5FHPA

Semet regulator of nicotine degradation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHREGGQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQATQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
molecule keywords NicR
total genus 74
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fhpA00
5K7ZA 1ORKA 3Q0VA 4I6ZA 2OPTA 4ME9A 1JTYA 2QIBA 5FKLA 4W97A 4L62A 2O7TA 2O7OA 4MO7A 5CXGA 4ACIA 3NNRA 5D1RA 5F08A 4UDSA 3BNIA 3VW0A 2ZB9A 5CXIA 4HKUA 3RH2A 2QTQA 3LJLA 5D18A 3PASA 5F0HA 2XPUA 3VW1A 3CRJA 2X6OA 1UI6A 2FQ4A 2DG7A 3C07A 2NP3A 3LSPA 3IH4A 3S5RA 2HYJA 3CWRA 5FGLA 5H9TA 2HXIA 2HYTA 3PM1A 2YVEA 3FK7A 1ZK8A 5F0FA 3BTCA 3HTIA 2XGDA 1Z0XA 1RPWA 2F07A 3ON2A 3BTLA 2OERA 3GZIA 3HE0A 3IUVA 2EH3A 2XPWA 2GBYA 5HBUA 2JK3A 3HTJA 3BR3A 2OI8A 3C2BA 4V2GA 3VOXA 4MXMA 3DCFA 3O8HA 2XB5A 5J1UA 3SFIA 2ID6A 2JJ7A 1UI5A 2ZCXA 3TP3A 3BRUA 3COLA 2UXUA 3JSJA 5K7HA 3B6CA 5F0CA 3BR5A 4D5FA 3VP5A 2I10A 3HTHA 3F1BA 4GFLA 3DPJA 4D5CA 1ZKGA 2DG8A 2VKVA 3BR6A 3HGGA 1Z77A 3HIMA 3VUQA 2DTZA 1QVUA 1U9NA 2Q24A 3O60A 3V78A 3BR2A 2XPVA 5F27A 2GENA 2G7GA 5FMPA 3BHQA 5EYRA 4JKZA 2G3BA 3P9TA 4M3FA 3ON4A 2QWTA 2PBXA 4JYKA 2QCOA 2HQ5A 3BT9A 3QBMA 4B3AA 2XGCA 5FHPA 5DAJA 2ZOYA 3QPSA 2UXPA 5IOYA 4KWAA 2XRLA 2ZCNA 3WHCA 3CCYA 3HGYA 3QQAA 2D6YA 3PPBA 4PXIA 5F04A 2WUIA 5FKNA 2W53A 3B81A 1JT0A 2NP5A 1SGMA 2Y2ZA 3ZQHA 2VPRA 2QKOA 2IAIA 2UXHA 4ICHA 2V57A 4W1UA 5GPCA 2VKEA 3MNLA 2Y31A 3EGQA 3ZQLA 4I76A 2IU5A 4GFKA 4M3EA 3FIWA 5IOZA 1RKWA 3AQTA 5EZHA 5C4YA 3AQSA 2OF7A 5K7FA 3G1LA 2GUHA 4GCKA 2ZCMA 3QPLA 2UXOA 4AC6A 3NPIA 2FD5A 1RKTA 4AC0A 3IH3A 4JL3A 2RAEA 2G0EA 3G56A 3RD3A 2WGBA 1JT6A 4B1RA 1QPIA 2XGEA 2X9DA 3Q0WA 4XK4A 3BR0A 3LSJA 5D19A 1JUPA 3IH2A 2TCTA 3GEUA 2ZOZA 2NX4A 3EUPA 4AUXA 4M3GA 3BQYA 3HTAA 3FK6A 3BTJA 3G1MA 5HSZA 3ANGA 5HAWA 3NXCA 5EZGA 3G7RA 5GPAA 2REKA 4ABZA 2FBQA 4D7MA 3LHQA 4D7NA 4X1EA 5J1RA 3T6NA 3KKDA 2HXOA 2RASA 1T56A 3ZQGA 4M3DA 3LOCA 1A6IA 3ANPA 1JUSA 5IP6A 3VW2A 3CDLA 4NELA 3LSRA 3VVYA 2NS7A 2TRTA 4G12A 3VIBA 4GCLA 3F0CA 3CJDA 3KNWA 5F1JA 3O8GA 3VVXA 3Q3SA 3WHBA 4AF5A 5J1YA 5FKOA 4NN1A 3E7QA 4M3BA 5J3LA 3BJBA 1U9OA 5IPAA 1JTXA 3TP0A 3VPRA 3KZ9A 3BR1A 2GFNA 3SDGA 1VI0A 2Y30A 3ZQIA 3QKXA 5EFYA 3B6AA 3G1OA 5FKMA 2WV1A 1T33A 2G7LA 3NRGA 3FRQA 2FJ1A 3ZQFA 2HKUA 2RHAA 3KKCA 2PZ9A 2QOPA 4GCTA 5K58A 1QVTA 4YZEA 4MK6A 2FX0A 2IEKA 2G7SA 2XDNA 5GP9A 3V6GA 2UXIA 4DW6A 1BJZA 5CW8A 3LWJA 3NI7A 3Q0UA 3MVPA 5FKKA 3VOKA 2NS8A 3BTIA 3BCGA 5AQCA 2IBDA 2ID3A 3VVZA 3BQZA 3DEWA 4JNNA 4CGRA 2YVHA 1JUMA 4V2FA
chains in the Genus database with same CATH superfamily
5K7ZA 1ORKA 3Q0VA 4I6ZA 2OPTA 4ME9A 1JTYA 2QIBA 5FKLA 4W97A 4L62A 2O7TA 2O7OA 4MO7A 3VTIA 5CXGA 4ACIA 3NNRA 5D1RA 5F08A 4UDSA 3BNIA 3VW0A 2ZB9A 5CXIA 4HKUA 3RH2A 2R7TA 2QTQA 3LJLA 5D18A 2R7VA 3PASA 4IRVA 2XPUA 3VW1A 5F0HA 3CRJA 2X6OA 1UI6A 2FQ4A 2DG7A 3C07A 2NP3A 3LSPA 3IH4A 3S5RA 2HYJA 3CWRA 5FGLA 5H9TA 2HXIA 2HYTA 3PM1A 2FJI1 2YVEA 3FK7A 1ZK8A 5F0FA 2YVXA 3BTCA 3HTIA 2XGDA 1Z0XA 1RPWA 2F07A 3ON2A 3BTLA 2OERA 3GZIA 3HE0A 3IUVA 2EH3A 2XPWA 2GBYA 5HBUA 2JK3A 3HTJA 3BR3A 2OI8A 3C2BA 4V2GA 3VOXA 4MXMA 3DCFA 3O8HA 2A2FX 2PFVA 2XB5A 5J1UA 3SFIA 2ID6A 2JJ7A 1UI5A 2ZCXA 3TP3A 3BRUA 3COLA 2UXUA 3JSJA 5K7HA 3B6CA 5F0CA 3BR5A 4D5FA 3VP5A 2I10A 3HTHA 3F1BA 4GFLA 3DPJA 4D5CA 1ZKGA 2DG8A 2VKVA 3BR6A 3HGGA 1Z77A 3HIMA 3VUQA 2DTZA 1QVUA 1U9NA 2Q24A 3O60A 3V78A 3BR2A 2XPVA 5F27A 2GENA 2G7GA 5FMPA 3BHQA 5EYRA 4JKZA 2G3BA 3P9TA 4M3FA 3ON4A 2QWTA 2PBXA 4JYKA 3DU6A 2R7WA 2QCOA 2HQ5A 3BT9A 3QBMA 4B3AA 2XGCA 5FHPA 5DAJA 2ZOYA 3QPSA 4OD5A 2UXPA 5IOYA 4KWAA 2XRLA 3KYLA 2ZY9A 2ZCNA 3WHCA 3CCYA 3HGYA 3QQAA 2D6YA 3PPBA 4PXIA 5F04A 2WUIA 5FKNA 2W53A 3B81A 1JT0A 2NP5A 1SGMA 2Y2ZA 4DVYP 3ZQHA 2VPRA 5CQGA 2QKOA 2IAIA 2UXHA 4ICHA 3SWHA 2V57A 4W1UA 5GPCA 2VKEA 3MNLA 2Y31A 2R7XA 3EGQA 3ZQLA 4I76A 2IU5A 4GFKA 3K8PC 4M3EA 3FIWA 5IOZA 1RKWA 3AQTA 5EZHA 5C4YA 3AQSA 2OF7A 5K7FA 3G1LA 2GUHA 4GCKA 2ZCMA 3QPLA 2UXOA 4AC6A 3NPIA 2FD5A 1RKTA 4AC0A 3IH3A 4JL3A 2RAEA 4OD4A 4WIBA 2G0EA 3G56A 3RD3A 2WGBA 1JT6A 4B1RA 1QPIA 2XGEA 2X9DA 3Q0WA 4XK4A 3BR0A 3LSJA 5D19A 1JUPA 3IH2A 2TCTA 3GEUA 2ZOZA 2NX4A 3EUPA 4AUXA 4M3GA 3BQYA 3HTAA 3FK6A 3BTJA 2R7SA 3G1MA 5HSZA 3ANGA 5HAWA 3NXCA 5EZGA 3G7RA 5GPAA 2REKA 4ABZA 2FBQA 4D7MA 3LHQA 4D7NA 4X1EA 5J1RA 3T6NA 3KKDA 2HXOA 2RASA 1T56A 4U9NA 3ZQGA 4M3DA 3LOCA 1A6IA 3ANPA 1JUSA 5IP6A 3VW2A 3CDLA 4NELA 3LSRA 3VVYA 2NS7A 2TRTA 4G12A 3VIBA 4GCLA 3F0CA 3CJDA 3KNWA 5F1JA 3O8GA 3VVXA 3Q3SA 3WHBA 4AF5A 5J1YA 5FKOA 4NN1A 3E7QA 4M3BA 5J3LA 3BJBA 1U9OA 5IPAA 1JTXA 3TP0A 3VPRA 3KZ9A 2R7RA 3BR1A 2GFNA 3SDGA 1VI0A 2Y30A 3ZQIA 3QKXA 5EFYA 3B6AA 3G1OA 2R7UA 4U9LA 5FKMA 2WV1A 1T33A 2G7LA 3NRGA 3FRQA 2FJ1A 3ZQFA 2HKUA 2RHAA 3KKCA 2B1EA 2PZ9A 2QOPA 4GCTA 5K58A 1QVTA 4YZEA 4MK6A 2FX0A 2IEKA 2G7SA 2XDNA 5GP9A 2B3WA 3V6GA 2UXIA 4DW6A 1BJZA 2R7OA 5CW8A 3LWJA 3NI7A 3Q0UA 2R7QA 3DU5A 3MVPA 3FHNA 4C2MA 5FKKA 3VOKA 2NS8A 3BTIA 3BCGA 3NS4A 5AQCA 2IBDA 2ID3A 3VVZA 3BQZA 3DEWA 4JNNA 4CGRA 2YVHA 1JUMA 4V2FA
chains in the Genus database with same CATH topology
5K7ZA 1ORKA 3Q0VA 4I6ZA 2OPTA 4ME9A 1JTYA 2QIBA 5FKLA 4W97A 4L62A 2O7TA 2O7OA 4MO7A 5CXGA 4ACIA 3NNRA 5D1RA 5F08A 4UDSA 3BNIA 3VW0A 2ZB9A 5CXIA 4HKUA 3RH2A 2QTQA 3LJLA 5D18A 3PASA 5F0HA 2XPUA 3VW1A 3CRJA 2X6OA 1UI6A 2FQ4A 2DG7A 3C07A 2NP3A 3LSPA 3IH4A 3S5RA 2HYJA 3CWRA 5FGLA 5H9TA 2HXIA 2HYTA 3PM1A 2YVEA 3FK7A 1ZK8A 5F0FA 3BTCA 3HTIA 2XGDA 1Z0XA 1RPWA 2F07A 3ON2A 3BTLA 2OERA 3GZIA 3HE0A 3IUVA 2EH3A 2XPWA 2GBYA 5HBUA 2JK3A 3HTJA 3BR3A 2OI8A 3C2BA 4V2GA 3VOXA 4MXMA 3DCFA 3O8HA 2XB5A 5J1UA 3SFIA 2ID6A 2JJ7A 1UI5A 2ZCXA 3TP3A 3BRUA 3COLA 2UXUA 3JSJA 5K7HA 3B6CA 5F0CA 3BR5A 4D5FA 3VP5A 2I10A 3HTHA 3F1BA 4GFLA 3DPJA 4D5CA 1ZKGA 2DG8A 2VKVA 3BR6A 3HGGA 1Z77A 3HIMA 3VUQA 2DTZA 1QVUA 1U9NA 2Q24A 3O60A 3V78A 3BR2A 2XPVA 5F27A 2GENA 2G7GA 5FMPA 3BHQA 5EYRA 4JKZA 2G3BA 3P9TA 4M3FA 3ON4A 2QWTA 2PBXA 4JYKA 2QCOA 2HQ5A 3BT9A 3QBMA 4B3AA 2XGCA 5FHPA 5DAJA 2ZOYA 3QPSA 2UXPA 5IOYA 4KWAA 2XRLA 2ZCNA 3WHCA 3CCYA 3HGYA 3QQAA 2D6YA 3PPBA 4PXIA 5F04A 2WUIA 5FKNA 2W53A 3B81A 1JT0A 2NP5A 1SGMA 2Y2ZA 3ZQHA 2VPRA 2QKOA 2IAIA 2UXHA 4ICHA 2V57A 4W1UA 5GPCA 2VKEA 3MNLA 2Y31A 3EGQA 3ZQLA 4I76A 2IU5A 4GFKA 4M3EA 3FIWA 5IOZA 1RKWA 3AQTA 5EZHA 5C4YA 3AQSA 2OF7A 5K7FA 3G1LA 2GUHA 4GCKA 2ZCMA 3QPLA 2UXOA 4AC6A 3NPIA 2FD5A 1RKTA 4AC0A 3IH3A 4JL3A 2RAEA 2G0EA 3G56A 3RD3A 2WGBA 1JT6A 4B1RA 1QPIA 2XGEA 2X9DA 3Q0WA 4XK4A 3BR0A 3LSJA 5D19A 1JUPA 3IH2A 2TCTA 3GEUA 2ZOZA 2NX4A 3EUPA 4AUXA 4M3GA 3BQYA 3HTAA 3FK6A 3BTJA 3G1MA 5HSZA 3ANGA 5HAWA 3NXCA 5EZGA 3G7RA 5GPAA 2REKA 4ABZA 2FBQA 4D7MA 3LHQA 4D7NA 4X1EA 5J1RA 3T6NA 3KKDA 2HXOA 2RASA 1T56A 3ZQGA 4M3DA 3LOCA 1A6IA 3ANPA 1JUSA 5IP6A 3VW2A 3CDLA 4NELA 3LSRA 3VVYA 2NS7A 2TRTA 4G12A 3VIBA 4GCLA 3F0CA 3CJDA 3KNWA 5F1JA 3O8GA 3VVXA 3Q3SA 3WHBA 4AF5A 5J1YA 5FKOA 4NN1A 3E7QA 4M3BA 5J3LA 3BJBA 1U9OA 5IPAA 1JTXA 3TP0A 3VPRA 3KZ9A 3BR1A 2GFNA 3SDGA 1VI0A 2Y30A 3ZQIA 3QKXA 5EFYA 3B6AA 3G1OA 5FKMA 2WV1A 1T33A 2G7LA 3NRGA 3FRQA 2FJ1A 3ZQFA 2HKUA 2RHAA 3KKCA 2PZ9A 2QOPA 4GCTA 5K58A 1QVTA 4YZEA 4MK6A 2FX0A 2IEKA 2G7SA 2XDNA 5GP9A 3V6GA 2UXIA 4DW6A 1BJZA 5CW8A 3LWJA 3NI7A 3Q0UA 3MVPA 5FKKA 3VOKA 2NS8A 3BTIA 3BCGA 5AQCA 2IBDA 2ID3A 3VVZA 3BQZA 3DEWA 4JNNA 4CGRA 2YVHA 1JUMA 4V2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7Z A;  1ORK A;  3Q0V A;  4I6Z A;  2OPT A;  4ME9 A;  1JTY A;  2QIB A;  5FKL A;  4W97 A;  4L62 A;  2O7T A;  2O7O A;  4MO7 A;  5CXG A;  4ACI A;  3NNR A;  5D1R A;  5F08 A;  4UDS A;  3BNI A;  3VW0 A;  2ZB9 A;  5CXI A;  4HKU A;  3RH2 A;  2QTQ A;  3LJL A;  5D18 A;  3PAS A;  5F0H A;  2XPU A;  3VW1 A;  3CRJ A;  2X6O A;  1UI6 A;  2FQ4 A;  2DG7 A;  3C07 A;  2NP3 A;  3LSP A;  3IH4 A;  3S5R A;  2HYJ A;  3CWR A;  5FGL A;  5H9T A;  2HXI A;  2HYT A;  3PM1 A;  2YVE A;  3FK7 A;  1ZK8 A;  5F0F A;  3BTC A;  3HTI A;  2XGD A;  1Z0X A;  1RPW A;  2F07 A;  3ON2 A;  3BTL A;  2OER A;  3GZI A;  3HE0 A;  3IUV A;  2EH3 A;  2XPW A;  2GBY A;  5HBU A;  2JK3 A;  3HTJ A;  3BR3 A;  2OI8 A;  3C2B A;  4V2G A;  3VOX A;  4MXM A;  3DCF A;  3O8H A;  2XB5 A;  5J1U A;  3SFI A;  2ID6 A;  2JJ7 A;  1UI5 A;  2ZCX A;  3TP3 A;  3BRU A;  3COL A;  2UXU A;  3JSJ A;  5K7H A;  3B6C A;  5F0C A;  3BR5 A;  4D5F A;  3VP5 A;  2I10 A;  3HTH A;  3F1B A;  4GFL A;  3DPJ A;  4D5C A;  1ZKG A;  2DG8 A;  2VKV A;  3BR6 A;  3HGG A;  1Z77 A;  3HIM A;  3VUQ A;  2DTZ A;  1QVU A;  1U9N A;  2Q24 A;  3O60 A;  3V78 A;  3BR2 A;  2XPV A;  5F27 A;  2GEN A;  2G7G A;  5FMP A;  3BHQ A;  5EYR A;  4JKZ A;  2G3B A;  3P9T A;  4M3F A;  3ON4 A;  2QWT A;  2PBX A;  4JYK A;  2QCO A;  2HQ5 A;  3BT9 A;  3QBM A;  4B3A A;  2XGC A;  5FHP A;  5DAJ A;  2ZOY A;  3QPS A;  2UXP A;  5IOY A;  4KWA A;  2XRL A;  2ZCN A;  3WHC A;  3CCY A;  3HGY A;  3QQA A;  2D6Y A;  3PPB A;  4PXI A;  5F04 A;  2WUI A;  5FKN A;  2W53 A;  3B81 A;  1JT0 A;  2NP5 A;  1SGM A;  2Y2Z A;  3ZQH A;  2VPR A;  2QKO A;  2IAI A;  2UXH A;  4ICH A;  2V57 A;  4W1U A;  5GPC A;  2VKE A;  3MNL A;  2Y31 A;  3EGQ A;  3ZQL A;  4I76 A;  2IU5 A;  4GFK A;  4M3E A;  3FIW A;  5IOZ A;  1RKW A;  3AQT A;  5EZH A;  5C4Y A;  3AQS A;  2OF7 A;  5K7F A;  3G1L A;  2GUH A;  4GCK A;  2ZCM A;  3QPL A;  2UXO A;  4AC6 A;  3NPI A;  2FD5 A;  1RKT A;  4AC0 A;  3IH3 A;  4JL3 A;  2RAE A;  2G0E A;  3G56 A;  3RD3 A;  2WGB A;  1JT6 A;  4B1R A;  1QPI A;  2XGE A;  2X9D A;  3Q0W A;  4XK4 A;  3BR0 A;  3LSJ A;  5D19 A;  1JUP A;  3IH2 A;  2TCT A;  3GEU A;  2ZOZ A;  2NX4 A;  3EUP A;  4AUX A;  4M3G A;  3BQY A;  3HTA A;  3FK6 A;  3BTJ A;  3G1M A;  5HSZ A;  3ANG A;  5HAW A;  3NXC A;  5EZG A;  3G7R A;  5GPA A;  2REK A;  4ABZ A;  2FBQ A;  4D7M A;  3LHQ A;  4D7N A;  4X1E A;  5J1R A;  3T6N A;  3KKD A;  2HXO A;  2RAS A;  1T56 A;  3ZQG A;  4M3D A;  3LOC A;  1A6I A;  3ANP A;  1JUS A;  5IP6 A;  3VW2 A;  3CDL A;  4NEL A;  3LSR A;  3VVY A;  2NS7 A;  2TRT A;  4G12 A;  3VIB A;  4GCL A;  3F0C A;  3CJD A;  3KNW A;  5F1J A;  3O8G A;  3VVX A;  3Q3S A;  3WHB A;  4AF5 A;  5J1Y A;  5FKO A;  4NN1 A;  3E7Q A;  4M3B A;  5J3L A;  3BJB A;  1U9O A;  5IPA A;  1JTX A;  3TP0 A;  3VPR A;  3KZ9 A;  3BR1 A;  2GFN A;  3SDG A;  1VI0 A;  2Y30 A;  3ZQI A;  3QKX A;  5EFY A;  3B6A A;  3G1O A;  5FKM A;  2WV1 A;  1T33 A;  2G7L A;  3NRG A;  3FRQ A;  2FJ1 A;  3ZQF A;  2HKU A;  2RHA A;  3KKC A;  2PZ9 A;  2QOP A;  4GCT A;  5K58 A;  1QVT A;  4YZE A;  4MK6 A;  2FX0 A;  2IEK A;  2G7S A;  2XDN A;  5GP9 A;  3V6G A;  2UXI A;  4DW6 A;  1BJZ A;  5CW8 A;  3LWJ A;  3NI7 A;  3Q0U A;  3MVP A;  5FKK A;  3VOK A;  2NS8 A;  3BTI A;  3BCG A;  5AQC A;  2IBD A;  2ID3 A;  3VVZ A;  3BQZ A;  3DEW A;  4JNN A;  4CGR A;  2YVH A;  1JUM A;  4V2F A; 
#chains in the Genus database with same CATH topology
 5K7Z A;  1ORK A;  3Q0V A;  4I6Z A;  2OPT A;  4ME9 A;  1JTY A;  2QIB A;  5FKL A;  4W97 A;  4L62 A;  2O7T A;  2O7O A;  4MO7 A;  3VTI A;  5CXG A;  4ACI A;  3NNR A;  5D1R A;  5F08 A;  4UDS A;  3BNI A;  3VW0 A;  2ZB9 A;  5CXI A;  4HKU A;  3RH2 A;  2R7T A;  2QTQ A;  3LJL A;  5D18 A;  2R7V A;  3PAS A;  4IRV A;  2XPU A;  3VW1 A;  5F0H A;  3CRJ A;  2X6O A;  1UI6 A;  2FQ4 A;  2DG7 A;  3C07 A;  2NP3 A;  3LSP A;  3IH4 A;  3S5R A;  2HYJ A;  3CWR A;  5FGL A;  5H9T A;  2HXI A;  2HYT A;  3PM1 A;  2FJI 1;  2YVE A;  3FK7 A;  1ZK8 A;  5F0F A;  2YVX A;  3BTC A;  3HTI A;  2XGD A;  1Z0X A;  1RPW A;  2F07 A;  3ON2 A;  3BTL A;  2OER A;  3GZI A;  3HE0 A;  3IUV A;  2EH3 A;  2XPW A;  2GBY A;  5HBU A;  2JK3 A;  3HTJ A;  3BR3 A;  2OI8 A;  3C2B A;  4V2G A;  3VOX A;  4MXM A;  3DCF A;  3O8H A;  2A2F X;  2PFV A;  2XB5 A;  5J1U A;  3SFI A;  2ID6 A;  2JJ7 A;  1UI5 A;  2ZCX A;  3TP3 A;  3BRU A;  3COL A;  2UXU A;  3JSJ A;  5K7H A;  3B6C A;  5F0C A;  3BR5 A;  4D5F A;  3VP5 A;  2I10 A;  3HTH A;  3F1B A;  4GFL A;  3DPJ A;  4D5C A;  1ZKG A;  2DG8 A;  2VKV A;  3BR6 A;  3HGG A;  1Z77 A;  3HIM A;  3VUQ A;  2DTZ A;  1QVU A;  1U9N A;  2Q24 A;  3O60 A;  3V78 A;  3BR2 A;  2XPV A;  5F27 A;  2GEN A;  2G7G A;  5FMP A;  3BHQ A;  5EYR A;  4JKZ A;  2G3B A;  3P9T A;  4M3F A;  3ON4 A;  2QWT A;  2PBX A;  4JYK A;  3DU6 A;  2R7W A;  2QCO A;  2HQ5 A;  3BT9 A;  3QBM A;  4B3A A;  2XGC A;  5FHP A;  5DAJ A;  2ZOY A;  3QPS A;  4OD5 A;  2UXP A;  5IOY A;  4KWA A;  2XRL A;  3KYL A;  2ZY9 A;  2ZCN A;  3WHC A;  3CCY A;  3HGY A;  3QQA A;  2D6Y A;  3PPB A;  4PXI A;  5F04 A;  2WUI A;  5FKN A;  2W53 A;  3B81 A;  1JT0 A;  2NP5 A;  1SGM A;  2Y2Z A;  4DVY P;  3ZQH A;  2VPR A;  5CQG A;  2QKO A;  2IAI A;  2UXH A;  4ICH A;  3SWH A;  2V57 A;  4W1U A;  5GPC A;  2VKE A;  3MNL A;  2Y31 A;  2R7X A;  3EGQ A;  3ZQL A;  4I76 A;  2IU5 A;  4GFK A;  3K8P C;  4M3E A;  3FIW A;  5IOZ A;  1RKW A;  3AQT A;  5EZH A;  5C4Y A;  3AQS A;  2OF7 A;  5K7F A;  3G1L A;  2GUH A;  4GCK A;  2ZCM A;  3QPL A;  2UXO A;  4AC6 A;  3NPI A;  2FD5 A;  1RKT A;  4AC0 A;  3IH3 A;  4JL3 A;  2RAE A;  4OD4 A;  4WIB A;  2G0E A;  3G56 A;  3RD3 A;  2WGB A;  1JT6 A;  4B1R A;  1QPI A;  2XGE A;  2X9D A;  3Q0W A;  4XK4 A;  3BR0 A;  3LSJ A;  5D19 A;  1JUP A;  3IH2 A;  2TCT A;  3GEU A;  2ZOZ A;  2NX4 A;  3EUP A;  4AUX A;  4M3G A;  3BQY A;  3HTA A;  3FK6 A;  3BTJ A;  2R7S A;  3G1M A;  5HSZ A;  3ANG A;  5HAW A;  3NXC A;  5EZG A;  3G7R A;  5GPA A;  2REK A;  4ABZ A;  2FBQ A;  4D7M A;  3LHQ A;  4D7N A;  4X1E A;  5J1R A;  3T6N A;  3KKD A;  2HXO A;  2RAS A;  1T56 A;  4U9N A;  3ZQG A;  4M3D A;  3LOC A;  1A6I A;  3ANP A;  1JUS A;  5IP6 A;  3VW2 A;  3CDL A;  4NEL A;  3LSR A;  3VVY A;  2NS7 A;  2TRT A;  4G12 A;  3VIB A;  4GCL A;  3F0C A;  3CJD A;  3KNW A;  5F1J A;  3O8G A;  3VVX A;  3Q3S A;  3WHB A;  4AF5 A;  5J1Y A;  5FKO A;  4NN1 A;  3E7Q A;  4M3B A;  5J3L A;  3BJB A;  1U9O A;  5IPA A;  1JTX A;  3TP0 A;  3VPR A;  3KZ9 A;  2R7R A;  3BR1 A;  2GFN A;  3SDG A;  1VI0 A;  2Y30 A;  3ZQI A;  3QKX A;  5EFY A;  3B6A A;  3G1O A;  2R7U A;  4U9L A;  5FKM A;  2WV1 A;  1T33 A;  2G7L A;  3NRG A;  3FRQ A;  2FJ1 A;  3ZQF A;  2HKU A;  2RHA A;  3KKC A;  2B1E A;  2PZ9 A;  2QOP A;  4GCT A;  5K58 A;  1QVT A;  4YZE A;  4MK6 A;  2FX0 A;  2IEK A;  2G7S A;  2XDN A;  5GP9 A;  2B3W A;  3V6G A;  2UXI A;  4DW6 A;  1BJZ A;  2R7O A;  5CW8 A;  3LWJ A;  3NI7 A;  3Q0U A;  2R7Q A;  3DU5 A;  3MVP A;  3FHN A;  4C2M A;  5FKK A;  3VOK A;  2NS8 A;  3BTI A;  3BCG A;  3NS4 A;  5AQC A;  2IBD A;  2ID3 A;  3VVZ A;  3BQZ A;  3DEW A;  4JNN A;  4CGR A;  2YVH A;  1JUM A;  4V2F A; 
#chains in the Genus database with same CATH homology
 5K7Z A;  1ORK A;  3Q0V A;  4I6Z A;  2OPT A;  4ME9 A;  1JTY A;  2QIB A;  5FKL A;  4W97 A;  4L62 A;  2O7T A;  2O7O A;  4MO7 A;  5CXG A;  4ACI A;  3NNR A;  5D1R A;  5F08 A;  4UDS A;  3BNI A;  3VW0 A;  2ZB9 A;  5CXI A;  4HKU A;  3RH2 A;  2QTQ A;  3LJL A;  5D18 A;  3PAS A;  5F0H A;  2XPU A;  3VW1 A;  3CRJ A;  2X6O A;  1UI6 A;  2FQ4 A;  2DG7 A;  3C07 A;  2NP3 A;  3LSP A;  3IH4 A;  3S5R A;  2HYJ A;  3CWR A;  5FGL A;  5H9T A;  2HXI A;  2HYT A;  3PM1 A;  2YVE A;  3FK7 A;  1ZK8 A;  5F0F A;  3BTC A;  3HTI A;  2XGD A;  1Z0X A;  1RPW A;  2F07 A;  3ON2 A;  3BTL A;  2OER A;  3GZI A;  3HE0 A;  3IUV A;  2EH3 A;  2XPW A;  2GBY A;  5HBU A;  2JK3 A;  3HTJ A;  3BR3 A;  2OI8 A;  3C2B A;  4V2G A;  3VOX A;  4MXM A;  3DCF A;  3O8H A;  2XB5 A;  5J1U A;  3SFI A;  2ID6 A;  2JJ7 A;  1UI5 A;  2ZCX A;  3TP3 A;  3BRU A;  3COL A;  2UXU A;  3JSJ A;  5K7H A;  3B6C A;  5F0C A;  3BR5 A;  4D5F A;  3VP5 A;  2I10 A;  3HTH A;  3F1B A;  4GFL A;  3DPJ A;  4D5C A;  1ZKG A;  2DG8 A;  2VKV A;  3BR6 A;  3HGG A;  1Z77 A;  3HIM A;  3VUQ A;  2DTZ A;  1QVU A;  1U9N A;  2Q24 A;  3O60 A;  3V78 A;  3BR2 A;  2XPV A;  5F27 A;  2GEN A;  2G7G A;  5FMP A;  3BHQ A;  5EYR A;  4JKZ A;  2G3B A;  3P9T A;  4M3F A;  3ON4 A;  2QWT A;  2PBX A;  4JYK A;  2QCO A;  2HQ5 A;  3BT9 A;  3QBM A;  4B3A A;  2XGC A;  5FHP A;  5DAJ A;  2ZOY A;  3QPS A;  2UXP A;  5IOY A;  4KWA A;  2XRL A;  2ZCN A;  3WHC A;  3CCY A;  3HGY A;  3QQA A;  2D6Y A;  3PPB A;  4PXI A;  5F04 A;  2WUI A;  5FKN A;  2W53 A;  3B81 A;  1JT0 A;  2NP5 A;  1SGM A;  2Y2Z A;  3ZQH A;  2VPR A;  2QKO A;  2IAI A;  2UXH A;  4ICH A;  2V57 A;  4W1U A;  5GPC A;  2VKE A;  3MNL A;  2Y31 A;  3EGQ A;  3ZQL A;  4I76 A;  2IU5 A;  4GFK A;  4M3E A;  3FIW A;  5IOZ A;  1RKW A;  3AQT A;  5EZH A;  5C4Y A;  3AQS A;  2OF7 A;  5K7F A;  3G1L A;  2GUH A;  4GCK A;  2ZCM A;  3QPL A;  2UXO A;  4AC6 A;  3NPI A;  2FD5 A;  1RKT A;  4AC0 A;  3IH3 A;  4JL3 A;  2RAE A;  2G0E A;  3G56 A;  3RD3 A;  2WGB A;  1JT6 A;  4B1R A;  1QPI A;  2XGE A;  2X9D A;  3Q0W A;  4XK4 A;  3BR0 A;  3LSJ A;  5D19 A;  1JUP A;  3IH2 A;  2TCT A;  3GEU A;  2ZOZ A;  2NX4 A;  3EUP A;  4AUX A;  4M3G A;  3BQY A;  3HTA A;  3FK6 A;  3BTJ A;  3G1M A;  5HSZ A;  3ANG A;  5HAW A;  3NXC A;  5EZG A;  3G7R A;  5GPA A;  2REK A;  4ABZ A;  2FBQ A;  4D7M A;  3LHQ A;  4D7N A;  4X1E A;  5J1R A;  3T6N A;  3KKD A;  2HXO A;  2RAS A;  1T56 A;  3ZQG A;  4M3D A;  3LOC A;  1A6I A;  3ANP A;  1JUS A;  5IP6 A;  3VW2 A;  3CDL A;  4NEL A;  3LSR A;  3VVY A;  2NS7 A;  2TRT A;  4G12 A;  3VIB A;  4GCL A;  3F0C A;  3CJD A;  3KNW A;  5F1J A;  3O8G A;  3VVX A;  3Q3S A;  3WHB A;  4AF5 A;  5J1Y A;  5FKO A;  4NN1 A;  3E7Q A;  4M3B A;  5J3L A;  3BJB A;  1U9O A;  5IPA A;  1JTX A;  3TP0 A;  3VPR A;  3KZ9 A;  3BR1 A;  2GFN A;  3SDG A;  1VI0 A;  2Y30 A;  3ZQI A;  3QKX A;  5EFY A;  3B6A A;  3G1O A;  5FKM A;  2WV1 A;  1T33 A;  2G7L A;  3NRG A;  3FRQ A;  2FJ1 A;  3ZQF A;  2HKU A;  2RHA A;  3KKC A;  2PZ9 A;  2QOP A;  4GCT A;  5K58 A;  1QVT A;  4YZE A;  4MK6 A;  2FX0 A;  2IEK A;  2G7S A;  2XDN A;  5GP9 A;  3V6G A;  2UXI A;  4DW6 A;  1BJZ A;  5CW8 A;  3LWJ A;  3NI7 A;  3Q0U A;  3MVP A;  5FKK A;  3VOK A;  2NS8 A;  3BTI A;  3BCG A;  5AQC A;  2IBD A;  2ID3 A;  3VVZ A;  3BQZ A;  3DEW A;  4JNN A;  4CGR A;  2YVH A;  1JUM A;  4V2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...