5FGLA

Co-crystal structure of nicr2_hsp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
200
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NicR
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
total genus 84
structure length 200
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fglA00
1QPIA 2VKVA 2PZ9A 4JL3A 3BR0A 2PBXA 3NPIA 5IPAA 2FX0A 2JK3A 5D19A 3COLA 5CXIA 5F08A 3BHQA 2FD5A 4W1UA 5F27A 1JTXA 1JUMA 5IOZA 2HKUA 2VPRA 3Q0VA 5K58A 2FBQA 5EYRA 3VVXA 4JYKA 4B3AA 1ZK8A 3VPRA 3BR2A 3IH3A 4GCLA 2QWTA 5IOYA 5HAWA 5K7ZA 3Q3SA 5CXGA 2HQ5A 3VIBA 4DW6A 3G7RA 2G7GA 3ANGA 5GP9A 5EFYA 3NNRA 4JNNA 2IBDA 4GFLA 4AC0A 2RAEA 2UXUA 2GFNA 2YVEA 2TRTA 3AQSA 1T56A 4W97A 4D5FA 3PPBA 3VP5A 3FK7A 4G12A 4AF5A 3ZQLA 1Z77A 3ZQFA 5D18A 3QKXA 3V78A 3O8HA 5AQCA 2X9DA 1ORKA 5FGLA 5J1UA 5F0FA 5IP6A 4AC6A 1RKWA 3G1LA 3ANPA 4UDSA 2NS7A 3BRUA 2OPTA 3FK6A 2VKEA 3HGGA 1JT0A 4MK6A 2O7TA 5K7HA 5EZGA 3WHBA 1UI6A 2IU5A 4HKUA 1QVUA 3KKCA 2XRLA 2ZOZA 2XGCA 1A6IA 2NP3A 2WV1A 3JSJA 3BNIA 3BR5A 4CGRA 1RPWA 2FQ4A 1JUPA 3IH2A 4AUXA 3RH2A 3S5RA 2OERA 2TCTA 2ZOYA 3PM1A 2I10A 3Q0UA 3ON2A 3HGYA 4D5CA 2JJ7A 5H9TA 3NRGA 5GPCA 3BTLA 2YVHA 4L62A 3LWJA 3BR3A 2IEKA 3VOKA 3O60A 2HXOA 2V57A 3ZQGA 2G7LA 5J3LA 1U9OA 5CW8A 3LOCA 2QCOA 2QIBA 3ZQIA 2G7SA 3SFIA 2WGBA 3VW1A 4M3BA 3DPJA 4NN1A 3NI7A 3V6GA 1QVTA 4JKZA 2Y2ZA 2QOPA 3VW0A 1SGMA 3DEWA 3HIMA 3DCFA 1JTYA 3TP3A 3B81A 4ABZA 4B1RA 2UXOA 2DG8A 2FJ1A 4XK4A 2ID6A 5F04A 2XGEA 2G3BA 2F07A 2UXHA 3EUPA 3G1OA 3IH4A 3IUVA 4GCTA 2XDNA 4D7MA 2D6YA 5HSZA 2DG7A 3G1MA 3VVYA 3QBMA 1JT6A 3E7QA 1U9NA 3B6AA 2ID3A 3CCYA 3NXCA 2ZB9A 1UI5A 3TP0A 4M3DA 3BR6A 1RKTA 2QTQA 2OI8A 3HTHA 3P9TA 3F0CA 3HTAA 2XB5A 3BTIA 3GZIA 2UXPA 3ON4A 3CJDA 2QKOA 5J1RA 4PXIA 5HBUA 3MVPA 4M3GA 3MNLA 3BTCA 3BJBA 3O8GA 2G0EA 3Q0WA 2Y31A 2GUHA 4ACIA 4X1EA 2XPUA 5EZHA 5D1RA 1VI0A 2RHAA 3QPLA 3RD3A 3BTJA 2X6OA 4MO7A 4I6ZA 3VVZA 3VW2A 2UXIA 3AQTA 1T33A 2ZCNA 3GEUA 4KWAA 3C2BA 2GENA 3B6CA 4ME9A 1ZKGA 3VOXA 5F0HA 3EGQA 3KZ9A 3G56A 3SDGA 1BJZA 2NS8A 3LSPA 2Y30A 2OF7A 2ZCXA 3HTIA 2NX4A 3C07A 5FKNA 2W53A 3T6NA 5FKLA 5FHPA 3F1BA 3HE0A 5FKOA 3KNWA 2ZCMA 2EH3A 4V2GA 2DTZA 1Z0XA 5FMPA 3FIWA 2RASA 4V2FA 4M3FA 3KKDA 2REKA 4M3EA 5J1YA 3CDLA 4MXMA 2XPWA 3PASA 4D7NA 4GCKA 4GFKA 3QPSA 5F1JA 5F0CA 2HYTA 5FKMA 3LJLA 4I76A 3BR1A 2XGDA 3LHQA 3FRQA 3BQYA 2WUIA 3WHCA 3QQAA 3HTJA 5K7FA 5C4YA 2O7OA 2XPVA 2NP5A 4NELA 3ZQHA 5DAJA 3LSRA 2IAIA 5FKKA 4ICHA 2HYJA 3CRJA 3CWRA 2GBYA 2Q24A 2HXIA 5GPAA 3LSJA 4YZEA 3BT9A 1JUSA 3BCGA 3BQZA 3VUQA
chains in the Genus database with same CATH superfamily
1QPIA 2VKVA 2PZ9A 4JL3A 3BR0A 2PBXA 3NPIA 5IPAA 3SWHA 2FX0A 2JK3A 5D19A 3COLA 5CXIA 5F08A 3BHQA 2FD5A 4W1UA 5F27A 1JTXA 1JUMA 5IOZA 2HKUA 2VPRA 3Q0VA 5K58A 2FBQA 5EYRA 2B1EA 3VVXA 4JYKA 4B3AA 1ZK8A 3VPRA 3BR2A 3IH3A 4GCLA 2QWTA 5IOYA 5HAWA 5K7ZA 2PFVA 3Q3SA 5CXGA 2HQ5A 3VIBA 4DW6A 3G7RA 2G7GA 3ANGA 5GP9A 5EFYA 3NNRA 4JNNA 4DVYP 2IBDA 4GFLA 3VTIA 4AC0A 2RAEA 2UXUA 2YVXA 2GFNA 2YVEA 2TRTA 3AQSA 1T56A 4W97A 4D5FA 3PPBA 3VP5A 3FK7A 4G12A 4AF5A 3ZQLA 1Z77A 3ZQFA 5D18A 3QKXA 2FJI1 3V78A 3O8HA 5AQCA 2X9DA 1ORKA 5FGLA 5J1UA 5F0FA 5IP6A 4AC6A 1RKWA 3G1LA 3ANPA 4UDSA 2NS7A 3BRUA 4U9NA 2OPTA 3FK6A 2VKEA 3HGGA 1JT0A 2ZY9A 4MK6A 2O7TA 2R7TA 5K7HA 5EZGA 4C2MA 3WHBA 1UI6A 2IU5A 4HKUA 1QVUA 3KKCA 2XRLA 2ZOZA 2XGCA 1A6IA 2NP3A 2WV1A 3JSJA 3BNIA 3BR5A 4CGRA 1RPWA 2FQ4A 1JUPA 3IH2A 4AUXA 3RH2A 3S5RA 2OERA 2TCTA 2ZOYA 3PM1A 2I10A 3Q0UA 3ON2A 3HGYA 4D5CA 2JJ7A 5H9TA 3NRGA 5GPCA 3BTLA 2YVHA 4L62A 3LWJA 3BR3A 2IEKA 2R7QA 3VOKA 3O60A 2HXOA 2V57A 3ZQGA 2G7LA 5J3LA 1U9OA 5CW8A 2A2FX 3LOCA 2QCOA 2QIBA 3ZQIA 2G7SA 3SFIA 2WGBA 4M3BA 3VW1A 3DPJA 4NN1A 3NI7A 3V6GA 1QVTA 4JKZA 2Y2ZA 2QOPA 3VW0A 1SGMA 3DEWA 3HIMA 3DCFA 3DU6A 1JTYA 3TP3A 3B81A 4ABZA 4B1RA 4WIBA 2UXOA 2DG8A 2R7VA 2FJ1A 4XK4A 2ID6A 5F04A 2XGEA 2B3WA 2G3BA 2F07A 2UXHA 3EUPA 3G1OA 3IH4A 3IUVA 4GCTA 2XDNA 4D7MA 2D6YA 5HSZA 2DG7A 3G1MA 3VVYA 3QBMA 4IRVA 1JT6A 3E7QA 1U9NA 3DU5A 3B6AA 2ID3A 3CCYA 3NXCA 2ZB9A 1UI5A 3TP0A 2R7SA 4M3DA 3BR6A 1RKTA 2QTQA 2OI8A 3HTHA 3P9TA 3F0CA 3HTAA 2XB5A 3BTIA 3GZIA 2UXPA 3ON4A 3CJDA 2QKOA 4U9LA 5J1RA 4PXIA 5HBUA 3MVPA 4M3GA 3NS4A 3MNLA 3BTCA 3BJBA 3O8GA 2G0EA 3Q0WA 2Y31A 2GUHA 4ACIA 4X1EA 2XPUA 5EZHA 5D1RA 1VI0A 2RHAA 3QPLA 3RD3A 3BTJA 2X6OA 4MO7A 4I6ZA 3VVZA 3VW2A 2UXIA 2R7WA 3AQTA 1T33A 2ZCNA 3KYLA 3GEUA 4KWAA 3C2BA 2GENA 3B6CA 4ME9A 3FHNA 1ZKGA 3VOXA 5F0HA 3EGQA 4OD4A 3KZ9A 3G56A 3SDGA 1BJZA 2NS8A 3LSPA 2R7OA 2Y30A 2OF7A 2ZCXA 3HTIA 3K8PC 2NX4A 4OD5A 3C07A 5FKNA 2W53A 3T6NA 5FKLA 5FHPA 3F1BA 3HE0A 5FKOA 3KNWA 2ZCMA 2EH3A 4V2GA 2DTZA 1Z0XA 5FMPA 2R7UA 3FIWA 2RASA 4V2FA 4M3FA 3KKDA 2REKA 4M3EA 5J1YA 3CDLA 4MXMA 2XPWA 3PASA 4D7NA 4GCKA 4GFKA 3QPSA 5F1JA 5F0CA 2HYTA 5FKMA 3LJLA 4I76A 3BR1A 2XGDA 2R7XA 3LHQA 3FRQA 3BQYA 2WUIA 3WHCA 3QQAA 3HTJA 5K7FA 5C4YA 2O7OA 2XPVA 2NP5A 4NELA 3ZQHA 5DAJA 3LSRA 2IAIA 5FKKA 4ICHA 2R7RA 2HYJA 3CRJA 3CWRA 2GBYA 2Q24A 2HXIA 5GPAA 3LSJA 5CQGA 4YZEA 3BT9A 1JUSA 3BCGA 3BQZA 3VUQA
chains in the Genus database with same CATH topology
1QPIA 2VKVA 2PZ9A 4JL3A 3BR0A 2PBXA 3NPIA 5IPAA 2FX0A 2JK3A 5D19A 3COLA 5CXIA 5F08A 3BHQA 2FD5A 4W1UA 5F27A 1JTXA 1JUMA 5IOZA 2HKUA 2VPRA 3Q0VA 5K58A 2FBQA 5EYRA 3VVXA 4JYKA 4B3AA 1ZK8A 3VPRA 3BR2A 3IH3A 4GCLA 2QWTA 5IOYA 5HAWA 5K7ZA 3Q3SA 5CXGA 2HQ5A 3VIBA 4DW6A 3G7RA 2G7GA 3ANGA 5GP9A 5EFYA 3NNRA 4JNNA 2IBDA 4GFLA 4AC0A 2RAEA 2UXUA 2GFNA 2YVEA 2TRTA 3AQSA 1T56A 4W97A 4D5FA 3PPBA 3VP5A 3FK7A 4G12A 4AF5A 3ZQLA 1Z77A 3ZQFA 5D18A 3QKXA 3V78A 3O8HA 5AQCA 2X9DA 1ORKA 5FGLA 5J1UA 5F0FA 5IP6A 4AC6A 1RKWA 3G1LA 3ANPA 4UDSA 2NS7A 3BRUA 2OPTA 3FK6A 2VKEA 3HGGA 1JT0A 4MK6A 2O7TA 5K7HA 5EZGA 3WHBA 1UI6A 2IU5A 4HKUA 1QVUA 3KKCA 2XRLA 2ZOZA 2XGCA 1A6IA 2NP3A 2WV1A 3JSJA 3BNIA 3BR5A 4CGRA 1RPWA 2FQ4A 1JUPA 3IH2A 4AUXA 3RH2A 3S5RA 2OERA 2TCTA 2ZOYA 3PM1A 2I10A 3Q0UA 3ON2A 3HGYA 4D5CA 2JJ7A 5H9TA 3NRGA 5GPCA 3BTLA 2YVHA 4L62A 3LWJA 3BR3A 2IEKA 3VOKA 3O60A 2HXOA 2V57A 3ZQGA 2G7LA 5J3LA 1U9OA 5CW8A 3LOCA 2QCOA 2QIBA 3ZQIA 2G7SA 3SFIA 2WGBA 3VW1A 4M3BA 3DPJA 4NN1A 3NI7A 3V6GA 1QVTA 4JKZA 2Y2ZA 2QOPA 3VW0A 1SGMA 3DEWA 3HIMA 3DCFA 1JTYA 3TP3A 3B81A 4ABZA 4B1RA 2UXOA 2DG8A 2FJ1A 4XK4A 2ID6A 5F04A 2XGEA 2G3BA 2F07A 2UXHA 3EUPA 3G1OA 3IH4A 3IUVA 4GCTA 2XDNA 4D7MA 2D6YA 5HSZA 2DG7A 3G1MA 3VVYA 3QBMA 1JT6A 3E7QA 1U9NA 3B6AA 2ID3A 3CCYA 3NXCA 2ZB9A 1UI5A 3TP0A 4M3DA 3BR6A 1RKTA 2QTQA 2OI8A 3HTHA 3P9TA 3F0CA 3HTAA 2XB5A 3BTIA 3GZIA 2UXPA 3ON4A 3CJDA 2QKOA 5J1RA 4PXIA 5HBUA 3MVPA 4M3GA 3MNLA 3BTCA 3BJBA 3O8GA 2G0EA 3Q0WA 2Y31A 2GUHA 4ACIA 4X1EA 2XPUA 5EZHA 5D1RA 1VI0A 2RHAA 3QPLA 3RD3A 3BTJA 2X6OA 4MO7A 4I6ZA 3VVZA 3VW2A 2UXIA 3AQTA 1T33A 2ZCNA 3GEUA 4KWAA 3C2BA 2GENA 3B6CA 4ME9A 1ZKGA 3VOXA 5F0HA 3EGQA 3KZ9A 3G56A 3SDGA 1BJZA 2NS8A 3LSPA 2Y30A 2OF7A 2ZCXA 3HTIA 2NX4A 3C07A 5FKNA 2W53A 3T6NA 5FKLA 5FHPA 3F1BA 3HE0A 5FKOA 3KNWA 2ZCMA 2EH3A 4V2GA 2DTZA 1Z0XA 5FMPA 3FIWA 2RASA 4V2FA 4M3FA 3KKDA 2REKA 4M3EA 5J1YA 3CDLA 4MXMA 2XPWA 3PASA 4D7NA 4GCKA 4GFKA 3QPSA 5F1JA 5F0CA 2HYTA 5FKMA 3LJLA 4I76A 3BR1A 2XGDA 3LHQA 3FRQA 3BQYA 2WUIA 3WHCA 3QQAA 3HTJA 5K7FA 5C4YA 2O7OA 2XPVA 2NP5A 4NELA 3ZQHA 5DAJA 3LSRA 2IAIA 5FKKA 4ICHA 2HYJA 3CRJA 3CWRA 2GBYA 2Q24A 2HXIA 5GPAA 3LSJA 4YZEA 3BT9A 1JUSA 3BCGA 3BQZA 3VUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPI A;  2VKV A;  2PZ9 A;  4JL3 A;  3BR0 A;  2PBX A;  3NPI A;  5IPA A;  2FX0 A;  2JK3 A;  5D19 A;  3COL A;  5CXI A;  5F08 A;  3BHQ A;  2FD5 A;  4W1U A;  5F27 A;  1JTX A;  1JUM A;  5IOZ A;  2HKU A;  2VPR A;  3Q0V A;  5K58 A;  2FBQ A;  5EYR A;  3VVX A;  4JYK A;  4B3A A;  1ZK8 A;  3VPR A;  3BR2 A;  3IH3 A;  4GCL A;  2QWT A;  5IOY A;  5HAW A;  5K7Z A;  3Q3S A;  5CXG A;  2HQ5 A;  3VIB A;  4DW6 A;  3G7R A;  2G7G A;  3ANG A;  5GP9 A;  5EFY A;  3NNR A;  4JNN A;  2IBD A;  4GFL A;  4AC0 A;  2RAE A;  2UXU A;  2GFN A;  2YVE A;  2TRT A;  3AQS A;  1T56 A;  4W97 A;  4D5F A;  3PPB A;  3VP5 A;  3FK7 A;  4G12 A;  4AF5 A;  3ZQL A;  1Z77 A;  3ZQF A;  5D18 A;  3QKX A;  3V78 A;  3O8H A;  5AQC A;  2X9D A;  1ORK A;  5FGL A;  5J1U A;  5F0F A;  5IP6 A;  4AC6 A;  1RKW A;  3G1L A;  3ANP A;  4UDS A;  2NS7 A;  3BRU A;  2OPT A;  3FK6 A;  2VKE A;  3HGG A;  1JT0 A;  4MK6 A;  2O7T A;  5K7H A;  5EZG A;  3WHB A;  1UI6 A;  2IU5 A;  4HKU A;  1QVU A;  3KKC A;  2XRL A;  2ZOZ A;  2XGC A;  1A6I A;  2NP3 A;  2WV1 A;  3JSJ A;  3BNI A;  3BR5 A;  4CGR A;  1RPW A;  2FQ4 A;  1JUP A;  3IH2 A;  4AUX A;  3RH2 A;  3S5R A;  2OER A;  2TCT A;  2ZOY A;  3PM1 A;  2I10 A;  3Q0U A;  3ON2 A;  3HGY A;  4D5C A;  2JJ7 A;  5H9T A;  3NRG A;  5GPC A;  3BTL A;  2YVH A;  4L62 A;  3LWJ A;  3BR3 A;  2IEK A;  3VOK A;  3O60 A;  2HXO A;  2V57 A;  3ZQG A;  2G7L A;  5J3L A;  1U9O A;  5CW8 A;  3LOC A;  2QCO A;  2QIB A;  3ZQI A;  2G7S A;  3SFI A;  2WGB A;  3VW1 A;  4M3B A;  3DPJ A;  4NN1 A;  3NI7 A;  3V6G A;  1QVT A;  4JKZ A;  2Y2Z A;  2QOP A;  3VW0 A;  1SGM A;  3DEW A;  3HIM A;  3DCF A;  1JTY A;  3TP3 A;  3B81 A;  4ABZ A;  4B1R A;  2UXO A;  2DG8 A;  2FJ1 A;  4XK4 A;  2ID6 A;  5F04 A;  2XGE A;  2G3B A;  2F07 A;  2UXH A;  3EUP A;  3G1O A;  3IH4 A;  3IUV A;  4GCT A;  2XDN A;  4D7M A;  2D6Y A;  5HSZ A;  2DG7 A;  3G1M A;  3VVY A;  3QBM A;  1JT6 A;  3E7Q A;  1U9N A;  3B6A A;  2ID3 A;  3CCY A;  3NXC A;  2ZB9 A;  1UI5 A;  3TP0 A;  4M3D A;  3BR6 A;  1RKT A;  2QTQ A;  2OI8 A;  3HTH A;  3P9T A;  3F0C A;  3HTA A;  2XB5 A;  3BTI A;  3GZI A;  2UXP A;  3ON4 A;  3CJD A;  2QKO A;  5J1R A;  4PXI A;  5HBU A;  3MVP A;  4M3G A;  3MNL A;  3BTC A;  3BJB A;  3O8G A;  2G0E A;  3Q0W A;  2Y31 A;  2GUH A;  4ACI A;  4X1E A;  2XPU A;  5EZH A;  5D1R A;  1VI0 A;  2RHA A;  3QPL A;  3RD3 A;  3BTJ A;  2X6O A;  4MO7 A;  4I6Z A;  3VVZ A;  3VW2 A;  2UXI A;  3AQT A;  1T33 A;  2ZCN A;  3GEU A;  4KWA A;  3C2B A;  2GEN A;  3B6C A;  4ME9 A;  1ZKG A;  3VOX A;  5F0H A;  3EGQ A;  3KZ9 A;  3G56 A;  3SDG A;  1BJZ A;  2NS8 A;  3LSP A;  2Y30 A;  2OF7 A;  2ZCX A;  3HTI A;  2NX4 A;  3C07 A;  5FKN A;  2W53 A;  3T6N A;  5FKL A;  5FHP A;  3F1B A;  3HE0 A;  5FKO A;  3KNW A;  2ZCM A;  2EH3 A;  4V2G A;  2DTZ A;  1Z0X A;  5FMP A;  3FIW A;  2RAS A;  4V2F A;  4M3F A;  3KKD A;  2REK A;  4M3E A;  5J1Y A;  3CDL A;  4MXM A;  2XPW A;  3PAS A;  4D7N A;  4GCK A;  4GFK A;  3QPS A;  5F1J A;  5F0C A;  2HYT A;  5FKM A;  3LJL A;  4I76 A;  3BR1 A;  2XGD A;  3LHQ A;  3FRQ A;  3BQY A;  2WUI A;  3WHC A;  3QQA A;  3HTJ A;  5K7F A;  5C4Y A;  2O7O A;  2XPV A;  2NP5 A;  4NEL A;  3ZQH A;  5DAJ A;  3LSR A;  2IAI A;  5FKK A;  4ICH A;  2HYJ A;  3CRJ A;  3CWR A;  2GBY A;  2Q24 A;  2HXI A;  5GPA A;  3LSJ A;  4YZE A;  3BT9 A;  1JUS A;  3BCG A;  3BQZ A;  3VUQ A; 
#chains in the Genus database with same CATH topology
 1QPI A;  2VKV A;  2PZ9 A;  4JL3 A;  3BR0 A;  2PBX A;  3NPI A;  5IPA A;  3SWH A;  2FX0 A;  2JK3 A;  5D19 A;  3COL A;  5CXI A;  5F08 A;  3BHQ A;  2FD5 A;  4W1U A;  5F27 A;  1JTX A;  1JUM A;  5IOZ A;  2HKU A;  2VPR A;  3Q0V A;  5K58 A;  2FBQ A;  5EYR A;  2B1E A;  3VVX A;  4JYK A;  4B3A A;  1ZK8 A;  3VPR A;  3BR2 A;  3IH3 A;  4GCL A;  2QWT A;  5IOY A;  5HAW A;  5K7Z A;  2PFV A;  3Q3S A;  5CXG A;  2HQ5 A;  3VIB A;  4DW6 A;  3G7R A;  2G7G A;  3ANG A;  5GP9 A;  5EFY A;  3NNR A;  4JNN A;  4DVY P;  2IBD A;  4GFL A;  3VTI A;  4AC0 A;  2RAE A;  2UXU A;  2YVX A;  2GFN A;  2YVE A;  2TRT A;  3AQS A;  1T56 A;  4W97 A;  4D5F A;  3PPB A;  3VP5 A;  3FK7 A;  4G12 A;  4AF5 A;  3ZQL A;  1Z77 A;  3ZQF A;  5D18 A;  3QKX A;  2FJI 1;  3V78 A;  3O8H A;  5AQC A;  2X9D A;  1ORK A;  5FGL A;  5J1U A;  5F0F A;  5IP6 A;  4AC6 A;  1RKW A;  3G1L A;  3ANP A;  4UDS A;  2NS7 A;  3BRU A;  4U9N A;  2OPT A;  3FK6 A;  2VKE A;  3HGG A;  1JT0 A;  2ZY9 A;  4MK6 A;  2O7T A;  2R7T A;  5K7H A;  5EZG A;  4C2M A;  3WHB A;  1UI6 A;  2IU5 A;  4HKU A;  1QVU A;  3KKC A;  2XRL A;  2ZOZ A;  2XGC A;  1A6I A;  2NP3 A;  2WV1 A;  3JSJ A;  3BNI A;  3BR5 A;  4CGR A;  1RPW A;  2FQ4 A;  1JUP A;  3IH2 A;  4AUX A;  3RH2 A;  3S5R A;  2OER A;  2TCT A;  2ZOY A;  3PM1 A;  2I10 A;  3Q0U A;  3ON2 A;  3HGY A;  4D5C A;  2JJ7 A;  5H9T A;  3NRG A;  5GPC A;  3BTL A;  2YVH A;  4L62 A;  3LWJ A;  3BR3 A;  2IEK A;  2R7Q A;  3VOK A;  3O60 A;  2HXO A;  2V57 A;  3ZQG A;  2G7L A;  5J3L A;  1U9O A;  5CW8 A;  2A2F X;  3LOC A;  2QCO A;  2QIB A;  3ZQI A;  2G7S A;  3SFI A;  2WGB A;  4M3B A;  3VW1 A;  3DPJ A;  4NN1 A;  3NI7 A;  3V6G A;  1QVT A;  4JKZ A;  2Y2Z A;  2QOP A;  3VW0 A;  1SGM A;  3DEW A;  3HIM A;  3DCF A;  3DU6 A;  1JTY A;  3TP3 A;  3B81 A;  4ABZ A;  4B1R A;  4WIB A;  2UXO A;  2DG8 A;  2R7V A;  2FJ1 A;  4XK4 A;  2ID6 A;  5F04 A;  2XGE A;  2B3W A;  2G3B A;  2F07 A;  2UXH A;  3EUP A;  3G1O A;  3IH4 A;  3IUV A;  4GCT A;  2XDN A;  4D7M A;  2D6Y A;  5HSZ A;  2DG7 A;  3G1M A;  3VVY A;  3QBM A;  4IRV A;  1JT6 A;  3E7Q A;  1U9N A;  3DU5 A;  3B6A A;  2ID3 A;  3CCY A;  3NXC A;  2ZB9 A;  1UI5 A;  3TP0 A;  2R7S A;  4M3D A;  3BR6 A;  1RKT A;  2QTQ A;  2OI8 A;  3HTH A;  3P9T A;  3F0C A;  3HTA A;  2XB5 A;  3BTI A;  3GZI A;  2UXP A;  3ON4 A;  3CJD A;  2QKO A;  4U9L A;  5J1R A;  4PXI A;  5HBU A;  3MVP A;  4M3G A;  3NS4 A;  3MNL A;  3BTC A;  3BJB A;  3O8G A;  2G0E A;  3Q0W A;  2Y31 A;  2GUH A;  4ACI A;  4X1E A;  2XPU A;  5EZH A;  5D1R A;  1VI0 A;  2RHA A;  3QPL A;  3RD3 A;  3BTJ A;  2X6O A;  4MO7 A;  4I6Z A;  3VVZ A;  3VW2 A;  2UXI A;  2R7W A;  3AQT A;  1T33 A;  2ZCN A;  3KYL A;  3GEU A;  4KWA A;  3C2B A;  2GEN A;  3B6C A;  4ME9 A;  3FHN A;  1ZKG A;  3VOX A;  5F0H A;  3EGQ A;  4OD4 A;  3KZ9 A;  3G56 A;  3SDG A;  1BJZ A;  2NS8 A;  3LSP A;  2R7O A;  2Y30 A;  2OF7 A;  2ZCX A;  3HTI A;  3K8P C;  2NX4 A;  4OD5 A;  3C07 A;  5FKN A;  2W53 A;  3T6N A;  5FKL A;  5FHP A;  3F1B A;  3HE0 A;  5FKO A;  3KNW A;  2ZCM A;  2EH3 A;  4V2G A;  2DTZ A;  1Z0X A;  5FMP A;  2R7U A;  3FIW A;  2RAS A;  4V2F A;  4M3F A;  3KKD A;  2REK A;  4M3E A;  5J1Y A;  3CDL A;  4MXM A;  2XPW A;  3PAS A;  4D7N A;  4GCK A;  4GFK A;  3QPS A;  5F1J A;  5F0C A;  2HYT A;  5FKM A;  3LJL A;  4I76 A;  3BR1 A;  2XGD A;  2R7X A;  3LHQ A;  3FRQ A;  3BQY A;  2WUI A;  3WHC A;  3QQA A;  3HTJ A;  5K7F A;  5C4Y A;  2O7O A;  2XPV A;  2NP5 A;  4NEL A;  3ZQH A;  5DAJ A;  3LSR A;  2IAI A;  5FKK A;  4ICH A;  2R7R A;  2HYJ A;  3CRJ A;  3CWR A;  2GBY A;  2Q24 A;  2HXI A;  5GPA A;  3LSJ A;  5CQG A;  4YZE A;  3BT9 A;  1JUS A;  3BCG A;  3BQZ A;  3VUQ A; 
#chains in the Genus database with same CATH homology
 1QPI A;  2VKV A;  2PZ9 A;  4JL3 A;  3BR0 A;  2PBX A;  3NPI A;  5IPA A;  2FX0 A;  2JK3 A;  5D19 A;  3COL A;  5CXI A;  5F08 A;  3BHQ A;  2FD5 A;  4W1U A;  5F27 A;  1JTX A;  1JUM A;  5IOZ A;  2HKU A;  2VPR A;  3Q0V A;  5K58 A;  2FBQ A;  5EYR A;  3VVX A;  4JYK A;  4B3A A;  1ZK8 A;  3VPR A;  3BR2 A;  3IH3 A;  4GCL A;  2QWT A;  5IOY A;  5HAW A;  5K7Z A;  3Q3S A;  5CXG A;  2HQ5 A;  3VIB A;  4DW6 A;  3G7R A;  2G7G A;  3ANG A;  5GP9 A;  5EFY A;  3NNR A;  4JNN A;  2IBD A;  4GFL A;  4AC0 A;  2RAE A;  2UXU A;  2GFN A;  2YVE A;  2TRT A;  3AQS A;  1T56 A;  4W97 A;  4D5F A;  3PPB A;  3VP5 A;  3FK7 A;  4G12 A;  4AF5 A;  3ZQL A;  1Z77 A;  3ZQF A;  5D18 A;  3QKX A;  3V78 A;  3O8H A;  5AQC A;  2X9D A;  1ORK A;  5FGL A;  5J1U A;  5F0F A;  5IP6 A;  4AC6 A;  1RKW A;  3G1L A;  3ANP A;  4UDS A;  2NS7 A;  3BRU A;  2OPT A;  3FK6 A;  2VKE A;  3HGG A;  1JT0 A;  4MK6 A;  2O7T A;  5K7H A;  5EZG A;  3WHB A;  1UI6 A;  2IU5 A;  4HKU A;  1QVU A;  3KKC A;  2XRL A;  2ZOZ A;  2XGC A;  1A6I A;  2NP3 A;  2WV1 A;  3JSJ A;  3BNI A;  3BR5 A;  4CGR A;  1RPW A;  2FQ4 A;  1JUP A;  3IH2 A;  4AUX A;  3RH2 A;  3S5R A;  2OER A;  2TCT A;  2ZOY A;  3PM1 A;  2I10 A;  3Q0U A;  3ON2 A;  3HGY A;  4D5C A;  2JJ7 A;  5H9T A;  3NRG A;  5GPC A;  3BTL A;  2YVH A;  4L62 A;  3LWJ A;  3BR3 A;  2IEK A;  3VOK A;  3O60 A;  2HXO A;  2V57 A;  3ZQG A;  2G7L A;  5J3L A;  1U9O A;  5CW8 A;  3LOC A;  2QCO A;  2QIB A;  3ZQI A;  2G7S A;  3SFI A;  2WGB A;  3VW1 A;  4M3B A;  3DPJ A;  4NN1 A;  3NI7 A;  3V6G A;  1QVT A;  4JKZ A;  2Y2Z A;  2QOP A;  3VW0 A;  1SGM A;  3DEW A;  3HIM A;  3DCF A;  1JTY A;  3TP3 A;  3B81 A;  4ABZ A;  4B1R A;  2UXO A;  2DG8 A;  2FJ1 A;  4XK4 A;  2ID6 A;  5F04 A;  2XGE A;  2G3B A;  2F07 A;  2UXH A;  3EUP A;  3G1O A;  3IH4 A;  3IUV A;  4GCT A;  2XDN A;  4D7M A;  2D6Y A;  5HSZ A;  2DG7 A;  3G1M A;  3VVY A;  3QBM A;  1JT6 A;  3E7Q A;  1U9N A;  3B6A A;  2ID3 A;  3CCY A;  3NXC A;  2ZB9 A;  1UI5 A;  3TP0 A;  4M3D A;  3BR6 A;  1RKT A;  2QTQ A;  2OI8 A;  3HTH A;  3P9T A;  3F0C A;  3HTA A;  2XB5 A;  3BTI A;  3GZI A;  2UXP A;  3ON4 A;  3CJD A;  2QKO A;  5J1R A;  4PXI A;  5HBU A;  3MVP A;  4M3G A;  3MNL A;  3BTC A;  3BJB A;  3O8G A;  2G0E A;  3Q0W A;  2Y31 A;  2GUH A;  4ACI A;  4X1E A;  2XPU A;  5EZH A;  5D1R A;  1VI0 A;  2RHA A;  3QPL A;  3RD3 A;  3BTJ A;  2X6O A;  4MO7 A;  4I6Z A;  3VVZ A;  3VW2 A;  2UXI A;  3AQT A;  1T33 A;  2ZCN A;  3GEU A;  4KWA A;  3C2B A;  2GEN A;  3B6C A;  4ME9 A;  1ZKG A;  3VOX A;  5F0H A;  3EGQ A;  3KZ9 A;  3G56 A;  3SDG A;  1BJZ A;  2NS8 A;  3LSP A;  2Y30 A;  2OF7 A;  2ZCX A;  3HTI A;  2NX4 A;  3C07 A;  5FKN A;  2W53 A;  3T6N A;  5FKL A;  5FHP A;  3F1B A;  3HE0 A;  5FKO A;  3KNW A;  2ZCM A;  2EH3 A;  4V2G A;  2DTZ A;  1Z0X A;  5FMP A;  3FIW A;  2RAS A;  4V2F A;  4M3F A;  3KKD A;  2REK A;  4M3E A;  5J1Y A;  3CDL A;  4MXM A;  2XPW A;  3PAS A;  4D7N A;  4GCK A;  4GFK A;  3QPS A;  5F1J A;  5F0C A;  2HYT A;  5FKM A;  3LJL A;  4I76 A;  3BR1 A;  2XGD A;  3LHQ A;  3FRQ A;  3BQY A;  2WUI A;  3WHC A;  3QQA A;  3HTJ A;  5K7F A;  5C4Y A;  2O7O A;  2XPV A;  2NP5 A;  4NEL A;  3ZQH A;  5DAJ A;  3LSR A;  2IAI A;  5FKK A;  4ICH A;  2HYJ A;  3CRJ A;  3CWR A;  2GBY A;  2Q24 A;  2HXI A;  5GPA A;  3LSJ A;  4YZE A;  3BT9 A;  1JUS A;  3BCG A;  3BQZ A;  3VUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...