5FH7A

Crystal structure of the fifth bromodomain of human pb1 in complex with compound 18
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Identification and Development of 2,3-Dihydropyrrolo[1,2-a]quinazolin-5(1H)-one Inhibitors Targeting Bromodomains within the Switch/Sucrose Nonfermenting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fh7A00
5HLSA 4KV4A 4BJXA 5DFCA 5I80A 5EGUA 4YY4A 5A82A 5HFQA 3TLPA 4UYFA 4NXJA 5HFRA 5EV9A 2DATA 4PY6A 5E73A 5D25A 3MXFA 3IU6A 3U5MA 5EISA 5CQAA 5A5OA 4A9EA 5F1HA 4PS5A 4QC3A 5I89A 5ENEA 3DAIA 5F1LA 4PKLA 4TT2A 5II2A 1JM4B 5EM3A 4BW4A 5CUGA 5HRWA 5A81A 5LKTA 4ZC9A 4YYNA 5D26A 4TZ2A 5CUAA 4UIYA 5FG6A 4ZW1A 3ONIA 5IGMA 4O78A 3QZSA 5L99A 4CURA 5ETBA 5L98A 3O34A 5HQ5A 5HELA 3U5NA 4LYIA 5EWWA 5KTUA 3JVKA 3O33A 4PTBA 5E9YA 4YYHA 5CS8A 2I8NA 2NXBA 5D24A 5FFWA 5F63A 5HENA 5CPEA 1WUMA 5F36A 2YW5A 3LXJA 4O7EA 3Q2EA 4TS8A 5F62A 4O7AA 5EU1A 5JWMA 5CQTA 2DVVA 5EI4A 5L97A 5I83A 4WHUA 3U5OA 4X2IA 5EWCA 4UIVA 3JVMA 5TB6A 3UV2A 4O7FA 5A7CA 4O74A 5DLZA 5DYCA 4LZ2A 4QSSA 3I3JA 2MJVB 2N9GA 5EPSA 4QSXA 5A5PA 4GPJA 5COIA 5LKXA 5I7YA 4NR5A 5ENIA 5CQ5A 5IBNA 4LRGA 5D3NA 4OGIA 5E7DA 4CUSA 3O36A 4YABA 4UYDA 5I1QA 4UITA 4UIWA 3AQAA 4YYKA 4NUDA 3P1FA 5ETDA 5CQ4A 5BT5A 4TT6A 4DONA 4LDFA 5FE8A 2RO1A 5I7XA 3UW9A 3GG3A 4IOQA 5D3RA 5FH8A 4YY6A 5HRXA 4IR3A 3S92A 4YBTA 5I88A 5AMFA 3QZTA 4BW1A 5A5QA 4QEVA 5DYXA 5FE4A 4HXOA 4QYDA 5AMEA 2FSAA 4OUFA 4ALGA 4NR9A 4TQNA 3HMEA 4NYXA 4HXMA 5ENCA 4J0RA 5DLXA 4Z6HA 4NYVA 5HRVA 5C4QA 4CUPA 3SVGA 1F68A 4J0SA 1X0JA 3D7CA 2L84A 2E7NA 5FE5A 2R10A 4QSUA 4MEOA 4RVRA 2RNWA 5G4RA 5FE3A 4YBSA 4O70A 4NR6A 5LUUA 5ENBA 5D3HA 5C7NA 4TU4A 3SVHA 4TU6A 5E9IA 4WIVA 4CLBA 1WUGA 3SVFA 2RNXA 5FE6A 5ENFA 5CUEA 5EWDA 5HJCA 4FLPA 3RCWA 5JI8A 4QUTA 5L8TA 4NS5A 3MB4A 4BW2A 5FB1A 3QZVA 4NQNA 4Z1SA 2DVSA 3MQMA 5CQ3A 2RI7A 4QSQA 4OGJA 1ZS5A 4LYWA 3UVWA 3LQHA 5FBXA 5IGKA 2GRCA 3JVJA 4O75A 5I40A 4IOOA 4QB3A 5DYUA 2WP2A 4UYEA 5EWVA 2R0VA 5CP5A 3NXBA 2I7KA 5CQ8A 5CTLA 5DKCA 3ZYUA 4YYGA 5IG6A 4NUCA 5DBMA 5FG4A 5CU8A 5CZGA 2YEKA 4IR6A 4ALHA 5CRZA 5DW1A 4YH4A 5E9LA 4LR6A 2RFJA 5F25A 5IIDA 1EQFA 5BT3A 5E9KA 5CFWA 2H60A 4QR3A 2LSPB 5DX4A 3O37A 3IU5A 5D3SA 5LKUA 2F6JA 4QEWA 4N4HA 1N72A 4KCXA 2DVRA 4YAXA 5HEMA 5C8GA 5EPBA 4XY9A 3HMHA 4UYFB 2YEMA 2D9EA 4E96A 5FH6A 4MR4A 5EQ1A 5D0CA 3P1CA 4PCIA 5CUDA 2DVQA 2L5EA 5D3PA 5IGLA 3U5KA 4IR4A 4QBMA 4A9MA 5HCLA 4N3WA 4AKNA 5ENHA 2YELA 5H1TA 5FB0A 2KTBB 4YK0A 4Q0NA 5H1UA 4WHWA 4NR8A 3HMFA 4YYJA 5KO4A 3MUKA 5A83A 3MULA 4TT4A 5A5SA 5FE7A 5FFYA 5KU3A 4F3IA 3UV5A 5AD3A 5CY9A 5CQ6A 2E7OA 5CUBA 4A9FA 5II1A 4MEQA 4A9OA 4UIZA 5ENJA 4HBYA 4MR5A 5A5RA 4HXRA 5E74A 5CQ7A 4QC1A 2WP1A 4CUUA 4HXLA 2R0YA 4YADA 5F61A 5BT4A 5DFBA 5K29A 4J1PA 4QEUA 3UVXA 4XYAA 5FH7A 5A85A 2OO1A 4NUEA 1JSPB 5KTXA 3AADA 5HQ7A 4O71A 5I86A 3UVYA 4HBVA 5F5ZA 3G0JA 2D82A 3U5PA 4XUBA 5KTWA 3LQJA 4TZ8A 4QSPA 5EP7A 4YATA 4KV1A 4BHWA 4CL9A 5FG5A 4QNSA 3LQIA 4C66A 5H1VA 4YBMA 2F6NA 4HXKA 4J3IA 4Y03A 3P5OA 5D3JA 4NR4A 4UYGA 2RS9B 4QSTA 4PCEA 4CFKA 4NR7A 4CUTA 5E3DA 5EVAA 5LJ1A 4N4FA 4A9IA 4A9NA 4QSRA 3Q2FA 4N4IA 2DKWA 4O7BA 5EPRA 1E6IA 5AD2A 3FKMX 4BW3A 3U5JA 4IORA 4HBWA 4O77A 4O76A 5FFVA 5E0RA 4Z6IA 4A9HA 3G0LA 2OUOA 5D3LA 5EWHA 4CFLA 4MR3A 5I29A 3DWYA 5F2PA 5DFDA 5J0DA 4YC9A 4A9LA 5LVQA 5LKZA 5CUCA 5LJ0A 5CRMA 3U5LA 4YYIA 4UIXA 4C67A 5EICA 4YYMA 3UVDA 3O35A 5E9VA 5FE2A 5E9MA 5D7XA 4QYLA 4ZQLA 5HQ6A 4TYLA 4MR6A 2YDWA 5DKHA 3P1DA 5C85A 2YQDA 3JVLA 4LC2A 4QY4A 3S91A 2RNYA 4MENA 4UIUA 5L96A 5LJ2A 5DW2A 4YH3A 4LZRA 4TTEA 4XY8A 4QR4A 5KHMA 4HBXA 4MEPA 5EK9A 4HXSA 5L8UA 4HXNA 5H85A 4A9JA 5EA1A 5DKDA 2DWWA 4UYHA 4Z1QA 4QR5A 4QSVA 5TCMA 4O72A 4NQMA 2G4AA 5E3GA 5A5NA 5HM0A 5ACYA 4NYWA 4HXPA 5D3TA 5CGPA 5FE1A 5C89A 5F60A 4LYSA 4NRAA 5IGNA 4A9KA 5F3AA 5DYAA 4IR5A 4QUUA 4Q0OA 5FDZA 3P1EA 5G4SA 4QZSA 2E3KA 4N4GA 3K2JA 5ENGA 5DY7A 4CUQA 4YYDA 4LZSA 5FE9A 4NRBA 4NRCA 4XUAA 2OSSA 4Z93A 5FE0A 2L85A 4QSWA 4O7CA 2R0SA 3LJWA 5LVRA 5C87A 3MB3A 3UV4A 2YYNA
chains in the Genus database with same CATH superfamily
5HLSA 4KV4A 4BJXA 5DFCA 5I80A 5EGUA 4YY4A 5A82A 5HFQA 3TLPA 4UYFA 4NXJA 5HFRA 5EV9A 2DATA 4PY6A 5E73A 5D25A 3MXFA 3IU6A 3U5MA 4AKGA 5EISA 5CQAA 5A5OA 4A9EA 5F1HA 4PS5A 4QC3A 5I89A 2EJNA 5ENEA 3DAIA 5F1LA 4PKLA 4TT2A 5II2A 1JM4B 5EM3A 4BW4A 5CUGA 5HRWA 5A81A 5LKTA 4ZC9A 4YYNA 5D26A 4TZ2A 5CUAA 4UIYA 5FG6A 4ZW1A 3ONIA 5IGMA 4O78A 3QZSA 5L99A 4CURA 5ETBA 5L98A 3O34A 5HQ5A 5HELA 3U5NA 4LYIA 5EWWA 5KTUA 3JVKA 3O33A 4PTBA 5E9YA 4YYHA 5CS8A 2I8NA 2NXBA 5D24A 5FFWA 5F63A 5HENA 5CPEA 1WUMA 5F36A 2YW5A 3LXJA 4O7EA 3Q2EA 4TS8A 5F62A 4O7AA 5EU1A 5JWMA 5CQTA 2DVVA 5EI4A 5L97A 5I83A 4WHUA 3U5OA 4X2IA 4AKIA 5EWCA 4UIVA 3JVMA 5TB6A 3UV2A 4O7FA 5A7CA 4O74A 5DLZA 5DYCA 4LZ2A 4QSSA 3I3JA 2MJVB 2N9GA 5EPSA 4QSXA 5A5PA 4GPJA 5COIA 5LKXA 5I7YA 4NR5A 5ENIA 5CQ5A 5IBNA 4LRGA 5D3NA 4OGIA 5E7DA 4CUSA 3O36A 4YABA 4UYDA 5I1QA 4UITA 4UIWA 3AQAA 4YYKA 1PUOA 4NUDA 3P1FA 5ETDA 5CQ4A 5BT5A 4TT6A 4DONA 4LDFA 5FE8A 2RO1A 5I7XA 3UW9A 3GG3A 4IOQA 5D3RA 5FH8A 4YY6A 5HRXA 4IR3A 3S92A 4YBTA 5I88A 5AMFA 3QZTA 4BW1A 5A5QA 4QEVA 5DYXA 5FE4A 4HXOA 4QYDA 5AMEA 2FSAA 4OUFA 4ALGA 4NR9A 4TQNA 3HMEA 4NYXA 4HXMA 5ENCA 4J0RA 5DLXA 4Z6HA 4NYVA 5HRVA 5C4QA 4CUPA 3SVGA 1F68A 4J0SA 1X0JA 3VKGA 3D7CA 2L84A 2E7NA 5FE5A 2R10A 4QSUA 4MEOA 4RVRA 2RNWA 5G4RA 5FE3A 4YBSA 4O70A 4NR6A 5LUUA 5ENBA 5D3HA 5C7NA 4TU4A 3SVHA 4TU6A 5E9IA 4WIVA 4CLBA 1WUGA 3SVFA 2RNXA 5FE6A 5ENFA 5CUEA 5EWDA 5HJCA 4FLPA 3RCWA 5JI8A 4QUTA 5L8TA 4NS5A 3MB4A 4BW2A 5FB1A 3QZVA 4NQNA 4Z1SA 2DVSA 3MQMA 5CQ3A 2RI7A 4QSQA 4OGJA 1ZS5A 4LYWA 3UVWA 3LQHA 5FBXA 5IGKA 2GRCA 3JVJA 4O75A 5I40A 4IOOA 4QB3A 5DYUA 2WP2A 4UYEA 5EWVA 2R0VA 5CP5A 3NXBA 2I7KA 5CQ8A 5CTLA 5DKCA 3ZYUA 4YYGA 5IG6A 4NUCA 5DBMA 5FG4A 5CU8A 5CZGA 2YEKA 4IR6A 4ALHA 5CRZA 5DW1A 4YH4A 5E9LA 4LR6A 2RFJA 5F25A 5IIDA 1EQFA 1ZKRA 5BT3A 5E9KA 5CFWA 2H60A 4QR3A 2LSPB 5DX4A 3O37A 3ERRA 3IU5A 5D3SA 5LKUA 2F6JA 4QEWA 4N4HA 1N72A 4KCXA 2DVRA 4YAXA 5HEMA 5C8GA 5EPBA 4XY9A 3HMHA 4UYFB 2YEMA 2D9EA 4E96A 5FH6A 4MR4A 5EQ1A 5D0CA 3P1CA 4PCIA 5CUDA 2DVQA 2L5EA 3D1BA 5D3PA 5IGLA 3U5KA 4IR4A 4QBMA 4A9MA 5HCLA 4N3WA 4AKNA 5ENHA 2YELA 5H1TA 5FB0A 2KTBB 4YK0A 4Q0NA 5H1UA 4WHWA 4NR8A 3HMFA 4YYJA 5KO4A 3MUKA 5A83A 3MULA 4TT4A 5A5SA 5FE7A 5FFYA 5KU3A 4F3IA 3UV5A 5AD3A 5CY9A 5CQ6A 2E7OA 5CUBA 4A9FA 5II1A 4MEQA 4A9OA 4UIZA 5ENJA 4HBYA 4MR5A 5A5RA 4HXRA 5E74A 5CQ7A 4QC1A 2WP1A 4CUUA 4HXLA 2R0YA 4YADA 5F61A 5BT4A 5DFBA 5K29A 4J1PA 4QEUA 3UVXA 4XYAA 5FH7A 5A85A 2OO1A 4NUEA 1JSPB 5KTXA 3AADA 5HQ7A 4O71A 5I86A 3UVYA 4HBVA 5F5ZA 3G0JA 2D82A 3U5PA 4XUBA 5KTWA 3LQJA 4TZ8A 4QSPA 5EP7A 4YATA 4KV1A 4BHWA 4CL9A 5FG5A 4QNSA 3LQIA 4C66A 5H1VA 4YBMA 2F6NA 4HXKA 4J3IA 4Y03A 3P5OA 5D3JA 4NR4A 3VKHA 4UYGA 2RS9B 4QSTA 4PCEA 4CFKA 4NR7A 4CUTA 5E3DA 5EVAA 5LJ1A 4N4FA 4A9IA 4A9NA 4QSRA 3Q2FA 4N4IA 2DKWA 4O7BA 5EPRA 1E6IA 5AD2A 3FKMX 4BW3A 3U5JA 4IORA 4HBWA 4O77A 4O76A 5FFVA 5E0RA 4Z6IA 4A9HA 3G0LA 2OUOA 4AI6A 5D3LA 5EWHA 4CFLA 4MR3A 5I29A 3DWYA 5F2PA 5DFDA 5J0DA 4YC9A 4A9LA 5LVQA 5LKZA 5CUCA 5LJ0A 5CRMA 3U5LA 4YYIA 4UIXA 4C67A 5EICA 4YYMA 3UVDA 3O35A 5E9VA 5FE2A 5E9MA 5D7XA 4QYLA 4ZQLA 5HQ6A 4TYLA 4MR6A 2YDWA 5DKHA 3P1DA 5C85A 2YQDA 3JVLA 4LC2A 4QY4A 3S91A 2RNYA 4MENA 4UIUA 5L96A 5LJ2A 5DW2A 4YH3A 4LZRA 4TTEA 4XY8A 4QR4A 5KHMA 4HBXA 4AKHA 4MEPA 5EK9A 4HXSA 5L8UA 4HXNA 5H85A 4A9JA 5EA1A 5DKDA 2DWWA 4UYHA 4Z1QA 4QR5A 4QSVA 5TCMA 4O72A 4NQMA 2G4AA 5E3GA 5A5NA 5HM0A 5ACYA 4NYWA 4HXPA 5D3TA 5CGPA 5FE1A 5C89A 5F60A 4LYSA 4NRAA 5IGNA 4A9KA 5F3AA 5DYAA 4IR5A 4QUUA 4Q0OA 5FDZA 3P1EA 3D1DA 4QZSA 5G4SA 2E3KA 4N4GA 3K2JA 5ENGA 5DY7A 4CUQA 4YYDA 4LZSA 5FE9A 4NRBA 4NRCA 4XUAA 2OSSA 4Z93A 5FE0A 2L85A 4QSWA 4O7CA 2R0SA 3LJWA 5LVRA 5C87A 3MB3A 3UV4A 2YYNA
chains in the Genus database with same CATH topology
5HLSA 4KV4A 4BJXA 5DFCA 5I80A 5EGUA 4YY4A 5A82A 5HFQA 3TLPA 4UYFA 4NXJA 5HFRA 5EV9A 2DATA 4PY6A 5E73A 5D25A 3MXFA 3IU6A 3U5MA 5EISA 5CQAA 5A5OA 4A9EA 5F1HA 4PS5A 4QC3A 5I89A 5ENEA 3DAIA 5F1LA 4PKLA 4TT2A 5II2A 1JM4B 5EM3A 4BW4A 5CUGA 5HRWA 5A81A 5LKTA 4ZC9A 4YYNA 5D26A 4TZ2A 5CUAA 4UIYA 5FG6A 4ZW1A 3ONIA 5IGMA 4O78A 3QZSA 5L99A 4CURA 5ETBA 5L98A 3O34A 5HQ5A 5HELA 3U5NA 4LYIA 5EWWA 5KTUA 3JVKA 3O33A 4PTBA 5E9YA 4YYHA 5CS8A 2I8NA 2NXBA 5D24A 5FFWA 5F63A 5HENA 5CPEA 1WUMA 5F36A 2YW5A 3LXJA 4O7EA 3Q2EA 4TS8A 5F62A 4O7AA 5EU1A 5JWMA 5CQTA 2DVVA 5EI4A 5L97A 5I83A 4WHUA 3U5OA 4X2IA 5EWCA 4UIVA 3JVMA 5TB6A 3UV2A 4O7FA 5A7CA 4O74A 5DLZA 5DYCA 4LZ2A 4QSSA 3I3JA 2MJVB 2N9GA 5EPSA 4QSXA 5A5PA 4GPJA 5COIA 5LKXA 5I7YA 4NR5A 5ENIA 5CQ5A 5IBNA 4LRGA 5D3NA 4OGIA 5E7DA 4CUSA 3O36A 4YABA 4UYDA 5I1QA 4UITA 4UIWA 3AQAA 4YYKA 4NUDA 3P1FA 5ETDA 5CQ4A 5BT5A 4TT6A 4DONA 4LDFA 5FE8A 2RO1A 5I7XA 3UW9A 3GG3A 4IOQA 5D3RA 5FH8A 4YY6A 5HRXA 4IR3A 3S92A 4YBTA 5I88A 5AMFA 3QZTA 4BW1A 5A5QA 4QEVA 5DYXA 5FE4A 4HXOA 4QYDA 5AMEA 2FSAA 4OUFA 4ALGA 4NR9A 4TQNA 3HMEA 4NYXA 4HXMA 5ENCA 4J0RA 5DLXA 4Z6HA 4NYVA 5HRVA 5C4QA 4CUPA 3SVGA 1F68A 4J0SA 1X0JA 3D7CA 2L84A 2E7NA 5FE5A 2R10A 4QSUA 4MEOA 4RVRA 2RNWA 5G4RA 5FE3A 4YBSA 4O70A 4NR6A 5LUUA 5ENBA 5D3HA 5C7NA 4TU4A 3SVHA 4TU6A 5E9IA 4WIVA 4CLBA 1WUGA 3SVFA 2RNXA 5FE6A 5ENFA 5CUEA 5EWDA 5HJCA 4FLPA 3RCWA 5JI8A 4QUTA 5L8TA 4NS5A 3MB4A 4BW2A 5FB1A 3QZVA 4NQNA 4Z1SA 2DVSA 3MQMA 5CQ3A 2RI7A 4QSQA 4OGJA 1ZS5A 4LYWA 3UVWA 3LQHA 5FBXA 5IGKA 2GRCA 3JVJA 4O75A 5I40A 4IOOA 4QB3A 5DYUA 2WP2A 4UYEA 5EWVA 2R0VA 5CP5A 3NXBA 2I7KA 5CQ8A 5CTLA 5DKCA 3ZYUA 4YYGA 5IG6A 4NUCA 5DBMA 5FG4A 5CU8A 5CZGA 2YEKA 4IR6A 4ALHA 5CRZA 5DW1A 4YH4A 5E9LA 4LR6A 2RFJA 5F25A 5IIDA 1EQFA 5BT3A 5E9KA 5CFWA 2H60A 4QR3A 2LSPB 5DX4A 3O37A 3IU5A 5D3SA 5LKUA 2F6JA 4QEWA 4N4HA 1N72A 4KCXA 2DVRA 4YAXA 5HEMA 5C8GA 5EPBA 4XY9A 3HMHA 4UYFB 2YEMA 2D9EA 4E96A 5FH6A 4MR4A 5EQ1A 5D0CA 3P1CA 4PCIA 5CUDA 2DVQA 2L5EA 5D3PA 5IGLA 3U5KA 4IR4A 4QBMA 4A9MA 5HCLA 4N3WA 4AKNA 5ENHA 2YELA 5H1TA 5FB0A 2KTBB 4YK0A 4Q0NA 5H1UA 4WHWA 4NR8A 3HMFA 4YYJA 5KO4A 3MUKA 5A83A 3MULA 4TT4A 5A5SA 5FE7A 5FFYA 5KU3A 4F3IA 3UV5A 5AD3A 5CY9A 5CQ6A 2E7OA 5CUBA 4A9FA 5II1A 4MEQA 4A9OA 4UIZA 5ENJA 4HBYA 4MR5A 5A5RA 4HXRA 5E74A 5CQ7A 4QC1A 2WP1A 4CUUA 4HXLA 2R0YA 4YADA 5F61A 5BT4A 5DFBA 5K29A 4J1PA 4QEUA 3UVXA 4XYAA 5FH7A 5A85A 2OO1A 4NUEA 1JSPB 5KTXA 3AADA 5HQ7A 4O71A 5I86A 3UVYA 4HBVA 5F5ZA 3G0JA 2D82A 3U5PA 4XUBA 5KTWA 3LQJA 4TZ8A 4QSPA 5EP7A 4YATA 4KV1A 4BHWA 4CL9A 5FG5A 4QNSA 3LQIA 4C66A 5H1VA 4YBMA 2F6NA 4HXKA 4J3IA 4Y03A 3P5OA 5D3JA 4NR4A 4UYGA 2RS9B 4QSTA 4PCEA 4CFKA 4NR7A 4CUTA 5E3DA 5EVAA 5LJ1A 4N4FA 4A9IA 4A9NA 4QSRA 3Q2FA 4N4IA 2DKWA 4O7BA 5EPRA 1E6IA 5AD2A 3FKMX 4BW3A 3U5JA 4IORA 4HBWA 4O77A 4O76A 5FFVA 5E0RA 4Z6IA 4A9HA 3G0LA 2OUOA 5D3LA 5EWHA 4CFLA 4MR3A 5I29A 3DWYA 5F2PA 5DFDA 5J0DA 4YC9A 4A9LA 5LVQA 5LKZA 5CUCA 5LJ0A 5CRMA 3U5LA 4YYIA 4UIXA 4C67A 5EICA 4YYMA 3UVDA 3O35A 5E9VA 5FE2A 5E9MA 5D7XA 4QYLA 4ZQLA 5HQ6A 4TYLA 4MR6A 2YDWA 5DKHA 3P1DA 5C85A 2YQDA 3JVLA 4LC2A 4QY4A 3S91A 2RNYA 4MENA 4UIUA 5L96A 5LJ2A 5DW2A 4YH3A 4LZRA 4TTEA 4XY8A 4QR4A 5KHMA 4HBXA 4MEPA 5EK9A 4HXSA 5L8UA 4HXNA 5H85A 4A9JA 5EA1A 5DKDA 2DWWA 4UYHA 4Z1QA 4QR5A 4QSVA 5TCMA 4O72A 4NQMA 2G4AA 5E3GA 5A5NA 5HM0A 5ACYA 4NYWA 4HXPA 5D3TA 5CGPA 5FE1A 5C89A 5F60A 4LYSA 4NRAA 5IGNA 4A9KA 5F3AA 5DYAA 4IR5A 4QUUA 4Q0OA 5FDZA 3P1EA 5G4SA 4QZSA 2E3KA 4N4GA 3K2JA 5ENGA 5DY7A 4CUQA 4YYDA 4LZSA 5FE9A 4NRBA 4NRCA 4XUAA 2OSSA 4Z93A 5FE0A 2L85A 4QSWA 4O7CA 2R0SA 3LJWA 5LVRA 5C87A 3MB3A 3UV4A 2YYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLS A;  4KV4 A;  4BJX A;  5DFC A;  5I80 A;  5EGU A;  4YY4 A;  5A82 A;  5HFQ A;  3TLP A;  4UYF A;  4NXJ A;  5HFR A;  5EV9 A;  2DAT A;  4PY6 A;  5E73 A;  5D25 A;  3MXF A;  3IU6 A;  3U5M A;  5EIS A;  5CQA A;  5A5O A;  4A9E A;  5F1H A;  4PS5 A;  4QC3 A;  5I89 A;  5ENE A;  3DAI A;  5F1L A;  4PKL A;  4TT2 A;  5II2 A;  1JM4 B;  5EM3 A;  4BW4 A;  5CUG A;  5HRW A;  5A81 A;  5LKT A;  4ZC9 A;  4YYN A;  5D26 A;  4TZ2 A;  5CUA A;  4UIY A;  5FG6 A;  4ZW1 A;  3ONI A;  5IGM A;  4O78 A;  3QZS A;  5L99 A;  4CUR A;  5ETB A;  5L98 A;  3O34 A;  5HQ5 A;  5HEL A;  3U5N A;  4LYI A;  5EWW A;  5KTU A;  3JVK A;  3O33 A;  4PTB A;  5E9Y A;  4YYH A;  5CS8 A;  2I8N A;  2NXB A;  5D24 A;  5FFW A;  5F63 A;  5HEN A;  5CPE A;  1WUM A;  5F36 A;  2YW5 A;  3LXJ A;  4O7E A;  3Q2E A;  4TS8 A;  5F62 A;  4O7A A;  5EU1 A;  5JWM A;  5CQT A;  2DVV A;  5EI4 A;  5L97 A;  5I83 A;  4WHU A;  3U5O A;  4X2I A;  5EWC A;  4UIV A;  3JVM A;  5TB6 A;  3UV2 A;  4O7F A;  5A7C A;  4O74 A;  5DLZ A;  5DYC A;  4LZ2 A;  4QSS A;  3I3J A;  2MJV B;  2N9G A;  5EPS A;  4QSX A;  5A5P A;  4GPJ A;  5COI A;  5LKX A;  5I7Y A;  4NR5 A;  5ENI A;  5CQ5 A;  5IBN A;  4LRG A;  5D3N A;  4OGI A;  5E7D A;  4CUS A;  3O36 A;  4YAB A;  4UYD A;  5I1Q A;  4UIT A;  4UIW A;  3AQA A;  4YYK A;  4NUD A;  3P1F A;  5ETD A;  5CQ4 A;  5BT5 A;  4TT6 A;  4DON A;  4LDF A;  5FE8 A;  2RO1 A;  5I7X A;  3UW9 A;  3GG3 A;  4IOQ A;  5D3R A;  5FH8 A;  4YY6 A;  5HRX A;  4IR3 A;  3S92 A;  4YBT A;  5I88 A;  5AMF A;  3QZT A;  4BW1 A;  5A5Q A;  4QEV A;  5DYX A;  5FE4 A;  4HXO A;  4QYD A;  5AME A;  2FSA A;  4OUF A;  4ALG A;  4NR9 A;  4TQN A;  3HME A;  4NYX A;  4HXM A;  5ENC A;  4J0R A;  5DLX A;  4Z6H A;  4NYV A;  5HRV A;  5C4Q A;  4CUP A;  3SVG A;  1F68 A;  4J0S A;  1X0J A;  3D7C A;  2L84 A;  2E7N A;  5FE5 A;  2R10 A;  4QSU A;  4MEO A;  4RVR A;  2RNW A;  5G4R A;  5FE3 A;  4YBS A;  4O70 A;  4NR6 A;  5LUU A;  5ENB A;  5D3H A;  5C7N A;  4TU4 A;  3SVH A;  4TU6 A;  5E9I A;  4WIV A;  4CLB A;  1WUG A;  3SVF A;  2RNX A;  5FE6 A;  5ENF A;  5CUE A;  5EWD A;  5HJC A;  4FLP A;  3RCW A;  5JI8 A;  4QUT A;  5L8T A;  4NS5 A;  3MB4 A;  4BW2 A;  5FB1 A;  3QZV A;  4NQN A;  4Z1S A;  2DVS A;  3MQM A;  5CQ3 A;  2RI7 A;  4QSQ A;  4OGJ A;  1ZS5 A;  4LYW A;  3UVW A;  3LQH A;  5FBX A;  5IGK A;  2GRC A;  3JVJ A;  4O75 A;  5I40 A;  4IOO A;  4QB3 A;  5DYU A;  2WP2 A;  4UYE A;  5EWV A;  2R0V A;  5CP5 A;  3NXB A;  2I7K A;  5CQ8 A;  5CTL A;  5DKC A;  3ZYU A;  4YYG A;  5IG6 A;  4NUC A;  5DBM A;  5FG4 A;  5CU8 A;  5CZG A;  2YEK A;  4IR6 A;  4ALH A;  5CRZ A;  5DW1 A;  4YH4 A;  5E9L A;  4LR6 A;  2RFJ A;  5F25 A;  5IID A;  1EQF A;  5BT3 A;  5E9K A;  5CFW A;  2H60 A;  4QR3 A;  2LSP B;  5DX4 A;  3O37 A;  3IU5 A;  5D3S A;  5LKU A;  2F6J A;  4QEW A;  4N4H A;  1N72 A;  4KCX A;  2DVR A;  4YAX A;  5HEM A;  5C8G A;  5EPB A;  4XY9 A;  3HMH A;  4UYF B;  2YEM A;  2D9E A;  4E96 A;  5FH6 A;  4MR4 A;  5EQ1 A;  5D0C A;  3P1C A;  4PCI A;  5CUD A;  2DVQ A;  2L5E A;  5D3P A;  5IGL A;  3U5K A;  4IR4 A;  4QBM A;  4A9M A;  5HCL A;  4N3W A;  4AKN A;  5ENH A;  2YEL A;  5H1T A;  5FB0 A;  2KTB B;  4YK0 A;  4Q0N A;  5H1U A;  4WHW A;  4NR8 A;  3HMF A;  4YYJ A;  5KO4 A;  3MUK A;  5A83 A;  3MUL A;  4TT4 A;  5A5S A;  5FE7 A;  5FFY A;  5KU3 A;  4F3I A;  3UV5 A;  5AD3 A;  5CY9 A;  5CQ6 A;  2E7O A;  5CUB A;  4A9F A;  5II1 A;  4MEQ A;  4A9O A;  4UIZ A;  5ENJ A;  4HBY A;  4MR5 A;  5A5R A;  4HXR A;  5E74 A;  5CQ7 A;  4QC1 A;  2WP1 A;  4CUU A;  4HXL A;  2R0Y A;  4YAD A;  5F61 A;  5BT4 A;  5DFB A;  5K29 A;  4J1P A;  4QEU A;  3UVX A;  4XYA A;  5FH7 A;  5A85 A;  2OO1 A;  4NUE A;  1JSP B;  5KTX A;  3AAD A;  5HQ7 A;  4O71 A;  5I86 A;  3UVY A;  4HBV A;  5F5Z A;  3G0J A;  2D82 A;  3U5P A;  4XUB A;  5KTW A;  3LQJ A;  4TZ8 A;  4QSP A;  5EP7 A;  4YAT A;  4KV1 A;  4BHW A;  4CL9 A;  5FG5 A;  4QNS A;  3LQI A;  4C66 A;  5H1V A;  4YBM A;  2F6N A;  4HXK A;  4J3I A;  4Y03 A;  3P5O A;  5D3J A;  4NR4 A;  4UYG A;  2RS9 B;  4QST A;  4PCE A;  4CFK A;  4NR7 A;  4CUT A;  5E3D A;  5EVA A;  5LJ1 A;  4N4F A;  4A9I A;  4A9N A;  4QSR A;  3Q2F A;  4N4I A;  2DKW A;  4O7B A;  5EPR A;  1E6I A;  5AD2 A;  3FKM X;  4BW3 A;  3U5J A;  4IOR A;  4HBW A;  4O77 A;  4O76 A;  5FFV A;  5E0R A;  4Z6I A;  4A9H A;  3G0L A;  2OUO A;  5D3L A;  5EWH A;  4CFL A;  4MR3 A;  5I29 A;  3DWY A;  5F2P A;  5DFD A;  5J0D A;  4YC9 A;  4A9L A;  5LVQ A;  5LKZ A;  5CUC A;  5LJ0 A;  5CRM A;  3U5L A;  4YYI A;  4UIX A;  4C67 A;  5EIC A;  4YYM A;  3UVD A;  3O35 A;  5E9V A;  5FE2 A;  5E9M A;  5D7X A;  4QYL A;  4ZQL A;  5HQ6 A;  4TYL A;  4MR6 A;  2YDW A;  5DKH A;  3P1D A;  5C85 A;  2YQD A;  3JVL A;  4LC2 A;  4QY4 A;  3S91 A;  2RNY A;  4MEN A;  4UIU A;  5L96 A;  5LJ2 A;  5DW2 A;  4YH3 A;  4LZR A;  4TTE A;  4XY8 A;  4QR4 A;  5KHM A;  4HBX A;  4MEP A;  5EK9 A;  4HXS A;  5L8U A;  4HXN A;  5H85 A;  4A9J A;  5EA1 A;  5DKD A;  2DWW A;  4UYH A;  4Z1Q A;  4QR5 A;  4QSV A;  5TCM A;  4O72 A;  4NQM A;  2G4A A;  5E3G A;  5A5N A;  5HM0 A;  5ACY A;  4NYW A;  4HXP A;  5D3T A;  5CGP A;  5FE1 A;  5C89 A;  5F60 A;  4LYS A;  4NRA A;  5IGN A;  4A9K A;  5F3A A;  5DYA A;  4IR5 A;  4QUU A;  4Q0O A;  5FDZ A;  3P1E A;  5G4S A;  4QZS A;  2E3K A;  4N4G A;  3K2J A;  5ENG A;  5DY7 A;  4CUQ A;  4YYD A;  4LZS A;  5FE9 A;  4NRB A;  4NRC A;  4XUA A;  2OSS A;  4Z93 A;  5FE0 A;  2L85 A;  4QSW A;  4O7C A;  2R0S A;  3LJW A;  5LVR A;  5C87 A;  3MB3 A;  3UV4 A;  2YYN A; 
#chains in the Genus database with same CATH topology
 5HLS A;  4KV4 A;  4BJX A;  5DFC A;  5I80 A;  5EGU A;  4YY4 A;  5A82 A;  5HFQ A;  3TLP A;  4UYF A;  4NXJ A;  5HFR A;  5EV9 A;  2DAT A;  4PY6 A;  5E73 A;  5D25 A;  3MXF A;  3IU6 A;  3U5M A;  4AKG A;  5EIS A;  5CQA A;  5A5O A;  4A9E A;  5F1H A;  4PS5 A;  4QC3 A;  5I89 A;  2EJN A;  5ENE A;  3DAI A;  5F1L A;  4PKL A;  4TT2 A;  5II2 A;  1JM4 B;  5EM3 A;  4BW4 A;  5CUG A;  5HRW A;  5A81 A;  5LKT A;  4ZC9 A;  4YYN A;  5D26 A;  4TZ2 A;  5CUA A;  4UIY A;  5FG6 A;  4ZW1 A;  3ONI A;  5IGM A;  4O78 A;  3QZS A;  5L99 A;  4CUR A;  5ETB A;  5L98 A;  3O34 A;  5HQ5 A;  5HEL A;  3U5N A;  4LYI A;  5EWW A;  5KTU A;  3JVK A;  3O33 A;  4PTB A;  5E9Y A;  4YYH A;  5CS8 A;  2I8N A;  2NXB A;  5D24 A;  5FFW A;  5F63 A;  5HEN A;  5CPE A;  1WUM A;  5F36 A;  2YW5 A;  3LXJ A;  4O7E A;  3Q2E A;  4TS8 A;  5F62 A;  4O7A A;  5EU1 A;  5JWM A;  5CQT A;  2DVV A;  5EI4 A;  5L97 A;  5I83 A;  4WHU A;  3U5O A;  4X2I A;  4AKI A;  5EWC A;  4UIV A;  3JVM A;  5TB6 A;  3UV2 A;  4O7F A;  5A7C A;  4O74 A;  5DLZ A;  5DYC A;  4LZ2 A;  4QSS A;  3I3J A;  2MJV B;  2N9G A;  5EPS A;  4QSX A;  5A5P A;  4GPJ A;  5COI A;  5LKX A;  5I7Y A;  4NR5 A;  5ENI A;  5CQ5 A;  5IBN A;  4LRG A;  5D3N A;  4OGI A;  5E7D A;  4CUS A;  3O36 A;  4YAB A;  4UYD A;  5I1Q A;  4UIT A;  4UIW A;  3AQA A;  4YYK A;  1PUO A;  4NUD A;  3P1F A;  5ETD A;  5CQ4 A;  5BT5 A;  4TT6 A;  4DON A;  4LDF A;  5FE8 A;  2RO1 A;  5I7X A;  3UW9 A;  3GG3 A;  4IOQ A;  5D3R A;  5FH8 A;  4YY6 A;  5HRX A;  4IR3 A;  3S92 A;  4YBT A;  5I88 A;  5AMF A;  3QZT A;  4BW1 A;  5A5Q A;  4QEV A;  5DYX A;  5FE4 A;  4HXO A;  4QYD A;  5AME A;  2FSA A;  4OUF A;  4ALG A;  4NR9 A;  4TQN A;  3HME A;  4NYX A;  4HXM A;  5ENC A;  4J0R A;  5DLX A;  4Z6H A;  4NYV A;  5HRV A;  5C4Q A;  4CUP A;  3SVG A;  1F68 A;  4J0S A;  1X0J A;  3VKG A;  3D7C A;  2L84 A;  2E7N A;  5FE5 A;  2R10 A;  4QSU A;  4MEO A;  4RVR A;  2RNW A;  5G4R A;  5FE3 A;  4YBS A;  4O70 A;  4NR6 A;  5LUU A;  5ENB A;  5D3H A;  5C7N A;  4TU4 A;  3SVH A;  4TU6 A;  5E9I A;  4WIV A;  4CLB A;  1WUG A;  3SVF A;  2RNX A;  5FE6 A;  5ENF A;  5CUE A;  5EWD A;  5HJC A;  4FLP A;  3RCW A;  5JI8 A;  4QUT A;  5L8T A;  4NS5 A;  3MB4 A;  4BW2 A;  5FB1 A;  3QZV A;  4NQN A;  4Z1S A;  2DVS A;  3MQM A;  5CQ3 A;  2RI7 A;  4QSQ A;  4OGJ A;  1ZS5 A;  4LYW A;  3UVW A;  3LQH A;  5FBX A;  5IGK A;  2GRC A;  3JVJ A;  4O75 A;  5I40 A;  4IOO A;  4QB3 A;  5DYU A;  2WP2 A;  4UYE A;  5EWV A;  2R0V A;  5CP5 A;  3NXB A;  2I7K A;  5CQ8 A;  5CTL A;  5DKC A;  3ZYU A;  4YYG A;  5IG6 A;  4NUC A;  5DBM A;  5FG4 A;  5CU8 A;  5CZG A;  2YEK A;  4IR6 A;  4ALH A;  5CRZ A;  5DW1 A;  4YH4 A;  5E9L A;  4LR6 A;  2RFJ A;  5F25 A;  5IID A;  1EQF A;  1ZKR A;  5BT3 A;  5E9K A;  5CFW A;  2H60 A;  4QR3 A;  2LSP B;  5DX4 A;  3O37 A;  3ERR A;  3IU5 A;  5D3S A;  5LKU A;  2F6J A;  4QEW A;  4N4H A;  1N72 A;  4KCX A;  2DVR A;  4YAX A;  5HEM A;  5C8G A;  5EPB A;  4XY9 A;  3HMH A;  4UYF B;  2YEM A;  2D9E A;  4E96 A;  5FH6 A;  4MR4 A;  5EQ1 A;  5D0C A;  3P1C A;  4PCI A;  5CUD A;  2DVQ A;  2L5E A;  3D1B A;  5D3P A;  5IGL A;  3U5K A;  4IR4 A;  4QBM A;  4A9M A;  5HCL A;  4N3W A;  4AKN A;  5ENH A;  2YEL A;  5H1T A;  5FB0 A;  2KTB B;  4YK0 A;  4Q0N A;  5H1U A;  4WHW A;  4NR8 A;  3HMF A;  4YYJ A;  5KO4 A;  3MUK A;  5A83 A;  3MUL A;  4TT4 A;  5A5S A;  5FE7 A;  5FFY A;  5KU3 A;  4F3I A;  3UV5 A;  5AD3 A;  5CY9 A;  5CQ6 A;  2E7O A;  5CUB A;  4A9F A;  5II1 A;  4MEQ A;  4A9O A;  4UIZ A;  5ENJ A;  4HBY A;  4MR5 A;  5A5R A;  4HXR A;  5E74 A;  5CQ7 A;  4QC1 A;  2WP1 A;  4CUU A;  4HXL A;  2R0Y A;  4YAD A;  5F61 A;  5BT4 A;  5DFB A;  5K29 A;  4J1P A;  4QEU A;  3UVX A;  4XYA A;  5FH7 A;  5A85 A;  2OO1 A;  4NUE A;  1JSP B;  5KTX A;  3AAD A;  5HQ7 A;  4O71 A;  5I86 A;  3UVY A;  4HBV A;  5F5Z A;  3G0J A;  2D82 A;  3U5P A;  4XUB A;  5KTW A;  3LQJ A;  4TZ8 A;  4QSP A;  5EP7 A;  4YAT A;  4KV1 A;  4BHW A;  4CL9 A;  5FG5 A;  4QNS A;  3LQI A;  4C66 A;  5H1V A;  4YBM A;  2F6N A;  4HXK A;  4J3I A;  4Y03 A;  3P5O A;  5D3J A;  4NR4 A;  3VKH A;  4UYG A;  2RS9 B;  4QST A;  4PCE A;  4CFK A;  4NR7 A;  4CUT A;  5E3D A;  5EVA A;  5LJ1 A;  4N4F A;  4A9I A;  4A9N A;  4QSR A;  3Q2F A;  4N4I A;  2DKW A;  4O7B A;  5EPR A;  1E6I A;  5AD2 A;  3FKM X;  4BW3 A;  3U5J A;  4IOR A;  4HBW A;  4O77 A;  4O76 A;  5FFV A;  5E0R A;  4Z6I A;  4A9H A;  3G0L A;  2OUO A;  4AI6 A;  5D3L A;  5EWH A;  4CFL A;  4MR3 A;  5I29 A;  3DWY A;  5F2P A;  5DFD A;  5J0D A;  4YC9 A;  4A9L A;  5LVQ A;  5LKZ A;  5CUC A;  5LJ0 A;  5CRM A;  3U5L A;  4YYI A;  4UIX A;  4C67 A;  5EIC A;  4YYM A;  3UVD A;  3O35 A;  5E9V A;  5FE2 A;  5E9M A;  5D7X A;  4QYL A;  4ZQL A;  5HQ6 A;  4TYL A;  4MR6 A;  2YDW A;  5DKH A;  3P1D A;  5C85 A;  2YQD A;  3JVL A;  4LC2 A;  4QY4 A;  3S91 A;  2RNY A;  4MEN A;  4UIU A;  5L96 A;  5LJ2 A;  5DW2 A;  4YH3 A;  4LZR A;  4TTE A;  4XY8 A;  4QR4 A;  5KHM A;  4HBX A;  4AKH A;  4MEP A;  5EK9 A;  4HXS A;  5L8U A;  4HXN A;  5H85 A;  4A9J A;  5EA1 A;  5DKD A;  2DWW A;  4UYH A;  4Z1Q A;  4QR5 A;  4QSV A;  5TCM A;  4O72 A;  4NQM A;  2G4A A;  5E3G A;  5A5N A;  5HM0 A;  5ACY A;  4NYW A;  4HXP A;  5D3T A;  5CGP A;  5FE1 A;  5C89 A;  5F60 A;  4LYS A;  4NRA A;  5IGN A;  4A9K A;  5F3A A;  5DYA A;  4IR5 A;  4QUU A;  4Q0O A;  5FDZ A;  3P1E A;  3D1D A;  4QZS A;  5G4S A;  2E3K A;  4N4G A;  3K2J A;  5ENG A;  5DY7 A;  4CUQ A;  4YYD A;  4LZS A;  5FE9 A;  4NRB A;  4NRC A;  4XUA A;  2OSS A;  4Z93 A;  5FE0 A;  2L85 A;  4QSW A;  4O7C A;  2R0S A;  3LJW A;  5LVR A;  5C87 A;  3MB3 A;  3UV4 A;  2YYN A; 
#chains in the Genus database with same CATH homology
 5HLS A;  4KV4 A;  4BJX A;  5DFC A;  5I80 A;  5EGU A;  4YY4 A;  5A82 A;  5HFQ A;  3TLP A;  4UYF A;  4NXJ A;  5HFR A;  5EV9 A;  2DAT A;  4PY6 A;  5E73 A;  5D25 A;  3MXF A;  3IU6 A;  3U5M A;  5EIS A;  5CQA A;  5A5O A;  4A9E A;  5F1H A;  4PS5 A;  4QC3 A;  5I89 A;  5ENE A;  3DAI A;  5F1L A;  4PKL A;  4TT2 A;  5II2 A;  1JM4 B;  5EM3 A;  4BW4 A;  5CUG A;  5HRW A;  5A81 A;  5LKT A;  4ZC9 A;  4YYN A;  5D26 A;  4TZ2 A;  5CUA A;  4UIY A;  5FG6 A;  4ZW1 A;  3ONI A;  5IGM A;  4O78 A;  3QZS A;  5L99 A;  4CUR A;  5ETB A;  5L98 A;  3O34 A;  5HQ5 A;  5HEL A;  3U5N A;  4LYI A;  5EWW A;  5KTU A;  3JVK A;  3O33 A;  4PTB A;  5E9Y A;  4YYH A;  5CS8 A;  2I8N A;  2NXB A;  5D24 A;  5FFW A;  5F63 A;  5HEN A;  5CPE A;  1WUM A;  5F36 A;  2YW5 A;  3LXJ A;  4O7E A;  3Q2E A;  4TS8 A;  5F62 A;  4O7A A;  5EU1 A;  5JWM A;  5CQT A;  2DVV A;  5EI4 A;  5L97 A;  5I83 A;  4WHU A;  3U5O A;  4X2I A;  5EWC A;  4UIV A;  3JVM A;  5TB6 A;  3UV2 A;  4O7F A;  5A7C A;  4O74 A;  5DLZ A;  5DYC A;  4LZ2 A;  4QSS A;  3I3J A;  2MJV B;  2N9G A;  5EPS A;  4QSX A;  5A5P A;  4GPJ A;  5COI A;  5LKX A;  5I7Y A;  4NR5 A;  5ENI A;  5CQ5 A;  5IBN A;  4LRG A;  5D3N A;  4OGI A;  5E7D A;  4CUS A;  3O36 A;  4YAB A;  4UYD A;  5I1Q A;  4UIT A;  4UIW A;  3AQA A;  4YYK A;  4NUD A;  3P1F A;  5ETD A;  5CQ4 A;  5BT5 A;  4TT6 A;  4DON A;  4LDF A;  5FE8 A;  2RO1 A;  5I7X A;  3UW9 A;  3GG3 A;  4IOQ A;  5D3R A;  5FH8 A;  4YY6 A;  5HRX A;  4IR3 A;  3S92 A;  4YBT A;  5I88 A;  5AMF A;  3QZT A;  4BW1 A;  5A5Q A;  4QEV A;  5DYX A;  5FE4 A;  4HXO A;  4QYD A;  5AME A;  2FSA A;  4OUF A;  4ALG A;  4NR9 A;  4TQN A;  3HME A;  4NYX A;  4HXM A;  5ENC A;  4J0R A;  5DLX A;  4Z6H A;  4NYV A;  5HRV A;  5C4Q A;  4CUP A;  3SVG A;  1F68 A;  4J0S A;  1X0J A;  3D7C A;  2L84 A;  2E7N A;  5FE5 A;  2R10 A;  4QSU A;  4MEO A;  4RVR A;  2RNW A;  5G4R A;  5FE3 A;  4YBS A;  4O70 A;  4NR6 A;  5LUU A;  5ENB A;  5D3H A;  5C7N A;  4TU4 A;  3SVH A;  4TU6 A;  5E9I A;  4WIV A;  4CLB A;  1WUG A;  3SVF A;  2RNX A;  5FE6 A;  5ENF A;  5CUE A;  5EWD A;  5HJC A;  4FLP A;  3RCW A;  5JI8 A;  4QUT A;  5L8T A;  4NS5 A;  3MB4 A;  4BW2 A;  5FB1 A;  3QZV A;  4NQN A;  4Z1S A;  2DVS A;  3MQM A;  5CQ3 A;  2RI7 A;  4QSQ A;  4OGJ A;  1ZS5 A;  4LYW A;  3UVW A;  3LQH A;  5FBX A;  5IGK A;  2GRC A;  3JVJ A;  4O75 A;  5I40 A;  4IOO A;  4QB3 A;  5DYU A;  2WP2 A;  4UYE A;  5EWV A;  2R0V A;  5CP5 A;  3NXB A;  2I7K A;  5CQ8 A;  5CTL A;  5DKC A;  3ZYU A;  4YYG A;  5IG6 A;  4NUC A;  5DBM A;  5FG4 A;  5CU8 A;  5CZG A;  2YEK A;  4IR6 A;  4ALH A;  5CRZ A;  5DW1 A;  4YH4 A;  5E9L A;  4LR6 A;  2RFJ A;  5F25 A;  5IID A;  1EQF A;  5BT3 A;  5E9K A;  5CFW A;  2H60 A;  4QR3 A;  2LSP B;  5DX4 A;  3O37 A;  3IU5 A;  5D3S A;  5LKU A;  2F6J A;  4QEW A;  4N4H A;  1N72 A;  4KCX A;  2DVR A;  4YAX A;  5HEM A;  5C8G A;  5EPB A;  4XY9 A;  3HMH A;  4UYF B;  2YEM A;  2D9E A;  4E96 A;  5FH6 A;  4MR4 A;  5EQ1 A;  5D0C A;  3P1C A;  4PCI A;  5CUD A;  2DVQ A;  2L5E A;  5D3P A;  5IGL A;  3U5K A;  4IR4 A;  4QBM A;  4A9M A;  5HCL A;  4N3W A;  4AKN A;  5ENH A;  2YEL A;  5H1T A;  5FB0 A;  2KTB B;  4YK0 A;  4Q0N A;  5H1U A;  4WHW A;  4NR8 A;  3HMF A;  4YYJ A;  5KO4 A;  3MUK A;  5A83 A;  3MUL A;  4TT4 A;  5A5S A;  5FE7 A;  5FFY A;  5KU3 A;  4F3I A;  3UV5 A;  5AD3 A;  5CY9 A;  5CQ6 A;  2E7O A;  5CUB A;  4A9F A;  5II1 A;  4MEQ A;  4A9O A;  4UIZ A;  5ENJ A;  4HBY A;  4MR5 A;  5A5R A;  4HXR A;  5E74 A;  5CQ7 A;  4QC1 A;  2WP1 A;  4CUU A;  4HXL A;  2R0Y A;  4YAD A;  5F61 A;  5BT4 A;  5DFB A;  5K29 A;  4J1P A;  4QEU A;  3UVX A;  4XYA A;  5FH7 A;  5A85 A;  2OO1 A;  4NUE A;  1JSP B;  5KTX A;  3AAD A;  5HQ7 A;  4O71 A;  5I86 A;  3UVY A;  4HBV A;  5F5Z A;  3G0J A;  2D82 A;  3U5P A;  4XUB A;  5KTW A;  3LQJ A;  4TZ8 A;  4QSP A;  5EP7 A;  4YAT A;  4KV1 A;  4BHW A;  4CL9 A;  5FG5 A;  4QNS A;  3LQI A;  4C66 A;  5H1V A;  4YBM A;  2F6N A;  4HXK A;  4J3I A;  4Y03 A;  3P5O A;  5D3J A;  4NR4 A;  4UYG A;  2RS9 B;  4QST A;  4PCE A;  4CFK A;  4NR7 A;  4CUT A;  5E3D A;  5EVA A;  5LJ1 A;  4N4F A;  4A9I A;  4A9N A;  4QSR A;  3Q2F A;  4N4I A;  2DKW A;  4O7B A;  5EPR A;  1E6I A;  5AD2 A;  3FKM X;  4BW3 A;  3U5J A;  4IOR A;  4HBW A;  4O77 A;  4O76 A;  5FFV A;  5E0R A;  4Z6I A;  4A9H A;  3G0L A;  2OUO A;  5D3L A;  5EWH A;  4CFL A;  4MR3 A;  5I29 A;  3DWY A;  5F2P A;  5DFD A;  5J0D A;  4YC9 A;  4A9L A;  5LVQ A;  5LKZ A;  5CUC A;  5LJ0 A;  5CRM A;  3U5L A;  4YYI A;  4UIX A;  4C67 A;  5EIC A;  4YYM A;  3UVD A;  3O35 A;  5E9V A;  5FE2 A;  5E9M A;  5D7X A;  4QYL A;  4ZQL A;  5HQ6 A;  4TYL A;  4MR6 A;  2YDW A;  5DKH A;  3P1D A;  5C85 A;  2YQD A;  3JVL A;  4LC2 A;  4QY4 A;  3S91 A;  2RNY A;  4MEN A;  4UIU A;  5L96 A;  5LJ2 A;  5DW2 A;  4YH3 A;  4LZR A;  4TTE A;  4XY8 A;  4QR4 A;  5KHM A;  4HBX A;  4MEP A;  5EK9 A;  4HXS A;  5L8U A;  4HXN A;  5H85 A;  4A9J A;  5EA1 A;  5DKD A;  2DWW A;  4UYH A;  4Z1Q A;  4QR5 A;  4QSV A;  5TCM A;  4O72 A;  4NQM A;  2G4A A;  5E3G A;  5A5N A;  5HM0 A;  5ACY A;  4NYW A;  4HXP A;  5D3T A;  5CGP A;  5FE1 A;  5C89 A;  5F60 A;  4LYS A;  4NRA A;  5IGN A;  4A9K A;  5F3A A;  5DYA A;  4IR5 A;  4QUU A;  4Q0O A;  5FDZ A;  3P1E A;  5G4S A;  4QZS A;  2E3K A;  4N4G A;  3K2J A;  5ENG A;  5DY7 A;  4CUQ A;  4YYD A;  4LZS A;  5FE9 A;  4NRB A;  4NRC A;  4XUA A;  2OSS A;  4Z93 A;  5FE0 A;  2L85 A;  4QSW A;  4O7C A;  2R0S A;  3LJW A;  5LVR A;  5C87 A;  3MB3 A;  3UV4 A;  2YYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...