXHH 1DQDL 4BM7A 1IAIM 3T2NL 3FO9A 2XKNB 3AFLA 1IEAA 4D9LL 4LKXA 1Z9LA 2JCCE 5TFSL 1FGVH 4X7CC 1I1AD 2VZOA 4YHZH 5GIRA 1OB1B 4RNRB 5C86A 1XF2B 4KK6D 3WDJA 4NO0D 1Q94A 5LGHH 3HFMH 4JDTL 3AMKA 4UUJB 1A14H 4IRJB 3ARFB 4MWFA 4FA8A 3BDYH 4WWKA 4NJAL 5BQ7B 5DJZB 3BP4B 2EYTA 3GBNH 1NUFA 1MCJA 1QKZH 3NH7L 3KPSA 3H9SE 5DLMH 3MRPB 3RGVB 2HTKC 3QIWB 4OB5L 2XQBL 3ARWA 3EFDL 3HMWH 5F9DC 1SBSH 1JWMA 3G6AA 5DWUL 3SOBL 3G6DL 4Y5XB 4HPOL 2QADD 4F58L 3DWTA 2JJUA 2IBGA 2ITDB 1EMTH 3QEGL 3D2UB 4NWUL 5SWSE 4R7NA 4I9WE 4XX1E 3TEUA 3S88L 3PWPE 3ARZA 1NGZB 2R23A 2G9HB 4CMHC 3QFDA 4P3DB 2EDQA 3LKQB 3TBTB 4M5YH 1EDQA 3GI9L 1MJJA 3KPRB 3X12B 1IQWH 1A6PA 3N1GC 4OUUB 4NO5B 1JF1B 2M26A 3ESVF 1T2XA 2DQTL 4XZUB 1EIBA 2DQJH 1QACA 4CVZB 4OZ4B 3ZTJH 5AAWA 2BVEA 3U46B 4LFHG 5DTFB 3P4LA 2ESVE 1D6EA 3F62A 1I7ZB 2IWGA 3MV9D 4W4OC 4YFLI 5EOTB 2C4FU 4RFEA 1L7IL 3HI6L 2DIAA 2J5LB 3ZSSA 4NN7C 3K2UH 1I9JH 3X11A 2CK0H 1BIHA 2EXYD 4ZNCD 3QBTB 1G1CA 3ULUL 5E2TL 1FLRH 2Z93B 3DUSA 4G5ZH 5JLZA 4UTAH 5CWSA 3RWGB 3SGDH 4GMTH 3M17B 2UVFA 4LRIA 5EIIB 3ARTA 2D7PA 4ZNEE 2AK4A 5BRZD 2PW2A 3BVNB 3VFTA 2H45A 3F5WB 1AKJB 2GY5A 3ARQA 2AEPH 5I8KH 3HMXH 3ROLB 4JRXD 4KRNA 2YWYA 3RL2A 2VE6A 5F7DB 5AD0A 4YXLL 3FFCD 2DBJA 2ID5A 4KKBD 1RZ7L 4MD5A 4KMLB 1ES0B 1TCRB 3MA9L 3HAEA 4PS4H 3V7AE 5HVWA 4AG4H 3K8MA 4LKCB 4WV1A 2DQGL 5CCKL 5JPMB 3T0EA 4Y88A 2ZUXA 3BO8B 4MYWB 1EVTC 4LK4A 4Y1AD 1R3KA 2YA0A 2G60H 4P9MH 3JTSB 1P2CB 1IC5L 3U4BH 4YO0B 3RWCB 2CKBA 4LLDA 3FKUS 3QFJD 1DQJB 2BRQA 4P4RB 1T5WB 2P42B 4P3CL 3VWJA 2HJKB 3V5HA 4CVUA 1JCKA 4N0RA 4AEHH 1P4BH 2HRPL 3SGEH 2A6KA 3Q0HA 2JELL 3TC9A 1QSEE 2UYLA 5A3ID 4XXCA 1M7DB 3HLAA 3FQXB 4NIKB 1N6VA 4ELME 1KV3A 3QIBB 2ADIA 1DBAL 1GH7A 3FMGL 1KJ2A 4MA3A 4PJ5D 3C09C 2LQRA 3CVHL 1WIPA 3SKUD 1ZT7A 4MX7A 2ZNWA 2VDNL 2DLFL 4Z0BL 2MNUA 3H3BC 3V79C 1XZ0A 3RVTC 2VZVA 1BFVL 1A6ZB 2DLEA 4ODSL 4Y4HA 3BQUC 1NPUA 3IU3A 3NA9H 4YR6B 5T3XE 1BD2B 3PWNA 4ZOEA 1NDGB 2ADGA 4UV7H 4POZC 4E5XA 4P5TA 3B2UC 4ZXBA 1NEZG 3PWUA 1MQ8A 5K93A 5EA0L 3SGJC 1OTUD 3VXMD 3WNLA 5EU6E 4QRQB 1DP0A 4Z7VB 2Q6WA 4L4VB 5TE7H 5JHDD 4L4TA 4HUVB 2WUBL 3QI9A 4OZFH 1TJHL 1RHHB 3L3KB 1HHHB 4S0SD 5D6CA 4FFVC 2NY1B 3C9NB 4MJ6A