5FGLA

Co-crystal structure of nicr2_hsp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
200
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NicR
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
total genus 84
structure length 200
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fglA00
3KKCA 2HYTA 2QTQA 3VVXA 3ZQIA 1RPWA 4HKUA 3BHQA 3KKDA 3TP0A 5D18A 2HKUA 3C07A 1JUSA 3B6CA 3CRJA 2IBDA 4ACIA 3NI7A 4GCKA 3E7QA 3ON2A 2PBXA 3G1OA 3BCGA 5IPAA 3VPRA 5J1YA 2XPVA 5F0HA 3LWJA 2PZ9A 3MVPA 3T6NA 4GCTA 3EUPA 4AC0A 5CW8A 3AQSA 3QQAA 4AUXA 2ZB9A 4GCLA 1QPIA 3WHBA 3VUQA 3O8HA 4MK6A 5CXGA 4D5CA 1UI5A 4JYKA 5H9TA 2NP3A 3HGYA 5EZHA 3DPJA 4AC6A 3FIWA 1JTXA 3BR0A 4MO7A 2O7OA 3ON4A 2XPUA 1JUMA 3CCYA 4DW6A 5FHPA 5GPAA 3BT9A 4V2GA 5DAJA 3MNLA 3BR3A 2OPTA 2DTZA 3QKXA 3VP5A 3BR6A 3O60A 4D5FA 3VIBA 3VW2A 3CJDA 3VOXA 2D6YA 4V2FA 3HE0A 5FKMA 3B81A 3VOKA 2JK3A 2UXOA 3NPIA 4UDSA 1JT0A 2Y30A 3PPBA 2NP5A 3FRQA 2X9DA 1ZK8A 1T33A 4AF5A 4CGRA 1T56A 2IU5A 4X1EA 2NS7A 2NS8A 4GFLA 2W53A 4YZEA 2ZOZA 4MXMA 2FD5A 2TCTA 1JUPA 2OI8A 3LSPA 2ID3A 5F0CA 3RH2A 2RAEA 3QPSA 3KZ9A 2HXOA 3ZQGA 5F04A 2I10A 3TP3A 2G7GA 3V78A 2G0EA 3VW1A 3F1BA 2QWTA 4NN1A 3ANGA 4W97A 5J1RA 4JKZA 3QPLA 4B1RA 3QBMA 1QVTA 3Q0WA 1JTYA 3WHCA 3AQTA 3RD3A 5EYRA 4M3GA 1JT6A 2YVHA 4ICHA 2YVEA 5K7FA 2UXUA 3BR2A 2G7SA 3BTIA 3ZQHA 3GZIA 3BTJA 4JNNA 1VI0A 3Q0VA 4KWAA 5J1UA 3FK6A 5D1RA 1Z0XA 5AQCA 3LSJA 1ZKGA 2FX0A 1ORKA 5C4YA 2GBYA 2G7LA 2QIBA 3G1LA 3LHQA 5FGLA 2QOPA 5J3LA 2Q24A 5FKKA 3NNRA 2IEKA 2G3BA 1UI6A 4I6ZA 3DCFA 5F1JA 2UXPA 2TRTA 4NELA 3S5RA 1BJZA 3HTAA 4I76A 3ZQLA 3SFIA 3ZQFA 3BQZA 3EGQA 3BQYA 3COLA 2REKA 3BR5A 2XGDA 2XB5A 3BR1A 2FJ1A 2HXIA 2FQ4A 2UXHA 2XPWA 3BRUA 5K7ZA 3HGGA 2ZCXA 5IOYA 4D7NA 2IAIA 2OERA 3KNWA 3HIMA 2HYJA 3LOCA 2QCOA 4M3DA 3SDGA 2WV1A 1U9NA 3PASA 3NXCA 2F07A 4M3EA 3IH2A 2VKEA 3BTCA 3G7RA 2XRLA 2JJ7A 2Y31A 4PXIA 5K7HA 2GFNA 2ZCMA 4G12A 3VVYA 4GFKA 5D19A 3F0CA 5CXIA 3HTHA 2X6OA 5FKOA 3BNIA 3VW0A 5F27A 5IOZA 4B3AA 2XDNA 2RHAA 5IP6A 4ME9A 2UXIA 2XGCA 3LSRA 5FKLA 3P9TA 1RKTA 2DG7A 2ID6A 4XK4A 2XGEA 3C2BA 2ZOYA 3LJLA 3JSJA 5GPCA 3V6GA 2VKVA 3O8GA 2GENA 2WGBA 3FK7A 3ANPA 2QKOA 1RKWA 4L62A 1A6IA 2FBQA 3B6AA 5K58A 3NRGA 4JL3A 5FMPA 5GP9A 2WUIA 2NX4A 2HQ5A 5HSZA 2GUHA 3CDLA 3IH4A 2Y2ZA 3HTJA 2EH3A 3Q3SA 2ZCNA 3CWRA 4ABZA 3PM1A 3G1MA 1Z77A 3VVZA 1QVUA 5HBUA 5F08A 5EFYA 2DG8A 3IH3A 1SGMA 5HAWA 4M3FA 3BJBA 3GEUA 1U9OA 3DEWA 3IUVA 4W1UA 4M3BA 5EZGA 4D7MA 3BTLA 2RASA 3HTIA 2VPRA 2O7TA 2V57A 5F0FA 3G56A 2OF7A 5FKNA 3Q0UA
chains in the Genus database with same CATH superfamily
3KKCA 2HYTA 2QTQA 3VVXA 3ZQIA 1RPWA 4HKUA 3BHQA 3DU5A 3KKDA 3TP0A 5D18A 2HKUA 3C07A 1JUSA 3B6CA 2B3WA 3CRJA 2IBDA 4ACIA 3NI7A 4GCKA 3E7QA 3ON2A 5CQGA 2PBXA 2PFVA 3G1OA 3BCGA 5IPAA 3VPRA 5J1YA 2XPVA 2R7RA 2R7UA 5F0HA 3LWJA 2PZ9A 3MVPA 3T6NA 3FHNA 4GCTA 3EUPA 4AC0A 5CW8A 3AQSA 3QQAA 4AUXA 2ZB9A 4GCLA 1QPIA 3WHBA 3VUQA 3O8HA 4MK6A 5CXGA 4D5CA 1UI5A 4JYKA 5H9TA 2NP3A 3HGYA 5EZHA 3DPJA 4AC6A 3FIWA 1JTXA 2R7SA 3NS4A 3VTIA 3BR0A 4MO7A 2O7OA 3ON4A 2XPUA 1JUMA 3CCYA 4DW6A 5FHPA 5GPAA 3BT9A 4V2GA 5DAJA 3MNLA 3BR3A 2OPTA 2DTZA 3QKXA 3VP5A 3BR6A 3O60A 4D5FA 3VIBA 3VW2A 3CJDA 3VOXA 2D6YA 4V2FA 3HE0A 5FKMA 3B81A 3VOKA 2JK3A 2UXOA 2A2FX 3NPIA 4UDSA 1JT0A 2Y30A 3PPBA 2NP5A 3FRQA 2X9DA 1ZK8A 1T33A 2R7QA 4U9LA 4AF5A 4CGRA 1T56A 2IU5A 4X1EA 2NS7A 2NS8A 4GFLA 2W53A 4YZEA 2ZOZA 2R7WA 4MXMA 2FD5A 2TCTA 1JUPA 2OI8A 3LSPA 2ID3A 5F0CA 3RH2A 2RAEA 3QPSA 3KZ9A 2HXOA 3ZQGA 5F04A 4OD5A 2I10A 3TP3A 2G7GA 3V78A 2G0EA 3VW1A 3F1BA 2QWTA 4NN1A 3ANGA 4W97A 5J1RA 4JKZA 2FJI1 3QPLA 4B1RA 3QBMA 1QVTA 3Q0WA 1JTYA 3WHCA 3AQTA 3RD3A 5EYRA 4M3GA 1JT6A 2YVHA 4ICHA 2YVEA 2R7XA 5K7FA 2UXUA 3BR2A 2G7SA 3BTIA 3ZQHA 3GZIA 3BTJA 4JNNA 1VI0A 3Q0VA 4KWAA 2R7OA 5J1UA 3FK6A 5D1RA 1Z0XA 5AQCA 3LSJA 1ZKGA 4OD4A 2FX0A 1ORKA 2YVXA 5C4YA 2GBYA 2G7LA 2QIBA 3G1LA 3LHQA 5FGLA 2QOPA 5J3LA 2Q24A 5FKKA 3NNRA 2IEKA 2G3BA 1UI6A 4I6ZA 3DCFA 5F1JA 2UXPA 2TRTA 4NELA 3S5RA 1BJZA 3HTAA 4I76A 3ZQLA 3SFIA 3ZQFA 3BQZA 3EGQA 3BQYA 3COLA 2REKA 3BR5A 2XGDA 2XB5A 3BR1A 2FJ1A 2HXIA 2FQ4A 2UXHA 2XPWA 3BRUA 5K7ZA 3HGGA 2ZCXA 5IOYA 4D7NA 2IAIA 2OERA 3KNWA 3HIMA 2HYJA 4C2MA 3LOCA 2QCOA 4M3DA 3SDGA 2WV1A 3DU6A 1U9NA 3PASA 3NXCA 2F07A 4M3EA 3IH2A 2VKEA 4IRVA 3BTCA 3G7RA 2XRLA 2JJ7A 2Y31A 4PXIA 5K7HA 2GFNA 2ZCMA 4G12A 3VVYA 4DVYP 4GFKA 5D19A 3F0CA 5CXIA 3HTHA 2X6OA 5FKOA 3BNIA 3VW0A 5F27A 5IOZA 4B3AA 2XDNA 2RHAA 5IP6A 4ME9A 2UXIA 2XGCA 3LSRA 5FKLA 3P9TA 1RKTA 2DG7A 2ID6A 2R7VA 4XK4A 2XGEA 3C2BA 2ZOYA 3LJLA 3JSJA 5GPCA 3V6GA 2VKVA 3O8GA 2GENA 2WGBA 3FK7A 3ANPA 2QKOA 4U9NA 1RKWA 4L62A 1A6IA 2FBQA 3B6AA 3K8PC 5K58A 3NRGA 4JL3A 5FMPA 5GP9A 2WUIA 2NX4A 2HQ5A 5HSZA 2GUHA 2R7TA 3CDLA 3IH4A 2Y2ZA 3HTJA 2EH3A 3Q3SA 2ZCNA 3CWRA 4ABZA 3PM1A 3G1MA 1Z77A 3VVZA 1QVUA 5HBUA 5F08A 5EFYA 2DG8A 3IH3A 1SGMA 5HAWA 4M3FA 4WIBA 3BJBA 3GEUA 1U9OA 3DEWA 3IUVA 3SWHA 4W1UA 4M3BA 5EZGA 4D7MA 3BTLA 2RASA 3HTIA 2VPRA 2O7TA 2V57A 2ZY9A 5F0FA 3G56A 2OF7A 3KYLA 5FKNA 2B1EA 3Q0UA
chains in the Genus database with same CATH topology
3KKCA 2HYTA 2QTQA 3VVXA 3ZQIA 1RPWA 4HKUA 3BHQA 3KKDA 3TP0A 5D18A 2HKUA 3C07A 1JUSA 3B6CA 3CRJA 2IBDA 4ACIA 3NI7A 4GCKA 3E7QA 3ON2A 2PBXA 3G1OA 3BCGA 5IPAA 3VPRA 5J1YA 2XPVA 5F0HA 3LWJA 2PZ9A 3MVPA 3T6NA 4GCTA 3EUPA 4AC0A 5CW8A 3AQSA 3QQAA 4AUXA 2ZB9A 4GCLA 1QPIA 3WHBA 3VUQA 3O8HA 4MK6A 5CXGA 4D5CA 1UI5A 4JYKA 5H9TA 2NP3A 3HGYA 5EZHA 3DPJA 4AC6A 3FIWA 1JTXA 3BR0A 4MO7A 2O7OA 3ON4A 2XPUA 1JUMA 3CCYA 4DW6A 5FHPA 5GPAA 3BT9A 4V2GA 5DAJA 3MNLA 3BR3A 2OPTA 2DTZA 3QKXA 3VP5A 3BR6A 3O60A 4D5FA 3VIBA 3VW2A 3CJDA 3VOXA 2D6YA 4V2FA 3HE0A 5FKMA 3B81A 3VOKA 2JK3A 2UXOA 3NPIA 4UDSA 1JT0A 2Y30A 3PPBA 2NP5A 3FRQA 2X9DA 1ZK8A 1T33A 4AF5A 4CGRA 1T56A 2IU5A 4X1EA 2NS7A 2NS8A 4GFLA 2W53A 4YZEA 2ZOZA 4MXMA 2FD5A 2TCTA 1JUPA 2OI8A 3LSPA 2ID3A 5F0CA 3RH2A 2RAEA 3QPSA 3KZ9A 2HXOA 3ZQGA 5F04A 2I10A 3TP3A 2G7GA 3V78A 2G0EA 3VW1A 3F1BA 2QWTA 4NN1A 3ANGA 4W97A 5J1RA 4JKZA 3QPLA 4B1RA 3QBMA 1QVTA 3Q0WA 1JTYA 3WHCA 3AQTA 3RD3A 5EYRA 4M3GA 1JT6A 2YVHA 4ICHA 2YVEA 5K7FA 2UXUA 3BR2A 2G7SA 3BTIA 3ZQHA 3GZIA 3BTJA 4JNNA 1VI0A 3Q0VA 4KWAA 5J1UA 3FK6A 5D1RA 1Z0XA 5AQCA 3LSJA 1ZKGA 2FX0A 1ORKA 5C4YA 2GBYA 2G7LA 2QIBA 3G1LA 3LHQA 5FGLA 2QOPA 5J3LA 2Q24A 5FKKA 3NNRA 2IEKA 2G3BA 1UI6A 4I6ZA 3DCFA 5F1JA 2UXPA 2TRTA 4NELA 3S5RA 1BJZA 3HTAA 4I76A 3ZQLA 3SFIA 3ZQFA 3BQZA 3EGQA 3BQYA 3COLA 2REKA 3BR5A 2XGDA 2XB5A 3BR1A 2FJ1A 2HXIA 2FQ4A 2UXHA 2XPWA 3BRUA 5K7ZA 3HGGA 2ZCXA 5IOYA 4D7NA 2IAIA 2OERA 3KNWA 3HIMA 2HYJA 3LOCA 2QCOA 4M3DA 3SDGA 2WV1A 1U9NA 3PASA 3NXCA 2F07A 4M3EA 3IH2A 2VKEA 3BTCA 3G7RA 2XRLA 2JJ7A 2Y31A 4PXIA 5K7HA 2GFNA 2ZCMA 4G12A 3VVYA 4GFKA 5D19A 3F0CA 5CXIA 3HTHA 2X6OA 5FKOA 3BNIA 3VW0A 5F27A 5IOZA 4B3AA 2XDNA 2RHAA 5IP6A 4ME9A 2UXIA 2XGCA 3LSRA 5FKLA 3P9TA 1RKTA 2DG7A 2ID6A 4XK4A 2XGEA 3C2BA 2ZOYA 3LJLA 3JSJA 5GPCA 3V6GA 2VKVA 3O8GA 2GENA 2WGBA 3FK7A 3ANPA 2QKOA 1RKWA 4L62A 1A6IA 2FBQA 3B6AA 5K58A 3NRGA 4JL3A 5FMPA 5GP9A 2WUIA 2NX4A 2HQ5A 5HSZA 2GUHA 3CDLA 3IH4A 2Y2ZA 3HTJA 2EH3A 3Q3SA 2ZCNA 3CWRA 4ABZA 3PM1A 3G1MA 1Z77A 3VVZA 1QVUA 5HBUA 5F08A 5EFYA 2DG8A 3IH3A 1SGMA 5HAWA 4M3FA 3BJBA 3GEUA 1U9OA 3DEWA 3IUVA 4W1UA 4M3BA 5EZGA 4D7MA 3BTLA 2RASA 3HTIA 2VPRA 2O7TA 2V57A 5F0FA 3G56A 2OF7A 5FKNA 3Q0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKC A;  2HYT A;  2QTQ A;  3VVX A;  3ZQI A;  1RPW A;  4HKU A;  3BHQ A;  3KKD A;  3TP0 A;  5D18 A;  2HKU A;  3C07 A;  1JUS A;  3B6C A;  3CRJ A;  2IBD A;  4ACI A;  3NI7 A;  4GCK A;  3E7Q A;  3ON2 A;  2PBX A;  3G1O A;  3BCG A;  5IPA A;  3VPR A;  5J1Y A;  2XPV A;  5F0H A;  3LWJ A;  2PZ9 A;  3MVP A;  3T6N A;  4GCT A;  3EUP A;  4AC0 A;  5CW8 A;  3AQS A;  3QQA A;  4AUX A;  2ZB9 A;  4GCL A;  1QPI A;  3WHB A;  3VUQ A;  3O8H A;  4MK6 A;  5CXG A;  4D5C A;  1UI5 A;  4JYK A;  5H9T A;  2NP3 A;  3HGY A;  5EZH A;  3DPJ A;  4AC6 A;  3FIW A;  1JTX A;  3BR0 A;  4MO7 A;  2O7O A;  3ON4 A;  2XPU A;  1JUM A;  3CCY A;  4DW6 A;  5FHP A;  5GPA A;  3BT9 A;  4V2G A;  5DAJ A;  3MNL A;  3BR3 A;  2OPT A;  2DTZ A;  3QKX A;  3VP5 A;  3BR6 A;  3O60 A;  4D5F A;  3VIB A;  3VW2 A;  3CJD A;  3VOX A;  2D6Y A;  4V2F A;  3HE0 A;  5FKM A;  3B81 A;  3VOK A;  2JK3 A;  2UXO A;  3NPI A;  4UDS A;  1JT0 A;  2Y30 A;  3PPB A;  2NP5 A;  3FRQ A;  2X9D A;  1ZK8 A;  1T33 A;  4AF5 A;  4CGR A;  1T56 A;  2IU5 A;  4X1E A;  2NS7 A;  2NS8 A;  4GFL A;  2W53 A;  4YZE A;  2ZOZ A;  4MXM A;  2FD5 A;  2TCT A;  1JUP A;  2OI8 A;  3LSP A;  2ID3 A;  5F0C A;  3RH2 A;  2RAE A;  3QPS A;  3KZ9 A;  2HXO A;  3ZQG A;  5F04 A;  2I10 A;  3TP3 A;  2G7G A;  3V78 A;  2G0E A;  3VW1 A;  3F1B A;  2QWT A;  4NN1 A;  3ANG A;  4W97 A;  5J1R A;  4JKZ A;  3QPL A;  4B1R A;  3QBM A;  1QVT A;  3Q0W A;  1JTY A;  3WHC A;  3AQT A;  3RD3 A;  5EYR A;  4M3G A;  1JT6 A;  2YVH A;  4ICH A;  2YVE A;  5K7F A;  2UXU A;  3BR2 A;  2G7S A;  3BTI A;  3ZQH A;  3GZI A;  3BTJ A;  4JNN A;  1VI0 A;  3Q0V A;  4KWA A;  5J1U A;  3FK6 A;  5D1R A;  1Z0X A;  5AQC A;  3LSJ A;  1ZKG A;  2FX0 A;  1ORK A;  5C4Y A;  2GBY A;  2G7L A;  2QIB A;  3G1L A;  3LHQ A;  5FGL A;  2QOP A;  5J3L A;  2Q24 A;  5FKK A;  3NNR A;  2IEK A;  2G3B A;  1UI6 A;  4I6Z A;  3DCF A;  5F1J A;  2UXP A;  2TRT A;  4NEL A;  3S5R A;  1BJZ A;  3HTA A;  4I76 A;  3ZQL A;  3SFI A;  3ZQF A;  3BQZ A;  3EGQ A;  3BQY A;  3COL A;  2REK A;  3BR5 A;  2XGD A;  2XB5 A;  3BR1 A;  2FJ1 A;  2HXI A;  2FQ4 A;  2UXH A;  2XPW A;  3BRU A;  5K7Z A;  3HGG A;  2ZCX A;  5IOY A;  4D7N A;  2IAI A;  2OER A;  3KNW A;  3HIM A;  2HYJ A;  3LOC A;  2QCO A;  4M3D A;  3SDG A;  2WV1 A;  1U9N A;  3PAS A;  3NXC A;  2F07 A;  4M3E A;  3IH2 A;  2VKE A;  3BTC A;  3G7R A;  2XRL A;  2JJ7 A;  2Y31 A;  4PXI A;  5K7H A;  2GFN A;  2ZCM A;  4G12 A;  3VVY A;  4GFK A;  5D19 A;  3F0C A;  5CXI A;  3HTH A;  2X6O A;  5FKO A;  3BNI A;  3VW0 A;  5F27 A;  5IOZ A;  4B3A A;  2XDN A;  2RHA A;  5IP6 A;  4ME9 A;  2UXI A;  2XGC A;  3LSR A;  5FKL A;  3P9T A;  1RKT A;  2DG7 A;  2ID6 A;  4XK4 A;  2XGE A;  3C2B A;  2ZOY A;  3LJL A;  3JSJ A;  5GPC A;  3V6G A;  2VKV A;  3O8G A;  2GEN A;  2WGB A;  3FK7 A;  3ANP A;  2QKO A;  1RKW A;  4L62 A;  1A6I A;  2FBQ A;  3B6A A;  5K58 A;  3NRG A;  4JL3 A;  5FMP A;  5GP9 A;  2WUI A;  2NX4 A;  2HQ5 A;  5HSZ A;  2GUH A;  3CDL A;  3IH4 A;  2Y2Z A;  3HTJ A;  2EH3 A;  3Q3S A;  2ZCN A;  3CWR A;  4ABZ A;  3PM1 A;  3G1M A;  1Z77 A;  3VVZ A;  1QVU A;  5HBU A;  5F08 A;  5EFY A;  2DG8 A;  3IH3 A;  1SGM A;  5HAW A;  4M3F A;  3BJB A;  3GEU A;  1U9O A;  3DEW A;  3IUV A;  4W1U A;  4M3B A;  5EZG A;  4D7M A;  3BTL A;  2RAS A;  3HTI A;  2VPR A;  2O7T A;  2V57 A;  5F0F A;  3G56 A;  2OF7 A;  5FKN A;  3Q0U A; 
#chains in the Genus database with same CATH topology
 3KKC A;  2HYT A;  2QTQ A;  3VVX A;  3ZQI A;  1RPW A;  4HKU A;  3BHQ A;  3DU5 A;  3KKD A;  3TP0 A;  5D18 A;  2HKU A;  3C07 A;  1JUS A;  3B6C A;  2B3W A;  3CRJ A;  2IBD A;  4ACI A;  3NI7 A;  4GCK A;  3E7Q A;  3ON2 A;  5CQG A;  2PBX A;  2PFV A;  3G1O A;  3BCG A;  5IPA A;  3VPR A;  5J1Y A;  2XPV A;  2R7R A;  2R7U A;  5F0H A;  3LWJ A;  2PZ9 A;  3MVP A;  3T6N A;  3FHN A;  4GCT A;  3EUP A;  4AC0 A;  5CW8 A;  3AQS A;  3QQA A;  4AUX A;  2ZB9 A;  4GCL A;  1QPI A;  3WHB A;  3VUQ A;  3O8H A;  4MK6 A;  5CXG A;  4D5C A;  1UI5 A;  4JYK A;  5H9T A;  2NP3 A;  3HGY A;  5EZH A;  3DPJ A;  4AC6 A;  3FIW A;  1JTX A;  2R7S A;  3NS4 A;  3VTI A;  3BR0 A;  4MO7 A;  2O7O A;  3ON4 A;  2XPU A;  1JUM A;  3CCY A;  4DW6 A;  5FHP A;  5GPA A;  3BT9 A;  4V2G A;  5DAJ A;  3MNL A;  3BR3 A;  2OPT A;  2DTZ A;  3QKX A;  3VP5 A;  3BR6 A;  3O60 A;  4D5F A;  3VIB A;  3VW2 A;  3CJD A;  3VOX A;  2D6Y A;  4V2F A;  3HE0 A;  5FKM A;  3B81 A;  3VOK A;  2JK3 A;  2UXO A;  2A2F X;  3NPI A;  4UDS A;  1JT0 A;  2Y30 A;  3PPB A;  2NP5 A;  3FRQ A;  2X9D A;  1ZK8 A;  1T33 A;  2R7Q A;  4U9L A;  4AF5 A;  4CGR A;  1T56 A;  2IU5 A;  4X1E A;  2NS7 A;  2NS8 A;  4GFL A;  2W53 A;  4YZE A;  2ZOZ A;  2R7W A;  4MXM A;  2FD5 A;  2TCT A;  1JUP A;  2OI8 A;  3LSP A;  2ID3 A;  5F0C A;  3RH2 A;  2RAE A;  3QPS A;  3KZ9 A;  2HXO A;  3ZQG A;  5F04 A;  4OD5 A;  2I10 A;  3TP3 A;  2G7G A;  3V78 A;  2G0E A;  3VW1 A;  3F1B A;  2QWT A;  4NN1 A;  3ANG A;  4W97 A;  5J1R A;  4JKZ A;  2FJI 1;  3QPL A;  4B1R A;  3QBM A;  1QVT A;  3Q0W A;  1JTY A;  3WHC A;  3AQT A;  3RD3 A;  5EYR A;  4M3G A;  1JT6 A;  2YVH A;  4ICH A;  2YVE A;  2R7X A;  5K7F A;  2UXU A;  3BR2 A;  2G7S A;  3BTI A;  3ZQH A;  3GZI A;  3BTJ A;  4JNN A;  1VI0 A;  3Q0V A;  4KWA A;  2R7O A;  5J1U A;  3FK6 A;  5D1R A;  1Z0X A;  5AQC A;  3LSJ A;  1ZKG A;  4OD4 A;  2FX0 A;  1ORK A;  2YVX A;  5C4Y A;  2GBY A;  2G7L A;  2QIB A;  3G1L A;  3LHQ A;  5FGL A;  2QOP A;  5J3L A;  2Q24 A;  5FKK A;  3NNR A;  2IEK A;  2G3B A;  1UI6 A;  4I6Z A;  3DCF A;  5F1J A;  2UXP A;  2TRT A;  4NEL A;  3S5R A;  1BJZ A;  3HTA A;  4I76 A;  3ZQL A;  3SFI A;  3ZQF A;  3BQZ A;  3EGQ A;  3BQY A;  3COL A;  2REK A;  3BR5 A;  2XGD A;  2XB5 A;  3BR1 A;  2FJ1 A;  2HXI A;  2FQ4 A;  2UXH A;  2XPW A;  3BRU A;  5K7Z A;  3HGG A;  2ZCX A;  5IOY A;  4D7N A;  2IAI A;  2OER A;  3KNW A;  3HIM A;  2HYJ A;  4C2M A;  3LOC A;  2QCO A;  4M3D A;  3SDG A;  2WV1 A;  3DU6 A;  1U9N A;  3PAS A;  3NXC A;  2F07 A;  4M3E A;  3IH2 A;  2VKE A;  4IRV A;  3BTC A;  3G7R A;  2XRL A;  2JJ7 A;  2Y31 A;  4PXI A;  5K7H A;  2GFN A;  2ZCM A;  4G12 A;  3VVY A;  4DVY P;  4GFK A;  5D19 A;  3F0C A;  5CXI A;  3HTH A;  2X6O A;  5FKO A;  3BNI A;  3VW0 A;  5F27 A;  5IOZ A;  4B3A A;  2XDN A;  2RHA A;  5IP6 A;  4ME9 A;  2UXI A;  2XGC A;  3LSR A;  5FKL A;  3P9T A;  1RKT A;  2DG7 A;  2ID6 A;  2R7V A;  4XK4 A;  2XGE A;  3C2B A;  2ZOY A;  3LJL A;  3JSJ A;  5GPC A;  3V6G A;  2VKV A;  3O8G A;  2GEN A;  2WGB A;  3FK7 A;  3ANP A;  2QKO A;  4U9N A;  1RKW A;  4L62 A;  1A6I A;  2FBQ A;  3B6A A;  3K8P C;  5K58 A;  3NRG A;  4JL3 A;  5FMP A;  5GP9 A;  2WUI A;  2NX4 A;  2HQ5 A;  5HSZ A;  2GUH A;  2R7T A;  3CDL A;  3IH4 A;  2Y2Z A;  3HTJ A;  2EH3 A;  3Q3S A;  2ZCN A;  3CWR A;  4ABZ A;  3PM1 A;  3G1M A;  1Z77 A;  3VVZ A;  1QVU A;  5HBU A;  5F08 A;  5EFY A;  2DG8 A;  3IH3 A;  1SGM A;  5HAW A;  4M3F A;  4WIB A;  3BJB A;  3GEU A;  1U9O A;  3DEW A;  3IUV A;  3SWH A;  4W1U A;  4M3B A;  5EZG A;  4D7M A;  3BTL A;  2RAS A;  3HTI A;  2VPR A;  2O7T A;  2V57 A;  2ZY9 A;  5F0F A;  3G56 A;  2OF7 A;  3KYL A;  5FKN A;  2B1E A;  3Q0U A; 
#chains in the Genus database with same CATH homology
 3KKC A;  2HYT A;  2QTQ A;  3VVX A;  3ZQI A;  1RPW A;  4HKU A;  3BHQ A;  3KKD A;  3TP0 A;  5D18 A;  2HKU A;  3C07 A;  1JUS A;  3B6C A;  3CRJ A;  2IBD A;  4ACI A;  3NI7 A;  4GCK A;  3E7Q A;  3ON2 A;  2PBX A;  3G1O A;  3BCG A;  5IPA A;  3VPR A;  5J1Y A;  2XPV A;  5F0H A;  3LWJ A;  2PZ9 A;  3MVP A;  3T6N A;  4GCT A;  3EUP A;  4AC0 A;  5CW8 A;  3AQS A;  3QQA A;  4AUX A;  2ZB9 A;  4GCL A;  1QPI A;  3WHB A;  3VUQ A;  3O8H A;  4MK6 A;  5CXG A;  4D5C A;  1UI5 A;  4JYK A;  5H9T A;  2NP3 A;  3HGY A;  5EZH A;  3DPJ A;  4AC6 A;  3FIW A;  1JTX A;  3BR0 A;  4MO7 A;  2O7O A;  3ON4 A;  2XPU A;  1JUM A;  3CCY A;  4DW6 A;  5FHP A;  5GPA A;  3BT9 A;  4V2G A;  5DAJ A;  3MNL A;  3BR3 A;  2OPT A;  2DTZ A;  3QKX A;  3VP5 A;  3BR6 A;  3O60 A;  4D5F A;  3VIB A;  3VW2 A;  3CJD A;  3VOX A;  2D6Y A;  4V2F A;  3HE0 A;  5FKM A;  3B81 A;  3VOK A;  2JK3 A;  2UXO A;  3NPI A;  4UDS A;  1JT0 A;  2Y30 A;  3PPB A;  2NP5 A;  3FRQ A;  2X9D A;  1ZK8 A;  1T33 A;  4AF5 A;  4CGR A;  1T56 A;  2IU5 A;  4X1E A;  2NS7 A;  2NS8 A;  4GFL A;  2W53 A;  4YZE A;  2ZOZ A;  4MXM A;  2FD5 A;  2TCT A;  1JUP A;  2OI8 A;  3LSP A;  2ID3 A;  5F0C A;  3RH2 A;  2RAE A;  3QPS A;  3KZ9 A;  2HXO A;  3ZQG A;  5F04 A;  2I10 A;  3TP3 A;  2G7G A;  3V78 A;  2G0E A;  3VW1 A;  3F1B A;  2QWT A;  4NN1 A;  3ANG A;  4W97 A;  5J1R A;  4JKZ A;  3QPL A;  4B1R A;  3QBM A;  1QVT A;  3Q0W A;  1JTY A;  3WHC A;  3AQT A;  3RD3 A;  5EYR A;  4M3G A;  1JT6 A;  2YVH A;  4ICH A;  2YVE A;  5K7F A;  2UXU A;  3BR2 A;  2G7S A;  3BTI A;  3ZQH A;  3GZI A;  3BTJ A;  4JNN A;  1VI0 A;  3Q0V A;  4KWA A;  5J1U A;  3FK6 A;  5D1R A;  1Z0X A;  5AQC A;  3LSJ A;  1ZKG A;  2FX0 A;  1ORK A;  5C4Y A;  2GBY A;  2G7L A;  2QIB A;  3G1L A;  3LHQ A;  5FGL A;  2QOP A;  5J3L A;  2Q24 A;  5FKK A;  3NNR A;  2IEK A;  2G3B A;  1UI6 A;  4I6Z A;  3DCF A;  5F1J A;  2UXP A;  2TRT A;  4NEL A;  3S5R A;  1BJZ A;  3HTA A;  4I76 A;  3ZQL A;  3SFI A;  3ZQF A;  3BQZ A;  3EGQ A;  3BQY A;  3COL A;  2REK A;  3BR5 A;  2XGD A;  2XB5 A;  3BR1 A;  2FJ1 A;  2HXI A;  2FQ4 A;  2UXH A;  2XPW A;  3BRU A;  5K7Z A;  3HGG A;  2ZCX A;  5IOY A;  4D7N A;  2IAI A;  2OER A;  3KNW A;  3HIM A;  2HYJ A;  3LOC A;  2QCO A;  4M3D A;  3SDG A;  2WV1 A;  1U9N A;  3PAS A;  3NXC A;  2F07 A;  4M3E A;  3IH2 A;  2VKE A;  3BTC A;  3G7R A;  2XRL A;  2JJ7 A;  2Y31 A;  4PXI A;  5K7H A;  2GFN A;  2ZCM A;  4G12 A;  3VVY A;  4GFK A;  5D19 A;  3F0C A;  5CXI A;  3HTH A;  2X6O A;  5FKO A;  3BNI A;  3VW0 A;  5F27 A;  5IOZ A;  4B3A A;  2XDN A;  2RHA A;  5IP6 A;  4ME9 A;  2UXI A;  2XGC A;  3LSR A;  5FKL A;  3P9T A;  1RKT A;  2DG7 A;  2ID6 A;  4XK4 A;  2XGE A;  3C2B A;  2ZOY A;  3LJL A;  3JSJ A;  5GPC A;  3V6G A;  2VKV A;  3O8G A;  2GEN A;  2WGB A;  3FK7 A;  3ANP A;  2QKO A;  1RKW A;  4L62 A;  1A6I A;  2FBQ A;  3B6A A;  5K58 A;  3NRG A;  4JL3 A;  5FMP A;  5GP9 A;  2WUI A;  2NX4 A;  2HQ5 A;  5HSZ A;  2GUH A;  3CDL A;  3IH4 A;  2Y2Z A;  3HTJ A;  2EH3 A;  3Q3S A;  2ZCN A;  3CWR A;  4ABZ A;  3PM1 A;  3G1M A;  1Z77 A;  3VVZ A;  1QVU A;  5HBU A;  5F08 A;  5EFY A;  2DG8 A;  3IH3 A;  1SGM A;  5HAW A;  4M3F A;  3BJB A;  3GEU A;  1U9O A;  3DEW A;  3IUV A;  4W1U A;  4M3B A;  5EZG A;  4D7M A;  3BTL A;  2RAS A;  3HTI A;  2VPR A;  2O7T A;  2V57 A;  5F0F A;  3G56 A;  2OF7 A;  5FKN A;  3Q0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...