5FGCE

Three dimensional structure of broadly neutralizing human anti - hepatitis c virus (hcv) glycoprotein e2 fab fragment hc33.8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
225
Chain Sequence
EVQLVESGGGLAQPGESLRLSCAASGFNFYTYAMTWVRQAPGKGLEWVSASSSTDGTTYYADSVKGRFTISRDNSKNILYLQMNSLKAEDTATYYCARAVVFTDSSAYYYSKYFDYWSQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Antibody Response to Hypervariable Region 1 Interferes with Broadly Neutralizing Antibodies to Hepatitis C Virus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein
total genus 46
structure length 225
sequence length 230
ec nomenclature
pdb deposition date 2015-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgcE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgcE01
3TZVD 5CHNA 1IAOB 3MUZ1 2KZ1B 2QQNL 4GXUM 3VFNA 5FKPA 3SGJA 5DUBB 4R6UA 1I7RA 3RIFF 1NPUA 3HAEG 2NCMA 4OF5A 2G5BB 3N1GC 4JO1H 1EGJA 4NCDA 3EUUA 5MEOB 1JK8A 2KQMA 4JFED 1S7RA 3LRGA 2Q76A 1J8HA 2PYED 5ALBL 2H1PL 4FQ2H 4L4TA 1F6LL 2D7NA 2DQCH 5B3JF 2W60A 4TVPD 4HKBB 4JFQB 4ZS7H 1UB5A 4PJHF 5IK3B 5J11C 2XA8L 2GHWB 1A8JH 3ULUH 1RJYB 5JIKA 1KN2H 2DWDA 2X09A 1IC4L 1T0MB 3KS0H 1ZOXA 3UP1A 4JVWA 2AABH 3PGDA 4HT1L 3VRJB 1FIEA 3I6KA 4GG8B 1KENL 1MUJA 5F1SA 3ZE2E 1KTRL 3W0WE 1A7OH 2QBWA 3NZ8B 3OXRA 4LSTH 1UWXK 2NLJB 1JL8A 1ZT4B 4N68A 5F9AC 4C54A 1OGAD 1E27B 2RFXB 5GJTH 2XKSA 4KTEH 1FGVH 3PWUB 4U1GC 3OF6D 2JJTA 3DX8A 3WDJA 2HFFA 1KCRH 3FQXA 1KTLB 2D7TL 1ZV5A 3QDHA 3VXME 1T5XA 2VLRD 4QHNB 5DK2B 1A1OB 1NGQL 5C9JA 3NZHH 3BZ4A 3AROA 4OKVA 3OSKA 5CGYC 4Q9RL 1W2KT 4S10A 3THML 3QRGL 5DGRA 3G08B 5J12C 4FQIH 2OZ4A 4ZG1A 4LLMB 5B8CB 5HYIA 3SGDI 3RVWD 1A14H 1S7VA 1LO4L 5GGRY 2D3VA 3NFNB 1SVZA 4JFXB 1LK2B 1EJOL 4JY4A 4UB0H 2H8PA 3GGWA 3OAUL 1MAJA 3ARBD 1CDGA 3SDAC 4F58H 3RZCA 3MYJA 1I8KA 2AK1H 5BRZD 1X4ZA 1P4LA 5EC2B 3GNMH 2ESVB 2PW2B 5FYKL 2CDEA 1PDKA 3HLAA 1K4CB 1CXHA 4G7VH 2FH6A 3PE9A 4PJBF 2DJSA 5DMJB 3SY0A 1BREA 3R06A 4L8DA 4GRMA 1PX3A 1YYML 1DBJH 2VXSH 3K2UH 1H3VA 2EIDA 5AEAA 4ZTOL 5LXGH 1YQVL 1T1ZA 1I3GL 3N1FC 4NQXB 5CJXC 5I8EB 1SEQL 1FIGL 4NO3A 5JXED 4XVUC 4G5ZH 1NFDE 4DZBA 2X42A 3MJ8A 4LCCC 3F12B 3VFVB 3VFOB 4XGZA 4U7KA 1GAFL 5E6YA 1INEH 2M2DA 1EMTL 1MI5A 3HE7C 2HT2C 5AAWA 4PJFB 3IRPX 3CU1A 4OLEA 1AGFA 1DBMH 4IBLT 5FF6B 4Y5VB 1MCOH 1AH1A 1NBYA 4XNZC 5C07D 1IAKB 3K8KA 4NGHH 2ZKHH 4JRWA 4Y4HC 3KYKH 4QOKA 2VITA 3D39D 2FYYA 1G9ML 2N56A 4Z7WE 1F3JB 2HT3C 4POZD 2IANA 2N7BA 2GY5A 1ORQB 4R2GB 5F1IB 4WIQA 3WKML 4Y5XC 3GHBL 5CEYB 3QUML 2RBLA 1IFHH 2IFFL 4ZAKA 1IAIL 3O3DB 3TPUB 4TVPL 2G9HB 2WWMC 4NKMB 4O9HL 4W81A 2ZUSA 3GSNH 4ZFFA 5FUOH 3A6BH 2BDNL 1JYXA 3TH4T 3NAAL 1HSBA 2OXHA 3Q6GL 3CFEB 1KYOJ 4NJ9L 5T3XH 2B8OT 2IH1B 1J0JA 1MELA 4X8JB 5JA9A 3OAYH 4M4PA 2CQVA 5DJAB 1ZA3A 3H42H 5DUMH 5F1KC 5JORA 3MRPA 3ZMRA 1CT8A 1ND0A 3MV01 2G60H 4G8GA 4RSVA 3P0VH 5I30L 3GJEA 5DK0A 3CXDL 3RGVA 5CJOH 2GAZB 2FO1A 1HIMH 1CE1H 3MNWB 2GQHA 2VRAA 4AQOA 2IH3B 2QHLA 1BECA 3KPRD 3KR3L 3CFKB 5BS0E 3EYOB 1G0YR 5KG9A 1I7ZA 3HG1B 3RP1A 4Q6IA 5EUKB 3IKCA 3IXTB 3HAEB 4FABH 1KXQE 2BK8A 4F7EB 2EDLA 1EAJA 4HEPG 1KB9K 2P24B 4YHPB 4CU8A 5IM7A 5EBMB 4OF6A 5SWZA 4FQXD 3FB7B 2ORBH 4U2YA 3OKNB 4JFPA 3WJJC 2FJGA 4OFKA 2A9MH 5TGBA 4P2OA 4EVNA 1DSFL 3HS0B 3PIQA 3RGHA 3AUVA 2VZTA 5LWYL 3SOBL 4PP2B 5TQ0L 4GRLB 2YBRB 3TBWB 4DTGL 4PJ5E 5IVOA 1C08B 1YN6A 3IAGC 4DQOH 2QLVB 1U8LB 2Z0BA 4XWOC 3ZE0E 1U58A 1DUZB 4OUUA 1JHTB 2FX7L 1PKQE 4XBPA 1K8IB 3BKJH 3V6OC 3QEHB 3SQOH 3V0WL 5LQBL 4JZJA 1MWAA 2NY3C 4QYOB 5I1DA 1CXFA 5KVEL 4W4NA 2F53B 4X5WA 1J05B 3LDBC 1X5JA 5MEPB 3FQTA 3PP3H 5E8PA 1JGVL 3KVQA 4F57H 4K7PL 4F7PB 3KPNB 3UZEA 1XCTA 3BIKB 3BUYA 3LKPA 1RIHH 5IKCA 2VWEE 5ALCL 2EICA 4H25B 5CSGA 5A16B 4ZO9A 3WS6C 3X3FL 2AV7B 5DC0A 1FZJB 1HEZA 4CU7A 5F72S 3MRMB 3CH1A 1FNEB 2MTPA 4N1CA 3TBSA 2ATPB 4KTDH 4TSAL 3B3IA 1A6PA 1XF5A 3I9GH 3VGAB 3NA9H 4I0PB 3BDBA 1TZGL 4H0HB 4OBSA 2HLAB 2VDMH 4X6CB 3KWWA 5E5MB 3Q3GB 3RWCA 4NDMB 3OR6A 2VL5A 1JPTL 3UO1L 3IU3B 1CL7H 4C56E 3HI6H 3ILPB 3JWDL 1ZHLA 2DTML 3A6OA 4HCRH 5DJXB 5E5RB 1AIFB 1U95B 3PWVA 1H0DA 4LFHD 3RWJB 3GBNH 2WW8A 1IGCH 5DEGB 4M1CC 4NYLA 3RI5F 5HXMA 2A6KB 1I9RL 3BEVB 1BF8A 3IDIA 1UZ6E 4ODXB 2G75B 4YAQB 3D6GA 4K7PX 3TA3B 3BKCL 1C12A 1UYWH 1U8KB 2BOCB 2QV2A 1PAMA 3FONB 1I7UB 1E4XH 5GRVL 1JV5A 3LHPH 4AIZA 1S9XB 3VXUA 5FYJH 4RQQB 3F6IA 4RFEB 1N4XH 4EN3B 5C08E 5F8RC 3SN6N 1U8NB 2NY1B 3JXAA 2WINB 5H94B 2YD5A 3QZWG 5D7JA 2CXKA 1R0AL 1OM3H 5T3ZH 3WN5A 4LBEB 5DRXA 1NAMA 2EIBA 2J8HA 3H9HB 3S8WA 3OV6A 1AXIB 4BUHA 4KROC 5GHWH 4Z7OE 3TT1L 2X4UB 2A6IA 3ILQD 4R7NB 3EJZC 4LHUD 4H20L 1IL1A 4NN5C 4O58H 5KSAA 3P4NA 1A6ZB 3FN9A 1A6WH 2E7LC 2CMRL 2BOBA 4HPYL 1ZA6B 4NFCA 4OCNC 1F45A 1LO5A 2W59A 5D1ZD 5EULV 5HYJA 5C0BA 2Q7YA 1IZJA 4IRJB 1EHNA 3CLEL 4EXPX 4HZAA 4P46C 4Z7QF 4R97C 3MLYH 3S37X 4LVOC 3MRHA 3RTQD 5FFLA 5I1HH 2ZSWB 3M1BB 3QG7H 3OGOE 4ZDHA 3RNKA 1S9WB 2AEWA 4LHJB 1QR1B 4S0SD 1HQRA 5FV2A 3IDXH 1QSEB 4NZRH 1JGLL 2VXTL 5I1IH 2BC4B 3QQ3B 4PJHA 3RKDD 1T80A 5D7IB 4Q58C 3WFHB 4MGXA 3ARDD 4D0CB 1EO8L 5C1MB 5D72H 1L7TH 2HFEB 1FYTB 3QEQD 5D6CA 5E70A 3ZYZA 4UTAL 2EKSA 3N85L 2F54B 2QR0B 4NRZB 1JP5A 2E6QA 5AUMA 2HFTA 5E7BA 5SWSD 3X17A 2PCPB 4JFZH 4UOW0 4OFYA 3GSUA 5DVKA 2OP4H 5E8OB 5F71A 3L5HA 2BSED 4D9QE 4XNYH 5IMMA 5F88B 5FHAH 1YEHL 2F8OA 3FAWA 1P6FA 2V9RA 1ORSA 4KUCF 4NO5B 1SVCP 4L8SC 1UM6L 4G7YH 1PEWA 3LKSB 4FQJH 4QTIH 2FGZA 3OR7B 5JW4M 1C5CL 3I84A 3G6DL 3N1QC 5CJQL 1WEJH 3WIIH 1HYRC 4HW6A 3MCKB 5ICYA 5E6ID 3L9RA 3QA3B 4TUOB 5BV7B 1VFBB 2OJEA 3BKYH 4LPYA 1AY1L 2GCYB 1E0OB 1HH9B 3AS0A 2P8PA 3TEUA 4M43H 2PTVA 3UEZA 1DLHA 2XWBA 1TVHB 4W70A 2NTFA 2VDKL 4P9HH 2VXQL 4WFED 3MROA 3GMRA 4Z5RB 3E6HA 4QHUA 4CJ1A 1Z6JT 4AEHH 1FVDB 4CL7A 1P1ZB 3IF1A 3BP5B 4L3CB 1KT2B 4K3EH 4PJBA 1WCBA 3MLZL 1G7LA 4RMWA 3ZL4L 1M71A 1KIPB 1RMFL 5FOBA 3RQ3A 3E3QE 3ARGA 2BCKB 3IRZA 5D7SL 1UA6L 3ZE0F 2FEDD 5C71A 5T3XE 5IR1A 1KIRB 2DD8H 5EC1A 3I50L 4JHAH 3VCLA 2HWZH 1PFCA 4ETQA 3FT4A 1BM3L 3L5WB 3P9WB 3DV4A 3MXVH 1A6VL 4IMLB 2J8UB 4MJ2A 4PJ7E 2RIKA 4PLJD 3TCXA 5IVXB 1A1MB 2X4SB 3SDYL 4BZ1H 1CLCA 2OTUA 1S7QB 2LE9A 4OCWL 2C3HA 1T4KB 2L7UA 3PQYB 3DIFA 3MRJB 4M4RA 3WUWA 5HVWA 1KGCE 2V5YA 2X1XR 1EH9A 2HVKB 2Q86A 3VFWA 1W72L 1I4FA 2Z92A 4PLNC 2D03H 1FG9C 1AP2B 1IGFL 4JVUA 4DVBA 2IAMA 5ICXA 1AXSA 1I1FA 3HC4H 2EC8A 2V9QA 3X11A 1KC5H 1CLOH 4ZXBB 1FFOA 1U36A 5CD5C 3S7GA 2HG5B 4LRNL 5M94B 4YDLC 3GK8H 5DJ0B 2AJVL 3V6FA 4FFVD 4YXHH 4OKDA 1V3MA 5I73C 3WFEH 1MLCB 1UZ6F 4M7KH 3U9UA 4AT6A 2VZOA 4ENED 1S8DA 4YHLL 4OD1L 4WWKA 5JW3H 1H8SA 3OKMB 5J13B 3QZWB 4GW4A 3NMEA 1MCHA 2D4FA 3S36L 1G0DA 3V0VB 3GSQA 4NT6A 3F62A 3HC3H 3VXOB 5DEFB 3T1WA 4OZHF 3ULUF 3PABB 2JELH 4ORGA 4OF0A 5BZWA 3ZDYE 5DVOA 3QWRD 1T03L 5I66B 4EI5C 4G9DA 2OJZL 5DYOA 4Z7OF 5C6TH 1UGNA 4FG6D 4G80B 4X6EA 1ZLSL 3DROA 3S98A 2BY0A 4P2QE 2YUVA 1PQZB 4IRZH 2VLKD 3WFDH 2ZUTA 1Z3GH 2J12B 1M6OB 2F15A 4YHIB 5KANI 1RUPH 4LEXL 2MHAB 4NNYA 4LNRB 2FHCA 2R23B 3QG6A 4R2GD 4WW1B 1VEPA 1G9NL 2CK0H 2DOCA 3OJMB 1AGDA 3ARXA 4LPWA 5EBWB 3RZCC 3QRFM 4DK3A 3O6FB 4JY6A 4LARH 5HDLA 2FHFA 5E99H 1JCKA 2AK4E 4PV9B 2XTJB 2XZAL 3L5XL 4U49A 2XICA 3DETC 1DVFA 4UQ2A 4P5MA 3TJHC 5CEXB 1UVQB 2W65B 2A2QT 3BPNB 5JLZA 3ULSB 4XB8A 5ITFA 1EO5A 2MFNA 1EEYB 1XGYL 4B7LA 3MLWH 3TFKD 2PN5A 5H37G 2ERJB 5DMYA 4NZUL 4PJAB 3E0GA 4GKZA 4YO0B 4JR9L 5FYJE 1J0IA 4G3YH 4JHZA 2EC9U 2BVPB 3ZKND 2VKWA 1EA9C 4P4KA 5EU4B 4ODVH 5F9OH 1T66D 3DVGB 3RWDA 3W0WA 5AWNL 4GOSA 1A6UL 1S7UA 2EDBA 3MOAL 2V7NB 2EDYA 5DHXB 1MRCL 1Q9WB 4LSQH 2NX5E 1J1XL 2FZ3A 2I24N 4MNQA 1X5YA 3ZKXB 5CGTA 2VISB 4PJGB 4RIRA 4BH8A 1FO0A 3MO1B 4HFUL 1KJMA 5DR5L 1ETZA 4WUUE 4RDQF 2MOVA 4AYFA 4OF7A 1LO2H 4Q74A 3HG1D 4G9FE 3UJJL 3VXMA 1QQDB 4ZS6D 4PR5A 1GZQB 3Q2CA 4OIAA 3SKMA 3OBAA 4O2FA 5GGVH 3MV9B 1RZGB 2HJKB 3KPQA 5GSVA 4P5TB 2YKLL 1M7DA 2VZSA 1ZLUK 3LV3A 4FMKA 1RUML 2AW2A 3JV4A 4P9MH 3S88H 4Q2ZB 3EDFA 1H8OA 2D7QA 5FCSH 1W0VA 3L7EB 1Z2KA 4FFZL 1FLTX 2O5XL 4QXTB 5L2KA 4KJQD 2WWKT 1R24A 3FOLA 3RY4A 3UC0H 5J57B 2W9LA 4MMXC 1IQWL 4WEBL 4GUPB 4JAMB 3DI3B 1LDPH 1UXWA 4WJ5B 4UAOB 1DQDL 5E5UB 4YHNB 3O3AA 4HD9A 3QUZC 4CAGA 3TIDB 2AVGA 1X4XA 1OT2A 4HS3A 2AAVA 2F53D 1FVCB 2EEAA 1UKTA 4I18C 1DBBH 4F15C 3JWOH 3RGVC 5IJKC 4HS6A 2O61B 3MLVL 4HFWB 2APXA 3MOBL 4LQ1A 4KI5E 1KJ3H 3PWPB 3SDCA 5SWQA 4C4KO 4YHYC 2XNAB 4HUUB 5I74B 5IHLB 3TO4B 5IEHA 2NNAB 4HIXH 4M8QB 4HK0A 3WDIA 5ESVB 3QQ9C 1UB6A 5IW1A 1FL3B 1G7JB 4XVJL 4CADB 1NBZB 4XC3L 3QQNA 4I3RL 3AMLA 3UCRA 3EOTH 3R1GL 4KK8C 2C1PB 3OJDA 4I0PD 2QQLH 2PTTB 4M6AA 1IC7H 5JOPD 4CDHA 3CVHA 4NP4H 1NMCC 3MRBA 4R0LB 4HWEH 4AJ0A 3INUH 4GKSB 1N5AB 3H7BB 5FAAA 2AI0H 4XP5L 1FNGB 1MCWM 1LEKA 5JR1L 3MRFA 2PKDA 3MRKA 1T0PB 4L8CA 2R4SL 1FSKC 3O6MH 4Y16A 2J5LB 1LO0H 3IJHB 3TA3D 1P2CB 5KSBE 3F58H 3LS4L 2AKRB 4YLQT 4UIKL 5D2LB 3NN8A 1DN0A 4IIQA 4IRSB 1CFSB 3VE0A 2R69L 4U1NA 5C8JA 1NAKL 4U0RC 3VW3L 1AC0A 2KH2B 4EN3D 3VXNA 1KTDB 1FZOA 1JWMA 2HJFA 5DRZA 1QFOA 4JN1L 5C0IB 1GZPA 1RU9L 2NY1D 5FECA 2R29H 2YPLE 4PIRF 2VH5L 1A9BB 1K2DA 5JDSB 1JGDA 4LKXA 3D0LB 3FL7A 2C1OB 3CK0H 2ADJA 5FO8B 4N0CC 1RIVL 3FO9A 4WNQA 1CFQB 4XTRC 2C4FT 1Q94B 4X98B 1EO7A 4M7JL 4OD3L 1ZLWK 1OT1A 3FO1A 2VAAB 4BQ6A 4BA8A 1HKLH 4Y19E 1XMWA 2R8SH 3FTGA 2Z93A 3FT2A 1IJ9A 1RULH 4YPGA 5CBAA 5ITBH 4L4VE 4YBLC 4K9EL 1BVLB 4OCRL 3QO0B 3KJ6H 3ZDYF 1EHLL 5J0BA 1ZVHA 4TNVK 2I5YL 3KNBA 3MGAA 4HUNB 4ZSOE 5BS0A 4YK4C 3IJSA 5EO1A 3U0WL 1XR9B 4WDIB 4HMDA 4IRJD 4MD5A 4OIIL 2YS4A 5T5NF 3X12A 3PJSB 1SBSH 4F33A 3VWKB 2P43B 1WIPA 3IFLL 3LZFH 2KUTA 1QA9B 4OZFG 3BP6B 4PB0L 3LKQB 1OP5H 4EOWH 5HHOE 1OWWA 3T0EC 4UBDC 3U79A 1QFHA 4JCMA 3QP3A 4PTUA 1F4WL 2A6JB 4M6NH 1CIUA 2ITDA 3CFCH 4X6BA 2IALA 3S96B 1DQQA 3LB6C 5CKGA 4APQA 3X3GL 2V2XB 2XKNB 4KVCH 3C2AL 3F65A 2KDGA 3B9KC 4OT1H 2F54D 4P3WA 1C8PA 1PKQA 4F3FA 3TH2T 4X99B 3FQUA 4TSBL 3A67L 4E41B 3FRPA 4PJDB 4ZUUA 3C6LB 4ELME 3ZKMC 3G6JB 1DQML 3E6FB 3OJVC 4N5ED 3BO8A 3GRWA 4U31A 1CD1B 2FRGP 1HILB 5TH2B 3GMLA 5B39B 1LEGB 1GRWA 4HC1L 4HV8A 3BZEA 5L8JB 5DQJB 1Q0XH 2QKIA 3SCMD 1U8QA 3U4EB 4JLRB 4JVPA 5IEKB 3W5MA 5EU3B 3LKNA 3O3BA 4JRYA 5I0ZA 5HPMA 2CRMA 5E2JA 3FB5B 4NUGL 1U8PA 2K7PA 2OCFD 3LY6A 4OLZH 3TV3H 3TBVA 1PEZA 2RHEA 5D7LD 2FO4B 5I75C 3TVMA 4PUBL 4L3EE 4NRYB 1HOCB 3AM8A 5IGXL 5FUZH 1SMOA 1MCLA 2XT1B 5MHSE 4LOUC 4ZUTB 5EO0A 1QYGH 1ITBB 4MXQC 3BQUC 1OD9A 3BGFB 1A02N 1P53A 4U1IB 1B0WA 3GB7B 3V5KA 1I9JH 1OAQH 1CTNA 5F44A 1HZHL 4ZOAA 1L0QA 4H88L 3TO2A 1BIHA 3U7WL 2WZPD 5LGJB 4NO0A 5IHUL 2WBJC 4FZ8L 5D5ME 3K4AA 4PD4K 4G6JL 1U3HA 4KRMB 1QACA 3X13B 3KLSA 1WBZB 3QUYC 5EO9A 4U1MB 5EU6B 4MQ7B 5C08A 2E7CA 4XMPL 5DS8A 3RBSA 3BISA 3KLAB 3IDJA 3QXVA 4OZHA 2E7MA 4PGBA 4I2XB 3D0VB 4LLVB 1RURL 5J11B 3C09C 4P2RB 2APWA 1L0XA 1B4RA 4G8IB 4WHCA 3DUUB 3TWCL 2ED8A 2CGRL 3TT3L 1HINH 3PGFL 1TZHA 4KI5F 1EFXB 4QCIA 3QQ4B 4N8VA 4WEUD 3P2TA 3PQYD 4L8BB 1J88A 4WHDA 3WLWC 4HIEB 4R4FL 4HXAL 5BQ7A 4OF3A 3JV6B 4K23H 5D2NA 4WU7B 4XH2B 1IM9B 4U1GB 4HS8H 4O51B 3RVVC 3VGHA 2GUOB 5IWLA 1T20B 1R3HA 4X7EC 4YBHA 3TCLB 3WO3B 4X4XA 5C7XL 4XPBH 4WGWB 4JJ5B 3OGCA 2VR5A 3WXWH 1ONQB 3T8XB 1MLBB 5CBEA 3W39A 3IVKA 1JMZA 4E5XB 3HRZB 4UDTB 5J12B 1OAXH 4YQXH 1T3FB 2BSTB 2P8MA 2W0KA 1EIBA 4ORZC 5LG1A 3DVNB 1OAZH 4V1DE 5KSBF 3NFSL 1MJJA 5EU7E 5F89B 3LN4B 3UTZB 3FCTA 2PYEE 4X4ZA 3SDAB 1R5IB 2WANA 3ZHDA 5HSFA 3VFMB 5ACZA 4ODWA 3CDFA 2MCPL 4L29B 1AO7D 4B7IA 4PY8J 1I1YA 2APBA 1P7QA 3MLXH 5ESAA 3VFGL 2GSIB 5BV7L 2VDNH 1JTTA 5MENB 3JVGA 3BDXA 1GPOL 2BXYA 1T83C 1YJDL 2BX5A 3HPLA 1MCEA 4UILL 4KZEL 1Q9LB 1NGWA 4NJAL 5IMLA 3MC0A 4LCCB 5I9QC 2ATKA 1CQKA 3MYZA 1BQUA 1FLRH 3WFCL 5I71C 1K4DA 3HE7B 1MHCB 2ZUUA 4U6VH 5EIIB 5JMRA 2UWEE 1EDQA 1XGRA 4HWBH 4NNXA 4BJLA 4OZFB 5GS1C 1FE8L 2FNBA 4KPHL 4FQHA 3QIUC 5D70L 4XNZB 4KAQH 4Y1AB 1IEBA 2YEZA 5IBTH 2X89A 4PP1C 4Y4HB 4R3SA 3WE6A 5AD0B 1ZS8B 1JRHH 4RGNC 4NPYB 1I7TB 4XP6H 3RL1A 1FH5L 1MCSA 4WO4A 4ESKA 4J6RL 3MRLB 1RZFH 3L3KA 3CUPB 4XP4H 1BPVA 5FGCE 1G6RL 2FECI 3GMPA 1EZVX 4HXBL 3PP4L 4NBXB 1I9IL 1MHEB 3U36B 3TJEL 4Y5XB 4AK1A 2L4OA 4X4YA 5ADOH 5GGRB 3RPKA 4MWFA 1D9KC 3GSNA 1I3RA 3AMKA 4DUXA 4FXKB 2N7AA 4LSUH 2CD0A 2HKHH 1EXUB 1MRFL 1ZEAH 1AFVH 4G6FB 3MV8E 5F7DB 2BVQB 4GLRI 2ZOKB 3O4LA 4Q6YA 4FQ1L 3VXRA 4QRSA 3U7YH 5J89A 4H1LG 4RRPG 2PO6C 4GSDL 4ELMF 4XZUA 1ODAA 4YHKH 4XCFL 3RA7H 7FABH 2R0KH 1X4YA 2AXFB 4A6YB 2DBJA 2A83A 4BKLA 4KK6C 4LEOA 4QXUL 3DBXA 2NZ9D 3CGTA 5SV4A 5C0FA 2ARJB 1QLFA 2EH7H 1CR9H 1CGVA 2Y72A 3MV9D 1TJHL 3BI9X 4P3CL 5D7KE 4M93C 3BVNA 3IETB 4QRRE 5FDYA 4P5TD 3NACL 3MA7B 1DFBL 3QJFA 1JPFA 4MSWA 4FXGA 5F21B 1RZJL 4JM4L 2GJZB 3EKCA 3C5SB 4Z95L 4TUKH 4DKFH 3QHFL 3OB0H 5EA0L 4DAGL 4RCAA 5BVPH 3OHXA 5DD3L 5TDPA 5IUSA 4HWZA 4NZJA 3MPCA 1R3KA 4KHTH 4FHBD 4XVTL 5JW5B 1RZIB 3IDMA 1YDPA 1JWUB 1K6QL 2A1WH 4FQLH 1H3PL 4NO2A 4RAHA 1YEEL 5I17B 1WBYA 5DRNA 2G5RA 2MPAL 1RZKC 5D5MF 1CLZL 4H5SA 5D8JL 3SGEH 3DURB 1GOFA 3LKRB 4HLJA 1DBKL 4JPWH 3RDTB 5B38A 1BGXL 3TO4D 2RQ8A 3BKML 3NCJL 5DD6B 3RWEA 4Y4FA 4F8TA 1UENA 3S9DB 2NY3B 5HHPB 3UTTE 5E8EA 5DA4A 1VPOL 4K7PY 2CH8A 4XWGH 1BVKB 4EBQL 1RUQH 5BOZG 1C5DB 4ZPTA 5KZCD 1L7IL 3LDBB 5TFSL 2R0LH 3FFCB 3MODL 1LDSA 3SPVA 5I76A 4N0YL 1F97A 4GO6B 2P48B 3GI9L 3PWLA 1OSPL 5LGHH 1JI1A 2FL5A 4HQQL 2A9NH 5J1AA 3RVWC 3VH8G 3RU8H 1NGPL 1K3IA 1JWSA 1KB5H 3LVEA 5E2TL 3QNXB 2AGJH 5CP3H 5J9PA 5F96L 3PHOA 4GMTH 4IRSD 4YX2H 1UM5H 2C5DC 2DQFA 4HCRA 2VDRL 4NQCB 4G42B 1LP9E 4P59H 3T3ME 3O2WL 4I48A 4HIHA 3VXSA 2VC2H 1NL0L 4NC2B 1A7PL 4U6XB 1MFAL 1B0RA 2D7OA 5GGTL 1SJEB 3T65B 3MJ9L 3EYSL 2APVA 1P4IL 2Q6WB 1Q1JL 5I19H 4XCNA 4Q97A 4JO4L 3B2UD 4WEBH 4GAYB 3HZMB 1NC4B 4OV6F 1AXTH 5JW4R 1AJ7H 3SKOA 4CRPA 3D25B 5DVMA 5INCB 5JXEC 4LASH 1MIEH 2F19L 2CLRA 5HDBE 2GITA 2JCCE 1UFUA 4FFWD 1HH6A 3QWOB 5C09B 1RJCA 4N0UA 2NX5A 3SDXE 4U7SA 1G7MB 2RGSA 1XF3A 4D3CL 2CJUL 4L1HA 4PREA 5E2WL 1OAUL 2JJSC 1S7SB 2GT9B 3QIWA 4WUUA 3ROLB 4NM8L 1V8HA 3LH2L 4G9FA 3GBLA 4XNMA 1FNAA 3AAZB 3K7UA 4UT9L 2J6EH 4KROB 1T04A 5EDXA 2K9UA 3NPZB 5EOQH 4Q7DA 5DO2D 1OAYL 1OW0A 1HE7A 3O6KH 5KANG 2BNQB 2UYLB 4NN5B 5HDQL 1BFVL 2UWEF 3HE6C 2EYRB 1IEAA 1FL5B 1KPVB 3HUJE 3LQAC 4G6ML 1U41A 5HHMB 5JNYB 1DBAL 4Z0XA 3U9PL 4D9RE 1XGUA 4OM0L 5HD8D 1NLDL 1XF2B 3JWDC 1ES0B 4P46B 4WWID 3DX9A 3RWFB 4LVOB 3RIAF 4DOHE 2JK5A 2GTZB 1FHGA 3GEWB 1JNNH 2DMBA 4ZFGH 2R4RH 4JQIL 4NWUL 2UUDH 3RJDA 5ADPH 2F5BL 5FA3B 4E41D 1S3KH 3C6LD 4NCC2 1JZ7A 2LU4A 4K94L 3V7AG 5HGBB 3DXAB 1AD0A 4E42A 1QHPA 3RWGA 2EE3A 4H1LB 2Y4SA 2EIZA 3NCYS 5HPOA 2V5MA 4HX1B 5EG6C 2BSRA 3QFDB 1KLUB 3QFJE 3N9GL 3UTQA 3NFPA 5I1AB 3EO1A 4G43A 3G5YA 4KK5D 4OAWB 5ISZA 3QNZB 5GIRA 1KYOK 5DJYA 5C3TA 4BYHA 4U05A 4L8SB 2JIXA 4BFIB 2XN9B 3O9WA 5AYUL 3BEWA 1WLHA 2UVEA 1KLGB 4WV1B 3T2OA 2P44B 1IT9L 3QISA 3HAEH 4LNVA 3BFOA 4RGOH 1KIQA 5IB4A 4Q9BA 2R56L 3CVIH 3UJIH 4B50A 1GYAA 1KCVH 3AVEA 4JDZA 3VXPA 1KCSH 3U0WH 2A74B 1DEEA 2AEQH 3KG5A 2ICES 4JREC 4OTXL 4FQXC 4LU5H 1I8LC 5E24E 1Z9MA 4PRPE 3GMNB 5TDOB 1TVBB 1CFNA 3BYYA 3QHZL 3UZVB 4APQC 2DI7A 3GO1H 3HMWL 1YZZA 2EDXA 1P4BL 4WFFD 3VWJC 4PB0H 1IAMA 3S6CA 1E6JH 2ZUVA 2YPVL 3CDGA 3VD3A 2XQYG 5IB1B 5E1HB 1TTFA 2GJ6D 3PGCA 5ESQB 3UAJC 2XTLA 3C8HA 1N7MH 5HY9A 3EYVA 4Q0XL 1FL6A 2IADB 4FP8H 3QUKA 2VDPH 4PRHB 2YPLA 4MD4A 1ZLVK 2R2EB 1KPRA 3BE1H 2WMPA 2LTQC 4P2RD 3MGTB 5IESH 5DHYB 4PGCB 5IFJA 3VD7A 3P4OB 4FZEL 1X7QA 1TJIL 1UG9A 4ONFL 1R6VA 2VWEC 1GGCL 1EFXD 4Y19A 3U83A 5DQ9B 3MCLH 5GGUA 3CCHA 3TN0D 1FRGL 4HGWB 4HGMA 1D6EB 4JRXB 4L4VA 5JPNA 3V4UH 1I1CA 4DZ8B 1IM9D 3ARFA 3QPQC 5FCUL 4ZSOA 2H32B 2Q8AH 3VI4E 4W4OC 3MLSL 5EPMB 4DGIH 4XCYA 1KJVB 1LNUB 4UV4H 3VH8B 4XMKL 1UWGL 3BOVA 4UV7H 3KS0J 2D31A 1BEYH 1KELH 5CGYD 3ROOB 2P8LA 3STZA 4ISVA 3B9EA 2FSEA 2X44D 2KPNA 2VERN 2AJUH 4OCMC 3IFOA 5ENWA 4XPTH 1NGYA 5C0DA 1X9QA 5HGDB 1A6AA 1AQKH 3EYQD 4XPAH 1DUYB 4GRWB 4EI6A 1MVUB 1S7RB 4JQXA 2HTLD 4OLUL 1WQVT 3L3HA 2F5AH 3SDAD 5HHXH 2X4OB 4GKNA 4L4TB 3BHBA 3NCFB 1SM3H 3AS3A 1L4IA 3OG6B 1CD8A 2X4QB 4LLAA 4YDLB 2AERT 4QRTB 5E2UL 1UB5B 3UBXA 4TTDC 3EGSA 5GS0H 3I75A 5I73B 1QSFB 1VKXB 4JQVC 2LABA 3GKWL 4LPXA 2VQUA 3WHXB 4ELMA 1N59A 2Z31C 4PRIA 5D1XC 4MB3A 3IKKA 4MNHB 3DNKA 1HHIB 3I6KB 4X6DB 3V5DA 5MEND 4UT6H 3KJ4C 3T77A 1II4E 4YNYA 4G8EA 1D5XB 1K8DB 2XWTA 4OI8A 3L5JA 3G9VA 4XVUD 5B22A 3ILQC 3QULB 4JO2H 3VFUA 1B3JA 5HDBF 3ULVE 2JCCF 1YPZB 2Q8BL 5E2VL 1GIGH 3LEYH 4QHLA 4JPIA 4O5LL 3SDXF 5HHVH 1FAKT 1AHWC 4OLWL 2CKBB 1D5BA 2ZCHH 4MDJA 5C9JB 1OGTA 4EI5B 3BZ4B 5I1LB 3HI1A 3T0XA 4J4PC 4LP5A 4GG6E 1ZT7B 5DFTA 2C7UA 1BBDH 4P2CG 4HBCL 3RKPA 5EZLA 4LSRH 4FQCL 4R8WH 3KXFE 4UNTA 3RTQC 4BZ2L 1P5UA 3TYGH 3UYRL 1RQ5A 1ZSDB 4XCCL 5E08H 2W92A 5IT2L 1KCUL 4LCUA 1AKJA 5E0QA 4ODTL 1NCBL 1UWEL 2H8PB 1TTGA 5BO1L 5HVGB 3RKDC 3BJLA 3EJYC 3CH8A 1X5LA 4P23A 1TPXC 3RZCB 5FO7B 3IFPA 3U2SA 5JOFA 1I8KB 1TVDA 4LCWA 3SJVE 1MJUH 2WIIA 5D5MA 1C1EL 1MREL 2VDLH 5IF0A 3PNWA 2ESVE 1MCCA 1UACL 1IBGH 4G6FD 5IHZB 3M17B 4AY0A 1DR9A 2OR9H 3QDGE 4L8DB 2B1HH 2R9HD 3AXLB 3RHWK 2E27H 3BESR 2E9JA 4HZLB 2NY2C 4YHMH 1CICC 3LSOB 4XP1H 4JJHA 2NY0C 4HKXB 1AGCA 1NQBA 1P9MA 5DURB 4NC1E 4XGZB 4FN0A 3JZ7A 3IB4A 2Z8WC 4L5FL 4PJFE 5DMKA 4X80L 5MEQA 1CGTA 3VFRA 3DARA 4JM2D 4YDKL 4JG1L 5E6IC 2RB8A 4P5KA 2EDKA 3VRIB 1NBYB 3MV7B 4PB9H 3GIZH 5EZOL 2V17L 4MA1B 4KQ3H 4YUEH 4Y5YC 2BJML 5BXFA 3I02A 2FYYB 3U46A 4HIIA 4X9GA 5TPWL 3BD5A 4K2UH 3TZVA 3QO1A 2IANB 4ZFZB 3EO0A 2P5WB 1QBAA 1HCVA 1G9NC 3LMJL 4HDIB 5I0DA 3BIAX 3F7RA 4U1LB 4Y0GA 4Z78A 4E0RB 3S35L 3S4SG 1N6QL 5FK9B 1BIIB 5IB3B 1B90A 3E3QC 3GJFK 3K74B 4V1DA 1RHHA 3AC0A 4ZFFB 4ZOCA 2EH8H 3GBMH 3DUSA 1TXKA 2Z8RA 2PYEA 1HSAB 1IILE 4NBZB 5JUEL 3DGGA 1FQ9C 2FEDC 3BPCB 4TUJA 4QRPE 4XWOD 3RDTD 1VB9A 3T2NH 1K9TA 1JTOA 1G7IB 3X14A 1LE5A 4U1SB 3ULVL 4XX1E 3QDMB 4WENB 3QUZB 2VIRA 5GISL 3QCUH 2HFGH 4OJFL 3V4PL 4PLJC 1W0WA 2GEEA 1D6VL 4I18B 5DK0B 5E00A 4F15B 3RGVB 3FFCD 4K3DH 4NN6C 2BNRE 4MA7L 1EFQA 1ZANH 4YHYB 3KPMB 1KEGH 1AR1C 3HC0A 3BGAA 4HMCA 2GFBA 1BLNA 4HHAB 3MA9H 1J1PL 1DE4B 2UWEA 3B8SA 4RAUB 4KXZI 3IKCB 5KOMC 1UXSB 4ZUSA 2X1QA 2RR3A 4F2MA 3NACH 2GTWB 3CMOL 1NMCB 3CAFA 4PS4L 4R7DA 4WI4A 4NHCL 4NQCD 1U92B 1INDL 2FIKB 3WYRA 2F58L 5L2JA 1F3DH 2IPTH 4FFVC 3QCTL 4YXKH 3NH7L 1U3JA 4M1CD 4QHMA 1FSKB 2XQBL 3SDDD 1I8MB 2L7JA 3ARBA 4R26H 1Q9KA 5BW7A 4OCYL 1ULVA 1NC4D 4KK9D 1JF1A 5BRZA 1SQ2N 1DTUA 5F7EH 5EWIH 1J5OH 3ELAT 4XBPB 2R39A 2ZPKH 1KNOA 2J2ZA 4Y4FC 5GZNC 3MV8A 4U0RB 3CX5J 2ADFL 2E7BA 2ZZUT 1P7KB 2BVOA 3IXAB 4NQVA 3LPWA 5DI8B 4KHXL 5JHDE 3WV0A 5KW9H 1C7SA 2OL3L 2XY2A 4ZOBA 1CFTA 2NY7H 1FP5A 5LVEA 1G9EA 4DVRH 2QEJA 4U6HA 1E28A 3Q1SL 1N64H 4UU9A 3LQZA 3BUYB 4KROD 4KVNL 2GK2A 1ZLWH 4FG6C 5TE7L 2GKIA 3H9SB 2DQIH 4D0BB 3EJZD 1SYSB 4MNGB 2BNQD 1S78C 3CH1B 4QRRA 2XRAH 3OX8B 4M02A 4YBLB 5TFSH 4RWYL 3SE9H 5DD0H 1CFVH 3T4AA 1NCWH 4H26B 3CFDA 32C2B 1KJ2H 5C07A 5HHMD 3WUWG 2DRUA 4X6CE 4YK4B 3D39A 3OR6B 1ERNA 2ADIA 1KTKE 1OSPH 3P0YL 4W68A 8FABA 4P46D 2AJZA 5DSCB 1T6VN 1ZHLB 3VGEA 2NXYC 1I85A 2FH8A 1U8HB 5L88H 4PBWD 4LLUA 2X1OA 1K5NA 4IHOA 5F9DC 1ZVSA 3TYFB 4GXVH 5EIVA 2J4WL 5A2KH 4OSUL 4FNLH 5FYLL 3T0EB 3PWJA 3HFMH 4NNPH 1NDMB 1OLZA 3DXAD 3U4BH 5IQ7L 1HWGB 2YA0A 1JV5B 3LAFA 3QCVH 1GGBL 2W9DL 3VXUB 1VACA 2QQKH 1FPTH 1MFCH 2VXVL 4LDLB 5ID0A 5DT1H 4PPTA 4F7CA 2YSSB 1B0GB 1NC2A 3EOAB 2DLGA 1XGQB 3HTLX 4U1HB 3ZKNC 3EJJX 3B9KB 1H5BA 3BN3B 5IROA 1MQ8A 4ZFOL 4WHTA 4PJ8C 1NAMB 4WI3A 4PY7A 3RRQA 3L95A 1NKRA 2YD3A 1OP3K 3CSPA 1RSFA 2H26A 2XN9D 1VGEH 1D5ZA 5INDA 4UMGA 3Q6FB 4KUZH 1LK3L 2FGWH 3B2VH 4ODSH 4ZS6C 1IL1B 2EE6A 3RNQA 4GQ9L 3V6BR 4N90E 3BGMB 1A6TB 4PJFF 2HLFC 5E2WH 2DM2A 3DUHA 3MXWL 3K1KC 1OD7A 2XQYK 1S7TA 1CXKA 2AJSL 2YMXL 5HYJB 1KFAL 2Q7YB 1P84J 1A7RL 4MA3B 5CKAA 1PD6A 3MRRA 1Z5LA 3KPSB 3QPXL 3VD4A 3MRHB 3AREA 3GMMA 1JPSH 1MEXL 2QSCH 3S4SB 3F7VB 4LLDA 3SE8L 4KJQC 4CDGC 3BQUB 2CLVB 1QSEE 1RUAL 1TZIA 2VE6A 3EYFA 3MRCA 4X9BA 3JBG7 4PRAA 4PJHB 5HYSG 3I6GB 5D7IE 1AD9A 5I1EL 4PRHD 1IKNC 3LS5H 4S2SB 3LEVL 3QUXA 1FYTE 1RZ7L 1I1RA 4KC3B 4NSKB 1YECL 3P3YA 5E9DD 2WBJB 1AGEB 3REWA 1GHFH 4OCXL 1T22A 1QRNB 5AUMB 1ACYH 2A73B 2R1WA 1S5IH 5ICZA 1ZGLA 4U1KB 4LLWA 4KMTL 5IMMB 3OPZL 3QUYB 2NW3B 4KQ4H 1U8JB 1OVZA 2JCCA 4TSCL 4F7MB 5K9QG 4MCZA 3UDWA 4JRXD 5AZEL 2IMNA 4U2ZA 2EYTA 3SDXA 3P4MB 5GRJL 3C09B 2VTFA 4CVXB 4JDVA 1RIUL 1JZ2A 4BH7B 5GS2D 2EDHA 4XNQA 1DQTA 2OMNA 1BQLL 3LIZL 1NBVH 2CDFA 4WUKL 4CJ0A 1F02I 4MJIE 5L6YL 3CPLA 4JB9L 5FA4A 1BZ9B 4HBQA 2R0ZL 1HXMA 1JNLL 4WW2C 1DLHB 2XWBB 5TF0A 4HSQA 3U30C 2AJXL 2MKWA 2NTFB 3T1FB 1T7XA 1ADQL 4C57C 4EIZC 1AGBA 3PHQB 3E6HB 5JQ6L 3ZO0A 5IB2A 1VGKA 5IQ9A 4HJ0C 1JNHB 1J8HD 4OZIB 4TQEL 4L4TD 5CD5D 2BVTA 5H2BA 3I6LE 3G5VA 1NSNL 2ZCKH 1EEZA 1D5MB 1E6OH 1G7LB 4HMEA 1F4YH 1QSFD 1BJ8A 1MRDH 1M71B 4I8DA 1X5KA 3OZ9L 5GGSA 3AU1B 5HI3C 3ORJA 4MXWL 1YEKL 1CU4H 1HHGB 2PUQT 2N1KA 3D9AH 2XPGB 3FKUS 4IOIA 4OZ4A 3VJ6A 1FAIL 5F7UA 4ETQB 4DW2H 3QFJA 5C0AE 3PWNA 5HJ3A 1IQDA 5BMFL 5F3BA 5C92A 2J8UE 2DDQH 5SX5K 3ZSSA 3OKYA 3QEGL 2GSGA 5IMOA 1UKQA 2W38A 5FV1L 5I1CH 5CMAA 1V3LA 3EFFA 1CDHA 3SKNA 2OTUB 4JGUA 4M5YL 4LHUA 4KJWC 2DQJH 2XZCH 5E1AA 3TBTA 5I9QB 1I1AC 2WWKO 1FFPA 1Q8MA 4HUXA 4P4RA 3VFWB 1YYLL 2UZIH 3HZKB 4HWBA 3ZZ1A 5I71B 2FD6L 4P2YA 4F80A 3I3BA 2EYSA 4IMKA 3BH8B 1MNUH 1W8OA 4DVBB 4PRPA 1WZKA 4JFHE 4X6CF 2OTWA 5TF1H 3C5JA 1I1FB 4M6MH 3IAPA 3QIUB 3RZCD 2D2OA 5H37H 4N8CH 4AM0A 3A6CL 3EO9L 3BYTA 3BD3A 4RGNB 3S3PA 4O2CA 3TJHD 1YEFH 6FABH 4NZTL 5E94A 1NEZA 1UZ8A 2DIAA 5ERWA 3PL6A 2D0HA 1BQHA 2ADGA 3ARDA 4GW5A 5E6ZA 3BAEL 5SX4H 4FFYL 5K9OB 4GW4B 1YUHA 3RWIB 4HG4J 1N6VA 3RY6C 1D9KB 5E95B 3EFDH 3KDMA 1YC7A 1RFDH 3L3JA 2XXMB 2VDQL 5F3HA 5DURD 3QDJB 4JFDB 5F9WB 15C8L 1MI5D 2OM5A 3SCMC 1GC1H 5LBSL 2Y5TB 2ZSVA 4XNUL 3D2UB 4TULL 2PO6B 5DJDB 4G9DB 5IJVA 3O0RH 3MV7D 1ZGLP 5DZOA 5GGVY 5F7MC 5ILTL 3K8MA 5GRUH 4M1GH 1JF6A 4X6EB 4MA8H 4QEGA 3N50A 5F6HJ 5BOPA 4Z76A 1F90H 1LEIA 3D5OF 1EGJL 4XC1L 4ZD3H 3WLBA 2IAND 2VLJB 2D0FA 4HUMB 1IAOA 4YWGH 4NNYB 2P5WD 4M93B 3HNTH 5DUBA 5T33H 3J8F7 1B4JL 1AGDB 1NANI 3EYUL 4ZAKD 3MJGX 1MY7A 2G5BA 5LCVL 1NCCL 3VFPB 1SEBB 4JY6B 3CC5A 2EC9T 5HYSB 2XZQL 4WY7H 2XTJE 5GJSL 4P5MB 2OBGA 3P9LA 5IT2H 1MQKL 1EVUA 2YUXA 3IS1X 1KBGL 2VYRE 3EDJA 2R0WH 4HKBA 4JFQA 4PG2C 5T5FL 3IGAB 4WFHD 5KN5B 4J1UB 2OR8A 5IK3A 4LSSH 3QUMB 5D7IF 3NABL 3QDMD 1RJYA 3N06B 1MFDL 3QUZD 4ZOEA 1J8KA 2ICCA 1BD2E 1T0MA 1YY8B 1CCZA 1GH7A 1F58H 5KSUA 3WJLA 4GG8A 5FYJU 4Y2DC 3O3UN 4EDWL 2E7HA 3RGVD 3QHTC 2CKBL 2E9IA 3VFSB 3M07A 3JTTB 4PGJA 2DLTA 4ZNEA 4G8GE 3KYOA 2NLJA 1ZT4A 1E27A 3GMOA 2RFXA 3M8OL 4KMLB 4WI2A 3O4OC 2MWCA 4RIRB 1FO0B 2NY4C 4BQ9A 2Y06L 2DQDH 5EORH 4JZOB 2P1YA 3TNNB 1OGAB 4LAQH 2OZ4L 4KKNA 1KTLA 5TE6L 3HNVL 4NFBA 4AG4H 4QHNA 4GAGL 1A1OA 2X10A 4PR5B 2I26N 4OGXH 3IYLW 4KK8D 2VLRB 4CVZB 4X5LA 3OKEB 3G08A 1V3JA 2HH0H 4HH9B 1M7DB 4LLMA 5B8CA 1RZJC 5I6XC 4G8FA 1AQDB 2H2PC 3JV4B 3NFNA 2OK0H 5SWZE 4JFXA 1LK2A 5T1MB 1W0VB 2ARWA 2KQNA 1KB5A 3PV6B 5CP3A 1CTOA 1YEGL 3CX2A 4IDJL 2HJLB 2VAJA 4OFDA 3VMOA 4XBEL 1NLBH 4UINL 3SJVA 3H0TB 5B21A 4XPHL 4LVNC 1RUKH 4PYGA 4LSPL 5EC2A 3AB0C 2ESVA 5E4IA 3NCMA 3O3AB 5IFHL 1H15B 1K4CA 4ERSL 4LVEA 5JA8B 4JKPL 3QDGA 4LCIL 4QT5B 1IARB 4A2MA 3PXJA 4KKAD 5CWSB 2GY7B 1F8TL 2IGFL 4N9GB 5D71H 1A7NL 4U3CA 1FGNH 4NQXA 5I8EA 3H3PL 1WC7B 3IFNH 3PWPE 5CUSH 4XTRD 1BWMA 1NFDB 1RK0B 4UT7H 5SWQB 3F12A 3VFVA 4M7LL 3H9SD 2UVFA 2VQ1A 4PJFA 1OPGH 5IW1B 3U7AA 1VADB 2NYYC 5FF6A 2J8UF 4Y5VA 3TC9A 3UX9B 3QWRA 3GSWB 3C2SA 4KKBC 3RVXD 3QDAA 4OZFH 1IAKA 4YHZH 1YN7B 3CVHB 2J6EA 4GW1B 4YFLF 4HJJH 4LPCA 4QRQA 2NY5L 2DQUL 4Z7WB 1LEKB 3DV6B 2AEPL 1ORQA 3MRFB 4Y88A 3MRKB 4S1SL 1NGXB 3UROR 2AJYL 5F1IA 3S34H 1MY5A 4I9WE 1PY4A 3HE6B 1MF2L 3IJYA 3T0ED 2YXFA 4LGPB 2FJHB 4JPKH 1V7MH 3TPUA 5BW7C 4BSWB 1WITA 2G9HA 4NKMA 2WLZA 3VXUD 3H3BC 3MZTA 4AH2A 5DD5H 3CFEA 4BQ8A 2DL9A 5ABDE 1FORL 2HJFB 4XXCA 5HGAB 2IH1A 1CXEA 5FECB 1YNKL 4X8JA 1MIMH 2ZG2A 4UI2A 4WCYL 1K2DB 5D7JD 3HNSH 4LKXB 1VSCA 3E2HC 3QH3A 4MAUL 2B5IC 5J06A 5EZIL 3MR9B 3L3OB 3ZKMD 4XAWH 4HUWB 3T0WA 4N0FA 4A6YH 5IW6A 4LSVL 2AV1B 1KEMH 5HHNB 3FTGB 2GAZA 1C5BL 1TETL 3MLUH 3VD9A 3MNWA 3MLTB 4PV8B 2NZ9C 5CINL 4RDQG 2IH3A 4PGDA 2OYPA 5CSZA 1JGEA 4MD0B 4JDTH 3FO0H 3U48A 1A3RH 3IJSB 4OGYL 4DGYH 5HYJD 1CLYL 3KPRB 4TOYH 4MD5B 5EUKA 2UY7A 1E4KA 3IXTA 5FDWB 1GVIA 2ICWI 3KPSD 3HAEA 2HMIC 5C0BE 4LKCA 4AMKH 4F7EA 4LOUD 2P24A 1YEJL 3TPKA 1BBJB 4MXQD 1D7FA 1NCUA 4LRIC 2NW2A 3C5ZC 5DC9B 3FB7A 3OKNA 5D4QA 1M05A 3MACL 5F9JB 1T7WA 3CXHK 4JREB 3HS0A 3QXWA 1DQLH 4TNVF 4FQXB 3GHEL 1QNZL 1R3LB 1IKFL 1MWAL 4GRLA 2YBRA 3TBWA 4APQB 2V5TA 1YQ2A 4PJ5B 1OF2A 1C08A 3VWJB 1U8LA 3GDBA 1MFEH 3V8OA 1DUZA 35C8H 1JHKL 2EEDA 4ZQKB 3IDNB 1K8IA 3QEHA 4E41E 3QUYD 4PJDE 4K8RH 5LJYH 5KTEL 2BFVH 3R0NA 3LKOA 4D8PB 1DLFL 1FN4B 2WUCL 2VXUH 2JB6A 2F53A 3GMQB 5JHDA 2VZVA 1J05A 4R90L 1ZLVH 4R96B 2LTQB 2FWOB 3P73B 4UNVA 4NWTH 4HV8B 4L9LC 2HKFL 4F7PA 3KPNA 1U8QB 1EVTC 4D9LL 3P0GB 1FCCA 1TNNA 1H3XA 1N0XL 1ZTXH 2I07B 2W9EH 1WFUA 4H25A 5A16A 4NQUA 2Y36H 3BDYL 3RI5K 3DMMC 4LQFH 2AV7A 2EDJA 1FZJA 4LIQL 3TBVB 4AEIL 2YZ1A 2VO5A 5HI5D 1FNEA 3L7FB 1A1NA 1LO3H 2ATPA 3IDYC 1LK3H 2DQGL 2AQ2A 3Q0HA 2OX5A 5C2BL 4I0PA 3RVVD 1V5JA 2HLAA 4X6CA 2RCSH 1Q38A 3Q3GA 1CS6A 4M48H 4NDMA 3RL2B 1MCDA 2J5LC 1WWAX 4RISH 3IU3A 4C56B 3ILPA 3L3IA 1A3QA 2YHGA 4ZODA 5DJXA 1AIFA 1U95A 1ZE3C 3RWJA 3RPIB 1IGTB 2A6KA 5GGSY 5T1LB 2WSKA 3UJTL 3AY4A 4NO0B 4ODXA 2G75A 1DL7L 4YAQA 1JUFB 1YNLH 1U8KA 2BOCA 2EDFA 4PJBE 5IVZB 5JHLH 4HK3N 1QBLL 4M1DL 3FQWA 3ARGD 1I7UA 3BSZH 3B2UC 2YA1A 1S9XA 5CILH 5L7XH 1NAML 4RFEA 2Y9RT 1KV3A 4EN3A 5EU6E 5C08B 3HB3D 4EEEA 4I3SH 5MP6L 1U8NA 3H9ZA 4K3JH 1PG7H 2CKNA 3WXVL 1IGML 1JPGB 2WINA 5H94A 2CDGB 4DFHA 1ZHNB 5CS7A 5F1NB 1QTYT 4NKIH 4M7LT 4DCQA 4Y4KA 3H9HA 2EE2A 5B38G 2Z31B 3PV7A 4NQDE 5D1XB 3IU4H 5FYKU 1RVFH 2DWEB 1MHPH 1TZHB 2X4UA 25C8H 4R7NA 4RNRA 3KJ4B 4HF5H 3LQMA 3U1SH 4ODHH 3M45A 5B4MD 2K1MA 1HWHB 4OUOA 2WIMA 3T4YB 3WFBL 2O26U 5BQ7B 1PSKL 4OM1L 1A6ZA 3F7PC 1TFHA 1RZ8A 1QP1A 4FQQB 1RIUH 4M6OH 2DIBA 1AHWB 1R3HB 1BZQK 2MKLC 4IRJA 1GXEA 1D5IH 1CF8H 3DRTB 5DLML 3OQ3B 3QIUD 4YDIH 5KVFH 1BF2A 4QF1B 2VOTA 2YN5A 1KXTB 2WNGA 2ZSWA 1CZ8H 3M1BA 4PP1D 4OCSL 3V52H 2WUBL 3BMVA 3KPLB 3IVKB 2FIRT 1S9WA 1LGVA 4RGND 1QR1A 2DM4A 1GOHA 3RTQB 1QSEA 4YBQC 1L9NA 4OB5H 3SE4A 5CCKL 3QXDB 2BC4A 4U6YB 3QQ3A 1YEIH 4Z8FL 5D7IA 4BZYA 1OARH 3ZTNH 3WFHA 5GRVK 1HHKB 1FDLL 3O2DL 2HFEA 3V9FA 1FYTA 4GH7B 3DSFL 1WIUA 1D9KD 2UZXB 1TPXB 1E4WH 1QBMH 2YN3A 3WBDA 43C9B 1MCBA 1R3IL 1HKFA 2QR0A 3BJ91 3QDJD 1F4XH 1OHQA 4JFDD 1WUNT 1QG3A 4LVHC 2APTA 2PCPA 5E8OA 2BRRL 3CFIC 5F88A 4LF3B 4OV5B 2DMCA 3NCYP 1P7QB 3D2UD 1N5YL 1KN4H 4NO5A 1OQXA 2FB4L 2PO6D 4XBGB 1RJLA 3LKSA 5T1DH 3I2CL 3OR7A 4WFGE 5FIEA 2NY2B 2ZJSH 5J6GA 1DCLA 1CICB 3LN5B 5A2IH 1NGWB 1C16B 2NY0B 3VG0H 4KK6D 5CEZD 3MCKA 2IQAB 4BK4A 3OKOB 1K4DB 2VLJD 5T1KB 3QEGH 4TUOA 4XPFL 3KYAA 5DQDL 1CD9B 1VFBA 1G1YA 3SKJH 4J8RA 3MBEA 4MJIA 2GCYA 1HH9A 1JPST 3ARYA 4O02L 3K8LA 5E6IB 4U6TA 1INQB 5D6DA 4FQHB 5I1GL 1TVHA 1S9KC 4XP9H 4Y1AE 4XXDB 1A21A 4EUPG 4Y7MA 4Y5YB 2XI9A 1BOGB 5CIPH 4G6KH 4YGVB 1EPFA 3RL1B 4Z5RA 4KZDH 1JJUA 2VZ3A 3VDCA 2DLFL 4LPUA 1P1ZA 3BP5A 3DJ9A 4L3CA 1KT2A 4MQTB 3C08L 4HPOL 1JRHI 5CP7B 3STLB 4X4YB 5EU5A 2DQTH 2CRZA 1MCPH 1CGUA 1KIPA 4OIBA 1HQ4A 3T0BA 5EOCH 4O4YH 3ZTJH 1XGPB 2BCKA 1CDUA 3GJFH 1MJ7H 1HCFX 4RBPK 4XNXH 3T2QA 1FC2D 5J4MA 3W0WD 1KIRA 3E1F1 2NR6D 3S5LG 4YE4H 1QFWH 3K1DA 1G7HA 4QRSB 1MPAL 3FOMB 4PJDF 3SO3B 3T0AA 4RMRA 5C0AA 1V7NH 3KLHC 3TN0C 4XZUB 1U6AL 2J8UA 1JF5A 4PJ7B 3FMGH 3FN0H 4S1RL 4JY5L 4MNQE 4XPGH 3DX7B 1A1MA 2H32H 3VXMD 3B5HA 4JKMA 1WFTA 4LEOB 3U6RA 1S7QA 5GS2H 5C0FB 5I18L 1HXYB 1T4KA 1QLFB 1U91B 2IG2L 2FECL 4NN6B 3BVNB 3MRJA 4QXGH 2HVKA 3QJFB 5EOTA 4PJ9A 4FXGB 2VDOL 3DECA 1V05A 4H8WC 1NCAH 2J88H 1XF1A 1AP2A 1ROWA 3RZWA 4DN4H 2QHRH 3EYQC 4ZXBA 2G2RB 2HG5A 4JPVH 2HTLC 5L2KE 1SHMA 3MUJA 4I77L 3ME0A 4QRUB 5TQ2H 1LMKA 4M00A 3REVB 4RFOH 3MNZB 4NO2B 1LQSR 3DHMA 1U8MB 3L1OH 3WJLC 1IVLA 4HAFA 5C6WH 12E8H 5M7QA 2BY3A 3QZWA 3SEPA 4ZYKA 3FHQA 5I8OH 1A5FH 3QIBA 3DYPA 3BPOC 2JJUA 2I9LB 3V0VA 4GMSH 3OAZK 3B6SB 3ULVC 3VXOA 5DEFA 1Q72H 1U3YA 4MHHI 2B4CL 1N3NB 4Y4FB 1Y0LB 4TNWK 3O41B 3FHAA 4F37K 3PABA 1IE5A 1HNFA 5CEZL 1EHAA 1FG2B 4JN2B 5FGSA 1BFOB 3FB8B 4M5ZH 1I8IB 1XIWC 1LE9B 1YEDB 1JYWA 4J23A 5I76B 4P2QB 2HRPL 1PQZA 2YWYA 4CKVX 1RI8A 3L6FA 4YHIA 3W2DH 2PXYA 4Z7QE 2MHAA 4LNRA 2VLKB 3CFJA 2J7LA 3ALWA 1QKZL 5FGBC 3HZVB 4WW1A 4MCYA 4X7FC 3WIHL 3HE6D 1KJ2A 5FHBL 2P7TB 1AI1L 5EBWA 4NM4L 3MLRL 3O6FA 2DQHL 3KPOA 1FFRA 2PYFA 3FN3A 4I5BB 4JANB 2AK4B 2C26A 2DBLH 2FATH 2DQFB 4Z7UE 1NCTA 4KKLC 4OQ1A 2W65A 1QFUL 3ULSA 2FX9L 2NXYB 4HEME 4YHOH 4JHWL 3MJ6A 1EEYA 3D69B 1RZKL 1MAML 3ALPA 3WNPA 1WTLA 2R9HC 4KUCD 1JTPA 3TLRA 4DKEL 1BD2A 3L3DB 3UBXG 3SKOB 1FO0L 2BVPA 2Y25A 3DVGA 4MYWB 1ACZA 2CLRB 2DMKA 5K9KB 1HH6B 2V7NA 5C09E 1Q9WA 1WGOA 1XF3B 5GGQH 5IP4A 1S9VB 2VISA 4JM2C 3KPPB 4LMQE 4QHKJ 3MO1A 2D0GA 3RJQB 4X7SH 5CD3A 3TNMA 1EJ6A 2OMBA 4PJ8B 3GM8A 4KRLB 1OTUC 5J8OA 1QQDA 2V2WB 1PGRB 5C0EA 4OCLC 3VXTB 4ALAH 1FFNB 1FNSL 2Q20A 1A7BA 4OLXL 1A3LL 1RZGA 4EUPB 2HJKA 4XMLH 3WHE0 4OBRA 3ZDXE 4RX4D 3WIFB 4NHUA 3HN3A 2X6MA 2IBZX 1CFBA 2BNUA 3QEUB 3L7EA 1XGUB 4DEPC 4DWHA 1J87A 5DHVH 4QXTA 4APQD 4PJ5D 2QSTA 3O3EB 1J1OL 2ENYA 3DX9B 3Q5YA 2IPUG 3C6SB 4PGZA 4HK3J 4S0TD 3VMNA 3VWJD 3QI9C 2PR4L 5DD1H 4YDVB 3W9DB 4WJ5A 2Y07H 3MNVA 1QPXA 1IM3B 4YHNA 3RY5A 3RDTC 5KJRH 3UAJD 2Y7QA 1CBVH 5AZ2H 3TIDA 5DWUH 3S5LB 1AD0B 3HR6A 4RGMC 4E42B 5KVDH 2R2HA 1IGIH 3HPJB 4KJYB 1FVCA 3MZGB 2O61A 1KCKA 4HFWA 2I60L 4R9HA 5IFAL 3PWPA 3BXNB 2XNAA 3GSVA 4HUUA 3TO4A 3G5YB 2NNAA 1QLEL 3CVHL 4M8QA 5ESVA 5GIRB 4I3GA 3MSPA 1FL3A 1G7JA 4JRYE 4CADA 5BJTA 1NBZA 1Z0NA 1E4KC 1HI6A 3WSQL 1AE6H 1D3CA 4AEEA 1NMAH 2ICEB 2PTTA 3QPQD 1EV2E 3O81A 4Y2OA 2QL1A 3O6LH 3EOBB 4JO3L 4F9PA 3UPCA 1CGSH 4R0LA 5IB4B 1SBBA 1T1XB 2V7HB 2C3VB 4GKSA 3RUGB 1N5AA 3Q5TA 3LQAL 2VJXA 4C56D 3C60C 4CN1A 3H7BA 4XB7A 2ZCLL 1ZXQA 4GAJH 1FNGA 1T7VA 5BVJB 5C0CB 4Q9QH 1MJ8H 4ZTPL 4GBXA 1WK0A 3E8UH 4OLVH 3O2VH 1MFBH 1L6ZA 4S1QL 5T1LD 2IPKA 1PLGL 4WW2B 4NO0D 4UDUB 3U30B 1BAFH 2B0SL 1P2CA 5KSBB 3UTPE 2AKRA 1XEDA 3SDDC 1YNTA 4IRSA 4ZO6A 2X70B 1OSZB 5DUPH 1RJZB 1UJ3C 3G6AB 3P40A 4UTBH 5TE4L 4KK9C 1KG0A 4M62H 2ILLA 5C08D 4F7TA 4JGJA 4M03A 1FJ1B 5C0IA 1T2JA 5I1KL 2E8YA 1A9BA 5JDSA 4TTDD 3U0TA 3S37L 3D0LA 3RAJH 1S7XB 3SGKC 5CLWA 1TJGL 4OZHE 4XVSH 5FO8A 3ULUE 2O5ZH 2AJ3A 1JHKH 3V79C 1Q94A 4X98A 2Z31D 5D1XD 3JUYA 4Z0BH 1X7QB 2VAAA 3HMXH 5C0RH 3P11L 2JB5H 3N1MC 1BZ7B 3R0MA 2ENSA 3CCHB 4IOFC 3ARUA 4TRPL 4DN3L 3KYNB 4KDTA 1BVLA 3ZT5A 5I1JH 2A6DB 5L9DL 5KVGL 3WS3A 4I13B 3ZYJA 2B2XL 1SYVB 2IC2A 4RWHA 4F9LA 5D2NE 3WD5L 1F42A 3NTCH 4WDIA 2ZG1A 3D48R 5JIIA 4WI5A 1PG7X 2DAVA 2FBJL 3DO7B 1NMBL 3PJSA 3KAAA 3MUY1 4YXLL 4J4PD 3MRQB 3VWKA 1X5IA 1WVZA 1QA9A 1Q0YH 1E4JA 3BP6A 5DJ2B 5HHOB 4KJPD 1I1AB 4DGVH 2B1AH 4KY1L 4U1JB 1GGIH 4ONGL 1NUNB 2A6JA 1DZBA 3G5ZB 2O5YH 4BK5A 3B4NA 2YXMA 1DJSA 1J10A 3LCYA 4EI6B 1A7QH 3S96A 5D1QC 5F7WC 2NY6B 2V2XA 2VSDA 3MBXL 3EJYD 2XKNA 1JHLH 2J8OA 3GRWL 2OSLA 4Z7UF 5JXAL 3BHBB 1OTSC 1QUNA 5I15L 2FX8L 2K3TA 5GS0C 3RWHA 5FB8A 4X99A 1OAKH 1RD6A 4E41A 1QSFE 2DYPA 1DDHB 4PJDA 2IQ9L 3QB7C 3C6LA 4ELMB 1P7QD 1N59B 3E6FA 1CD1A 5TH2A 1HILA 1U8IB 4HKJA 1Y6KR 4M7ZB 4PRDB 5B39A 1LEGA 1T2QL 2NY2D 2X4TB 1ZHBA 3DSNA 1CICD 1KOAA 5DQJA 2AQ1A 3U4EA 4JLRA 5DJZB 3VRLE 1CK0H 2NY0D 4JG0L 1YPZE 4WV1C 3CU7A 3SBWC 5K9JL 5T1KD 3FB5A 3SCMB 5DJ8B 2X4RA 2FO4A 2R1YA 1WT5C 4L3EB 4PGEB 4NRYA 5DMIH 4C4KT 1T89C 5I8CA 3RFZC 2H45A 5D7LB 5E8DH 2C7UB 1JZ6A 2X89D 5I8KH 2MQCA 1CDJA 3HI5H 4ZUTA 3O8XC 2CIKB 4JO1L 1BMGA 4WO4D 3GI8H 4OQTH 2BMKB 4U1IA 4LP4A 3RVUC 3V4VH 3ZDXF 3GB7A 2HT4D 1ZT1B 4X7TB 2X4PB 4Y8DC 2AXGB 4FQ2L 3J7HA 4OGZA 2DQCL 1SY6H 2V5RA 4ZS7L 1S7WB 5LGJA 3TBYB 3U2SB 5JOFB 4OLYH 4KKCD 3P77B 5EZJA 4KTYA 1KN2L 5D5MB 3V7AE 1NCDH 4YJZL 1IC5H 1P84K 2VUYA 1T21B 5T3XD 1WBZA 2AABL 1JZ8A 2GW5A 5EU6A 1G6RB 1MHHB 1UM4L 1A7OL 3KLAA 1R5VA 3C9NB 5EFIA 5DFWH 5CZVH 4LSTL 4MVBD 4PJXB 1WZ1H 1NEUA 1JVKA 4I2XA 3D0VA 4LLVA 3O4LE 4P2RA 3VXRE 5GJTL 2CUMA 4KTEL 3U0PB 4G8IA 1T5WA 1FGVL 2H3NB 1XR8B 3DUUA 4H0GA 2HVJA 2X4NA 4I0CC 4NQDA 4AL8H 1KCRL 2DN7A 1QVOA 4Y2DB 4P49A 3PDOB 2Q3AA 3NZHL 2YK1H 4L8BA 1OY3B 3K2MC 1VFUA 4ZUVB 5LAXA 1KGCD 4HIEA 5D6DC 3JV6A 2HN7B 1Q9OB 1AR1D 4P5KB 4WU7A 3RHWF 3O4OB 4FQIL 4A2LA 3BT2H 1IM9A 2NY4B 5DGQA 3SGJC 4DKDC 4O51A 2GUOA 1A14L 1OCWH 4FA8A 3TCLA 1UEYA 2X40A 4UB0L 4TYUA 3MJ7B 1PX4A 3MRIB 4JJ5A 4F58L 1ONQA 4PJCB 4DFIA 3T8XA 1MLBA 3CZJA 4E5XA 2QQNH 3HRZA 3VGGA 3ZLQC 1T3FA 3GNML 2BSTA 1DANU 5I6XB 4ONHB 1EAPA 1XZ0B 2ZUQC 4G7VL 1S5HA 2A77L 2ZNWA 2CLZB 4JEGB 1DBJL 5F89A 3LN4A 2VXSL 3UTZA 3K2UL 1EBAA 5LXGL 4OD2B 3SDAA 1R5IA 5HI4C 4X5XA 1K3ZA 2W0FA 4WHYH 5ALBH 4LVNB 3VFMA 3X14B 2H1PH 5F97E 1MAKA 4LLYB 3AB0B 2OQJB 5H35A 4Y4FD 5GZND 1UQSB 1A4KB 2XA8H 1INEL 5C0JB 1JZ4A 2GI7A 1DBML 1AO7B 2GSIA 1IC4H 1XCQB 4P0DA 1MCOL 2JJTC 1F3DJ 4HT1H 5E00B 1WWCA 1KENH 5CJXA 3GIVB 2VUOA 4PRBB 1QO3B 1Q9LA 4NGHL 2ZKHL 4P2QD 3KYKL 4LCCA 3LRSB 5ECJE 2Z35A 3LOWA 4PJ9C 3HE7A 2GFBB 1X6LA 2J3SA 5EIIA 5DRWA 4JGMA 2Z8SA 1S78D 4YFLI 4AEFA 4KMQA 1L9MA 5MERB 4OZFA 4DKAA 2D7TH 1XH3B 1VENA 1NDGA 1A9EB 2CXGA 4Y1AA 2VABB 1NGQH 4X7DC 1IFHL 4PJEE 4Y4HA 2YPKB 5GRZA 1FYHB 5AD0A 2B20A 1ZS8A 2AK4D 4Q9RH 4R7DB 4NPYA 1I7TA 3THMH 3QRGH 2XFXA 3OKLB 3GSNL 5FM5M 5FUOL 3MRLA 3A6BL 1WIOA 3CUPA 2CR3A 2DTSA 3FT3A 2NXYD 5ACLA 5FKAB 5T3XL 1LO4H 5E8NB 3U36A 4LPTA 1EJOH 2M26A 4Y5XA 3VXSE 4GLRH 4JE4B 3OAUH 3QIBC 2P5EB 1JF1B 3H42L 4FXKA 1MCWW 4QLRA 5DDHA 4I77H 5DUML 4EIGB 1EXUA 3MV8B 5F7DA 2BVQA 2DM3A 2G60L 1FNLA 2XIDA 3P0VL 4RMVA 5FYKH 4V2BA 2BVOB 3BZFB 4Z18A 5CJOL 3T2PA 1HIML 3JUZA 1CE1L 2YD4A 1KF9B 1HHJA 1TITA 3MUHL 2CPCA 1YYMH 2DIJA 1CDYA 3E2HB 5IW3A 4N0UE 4X6DF 2Z91B 2B5IB 4ZTOH 4PJ8D 1YQVH 4A6YA 5T3ZE 4G9FD 1I3GH 1SEQH 2IBBA 1FIGH 3DGCR 2YUWA 4K7FA 4MA1C 3VRLF 2PXYC 2Z4QA 4X0KB 4HG4K 4MNGE 1GAFH 1YPZF 2ARJA 1RAMA 1EMTH 5KS9E 2IPUK 2V5SA 2ICWB 4FABL 4QRRB 2HLFD 3MA7A 2Q1EA 2E6PA 1XF4B 2X1PA 2ORBL 2GJZA 5JO5B 2XACC 1WBXB 4ZAKC 2ZOLA 2NY5C 2EKJA 8FABB 1G9MH 1T1YB 1GOGA 3UTSE 3D18B 4LLUB 5F8QC 4DQOL 1RZIA 1ZVSB 3C5ZB 3T0EE 3WKMH 1LVEA 3GHBH 3QUMH 3SQOL 5I17A 2IFFH 1IAIH 1S9YB 4B53A 2YD8A 4CMHC 3V95A 4TVPH 2VLME 2WAHA 4O9HH 3OXSA 2VB5A 5ID0B 2BDNH 3NAAH 1NC2B 3NBNA 4N8PA 1TIUA 3Q6GH 1G1CA 3DURA 3ARRA 3LKRA 4NJ9H 4P99A 3QBTB 4F57L 1N8ZB 2I27N 1NUGA 3ARPA 3V2AR 4FTVE 1NCNA 4HKZB 1RIHL 3ZYIA 3BP4B 4HJGB 2MQ0A 1F11B 2CO6B 3MMEA 3UTTB 5HHPA 1NFIA 1N26A 2VN4A 5F7NC 1VFAB 5ISZE 3ARQA 1BVKA 5INDB 1D5ZB 1N2RB 5IIEB 3GUTB 4KTDL 4Q6IC 3FFCA 5I30H 3RNQB 3I9GL 4L9LB 3CXDH 3NA9L 5KBNC 2VDML 4PJIE 5KZCB 4MZ3A 5KAQG 2SEBB 1J0KA 1DN2A 2H6PB 2R2BB 4KGJA 3R4DA 4EDXA 1UC6A 1CL7L 1G0XA 3HI6L 3C8DA 5C0CD 1ZGLM 3WS6A 4NFDA 2OXGA 3DMMB 1MH5B 3KR3H 3HR5B 4HCRL 4PD4J 1QPPA 1VFOA 4JCLA 3GBNL 1IGCL 4P2OC 4HLZH 3IDYB 3QNXA 5DJ6B 3AREB 1SMAA 3BH9B 3AGVA 1UYWL 2WM0A 4XI5D 1E4XL 4Z7UA 4NQCA 4G42A 3LHPL 4HJ0D 5FYJL 1F4AA 1LP9B 3EYFB 1PYWB 4PRAB 3TGXA 1X5FA 3OB8A 1N4XL 3VXQB 1AD9B 4U6XA 1EUTA 3K0WA 4JZJC 1SJEA 3T65A 1DSFH 2V2TB 2Q6WA 3TP4A 3WNNA 5LWYH 3SOBH 5TQ0H 4BSVB 4KKAC 2XWJB 4GAYA 4DTGH 3HZMA 3W9EB 1OM3L 2JJWA 5T3ZL 3IDUA 3TH3T 1QRNE 1GL4B 5CGMA 4OFIA 2R1WB 5ICZB 1ZGLB 5HI3D 3D25A 5INCA 5GHWL 4Y19D 4CW1B 2FX7H 3C8KB 4MHHG 3PUCA 5LQBH 3V0WH 4HUVB 4MCZB 1CG9B 4L4VD 5C09A 2VQTA 3NIFE 2EYTB 3C87A 3SDXB 1G7MA 4O58L 5KVEH 1I3VA 3EDEA 1S7SA 2P4AB 2GT9A 3ROLA 1A6WL 1Z9OA 4BM7A 1JGVH 1OQOA 4JZNA 3RVXC 4YIQB 3D85B 4K7PH 2Y23A 4XNQB 2BHZA 5DTFB 4BQCA 4KJWD 5ALCH 3MLYL 2BNQA 3MRGB 4QKXB 3X3FH 2BSSA 5I1HL 1HXMB 3QG7L 5HHOD 2EYRA 4KRPC 1TQCC 1I1AD 1KPVA 2YRPA 3HUJB 1F00I 3IDXL 4TSAH 2E7LA 4UOJA 4NZRL 5JNYA 1CVSC 5I1IL 1TZGH 1XGTB 4ODBD 5I16B 1JYVA 4RZCB 4PJEF 5ANMB 2NY6D 1ES0A 1JPTH 4P46A 3RWFA 3UO1H 4OZIE 5D72L 3CZFA 3BP7A 1G7QB 2GTZA 3JWDH 6CGTA 2DTMH 4JFFE 3CNKA 4CGTA 2YD1A 5FA3A 1I9RH 4JFZL 5IMKB 8CGTA 2OP4L 3U4AA 4DJMA 4PG9B 4XNYL 5FHAL 5HGBA 3DXAA 5D7JC 5AAMA 1QSZA 3BKCH 1DEDA 4RRPA 3WN5C 4QY8B 4CNIB 4G7YL 4PRIE 4FQJL 4QTIL 3BPLC 4HX1A 4OZ4B 3VJ6B 3WL9B 5JIPA 3QFDA 2HTKC 3S3JA 3FFDB 1KLUA 3QFJB 2EXWC 5I1AA 3KYMA 5IG7B 4LVHB 1WEJL 5GZOC 4OAWA 3WIIL 1IQDB 1MCRA 5KSAC 1R0AH 1RK1A 3BKYL 1ITCA 4HIJB 1UH2A 4L3ED 5CMAB 1CE6B 1CGXA 2N4IA 2XN9A 4LPVA 4BFIA 4M43L 3SKNB 4Y89A 1B2WL 1KLGA 3TT1H 4YGAB 5MHSD 5FUCC 4KDWA 4P9HL 4NQSA 4H20H 4C83A 5KS9F 1PZ5B 2E3VA 5FO9B 5ID1A 2H9GB 2EYSB 1AKJD 2CMRH 4PTTB 3WEXB 4AEHL 4HPYH 4PRPB 5TDOA 4NOFA 2OTWB 4K3EL 4NKDA 4XAKE 1TCRB 3CLEH 2F8VA 5CIPA 1A2YA 2MQ3A 2Z8VC 4LCYB 1W8NA 2EZ0C 4O2CB 3G04B 4LCWE 5IB1A 5ESQA 3CSYA 4EKXA 3VA2C 1JGLH 2VXTH 2DD8L 4JHAL 2HWZL 3G9AB 1J18A 2R2EA 4GW5B 2GJ6B 3JSSA 1DQJB 1EO8H 5DHYA 4PGCA 4KFZC 3MXVL 3GJFA 1FV1B 3P4OA 4UTAH 4JFDE 1GC1C 3MUGB 3N85H 4XRCB 2FHBA 5FYKE 4Y2DD 4UNUA 4OZGB 3CFBB 5DQ9A 4BZ1L 4RBPH 2ZP0T 3BMWA 4CVWA 1D6EA 1R5WB 1YEHH 4KRNA 3BRGC 4MZ2A 3TN0B 4DZ8A 1UM6H 2NY4D 5HI5C 2DF3A 2H32A 3W11D 5IVNA 1UWXH 5EPMA 1MCQA 1AR2A 1C5CH 2A0LD 5CLTA 1KJVA 3G6DH 1O0VA 2D03L 3VH8A 5CJQH 3L3GB 3WLBB 4PJIF 5DF0A 2VLJE 3HC4L 2W91A 2RJMA 1KC5L 3ROOA 1CLOL 1KCLA 4X4ME 1AY1H 3MFFB 3GK8L 4MJ6B 5BCAA 4YXHL 1HDMB 2H2PD 5HGDA 2Z9TA 5BZDB 2PNDA 4V1DD 3WFEL 3CC5B 1DUYA 2VDKH 4AIXA 4YDJB 2VXQH 4MX7B 4M7KL 5A2FA 1MVUA 3H9YA 3P9LB 5JW3L 3ARGC 2X4OA 4JFEE 2AEIT 2X4QA 4QRTA 2HP4A 3P4LA 3HB3C 3HC3L 1ED3B 1QSFA 5GQBA 3BW9B 1VKXA 4ZPVB 3MLZH 4TVPE 5GRWA 3WHXA 4WTZG 1A64A 3HZYA 3ZL4H 2JELL 4MNHA 5KSUB 1RMFH 1HHIA 4X6DA 1QEWB 5GRYA 3VFTA 1UM4H 5D7SH 1UA6H 1D5XA 1K8DA 3BPOB 3MRDA 3KYOB 5C6TL 3I50H 3QULA 4DUVA 3GMOB 1YPZA 1OLLA 4WGVB 3OAZH 4IRZL 3WFDL 3NIFF 5B4MC 1BM3H 1Z3GL 5B3NA 1NJ9B 1OGAE 1RUPL 1A6VH 2NYYD 1XAUA 2CKBA 3P9MB 1M7IB 4EI5A 3SDYH 1BOYA 5I1LA 4KKBD 1A47A 2CK0L 4GG6B 2OS7A 1ZT7A 2VLRE 2IAMC 1XIWB 4OCWH 3GFUA 1QLRB 5HHQB 5C0GA 3KXFB 4PYHA 1BX2A 3QWQB 4LARL 5E99L 3GKZA 4P3DB 5C0NC 1ZSDA 2I9TB 4G8FB 4ELKB 1W72H 1KB5B 2X7LB 4KGLA 1IGFH 3BN9D 5ETUB 3MLWL 5FO7A 4PY8I 4WWKC 2P5ED 4I4WB 3SJVB 1CIDA 4OZIF 4LRNH 3QJHB 1PG7W 2R1XA 4QGTA 1FZKB 4G3YL 2AJVH 5J6HB 5CJBA 3MV8D 4GJTB 5IHZA 5BRZE 2WP3T 3M17A 3MOQA 4AZ8A 4ODVL 4X83A 5F9OL 1U93B 5F9WC 2A77H 3QDGB 3GSXB 1WTGT 1BP3B 2LQRA 3AXLA 1KUMA 4HAGA 3QNYB 3ZYOA 4LSQL 2IBZY 3FZUD 4HZLA 2LAGB 4OD1H 4YHLH 5EBLA 4YC2C 3LSOA 3EBAA 2OR7A 4ZO7A 4AQ1B 3S36H 4HKXA 3QXAB 1LO2L 2B4CC 4UIMB 2YRZA 2VQ1B 3VG9C 5D7KD 4JKKA 5GGVL 4QRRD 2NXZC 3DRQA 2OL3B 3VRIA 1T03H 3MV7A 3MREB 4JM2B 3DYMA 2OJZH 1JI2A 4P9ML 3F6LA 1URLA 3S88L 1ZLSH 4QRQB 5C07E 5K59E 1SJHB 5TDNB 5L8LB 5JPMB 3D39E 3FQRA 4ZFZA 2HMID 1ZHKB 1DVFC 2P5WA 4LEXH 3NCEB 2LU7A 3UC0L 4HDIA 1Z0MA 1LDPL 3IJYB 3C5ZD 1G9NH 4U1LA 4E0RA 5FK9A 1BIIA 5IB3A 4KU1A 5DHVA 4DEPB 4AH2B 2XZAH 3L5XH 1NC2D 3K81A 3VD5A 1DBBL 1HSAA 3JWOL 4NKOB 3LN9A 4P4KC 3BPCA 2EO1A 4QRPB 3QI9B 3ET9F 1G7IA 1KJ3L 4U1SA 2NR6C 2ITCB 3PDGA 1XGYH 3QDMA 3QH3B 3KHOA 1L6XA 3W81A 4HIXL 3UTTD 3QUZA 1ZK9A 4NZUH 2LFGA 4N0FB 4RGMB 1FFQA 3LEXA 4JR9H 5CZXC 5EN2B 5IW6B 5K9QI 5HYQB 2JKXA 4I18A 5IJKA 3EOTL 1B88A 3FRUB 5DFVD 5E7FA 1O7SA 5AWNH 2BNRB 1A6UH 2QQLL 4KXZH 2LVEA 2D9QB 1IC7L 4NP4L 3I85A 3MOAH 3KPMA 1MRCH 4HWEL 4PGDB 1J1XH 4ZFOB 3INUL 5CSZB 1JGEB 2OTPA 4HHAA 3OB0K 3DMMD 1DE4A 2AI0L 4ODUB 2EDOA 4HFUH 4RAUA 5DR5H 3KPRE 1T1WA 5IOPA 1ZWIB 3T3PE 1UXSA 3UJJH 3O6ML 3ARED 4NUJA 3TESA 4LKCB 4PJEA 1LO0L 2GTWA 2EIEA 3F58L 1MCKA 5A3ID 5MI0C 2CRIA 2NW2B 4M3KB 1U92A 3C60B 2FIKA 3TIEA 1M05B 2YKLH 4Z7VE 3HCVB 4LLQB 3MGOB 1RUMH 2M1KA 2HYMA 5DK3A 2X9YA 2APFA 2R29L 3QUXD 4M61B 2WQRA 4Z7NE 2DKUA 1I8MA 1OF2B 1V3KA 1N0LA 4FFZH 2O5XH 4POYA 3CK0L 3F7YB 1TQBC 1UH3A 2D7PA 3F5WA 3SDDB 4K8RC 3DX6B 1UT9A 3FB6B 4J3WA 1IQWH 5FM4A 2X1WL 1UJ3B 3SDCC 2MSPA 4I1NB 1CI5A 1HKLL 1DQDH 3LKOB 2R8SL 1P7KA 3IXAA 3MQIA 1RULL 5DI8A 2JB6B 5ITBL 1A4JA 1IGYB 3IT8D 5JHDB 1YMMB 3STBA 3KJ6L 3HMXA 3ZE2F 5GSRB 3MLVH 3D85D 3MOBH 2ZWLT 4RA3A 3O45B 1CVRA 2CIIA 5FXCH 3H9SA 1BHGA 4D0BA 1SYSA 4MNGA 3QXTA 1SBSL 5KS9A 4OF8A 1OB1A 3LZFL 4MAYA 1A1NB 3OX8A 4XVJH 4H26A 4XC3H 4EOWL 4I3RH 32C2A 3QXUA 1PW3A 3R1GH 4Y16C 2DLHA 4M6NL 4D9RD 4PRNA 4WU5B 3CFCL 3L3IB 1BQSA 5DSCA 4IIQC 1U8HA 3OL2A 3UTSA 4IS6A 4XP5H 2YC1B 4EJ1C 4KVCL 5JR1H 4OT1L 3TYFA 2R4SH 3T0EA 4YBQD 3WHE1 5IBLD 1NDMA 3FQWB 2FEEI 4C58B 3LS4H 4UIKH 1U8OB 1WISA 4O2EB 5D1QB 5JDJA 2XKUA 2R69H 2YSSA 1B0GA 3EOAA 1NAKH 1XGQA 3D3VB 4U1HA 3VW3H 3V6ZB 1QOKA 3B9KA 4TVSa 3QFJD 1Q0XL 4JN1H 1RU9H 4FTVA 4UQ3B 1WAAE 2VH5H 4H0IA 5I2IB 1F6FB 4DCQB 4Y4KB 5C3LD 2PW1B 4OLZL 3TV3L 1RIVH 4M7JH 4OD3H 1NFDF 4RNRB 3Q6FA 4Z77B 2CUHA 4MJ4A 4J3TA 3FQNB 5FUZL 4LMQI 3BGMA 1A6TA 4PJIA 2EXYD 3OKDB 4EUPH 3K80A 1QYGL 3G5XB 4K9EH 1RZ8B 4OCRH 3NOIA 1EEUA 4RAVA 1EHLH 4JFOB 3OJ2C 2I5YH 4NQEB 5IBUG 5IB5A 4PRPD 1I9JL 1OAQL 1T6WA 5D9SB 2P45B 1EK3A 4MA3A 2HA1A 4OIIH 3KPSA 4Z7WF 5K59F 3S4SA 3F7VA 2UUDK 5EUOE 4OQTA 3O8XB 3IFLH 5AYQA 4K07A 3BQUA 2CLVA 3BWAB 4MB4A 3I6GA 1TCMA 1SY6A 3PL6D 1F2XK 3GSOB 1F4WH 43CAB 2CR6A 4S2SA 4O00A 4NSKA 3CIQA 4YR6A 2WBJA 3FO2B 1AGEA 2EDEA 3X3GH 4TPRL 4JFYB 1QRNA 4NC0B 1FNHA 3C2AH 3QEQE 2A73A 5IV2B 4U1KA 4R4BB 5E9DB 1HINL 3QUYA 2NW3A 2UV3A 1U8JA 3O2DA 4TSBH 2FJFA 2AP2A 3A67H 4PFEA 4D0DA 5KOVC 4F7MA 5SWSE 1GJIA 4IOSD 1PBY