5FGKB

Cdk8-cycc in complex with 8-[3-(3-amino-1h-indazol-6-yl)-5-chloro- pyridine-4-yl]-2,8-diaza-spiro[4.5]decan-1-one
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
b'KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5fgkB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5fgkB01
1F5QB 4BCOB 1H26B 2PHGA 4EC9B 2C5NB 4Y72B 2CJMB 1C9BA 4EORB 1H1SB 5ACBA 5IDNB 5I5ZB 1AISB 1AD6A 3DDPB 4CFXB 4BCIB 5HNBB 1OIUB 5ICPB 4KRCB 4CFWB 1OL1B 5L2WB 3M03A 1GH6B 5LQFB 4EOKB 2UZEB 3BHUB 4RODA 2V22B 4EOIB 3BHTB 1GUXB 3TNHB 2B9RA 1GUXA 1H25B 1OIYB 2JGZB 2UZDB 1VYWB 2C4GB 4EOJB 4F6SB 2BKZB 2W96A 4F7SB 3F5XB 4ELLA 4BCMB 4EOOB 5HBEB 5BNJB 1KXUA 2WPAB 2WHBB 3MY1B 2PMIB 3G33B 1H24B 1OKWB 2C5XB 3K7AM 4I3ZB 4YOOA 4EOQB 2C5OB 2EUFA 4EONB 3BLQB 4YOZA 1OKVB 1QMZB 2IW8B 4BCJB 5LMKB 2UZBB 1H4LD 4EOMB 2X1NB 1E9HB 1FVVB 1UNHD 1W98B 2WIHB 3MIAB 4BCQB 5HQ0B 4F7NB 1H1RB 5HBHB 4CFUD 3TN8B 2W99A 2IW9B 1JKWA 3MI9B 2IVXA 5EFQB 1XO2A 1UNGD 4F6WB 5HVYB 1PKDB 1H28B 2IW6B 4KRDB 2R7GA 3EJ1B 2WMBB 1OI9B 1N4MA 4IMYB 4ELJA 4BCKB 4BCND 1P5EB 2G9XB 2C6TB 4CRLB 3QHRB 4CFNB 3QHWB 2I40B 1JOWA 4BCGB 5IDPB 4EOPB 2W2HA 2CCHB 1VINA 3H4CA 2WXVB 4II5B 1FINB 2QDJA 2W9FA 4F70B 1JSTB 2WFYB 5HBJB 4EOLB 3EIDB 2PK9B 4TTHA 4BCFB 1G3NC 4NSTB 1H1QB 1O9KA 2I53A 4CFVB 3BLRB 4F6UB 2C5VB 3EOCB 4BCPB 2F2CA 4OGRB 3RGFB 4BCQD 4EC8B 1VOLA 1H1PB 4CFMB 2WMAB 4YOSA 1BU2A 4BCNB 4OR5B 4CXAB 1H27B 4G6LB 4F7JB 3DDQB 3TNIB 3MY5B 1TFBA 3POMA 5CYIB 2W9ZA 1URCB 5FGKB 1ZP2A 5IF1B 1JSUB 4UN0A 5CEIB 1D3UB 4ROCA 4BCMD 4F7LB 4BCHB 4FX3B 2PK2A 3DOGB 3O0GD 1UNLD 4EOSB 3BLHB 1GY3B 1O9KB 2UUEB 3TNWB 3BHVB 4ROEA 2WIPB 4CFUB 1OGUB 1OL2B 2BPMB 4YC3B 2WEVB 2CCIB 3LQ5B 2UZLB
chains in the Genus database with same CATH superfamily
4BCOB 3QYEA 1H26B 2PJQA 2CJMB 2KMGA 5IDNB 5I5ZB 3QZ9B 4CFXB 5ICPB 4KRCB 5L2WB 5LQFB 1GH6B 3BG5A 4JX6A 3BHTB 1GUXB 2B9RA 1H25B 2DXCB 2G77A 3NDQA 4HL4A 4EOOB 5BNJB 3MY1B 2PMIB 2C5XB 4YOOA 3HO8A 2IW8B 4BCJB 3DL1A 1E9HB 4NC6A 5HQ0B 4F7NB 1H1RB 2AHJB 3X25B 2DPPB 2W99A 3MI9B 1UNGD 2BS3A 2IW6B 4BY7X 2R7GA 3A8LB 2ZPFB 4CRLB 3QHRB 2I40B 1VINA 4HNVA 3H4CA 2QFZA 3EIDB 2PK9B 4BCFB 4BY1X 1G3NC 2I53A 2BS4A 2QF7A 3A8MB 4EC8B 1IREB 4CXAB 4ZGJB 3PO3S 3DDQB 3MY5B 4ZGEB 5CYIB 1URCB 1JSUB 1D3UB 4BCHB 3DOGB 3O0GD 2ZPBB 2WIPB 1OL2B 2BPMB 4YC3B 3QWLA 2CCIB 3B57A 2PHGA 4EC9B 3X28B 1H1SB 1AD6A 4BCIB 1OIUB 4CFWB 3QZ5B 4EOKB 2UZEB 3A8HB 2CZ6B 2DD5B 2JGZB 2UZDB 1VYWB 4EOJB 2W96A 4F7SB 3F5XB 4ELLA 3G33B 1H24B 4I3ZB 5IHYA 1FKMA 4EONB 2UZBB 1H4LD 4BCQB 1W98B 2WJ9A 5HBHB 3TN8B 4BBSM 2IW9B 2KR6A 5EFQB 5HVYB 2QGSA 1H28B 4KRDB 4IMYB 2WMBB 2BS2A 4BCKB 2G9XB 2WXVB 1FINB 3KHIA 2ZPEB 4TTHA 4HLQA 2ZPIB 3DTOA 3VKHA 4BXXX 2C5VB 4BCPB 2CZ0B 4OGRB 3TW6A 1VOLA 1H27B 4G6LB 1UGPB 5FGKB 2QQ8A 5IF1B 4UN0A 1TD6A 4HNUA 1UNLD 2QDYB 1GY3B 3TNWB 1OGUB 4AKHA 2C5NB 1C9BA 5ACBA 1AISB 2CZ1B 5HNBB 4ROCA 2LW4A 1QLBA 2V22B 3TNHB 1GUXA 1OIYB 3QYGB 2C4GB 4F6SB 1AHJB 1KXUA 3TW7A 2WHBB 2DMEA 1OKWB 3QYBA 4EOQB 2C5OB 2EUFA 4YOZA 1E7PA 5LMKB 4EOMB 3MIAB 2D0QB 4CFUD 1XO2A 4ZGDB 4F6WB 2ZPGB 3GTMS 1UGRB 4AKGA 1N4MA 1UGSB 3HBLA 2C6TB 3X20B 4CFNB 3X26B 4BCGB 3WVDB 5IDPB 4EOPB 2CCHB 3HZJA 4MFEA 4F70B 1ENWA 4Z6YA 5HBJB 3DJBA 3BG9A 4NSTB 1H1QB 3QXEB 3X24B 3BLRB 3WVEB 3VYGB 3RGFB 1H1PB 4CFMB 2WMAB 1BU2A 2ZZDB 4F7JB 5EJCA 4OB0B 3TNIB 1TFBA 4BBRM 4BCMD 4FX3B 5DQWA 4ROEA 1O9KB 3HHTB 3BHVB 4LOCA 3BG3A 2WEVB 1F5QB 2CYZB 1UGQB 4Y72B 4OB3B 5DQVA 4EORB 3HB9A 1V29B 3DDPB 1OL1B 3M03A 4RODA 3BHUB 4EOIB 4MFDA 4OB1B 2BKZB 4BCMB 5HBEB 2DD4B 2WPAB 3A8OB 2DXBB 3K7AM 3BLQB 4HNTA 1OKVB 1QMZB 2X1NB 1FVVB 1UNHD 2WIHB 4JX4A 3A8GB 1JKWA 2IVXA 3VYHB 4M6VA 1PKDB 3EJ1B 2ZCFB 4ELJA 1OI9B 3VKGA 4BCND 1P5EB 2IN3A 3QHWB 1JOWA 2W2HA 4II5B 2QDJA 2W9FA 1JSTB 2WFYB 4FM4B 4EOLB 1O9KA 4JX5A 4AI6A 4OB2B 4CFVB 4F6UB 3EOCB 2F2CA 3QYHB 4QSHA 4BCQD 2ZPHB 4YOSA 4BCNB 4OR5B 2CZ7B 3POMA 2W9ZA 1ZP2A 5CEIB 4AKIA 4MIMA 4F7LB 2PK2A 4EOSB 3BLHB 2UUEB 4CFUB 3LQ5B 2UZLB
chains in the Genus database with same CATH topology
1F5QB 4BCOB 1H26B 2PHGA 4EC9B 2C5NB 4Y72B 2CJMB 1C9BA 4EORB 1H1SB 5ACBA 5IDNB 5I5ZB 1AISB 1AD6A 3DDPB 4CFXB 4BCIB 5HNBB 1OIUB 5ICPB 4KRCB 4CFWB 1OL1B 5L2WB 3M03A 1GH6B 5LQFB 4EOKB 2UZEB 3BHUB 4RODA 2V22B 4EOIB 3BHTB 1GUXB 3TNHB 2B9RA 1GUXA 1H25B 1OIYB 2JGZB 2UZDB 1VYWB 2C4GB 4EOJB 4F6SB 2BKZB 2W96A 4F7SB 3F5XB 4ELLA 4BCMB 4EOOB 5HBEB 5BNJB 1KXUA 2WPAB 2WHBB 3MY1B 2PMIB 3G33B 1H24B 1OKWB 2C5XB 3K7AM 4I3ZB 4YOOA 4EOQB 2C5OB 2EUFA 4EONB 3BLQB 4YOZA 1OKVB 1QMZB 2IW8B 4BCJB 5LMKB 2UZBB 1H4LD 4EOMB 2X1NB 1E9HB 1FVVB 1UNHD 1W98B 2WIHB 3MIAB 4BCQB 5HQ0B 4F7NB 1H1RB 5HBHB 4CFUD 3TN8B 2W99A 2IW9B 1JKWA 3MI9B 2IVXA 5EFQB 1XO2A 1UNGD 4F6WB 5HVYB 1PKDB 1H28B 2IW6B 4KRDB 2R7GA 3EJ1B 2WMBB 1OI9B 1N4MA 4IMYB 4ELJA 4BCKB 4BCND 1P5EB 2G9XB 2C6TB 4CRLB 3QHRB 4CFNB 3QHWB 2I40B 1JOWA 4BCGB 5IDPB 4EOPB 2W2HA 2CCHB 1VINA 3H4CA 2WXVB 4II5B 1FINB 2QDJA 2W9FA 4F70B 1JSTB 2WFYB 5HBJB 4EOLB 3EIDB 2PK9B 4TTHA 4BCFB 1G3NC 4NSTB 1H1QB 1O9KA 2I53A 4CFVB 3BLRB 4F6UB 2C5VB 3EOCB 4BCPB 2F2CA 4OGRB 3RGFB 4BCQD 4EC8B 1VOLA 1H1PB 4CFMB 2WMAB 4YOSA 1BU2A 4BCNB 4OR5B 4CXAB 1H27B 4G6LB 4F7JB 3DDQB 3TNIB 3MY5B 1TFBA 3POMA 5CYIB 2W9ZA 1URCB 5FGKB 1ZP2A 5IF1B 1JSUB 4UN0A 5CEIB 1D3UB 4ROCA 4BCMD 4F7LB 4BCHB 4FX3B 2PK2A 3DOGB 3O0GD 1UNLD 4EOSB 3BLHB 1GY3B 1O9KB 2UUEB 3TNWB 3BHVB 4ROEA 2WIPB 4CFUB 1OGUB 1OL2B 2BPMB 4YC3B 2WEVB 2CCIB 3LQ5B 2UZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F5Q B;  4BCO B;  1H26 B;  2PHG A;  4EC9 B;  2C5N B;  4Y72 B;  2CJM B;  1C9B A;  4EOR B;  1H1S B;  5ACB A;  5IDN B;  5I5Z B;  1AIS B;  1AD6 A;  3DDP B;  4CFX B;  4BCI B;  5HNB B;  1OIU B;  5ICP B;  4KRC B;  4CFW B;  1OL1 B;  5L2W B;  3M03 A;  1GH6 B;  5LQF B;  4EOK B;  2UZE B;  3BHU B;  4ROD A;  2V22 B;  4EOI B;  3BHT B;  1GUX B;  3TNH B;  2B9R A;  1GUX A;  1H25 B;  1OIY B;  2JGZ B;  2UZD B;  1VYW B;  2C4G B;  4EOJ B;  4F6S B;  2BKZ B;  2W96 A;  4F7S B;  3F5X B;  4ELL A;  4BCM B;  4EOO B;  5HBE B;  5BNJ B;  1KXU A;  2WPA B;  2WHB B;  3MY1 B;  2PMI B;  3G33 B;  1H24 B;  1OKW B;  2C5X B;  3K7A M;  4I3Z B;  4YOO A;  4EOQ B;  2C5O B;  2EUF A;  4EON B;  3BLQ B;  4YOZ A;  1OKV B;  1QMZ B;  2IW8 B;  4BCJ B;  5LMK B;  2UZB B;  1H4L D;  4EOM B;  2X1N B;  1E9H B;  1FVV B;  1UNH D;  1W98 B;  2WIH B;  3MIA B;  4BCQ B;  5HQ0 B;  4F7N B;  1H1R B;  5HBH B;  4CFU D;  3TN8 B;  2W99 A;  2IW9 B;  1JKW A;  3MI9 B;  2IVX A;  5EFQ B;  1XO2 A;  1UNG D;  4F6W B;  5HVY B;  1PKD B;  1H28 B;  2IW6 B;  4KRD B;  2R7G A;  3EJ1 B;  2WMB B;  1OI9 B;  1N4M A;  4IMY B;  4ELJ A;  4BCK B;  4BCN D;  1P5E B;  2G9X B;  2C6T B;  4CRL B;  3QHR B;  4CFN B;  3QHW B;  2I40 B;  1JOW A;  4BCG B;  5IDP B;  4EOP B;  2W2H A;  2CCH B;  1VIN A;  3H4C A;  2WXV B;  4II5 B;  1FIN B;  2QDJ A;  2W9F A;  4F70 B;  1JST B;  2WFY B;  5HBJ B;  4EOL B;  3EID B;  2PK9 B;  4TTH A;  4BCF B;  1G3N C;  4NST B;  1H1Q B;  1O9K A;  2I53 A;  4CFV B;  3BLR B;  4F6U B;  2C5V B;  3EOC B;  4BCP B;  2F2C A;  4OGR B;  3RGF B;  4BCQ D;  4EC8 B;  1VOL A;  1H1P B;  4CFM B;  2WMA B;  4YOS A;  1BU2 A;  4BCN B;  4OR5 B;  4CXA B;  1H27 B;  4G6L B;  4F7J B;  3DDQ B;  3TNI B;  3MY5 B;  1TFB A;  3POM A;  5CYI B;  2W9Z A;  1URC B;  5FGK B;  1ZP2 A;  5IF1 B;  1JSU B;  4UN0 A;  5CEI B;  1D3U B;  4ROC A;  4BCM D;  4F7L B;  4BCH B;  4FX3 B;  2PK2 A;  3DOG B;  3O0G D;  1UNL D;  4EOS B;  3BLH B;  1GY3 B;  1O9K B;  2UUE B;  3TNW B;  3BHV B;  4ROE A;  2WIP B;  4CFU B;  1OGU B;  1OL2 B;  2BPM B;  4YC3 B;  2WEV B;  2CCI B;  3LQ5 B;  2UZL B; 
#chains in the Genus database with same CATH topology
 4BCO B;  3QYE A;  1H26 B;  2PJQ A;  2CJM B;  2KMG A;  5IDN B;  5I5Z B;  3QZ9 B;  4CFX B;  5ICP B;  4KRC B;  5L2W B;  5LQF B;  1GH6 B;  3BG5 A;  4JX6 A;  3BHT B;  1GUX B;  2B9R A;  1H25 B;  2DXC B;  2G77 A;  3NDQ A;  4HL4 A;  4EOO B;  5BNJ B;  3MY1 B;  2PMI B;  2C5X B;  4YOO A;  3HO8 A;  2IW8 B;  4BCJ B;  3DL1 A;  1E9H B;  4NC6 A;  5HQ0 B;  4F7N B;  1H1R B;  2AHJ B;  3X25 B;  2DPP B;  2W99 A;  3MI9 B;  1UNG D;  2BS3 A;  2IW6 B;  4BY7 X;  2R7G A;  3A8L B;  2ZPF B;  4CRL B;  3QHR B;  2I40 B;  1VIN A;  4HNV A;  3H4C A;  2QFZ A;  3EID B;  2PK9 B;  4BCF B;  4BY1 X;  1G3N C;  2I53 A;  2BS4 A;  2QF7 A;  3A8M B;  4EC8 B;  1IRE B;  4CXA B;  4ZGJ B;  3PO3 S;  3DDQ B;  3MY5 B;  4ZGE B;  5CYI B;  1URC B;  1JSU B;  1D3U B;  4BCH B;  3DOG B;  3O0G D;  2ZPB B;  2WIP B;  1OL2 B;  2BPM B;  4YC3 B;  3QWL A;  2CCI B;  3B57 A;  2PHG A;  4EC9 B;  3X28 B;  1H1S B;  1AD6 A;  4BCI B;  1OIU B;  4CFW B;  3QZ5 B;  4EOK B;  2UZE B;  3A8H B;  2CZ6 B;  2DD5 B;  2JGZ B;  2UZD B;  1VYW B;  4EOJ B;  2W96 A;  4F7S B;  3F5X B;  4ELL A;  3G33 B;  1H24 B;  4I3Z B;  5IHY A;  1FKM A;  4EON B;  2UZB B;  1H4L D;  4BCQ B;  1W98 B;  2WJ9 A;  5HBH B;  3TN8 B;  4BBS M;  2IW9 B;  2KR6 A;  5EFQ B;  5HVY B;  2QGS A;  1H28 B;  4KRD B;  4IMY B;  2WMB B;  2BS2 A;  4BCK B;  2G9X B;  2WXV B;  1FIN B;  3KHI A;  2ZPE B;  4TTH A;  4HLQ A;  2ZPI B;  3DTO A;  3VKH A;  4BXX X;  2C5V B;  4BCP B;  2CZ0 B;  4OGR B;  3TW6 A;  1VOL A;  1H27 B;  4G6L B;  1UGP B;  5FGK B;  2QQ8 A;  5IF1 B;  4UN0 A;  1TD6 A;  4HNU A;  1UNL D;  2QDY B;  1GY3 B;  3TNW B;  1OGU B;  4AKH A;  2C5N B;  1C9B A;  5ACB A;  1AIS B;  2CZ1 B;  5HNB B;  4ROC A;  2LW4 A;  1QLB A;  2V22 B;  3TNH B;  1GUX A;  1OIY B;  3QYG B;  2C4G B;  4F6S B;  1AHJ B;  1KXU A;  3TW7 A;  2WHB B;  2DME A;  1OKW B;  3QYB A;  4EOQ B;  2C5O B;  2EUF A;  4YOZ A;  1E7P A;  5LMK B;  4EOM B;  3MIA B;  2D0Q B;  4CFU D;  1XO2 A;  4ZGD B;  4F6W B;  2ZPG B;  3GTM S;  1UGR B;  4AKG A;  1N4M A;  1UGS B;  3HBL A;  2C6T B;  3X20 B;  4CFN B;  3X26 B;  4BCG B;  3WVD B;  5IDP B;  4EOP B;  2CCH B;  3HZJ A;  4MFE A;  4F70 B;  1ENW A;  4Z6Y A;  5HBJ B;  3DJB A;  3BG9 A;  4NST B;  1H1Q B;  3QXE B;  3X24 B;  3BLR B;  3WVE B;  3VYG B;  3RGF B;  1H1P B;  4CFM B;  2WMA B;  1BU2 A;  2ZZD B;  4F7J B;  5EJC A;  4OB0 B;  3TNI B;  1TFB A;  4BBR M;  4BCM D;  4FX3 B;  5DQW A;  4ROE A;  1O9K B;  3HHT B;  3BHV B;  4LOC A;  3BG3 A;  2WEV B;  1F5Q B;  2CYZ B;  1UGQ B;  4Y72 B;  4OB3 B;  5DQV A;  4EOR B;  3HB9 A;  1V29 B;  3DDP B;  1OL1 B;  3M03 A;  4ROD A;  3BHU B;  4EOI B;  4MFD A;  4OB1 B;  2BKZ B;  4BCM B;  5HBE B;  2DD4 B;  2WPA B;  3A8O B;  2DXB B;  3K7A M;  3BLQ B;  4HNT A;  1OKV B;  1QMZ B;  2X1N B;  1FVV B;  1UNH D;  2WIH B;  4JX4 A;  3A8G B;  1JKW A;  2IVX A;  3VYH B;  4M6V A;  1PKD B;  3EJ1 B;  2ZCF B;  4ELJ A;  1OI9 B;  3VKG A;  4BCN D;  1P5E B;  2IN3 A;  3QHW B;  1JOW A;  2W2H A;  4II5 B;  2QDJ A;  2W9F A;  1JST B;  2WFY B;  4FM4 B;  4EOL B;  1O9K A;  4JX5 A;  4AI6 A;  4OB2 B;  4CFV B;  4F6U B;  3EOC B;  2F2C A;  3QYH B;  4QSH A;  4BCQ D;  2ZPH B;  4YOS A;  4BCN B;  4OR5 B;  2CZ7 B;  3POM A;  2W9Z A;  1ZP2 A;  5CEI B;  4AKI A;  4MIM A;  4F7L B;  2PK2 A;  4EOS B;  3BLH B;  2UUE B;  4CFU B;  3LQ5 B;  2UZL B; 
#chains in the Genus database with same CATH homology
 1F5Q B;  4BCO B;  1H26 B;  2PHG A;  4EC9 B;  2C5N B;  4Y72 B;  2CJM B;  1C9B A;  4EOR B;  1H1S B;  5ACB A;  5IDN B;  5I5Z B;  1AIS B;  1AD6 A;  3DDP B;  4CFX B;  4BCI B;  5HNB B;  1OIU B;  5ICP B;  4KRC B;  4CFW B;  1OL1 B;  5L2W B;  3M03 A;  1GH6 B;  5LQF B;  4EOK B;  2UZE B;  3BHU B;  4ROD A;  2V22 B;  4EOI B;  3BHT B;  1GUX B;  3TNH B;  2B9R A;  1GUX A;  1H25 B;  1OIY B;  2JGZ B;  2UZD B;  1VYW B;  2C4G B;  4EOJ B;  4F6S B;  2BKZ B;  2W96 A;  4F7S B;  3F5X B;  4ELL A;  4BCM B;  4EOO B;  5HBE B;  5BNJ B;  1KXU A;  2WPA B;  2WHB B;  3MY1 B;  2PMI B;  3G33 B;  1H24 B;  1OKW B;  2C5X B;  3K7A M;  4I3Z B;  4YOO A;  4EOQ B;  2C5O B;  2EUF A;  4EON B;  3BLQ B;  4YOZ A;  1OKV B;  1QMZ B;  2IW8 B;  4BCJ B;  5LMK B;  2UZB B;  1H4L D;  4EOM B;  2X1N B;  1E9H B;  1FVV B;  1UNH D;  1W98 B;  2WIH B;  3MIA B;  4BCQ B;  5HQ0 B;  4F7N B;  1H1R B;  5HBH B;  4CFU D;  3TN8 B;  2W99 A;  2IW9 B;  1JKW A;  3MI9 B;  2IVX A;  5EFQ B;  1XO2 A;  1UNG D;  4F6W B;  5HVY B;  1PKD B;  1H28 B;  2IW6 B;  4KRD B;  2R7G A;  3EJ1 B;  2WMB B;  1OI9 B;  1N4M A;  4IMY B;  4ELJ A;  4BCK B;  4BCN D;  1P5E B;  2G9X B;  2C6T B;  4CRL B;  3QHR B;  4CFN B;  3QHW B;  2I40 B;  1JOW A;  4BCG B;  5IDP B;  4EOP B;  2W2H A;  2CCH B;  1VIN A;  3H4C A;  2WXV B;  4II5 B;  1FIN B;  2QDJ A;  2W9F A;  4F70 B;  1JST B;  2WFY B;  5HBJ B;  4EOL B;  3EID B;  2PK9 B;  4TTH A;  4BCF B;  1G3N C;  4NST B;  1H1Q B;  1O9K A;  2I53 A;  4CFV B;  3BLR B;  4F6U B;  2C5V B;  3EOC B;  4BCP B;  2F2C A;  4OGR B;  3RGF B;  4BCQ D;  4EC8 B;  1VOL A;  1H1P B;  4CFM B;  2WMA B;  4YOS A;  1BU2 A;  4BCN B;  4OR5 B;  4CXA B;  1H27 B;  4G6L B;  4F7J B;  3DDQ B;  3TNI B;  3MY5 B;  1TFB A;  3POM A;  5CYI B;  2W9Z A;  1URC B;  5FGK B;  1ZP2 A;  5IF1 B;  1JSU B;  4UN0 A;  5CEI B;  1D3U B;  4ROC A;  4BCM D;  4F7L B;  4BCH B;  4FX3 B;  2PK2 A;  3DOG B;  3O0G D;  1UNL D;  4EOS B;  3BLH B;  1GY3 B;  1O9K B;  2UUE B;  3TNW B;  3BHV B;  4ROE A;  2WIP B;  4CFU B;  1OGU B;  1OL2 B;  2BPM B;  4YC3 B;  2WEV B;  2CCI B;  3LQ5 B;  2UZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...