5FGLA

Co-crystal structure of nicr2_hsp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
200
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
molecule keywords NicR
total genus 84
structure length 200
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fglA00
2OERA 2OPTA 2UXIA 3EGQA 2DG7A 4HKUA 2ID3A 3BR3A 2WUIA 3LSRA 3KZ9A 2IU5A 3PM1A 2XGEA 3T6NA 2XPVA 3KKDA 2ZCMA 3ANGA 4M3FA 2G0EA 3VW1A 1ORKA 3VVXA 5J1YA 5D1RA 2FD5A 3IH4A 2NP3A 5DAJA 3O60A 4V2FA 3LJLA 4M3GA 4V2GA 5K7ZA 2O7TA 3E7QA 2NP5A 5J3LA 2DTZA 2QIBA 3FRQA 4KWAA 3KKCA 2OF7A 3QPLA 2XPWA 3PASA 3COLA 2O7OA 3BCGA 2QCOA 2PBXA 2ZB9A 2HXOA 5J1RA 2QOPA 3C07A 2QKOA 2D6YA 5FMPA 3LHQA 2Q24A 3HGGA 2VPRA 1QVUA 3ON2A 3HTJA 3BRUA 4NN1A 4NELA 1JTYA 4AC6A 5EZHA 3CDLA 2G7SA 3G56A 3BT9A 1UI5A 5GPCA 3VOKA 4GFKA 3NI7A 3BNIA 2UXOA 2Y31A 2RAEA 4I6ZA 3BR5A 4YZEA 3G7RA 2IAIA 5IOYA 3VPRA 5K58A 2V57A 4G12A 5FGLA 3HTHA 1ZKGA 1JT6A 2RHAA 3HGYA 4M3DA 3VUQA 5IPAA 3BQZA 4GCLA 1VI0A 3LWJA 5HBUA 3NRGA 4DW6A 5F08A 3PPBA 3C2BA 3LOCA 4AUXA 3B6CA 3ANPA 3RH2A 4GCKA 2Y30A 3NXCA 5CXIA 2NX4A 3BTIA 3G1MA 2QTQA 3ZQGA 3WHCA 3TP3A 3VP5A 4D7NA 3CJDA 2FJ1A 4GCTA 3EUPA 3BR6A 2FX0A 5FKOA 4ACIA 2OI8A 5HSZA 3GEUA 2DG8A 3IH2A 3CWRA 2ZOZA 2GENA 4B1RA 2ZCNA 5EFYA 3NPIA 2Y2ZA 5CXGA 5K7HA 2W53A 4MXMA 2HQ5A 3O8GA 2QWTA 3G1OA 5FKLA 3O8HA 3QQAA 3DPJA 3BJBA 5AQCA 3BR1A 3Q0UA 2HXIA 1RKWA 2IBDA 2G7LA 2FQ4A 1SGMA 3LSJA 5J1UA 4X1EA 4L62A 3ZQFA 5F0FA 2YVEA 2TCTA 4CGRA 5HAWA 1Z0XA 2NS8A 2ZOYA 1JTXA 3JSJA 3DCFA 2HYTA 2GBYA 2G7GA 1BJZA 2F07A 3GZIA 3B81A 3BHQA 2VKEA 4ABZA 3IUVA 3LSPA 5F0HA 5C4YA 1JUMA 1QPIA 4I76A 5FHPA 2X6OA 3AQTA 4JKZA 3CCYA 1U9NA 3HIMA 4XK4A 3MNLA 5FKKA 2EH3A 3ZQLA 3BTCA 4JNNA 4AF5A 5IOZA 4D5CA 2ZCXA 3VOXA 2RASA 5FKMA 3F1BA 4ME9A 3FIWA 2WGBA 3G1LA 4AC0A 4ICHA 3ON4A 3DEWA 2VKVA 3VW2A 1RPWA 3Q3SA 5IP6A 1Z77A 5D19A 4D5FA 3BR0A 3V6GA 4W97A 3AQSA 2ID6A 4D7MA 3FK7A 4MO7A 3VVYA 3HE0A 3QKXA 3KNWA 4PXIA 5EYRA 3WHBA 1RKTA 2REKA 3NNRA 3IH3A 5F04A 4B3AA 3S5RA 5FKNA 3BR2A 3RD3A 4UDSA 3HTAA 2GUHA 3CRJA 3TP0A 4W1UA 2XB5A 2XGDA 2NS7A 3VIBA 2X9DA 1U9OA 3MVPA 2JK3A 3ZQHA 5K7FA 4M3EA 2YVHA 2IEKA 3ZQIA 2XDNA 3P9TA 5EZGA 1JUPA 3FK6A 2G3BA 2I10A 2UXHA 2XRLA 5CW8A 1T33A 2XGCA 5F1JA 3Q0WA 2UXUA 1T56A 5H9TA 3Q0VA 1QVTA 4M3BA 3QPSA 1JUSA 2WV1A 3BQYA 3SFIA 4JL3A 3QBMA 5D18A 5GP9A 3VW0A 2UXPA 3F0CA 4JYKA 5GPAA 2JJ7A 1UI6A 3V78A 1ZK8A 2TRTA 2HYJA 5F27A 1A6IA 1JT0A 2HKUA 2XPUA 5F0CA 3VVZA 4MK6A 2FBQA 4GFLA 3BTLA 2GFNA 3B6AA 2PZ9A 3HTIA 3SDGA 3BTJA
chains in the Genus database with same CATH superfamily
2OERA 2OPTA 2UXIA 3EGQA 2DG7A 4HKUA 2ID3A 3BR3A 2WUIA 2B1EA 3LSRA 3KZ9A 2IU5A 3PM1A 2YVXA 2XGEA 3T6NA 2XPVA 2R7SA 3KKDA 2ZCMA 3ANGA 4M3FA 4WIBA 2G0EA 3VW1A 1ORKA 3VVXA 5J1YA 5D1RA 2FD5A 3IH4A 2NP3A 5DAJA 3O60A 4V2FA 3LJLA 4M3GA 4V2GA 5K7ZA 2O7TA 3E7QA 2NP5A 5J3LA 2DTZA 3KYLA 2QIBA 3FRQA 4KWAA 3KKCA 2OF7A 3QPLA 2XPWA 3PASA 3COLA 2O7OA 3BCGA 2QCOA 2PBXA 2ZB9A 2HXOA 5J1RA 2QOPA 3C07A 2QKOA 2D6YA 5FMPA 3LHQA 2Q24A 3HGGA 2R7QA 2VPRA 1QVUA 3ON2A 3HTJA 3BRUA 4NN1A 2A2FX 4NELA 1JTYA 4AC6A 5EZHA 3DU6A 3CDLA 2G7SA 3G56A 3BT9A 1UI5A 5GPCA 3VOKA 4GFKA 3NI7A 3BNIA 2UXOA 2Y31A 2RAEA 4I6ZA 3BR5A 4YZEA 3G7RA 2IAIA 5IOYA 3VPRA 5K58A 2V57A 4G12A 5FGLA 3HTHA 1ZKGA 1JT6A 2RHAA 3HGYA 4M3DA 3VUQA 5IPAA 3BQZA 4GCLA 1VI0A 3LWJA 5HBUA 3NRGA 4DW6A 5F08A 3PPBA 3C2BA 3LOCA 4AUXA 3B6CA 3ANPA 3RH2A 4GCKA 2Y30A 3NXCA 3SWHA 5CXIA 2NX4A 3BTIA 2R7OA 3G1MA 4OD5A 2QTQA 3ZQGA 3WHCA 3TP3A 3VP5A 4D7NA 3FHNA 3CJDA 2FJ1A 4GCTA 3EUPA 3BR6A 2FX0A 5FKOA 2R7XA 4ACIA 2OI8A 5HSZA 3GEUA 2DG8A 3IH2A 3CWRA 2ZOZA 2GENA 4B1RA 2ZCNA 5EFYA 3NPIA 2Y2ZA 5CXGA 5K7HA 3VTIA 2W53A 4MXMA 2HQ5A 3O8GA 2QWTA 3G1OA 5FKLA 3O8HA 3QQAA 4U9NA 3DPJA 3BJBA 5AQCA 3BR1A 3Q0UA 2HXIA 1RKWA 2R7TA 2ZY9A 2IBDA 3DU5A 2G7LA 2FQ4A 1SGMA 3LSJA 5J1UA 4X1EA 4L62A 3ZQFA 5F0FA 2YVEA 2TCTA 4CGRA 5HAWA 1Z0XA 2NS8A 2ZOYA 1JTXA 3JSJA 3DCFA 2HYTA 2GBYA 2R7UA 2G7GA 4DVYP 1BJZA 2F07A 3GZIA 3B81A 3BHQA 2VKEA 4ABZA 3IUVA 3LSPA 5F0HA 5C4YA 1JUMA 1QPIA 4I76A 5FHPA 2X6OA 3AQTA 4JKZA 4XK4A 3CCYA 1U9NA 3HIMA 3MNLA 5FKKA 2EH3A 3ZQLA 3BTCA 4JNNA 2PFVA 4AF5A 5IOZA 4D5CA 2ZCXA 3VOXA 5CQGA 2RASA 5FKMA 3F1BA 4ME9A 3FIWA 2FJI1 2B3WA 2WGBA 3G1LA 4AC0A 4ICHA 3ON4A 3DEWA 2VKVA 3VW2A 2R7VA 1RPWA 3Q3SA 4C2MA 5IP6A 1Z77A 5D19A 4D5FA 3BR0A 3V6GA 4W97A 3AQSA 2ID6A 4D7MA 3FK7A 4MO7A 2R7WA 3VVYA 3HE0A 3QKXA 4OD4A 3KNWA 4PXIA 5EYRA 3WHBA 1RKTA 2REKA 3NNRA 3IH3A 5F04A 4B3AA 3S5RA 5FKNA 3BR2A 3RD3A 4UDSA 3HTAA 2GUHA 3CRJA 3TP0A 4W1UA 2XB5A 2XGDA 2NS7A 3VIBA 2X9DA 1U9OA 3MVPA 2JK3A 3ZQHA 5K7FA 4M3EA 3NS4A 2YVHA 2IEKA 3ZQIA 2XDNA 3P9TA 5EZGA 1JUPA 3FK6A 2G3BA 2I10A 2UXHA 4IRVA 2XRLA 5CW8A 1T33A 2XGCA 5F1JA 3Q0WA 2UXUA 1T56A 5H9TA 3Q0VA 1QVTA 4M3BA 3QPSA 1JUSA 2WV1A 3BQYA 3SFIA 4JL3A 2R7RA 3QBMA 5D18A 5GP9A 3VW0A 2UXPA 3F0CA 4JYKA 4U9LA 5GPAA 2JJ7A 1UI6A 3V78A 1ZK8A 2TRTA 2HYJA 3K8PC 5F27A 1A6IA 1JT0A 2HKUA 2XPUA 5F0CA 3VVZA 4MK6A 2FBQA 4GFLA 3BTLA 2GFNA 3B6AA 2PZ9A 3HTIA 3SDGA 3BTJA
chains in the Genus database with same CATH topology
2OERA 2OPTA 2UXIA 3EGQA 2DG7A 4HKUA 2ID3A 3BR3A 2WUIA 3LSRA 3KZ9A 2IU5A 3PM1A 2XGEA 3T6NA 2XPVA 3KKDA 2ZCMA 3ANGA 4M3FA 2G0EA 3VW1A 1ORKA 3VVXA 5J1YA 5D1RA 2FD5A 3IH4A 2NP3A 5DAJA 3O60A 4V2FA 3LJLA 4M3GA 4V2GA 5K7ZA 2O7TA 3E7QA 2NP5A 5J3LA 2DTZA 2QIBA 3FRQA 4KWAA 3KKCA 2OF7A 3QPLA 2XPWA 3PASA 3COLA 2O7OA 3BCGA 2QCOA 2PBXA 2ZB9A 2HXOA 5J1RA 2QOPA 3C07A 2QKOA 2D6YA 5FMPA 3LHQA 2Q24A 3HGGA 2VPRA 1QVUA 3ON2A 3HTJA 3BRUA 4NN1A 4NELA 1JTYA 4AC6A 5EZHA 3CDLA 2G7SA 3G56A 3BT9A 1UI5A 5GPCA 3VOKA 4GFKA 3NI7A 3BNIA 2UXOA 2Y31A 2RAEA 4I6ZA 3BR5A 4YZEA 3G7RA 2IAIA 5IOYA 3VPRA 5K58A 2V57A 4G12A 5FGLA 3HTHA 1ZKGA 1JT6A 2RHAA 3HGYA 4M3DA 3VUQA 5IPAA 3BQZA 4GCLA 1VI0A 3LWJA 5HBUA 3NRGA 4DW6A 5F08A 3PPBA 3C2BA 3LOCA 4AUXA 3B6CA 3ANPA 3RH2A 4GCKA 2Y30A 3NXCA 5CXIA 2NX4A 3BTIA 3G1MA 2QTQA 3ZQGA 3WHCA 3TP3A 3VP5A 4D7NA 3CJDA 2FJ1A 4GCTA 3EUPA 3BR6A 2FX0A 5FKOA 4ACIA 2OI8A 5HSZA 3GEUA 2DG8A 3IH2A 3CWRA 2ZOZA 2GENA 4B1RA 2ZCNA 5EFYA 3NPIA 2Y2ZA 5CXGA 5K7HA 2W53A 4MXMA 2HQ5A 3O8GA 2QWTA 3G1OA 5FKLA 3O8HA 3QQAA 3DPJA 3BJBA 5AQCA 3BR1A 3Q0UA 2HXIA 1RKWA 2IBDA 2G7LA 2FQ4A 1SGMA 3LSJA 5J1UA 4X1EA 4L62A 3ZQFA 5F0FA 2YVEA 2TCTA 4CGRA 5HAWA 1Z0XA 2NS8A 2ZOYA 1JTXA 3JSJA 3DCFA 2HYTA 2GBYA 2G7GA 1BJZA 2F07A 3GZIA 3B81A 3BHQA 2VKEA 4ABZA 3IUVA 3LSPA 5F0HA 5C4YA 1JUMA 1QPIA 4I76A 5FHPA 2X6OA 3AQTA 4JKZA 3CCYA 1U9NA 3HIMA 4XK4A 3MNLA 5FKKA 2EH3A 3ZQLA 3BTCA 4JNNA 4AF5A 5IOZA 4D5CA 2ZCXA 3VOXA 2RASA 5FKMA 3F1BA 4ME9A 3FIWA 2WGBA 3G1LA 4AC0A 4ICHA 3ON4A 3DEWA 2VKVA 3VW2A 1RPWA 3Q3SA 5IP6A 1Z77A 5D19A 4D5FA 3BR0A 3V6GA 4W97A 3AQSA 2ID6A 4D7MA 3FK7A 4MO7A 3VVYA 3HE0A 3QKXA 3KNWA 4PXIA 5EYRA 3WHBA 1RKTA 2REKA 3NNRA 3IH3A 5F04A 4B3AA 3S5RA 5FKNA 3BR2A 3RD3A 4UDSA 3HTAA 2GUHA 3CRJA 3TP0A 4W1UA 2XB5A 2XGDA 2NS7A 3VIBA 2X9DA 1U9OA 3MVPA 2JK3A 3ZQHA 5K7FA 4M3EA 2YVHA 2IEKA 3ZQIA 2XDNA 3P9TA 5EZGA 1JUPA 3FK6A 2G3BA 2I10A 2UXHA 2XRLA 5CW8A 1T33A 2XGCA 5F1JA 3Q0WA 2UXUA 1T56A 5H9TA 3Q0VA 1QVTA 4M3BA 3QPSA 1JUSA 2WV1A 3BQYA 3SFIA 4JL3A 3QBMA 5D18A 5GP9A 3VW0A 2UXPA 3F0CA 4JYKA 5GPAA 2JJ7A 1UI6A 3V78A 1ZK8A 2TRTA 2HYJA 5F27A 1A6IA 1JT0A 2HKUA 2XPUA 5F0CA 3VVZA 4MK6A 2FBQA 4GFLA 3BTLA 2GFNA 3B6AA 2PZ9A 3HTIA 3SDGA 3BTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OER A;  2OPT A;  2UXI A;  3EGQ A;  2DG7 A;  4HKU A;  2ID3 A;  3BR3 A;  2WUI A;  3LSR A;  3KZ9 A;  2IU5 A;  3PM1 A;  2XGE A;  3T6N A;  2XPV A;  3KKD A;  2ZCM A;  3ANG A;  4M3F A;  2G0E A;  3VW1 A;  1ORK A;  3VVX A;  5J1Y A;  5D1R A;  2FD5 A;  3IH4 A;  2NP3 A;  5DAJ A;  3O60 A;  4V2F A;  3LJL A;  4M3G A;  4V2G A;  5K7Z A;  2O7T A;  3E7Q A;  2NP5 A;  5J3L A;  2DTZ A;  2QIB A;  3FRQ A;  4KWA A;  3KKC A;  2OF7 A;  3QPL A;  2XPW A;  3PAS A;  3COL A;  2O7O A;  3BCG A;  2QCO A;  2PBX A;  2ZB9 A;  2HXO A;  5J1R A;  2QOP A;  3C07 A;  2QKO A;  2D6Y A;  5FMP A;  3LHQ A;  2Q24 A;  3HGG A;  2VPR A;  1QVU A;  3ON2 A;  3HTJ A;  3BRU A;  4NN1 A;  4NEL A;  1JTY A;  4AC6 A;  5EZH A;  3CDL A;  2G7S A;  3G56 A;  3BT9 A;  1UI5 A;  5GPC A;  3VOK A;  4GFK A;  3NI7 A;  3BNI A;  2UXO A;  2Y31 A;  2RAE A;  4I6Z A;  3BR5 A;  4YZE A;  3G7R A;  2IAI A;  5IOY A;  3VPR A;  5K58 A;  2V57 A;  4G12 A;  5FGL A;  3HTH A;  1ZKG A;  1JT6 A;  2RHA A;  3HGY A;  4M3D A;  3VUQ A;  5IPA A;  3BQZ A;  4GCL A;  1VI0 A;  3LWJ A;  5HBU A;  3NRG A;  4DW6 A;  5F08 A;  3PPB A;  3C2B A;  3LOC A;  4AUX A;  3B6C A;  3ANP A;  3RH2 A;  4GCK A;  2Y30 A;  3NXC A;  5CXI A;  2NX4 A;  3BTI A;  3G1M A;  2QTQ A;  3ZQG A;  3WHC A;  3TP3 A;  3VP5 A;  4D7N A;  3CJD A;  2FJ1 A;  4GCT A;  3EUP A;  3BR6 A;  2FX0 A;  5FKO A;  4ACI A;  2OI8 A;  5HSZ A;  3GEU A;  2DG8 A;  3IH2 A;  3CWR A;  2ZOZ A;  2GEN A;  4B1R A;  2ZCN A;  5EFY A;  3NPI A;  2Y2Z A;  5CXG A;  5K7H A;  2W53 A;  4MXM A;  2HQ5 A;  3O8G A;  2QWT A;  3G1O A;  5FKL A;  3O8H A;  3QQA A;  3DPJ A;  3BJB A;  5AQC A;  3BR1 A;  3Q0U A;  2HXI A;  1RKW A;  2IBD A;  2G7L A;  2FQ4 A;  1SGM A;  3LSJ A;  5J1U A;  4X1E A;  4L62 A;  3ZQF A;  5F0F A;  2YVE A;  2TCT A;  4CGR A;  5HAW A;  1Z0X A;  2NS8 A;  2ZOY A;  1JTX A;  3JSJ A;  3DCF A;  2HYT A;  2GBY A;  2G7G A;  1BJZ A;  2F07 A;  3GZI A;  3B81 A;  3BHQ A;  2VKE A;  4ABZ A;  3IUV A;  3LSP A;  5F0H A;  5C4Y A;  1JUM A;  1QPI A;  4I76 A;  5FHP A;  2X6O A;  3AQT A;  4JKZ A;  3CCY A;  1U9N A;  3HIM A;  4XK4 A;  3MNL A;  5FKK A;  2EH3 A;  3ZQL A;  3BTC A;  4JNN A;  4AF5 A;  5IOZ A;  4D5C A;  2ZCX A;  3VOX A;  2RAS A;  5FKM A;  3F1B A;  4ME9 A;  3FIW A;  2WGB A;  3G1L A;  4AC0 A;  4ICH A;  3ON4 A;  3DEW A;  2VKV A;  3VW2 A;  1RPW A;  3Q3S A;  5IP6 A;  1Z77 A;  5D19 A;  4D5F A;  3BR0 A;  3V6G A;  4W97 A;  3AQS A;  2ID6 A;  4D7M A;  3FK7 A;  4MO7 A;  3VVY A;  3HE0 A;  3QKX A;  3KNW A;  4PXI A;  5EYR A;  3WHB A;  1RKT A;  2REK A;  3NNR A;  3IH3 A;  5F04 A;  4B3A A;  3S5R A;  5FKN A;  3BR2 A;  3RD3 A;  4UDS A;  3HTA A;  2GUH A;  3CRJ A;  3TP0 A;  4W1U A;  2XB5 A;  2XGD A;  2NS7 A;  3VIB A;  2X9D A;  1U9O A;  3MVP A;  2JK3 A;  3ZQH A;  5K7F A;  4M3E A;  2YVH A;  2IEK A;  3ZQI A;  2XDN A;  3P9T A;  5EZG A;  1JUP A;  3FK6 A;  2G3B A;  2I10 A;  2UXH A;  2XRL A;  5CW8 A;  1T33 A;  2XGC A;  5F1J A;  3Q0W A;  2UXU A;  1T56 A;  5H9T A;  3Q0V A;  1QVT A;  4M3B A;  3QPS A;  1JUS A;  2WV1 A;  3BQY A;  3SFI A;  4JL3 A;  3QBM A;  5D18 A;  5GP9 A;  3VW0 A;  2UXP A;  3F0C A;  4JYK A;  5GPA A;  2JJ7 A;  1UI6 A;  3V78 A;  1ZK8 A;  2TRT A;  2HYJ A;  5F27 A;  1A6I A;  1JT0 A;  2HKU A;  2XPU A;  5F0C A;  3VVZ A;  4MK6 A;  2FBQ A;  4GFL A;  3BTL A;  2GFN A;  3B6A A;  2PZ9 A;  3HTI A;  3SDG A;  3BTJ A; 
#chains in the Genus database with same CATH topology
 2OER A;  2OPT A;  2UXI A;  3EGQ A;  2DG7 A;  4HKU A;  2ID3 A;  3BR3 A;  2WUI A;  2B1E A;  3LSR A;  3KZ9 A;  2IU5 A;  3PM1 A;  2YVX A;  2XGE A;  3T6N A;  2XPV A;  2R7S A;  3KKD A;  2ZCM A;  3ANG A;  4M3F A;  4WIB A;  2G0E A;  3VW1 A;  1ORK A;  3VVX A;  5J1Y A;  5D1R A;  2FD5 A;  3IH4 A;  2NP3 A;  5DAJ A;  3O60 A;  4V2F A;  3LJL A;  4M3G A;  4V2G A;  5K7Z A;  2O7T A;  3E7Q A;  2NP5 A;  5J3L A;  2DTZ A;  3KYL A;  2QIB A;  3FRQ A;  4KWA A;  3KKC A;  2OF7 A;  3QPL A;  2XPW A;  3PAS A;  3COL A;  2O7O A;  3BCG A;  2QCO A;  2PBX A;  2ZB9 A;  2HXO A;  5J1R A;  2QOP A;  3C07 A;  2QKO A;  2D6Y A;  5FMP A;  3LHQ A;  2Q24 A;  3HGG A;  2R7Q A;  2VPR A;  1QVU A;  3ON2 A;  3HTJ A;  3BRU A;  4NN1 A;  2A2F X;  4NEL A;  1JTY A;  4AC6 A;  5EZH A;  3DU6 A;  3CDL A;  2G7S A;  3G56 A;  3BT9 A;  1UI5 A;  5GPC A;  3VOK A;  4GFK A;  3NI7 A;  3BNI A;  2UXO A;  2Y31 A;  2RAE A;  4I6Z A;  3BR5 A;  4YZE A;  3G7R A;  2IAI A;  5IOY A;  3VPR A;  5K58 A;  2V57 A;  4G12 A;  5FGL A;  3HTH A;  1ZKG A;  1JT6 A;  2RHA A;  3HGY A;  4M3D A;  3VUQ A;  5IPA A;  3BQZ A;  4GCL A;  1VI0 A;  3LWJ A;  5HBU A;  3NRG A;  4DW6 A;  5F08 A;  3PPB A;  3C2B A;  3LOC A;  4AUX A;  3B6C A;  3ANP A;  3RH2 A;  4GCK A;  2Y30 A;  3NXC A;  3SWH A;  5CXI A;  2NX4 A;  3BTI A;  2R7O A;  3G1M A;  4OD5 A;  2QTQ A;  3ZQG A;  3WHC A;  3TP3 A;  3VP5 A;  4D7N A;  3FHN A;  3CJD A;  2FJ1 A;  4GCT A;  3EUP A;  3BR6 A;  2FX0 A;  5FKO A;  2R7X A;  4ACI A;  2OI8 A;  5HSZ A;  3GEU A;  2DG8 A;  3IH2 A;  3CWR A;  2ZOZ A;  2GEN A;  4B1R A;  2ZCN A;  5EFY A;  3NPI A;  2Y2Z A;  5CXG A;  5K7H A;  3VTI A;  2W53 A;  4MXM A;  2HQ5 A;  3O8G A;  2QWT A;  3G1O A;  5FKL A;  3O8H A;  3QQA A;  4U9N A;  3DPJ A;  3BJB A;  5AQC A;  3BR1 A;  3Q0U A;  2HXI A;  1RKW A;  2R7T A;  2ZY9 A;  2IBD A;  3DU5 A;  2G7L A;  2FQ4 A;  1SGM A;  3LSJ A;  5J1U A;  4X1E A;  4L62 A;  3ZQF A;  5F0F A;  2YVE A;  2TCT A;  4CGR A;  5HAW A;  1Z0X A;  2NS8 A;  2ZOY A;  1JTX A;  3JSJ A;  3DCF A;  2HYT A;  2GBY A;  2R7U A;  2G7G A;  4DVY P;  1BJZ A;  2F07 A;  3GZI A;  3B81 A;  3BHQ A;  2VKE A;  4ABZ A;  3IUV A;  3LSP A;  5F0H A;  5C4Y A;  1JUM A;  1QPI A;  4I76 A;  5FHP A;  2X6O A;  3AQT A;  4JKZ A;  4XK4 A;  3CCY A;  1U9N A;  3HIM A;  3MNL A;  5FKK A;  2EH3 A;  3ZQL A;  3BTC A;  4JNN A;  2PFV A;  4AF5 A;  5IOZ A;  4D5C A;  2ZCX A;  3VOX A;  5CQG A;  2RAS A;  5FKM A;  3F1B A;  4ME9 A;  3FIW A;  2FJI 1;  2B3W A;  2WGB A;  3G1L A;  4AC0 A;  4ICH A;  3ON4 A;  3DEW A;  2VKV A;  3VW2 A;  2R7V A;  1RPW A;  3Q3S A;  4C2M A;  5IP6 A;  1Z77 A;  5D19 A;  4D5F A;  3BR0 A;  3V6G A;  4W97 A;  3AQS A;  2ID6 A;  4D7M A;  3FK7 A;  4MO7 A;  2R7W A;  3VVY A;  3HE0 A;  3QKX A;  4OD4 A;  3KNW A;  4PXI A;  5EYR A;  3WHB A;  1RKT A;  2REK A;  3NNR A;  3IH3 A;  5F04 A;  4B3A A;  3S5R A;  5FKN A;  3BR2 A;  3RD3 A;  4UDS A;  3HTA A;  2GUH A;  3CRJ A;  3TP0 A;  4W1U A;  2XB5 A;  2XGD A;  2NS7 A;  3VIB A;  2X9D A;  1U9O A;  3MVP A;  2JK3 A;  3ZQH A;  5K7F A;  4M3E A;  3NS4 A;  2YVH A;  2IEK A;  3ZQI A;  2XDN A;  3P9T A;  5EZG A;  1JUP A;  3FK6 A;  2G3B A;  2I10 A;  2UXH A;  4IRV A;  2XRL A;  5CW8 A;  1T33 A;  2XGC A;  5F1J A;  3Q0W A;  2UXU A;  1T56 A;  5H9T A;  3Q0V A;  1QVT A;  4M3B A;  3QPS A;  1JUS A;  2WV1 A;  3BQY A;  3SFI A;  4JL3 A;  2R7R A;  3QBM A;  5D18 A;  5GP9 A;  3VW0 A;  2UXP A;  3F0C A;  4JYK A;  4U9L A;  5GPA A;  2JJ7 A;  1UI6 A;  3V78 A;  1ZK8 A;  2TRT A;  2HYJ A;  3K8P C;  5F27 A;  1A6I A;  1JT0 A;  2HKU A;  2XPU A;  5F0C A;  3VVZ A;  4MK6 A;  2FBQ A;  4GFL A;  3BTL A;  2GFN A;  3B6A A;  2PZ9 A;  3HTI A;  3SDG A;  3BTJ A; 
#chains in the Genus database with same CATH homology
 2OER A;  2OPT A;  2UXI A;  3EGQ A;  2DG7 A;  4HKU A;  2ID3 A;  3BR3 A;  2WUI A;  3LSR A;  3KZ9 A;  2IU5 A;  3PM1 A;  2XGE A;  3T6N A;  2XPV A;  3KKD A;  2ZCM A;  3ANG A;  4M3F A;  2G0E A;  3VW1 A;  1ORK A;  3VVX A;  5J1Y A;  5D1R A;  2FD5 A;  3IH4 A;  2NP3 A;  5DAJ A;  3O60 A;  4V2F A;  3LJL A;  4M3G A;  4V2G A;  5K7Z A;  2O7T A;  3E7Q A;  2NP5 A;  5J3L A;  2DTZ A;  2QIB A;  3FRQ A;  4KWA A;  3KKC A;  2OF7 A;  3QPL A;  2XPW A;  3PAS A;  3COL A;  2O7O A;  3BCG A;  2QCO A;  2PBX A;  2ZB9 A;  2HXO A;  5J1R A;  2QOP A;  3C07 A;  2QKO A;  2D6Y A;  5FMP A;  3LHQ A;  2Q24 A;  3HGG A;  2VPR A;  1QVU A;  3ON2 A;  3HTJ A;  3BRU A;  4NN1 A;  4NEL A;  1JTY A;  4AC6 A;  5EZH A;  3CDL A;  2G7S A;  3G56 A;  3BT9 A;  1UI5 A;  5GPC A;  3VOK A;  4GFK A;  3NI7 A;  3BNI A;  2UXO A;  2Y31 A;  2RAE A;  4I6Z A;  3BR5 A;  4YZE A;  3G7R A;  2IAI A;  5IOY A;  3VPR A;  5K58 A;  2V57 A;  4G12 A;  5FGL A;  3HTH A;  1ZKG A;  1JT6 A;  2RHA A;  3HGY A;  4M3D A;  3VUQ A;  5IPA A;  3BQZ A;  4GCL A;  1VI0 A;  3LWJ A;  5HBU A;  3NRG A;  4DW6 A;  5F08 A;  3PPB A;  3C2B A;  3LOC A;  4AUX A;  3B6C A;  3ANP A;  3RH2 A;  4GCK A;  2Y30 A;  3NXC A;  5CXI A;  2NX4 A;  3BTI A;  3G1M A;  2QTQ A;  3ZQG A;  3WHC A;  3TP3 A;  3VP5 A;  4D7N A;  3CJD A;  2FJ1 A;  4GCT A;  3EUP A;  3BR6 A;  2FX0 A;  5FKO A;  4ACI A;  2OI8 A;  5HSZ A;  3GEU A;  2DG8 A;  3IH2 A;  3CWR A;  2ZOZ A;  2GEN A;  4B1R A;  2ZCN A;  5EFY A;  3NPI A;  2Y2Z A;  5CXG A;  5K7H A;  2W53 A;  4MXM A;  2HQ5 A;  3O8G A;  2QWT A;  3G1O A;  5FKL A;  3O8H A;  3QQA A;  3DPJ A;  3BJB A;  5AQC A;  3BR1 A;  3Q0U A;  2HXI A;  1RKW A;  2IBD A;  2G7L A;  2FQ4 A;  1SGM A;  3LSJ A;  5J1U A;  4X1E A;  4L62 A;  3ZQF A;  5F0F A;  2YVE A;  2TCT A;  4CGR A;  5HAW A;  1Z0X A;  2NS8 A;  2ZOY A;  1JTX A;  3JSJ A;  3DCF A;  2HYT A;  2GBY A;  2G7G A;  1BJZ A;  2F07 A;  3GZI A;  3B81 A;  3BHQ A;  2VKE A;  4ABZ A;  3IUV A;  3LSP A;  5F0H A;  5C4Y A;  1JUM A;  1QPI A;  4I76 A;  5FHP A;  2X6O A;  3AQT A;  4JKZ A;  3CCY A;  1U9N A;  3HIM A;  4XK4 A;  3MNL A;  5FKK A;  2EH3 A;  3ZQL A;  3BTC A;  4JNN A;  4AF5 A;  5IOZ A;  4D5C A;  2ZCX A;  3VOX A;  2RAS A;  5FKM A;  3F1B A;  4ME9 A;  3FIW A;  2WGB A;  3G1L A;  4AC0 A;  4ICH A;  3ON4 A;  3DEW A;  2VKV A;  3VW2 A;  1RPW A;  3Q3S A;  5IP6 A;  1Z77 A;  5D19 A;  4D5F A;  3BR0 A;  3V6G A;  4W97 A;  3AQS A;  2ID6 A;  4D7M A;  3FK7 A;  4MO7 A;  3VVY A;  3HE0 A;  3QKX A;  3KNW A;  4PXI A;  5EYR A;  3WHB A;  1RKT A;  2REK A;  3NNR A;  3IH3 A;  5F04 A;  4B3A A;  3S5R A;  5FKN A;  3BR2 A;  3RD3 A;  4UDS A;  3HTA A;  2GUH A;  3CRJ A;  3TP0 A;  4W1U A;  2XB5 A;  2XGD A;  2NS7 A;  3VIB A;  2X9D A;  1U9O A;  3MVP A;  2JK3 A;  3ZQH A;  5K7F A;  4M3E A;  2YVH A;  2IEK A;  3ZQI A;  2XDN A;  3P9T A;  5EZG A;  1JUP A;  3FK6 A;  2G3B A;  2I10 A;  2UXH A;  2XRL A;  5CW8 A;  1T33 A;  2XGC A;  5F1J A;  3Q0W A;  2UXU A;  1T56 A;  5H9T A;  3Q0V A;  1QVT A;  4M3B A;  3QPS A;  1JUS A;  2WV1 A;  3BQY A;  3SFI A;  4JL3 A;  3QBM A;  5D18 A;  5GP9 A;  3VW0 A;  2UXP A;  3F0C A;  4JYK A;  5GPA A;  2JJ7 A;  1UI6 A;  3V78 A;  1ZK8 A;  2TRT A;  2HYJ A;  5F27 A;  1A6I A;  1JT0 A;  2HKU A;  2XPU A;  5F0C A;  3VVZ A;  4MK6 A;  2FBQ A;  4GFL A;  3BTL A;  2GFN A;  3B6A A;  2PZ9 A;  3HTI A;  3SDG A;  3BTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...