5FHPA

Semet regulator of nicotine degradation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHREGGQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQATQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
molecule keywords NicR
total genus 74
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fhpA00
5IP6A 1T33A 4GCLA 2QKOA 2VPRA 2ZCMA 2IAIA 5J1UA 3TP3A 3IUVA 3KKDA 3BR1A 5FGLA 5F0HA 4ICHA 1U9NA 2YVEA 4NN1A 3MVPA 1JTYA 3Q0WA 1JT0A 3G1MA 2D6YA 4V2GA 5D18A 2G3BA 3NNRA 3IH3A 2XGDA 2RAEA 2G0EA 2JK3A 2JJ7A 3BR5A 3BCGA 1Z77A 3ZQIA 3TP0A 4V2FA 2W53A 3NI7A 3Q0UA 2NX4A 2XGCA 2NS8A 4JL3A 3BR2A 4ME9A 3T6NA 1JUPA 3NRGA 4HKUA 3LJLA 5J1YA 3VW1A 5GP9A 2WUIA 3BTCA 3V78A 3FRQA 3CWRA 3PPBA 5CW8A 3DCFA 2FX0A 4MO7A 3VVYA 2HYTA 3P9TA 2XPWA 2HYJA 2QWTA 3KNWA 3ON2A 2IEKA 4ABZA 3VIBA 2XPVA 3B6CA 3IH2A 2PZ9A 3G56A 5CXGA 3GZIA 1ORKA 5C4YA 3BQYA 3BR0A 2ZCXA 1Z0XA 2DG8A 4AC0A 4GCKA 3QKXA 2XDNA 3QQAA 2IBDA 3IH4A 4AC6A 2UXIA 2GENA 3BTIA 3VOKA 5K7ZA 2TCTA 1T56A 2G7SA 3QPSA 4D5FA 1ZKGA 4M3BA 4NELA 2O7OA 3HIMA 3KKCA 5F0FA 3V6GA 2NP5A 3BHQA 4L62A 1U9OA 2HKUA 4AUXA 2X9DA 4GCTA 3G1OA 3F1BA 5GPCA 4JKZA 4M3FA 2NS7A 5K58A 5CXIA 3HGGA 2QTQA 3C07A 3VVZA 5FKKA 3HTAA 2G7GA 2V57A 1UI6A 3NXCA 5HBUA 2GBYA 3BTJA 3BR6A 2FQ4A 3CRJA 5F0CA 1QVTA 2G7LA 2OI8A 3WHCA 3HGYA 3ANGA 5EFYA 4B1RA 1QPIA 5EYRA 1RPWA 3MNLA 2VKEA 5FKOA 5F08A 5FKLA 2ZOYA 3BR3A 4W97A 3QPLA 2UXOA 3BJBA 2REKA 3B81A 2VKVA 3ZQGA 2Y30A 4I6ZA 3FK6A 3BQZA 5F1JA 3G7RA 3CCYA 3VW0A 3O60A 2DTZA 5DAJA 3ON4A 3C2BA 5FKMA 2GUHA 1JUSA 4M3DA 3LHQA 5FHPA 4W1UA 4MK6A 2GFNA 4I76A 5J3LA 5F04A 3VOXA 4D5CA 3DEWA 3VPRA 1JTXA 4M3GA 3LOCA 3QBMA 3SDGA 3CJDA 2DG7A 5HAWA 1UI5A 2OF7A 5AQCA 2WV1A 3RD3A 4GFLA 3LSJA 2RASA 2TRTA 2QOPA 1ZK8A 3AQTA 2NP3A 3ZQFA 3KZ9A 3WHBA 3G1LA 3VUQA 2ID6A 2Y31A 1BJZA 5FKNA 3LWJA 4GFKA 4KWAA 3PASA 2ID3A 2PBXA 3NPIA 3LSRA 5EZHA 5H9TA 3Q3SA 2UXUA 5IOYA 2RHAA 2QIBA 3HTJA 5K7FA 3FK7A 3S5RA 4G12A 2I10A 5GPAA 4ACIA 4M3EA 3VW2A 1A6IA 3RH2A 2HXIA 3HTIA 2X6OA 3HE0A 1JT6A 4CGRA 3AQSA 3BRUA 3EUPA 3O8HA 2FD5A 4D7MA 2IU5A 2XGEA 4D7NA 3EGQA 3ZQLA 3FIWA 5HSZA 5J1RA 3GEUA 3COLA 3ZQHA 1SGMA 1QVUA 4JYKA 3BTLA 2HXOA 4PXIA 3E7QA 2ZOZA 2ZB9A 5FMPA 2XB5A 4MXMA 3VP5A 2ZCNA 2XRLA 3O8GA 1RKTA 3VVXA 2Q24A 2QCOA 2YVHA 3BT9A 3ANPA 3LSPA 3Q0VA 2EH3A 5EZGA 2OERA 1VI0A 4XK4A 2O7TA 4X1EA 5K7HA 4AF5A 4UDSA 2HQ5A 2F07A 3HTHA 3CDLA 2Y2ZA 3DPJA 4YZEA 5D19A 2FJ1A 5IOZA 3SFIA 3BNIA 3F0CA 2UXHA 2WGBA 4DW6A 4B3AA 1RKWA 4JNNA 5F27A 1JUMA 2FBQA 3PM1A 5D1RA 3B6AA 2UXPA 5IPAA 2XPUA 2OPTA 3JSJA
chains in the Genus database with same CATH superfamily
5IP6A 1T33A 4GCLA 2QKOA 2VPRA 2ZCMA 2IAIA 5J1UA 3TP3A 3IUVA 3KKDA 3BR1A 5FGLA 5F0HA 4ICHA 4OD4A 2B3WA 1U9NA 2R7OA 2YVEA 4NN1A 3MVPA 1JTYA 2PFVA 3Q0WA 1JT0A 3G1MA 2D6YA 4V2GA 5D18A 2G3BA 3NNRA 3KYLA 3IH3A 2XGDA 2R7XA 2RAEA 2G0EA 2JK3A 2JJ7A 3BR5A 3BCGA 1Z77A 3ZQIA 3TP0A 4V2FA 2W53A 3NI7A 3Q0UA 2NX4A 2XGCA 2NS8A 4JL3A 3BR2A 4ME9A 3T6NA 1JUPA 3NRGA 4HKUA 3LJLA 5J1YA 3VW1A 5GP9A 2WUIA 3BTCA 3NS4A 3V78A 2R7TA 3FRQA 2B1EA 3CWRA 3PPBA 5CW8A 3DCFA 2FX0A 4MO7A 3VVYA 2HYTA 3P9TA 2XPWA 2HYJA 2QWTA 3KNWA 3ON2A 2IEKA 4DVYP 4IRVA 4ABZA 3VIBA 2XPVA 3B6CA 3IH2A 2PZ9A 3G56A 2R7VA 5CXGA 3GZIA 1ORKA 5C4YA 3BQYA 3BR0A 2ZCXA 1Z0XA 2DG8A 4AC0A 4GCKA 3QKXA 2XDNA 3QQAA 2IBDA 3IH4A 4AC6A 2UXIA 2GENA 3BTIA 3VOKA 5K7ZA 3DU5A 2TCTA 1T56A 2G7SA 3QPSA 4D5FA 1ZKGA 4M3BA 5CQGA 4NELA 2O7OA 3HIMA 3KKCA 5F0FA 3V6GA 2ZY9A 2NP5A 3BHQA 4L62A 1U9OA 2HKUA 4AUXA 2X9DA 4GCTA 3G1OA 3F1BA 5GPCA 4JKZA 4M3FA 2NS7A 5K58A 5CXIA 3HGGA 2QTQA 3C07A 3VVZA 5FKKA 3HTAA 2G7GA 2V57A 1UI6A 3NXCA 5HBUA 4U9NA 2GBYA 3BTJA 2A2FX 3BR6A 2FQ4A 3CRJA 5F0CA 1QVTA 2G7LA 2OI8A 3WHCA 4OD5A 3HGYA 3ANGA 5EFYA 4B1RA 1QPIA 5EYRA 1RPWA 3MNLA 2VKEA 5FKOA 5F08A 5FKLA 3K8PC 2ZOYA 4U9LA 3BR3A 4W97A 3QPLA 2UXOA 3BJBA 2REKA 3B81A 2VKVA 3ZQGA 2Y30A 4I6ZA 3FK6A 3BQZA 5F1JA 3G7RA 3CCYA 3VW0A 3O60A 2DTZA 5DAJA 3ON4A 3C2BA 5FKMA 2GUHA 1JUSA 4M3DA 3LHQA 5FHPA 4W1UA 4MK6A 2GFNA 4I76A 5J3LA 5F04A 3VOXA 4D5CA 4C2MA 3DEWA 3VPRA 1JTXA 4M3GA 3LOCA 3QBMA 3SDGA 3CJDA 2DG7A 5HAWA 1UI5A 2OF7A 5AQCA 2WV1A 3RD3A 4GFLA 3LSJA 2RASA 3DU6A 2TRTA 2QOPA 3FHNA 1ZK8A 3AQTA 2R7UA 2NP3A 3ZQFA 3KZ9A 3WHBA 3G1LA 2R7WA 2YVXA 3VUQA 2ID6A 2Y31A 1BJZA 5FKNA 3LWJA 4GFKA 4KWAA 3PASA 4WIBA 2ID3A 2PBXA 3NPIA 3LSRA 5EZHA 5H9TA 3Q3SA 2UXUA 5IOYA 2RHAA 2QIBA 3HTJA 5K7FA 3FK7A 3S5RA 4G12A 2I10A 5GPAA 4ACIA 4M3EA 3VW2A 1A6IA 3RH2A 2HXIA 3VTIA 3HTIA 2X6OA 3HE0A 1JT6A 4CGRA 3AQSA 3BRUA 3EUPA 3O8HA 2FD5A 4D7MA 2IU5A 2XGEA 4D7NA 3EGQA 3ZQLA 3FIWA 2R7SA 5HSZA 5J1RA 2FJI1 3GEUA 3COLA 3ZQHA 1SGMA 1QVUA 4JYKA 3BTLA 2HXOA 4PXIA 3E7QA 2ZOZA 2ZB9A 5FMPA 2XB5A 4MXMA 3VP5A 2ZCNA 2XRLA 3O8GA 1RKTA 3VVXA 2Q24A 2QCOA 2YVHA 3BT9A 3ANPA 3LSPA 3Q0VA 2EH3A 5EZGA 2OERA 2R7RA 2R7QA 1VI0A 4XK4A 2O7TA 4X1EA 5K7HA 4AF5A 4UDSA 2HQ5A 2F07A 3HTHA 3SWHA 3CDLA 2Y2ZA 3DPJA 4YZEA 5D19A 2FJ1A 5IOZA 3SFIA 3BNIA 3F0CA 2UXHA 2WGBA 4DW6A 4B3AA 1RKWA 4JNNA 5F27A 1JUMA 2FBQA 3PM1A 5D1RA 3B6AA 2UXPA 5IPAA 2XPUA 2OPTA 3JSJA
chains in the Genus database with same CATH topology
5IP6A 1T33A 4GCLA 2QKOA 2VPRA 2ZCMA 2IAIA 5J1UA 3TP3A 3IUVA 3KKDA 3BR1A 5FGLA 5F0HA 4ICHA 1U9NA 2YVEA 4NN1A 3MVPA 1JTYA 3Q0WA 1JT0A 3G1MA 2D6YA 4V2GA 5D18A 2G3BA 3NNRA 3IH3A 2XGDA 2RAEA 2G0EA 2JK3A 2JJ7A 3BR5A 3BCGA 1Z77A 3ZQIA 3TP0A 4V2FA 2W53A 3NI7A 3Q0UA 2NX4A 2XGCA 2NS8A 4JL3A 3BR2A 4ME9A 3T6NA 1JUPA 3NRGA 4HKUA 3LJLA 5J1YA 3VW1A 5GP9A 2WUIA 3BTCA 3V78A 3FRQA 3CWRA 3PPBA 5CW8A 3DCFA 2FX0A 4MO7A 3VVYA 2HYTA 3P9TA 2XPWA 2HYJA 2QWTA 3KNWA 3ON2A 2IEKA 4ABZA 3VIBA 2XPVA 3B6CA 3IH2A 2PZ9A 3G56A 5CXGA 3GZIA 1ORKA 5C4YA 3BQYA 3BR0A 2ZCXA 1Z0XA 2DG8A 4AC0A 4GCKA 3QKXA 2XDNA 3QQAA 2IBDA 3IH4A 4AC6A 2UXIA 2GENA 3BTIA 3VOKA 5K7ZA 2TCTA 1T56A 2G7SA 3QPSA 4D5FA 1ZKGA 4M3BA 4NELA 2O7OA 3HIMA 3KKCA 5F0FA 3V6GA 2NP5A 3BHQA 4L62A 1U9OA 2HKUA 4AUXA 2X9DA 4GCTA 3G1OA 3F1BA 5GPCA 4JKZA 4M3FA 2NS7A 5K58A 5CXIA 3HGGA 2QTQA 3C07A 3VVZA 5FKKA 3HTAA 2G7GA 2V57A 1UI6A 3NXCA 5HBUA 2GBYA 3BTJA 3BR6A 2FQ4A 3CRJA 5F0CA 1QVTA 2G7LA 2OI8A 3WHCA 3HGYA 3ANGA 5EFYA 4B1RA 1QPIA 5EYRA 1RPWA 3MNLA 2VKEA 5FKOA 5F08A 5FKLA 2ZOYA 3BR3A 4W97A 3QPLA 2UXOA 3BJBA 2REKA 3B81A 2VKVA 3ZQGA 2Y30A 4I6ZA 3FK6A 3BQZA 5F1JA 3G7RA 3CCYA 3VW0A 3O60A 2DTZA 5DAJA 3ON4A 3C2BA 5FKMA 2GUHA 1JUSA 4M3DA 3LHQA 5FHPA 4W1UA 4MK6A 2GFNA 4I76A 5J3LA 5F04A 3VOXA 4D5CA 3DEWA 3VPRA 1JTXA 4M3GA 3LOCA 3QBMA 3SDGA 3CJDA 2DG7A 5HAWA 1UI5A 2OF7A 5AQCA 2WV1A 3RD3A 4GFLA 3LSJA 2RASA 2TRTA 2QOPA 1ZK8A 3AQTA 2NP3A 3ZQFA 3KZ9A 3WHBA 3G1LA 3VUQA 2ID6A 2Y31A 1BJZA 5FKNA 3LWJA 4GFKA 4KWAA 3PASA 2ID3A 2PBXA 3NPIA 3LSRA 5EZHA 5H9TA 3Q3SA 2UXUA 5IOYA 2RHAA 2QIBA 3HTJA 5K7FA 3FK7A 3S5RA 4G12A 2I10A 5GPAA 4ACIA 4M3EA 3VW2A 1A6IA 3RH2A 2HXIA 3HTIA 2X6OA 3HE0A 1JT6A 4CGRA 3AQSA 3BRUA 3EUPA 3O8HA 2FD5A 4D7MA 2IU5A 2XGEA 4D7NA 3EGQA 3ZQLA 3FIWA 5HSZA 5J1RA 3GEUA 3COLA 3ZQHA 1SGMA 1QVUA 4JYKA 3BTLA 2HXOA 4PXIA 3E7QA 2ZOZA 2ZB9A 5FMPA 2XB5A 4MXMA 3VP5A 2ZCNA 2XRLA 3O8GA 1RKTA 3VVXA 2Q24A 2QCOA 2YVHA 3BT9A 3ANPA 3LSPA 3Q0VA 2EH3A 5EZGA 2OERA 1VI0A 4XK4A 2O7TA 4X1EA 5K7HA 4AF5A 4UDSA 2HQ5A 2F07A 3HTHA 3CDLA 2Y2ZA 3DPJA 4YZEA 5D19A 2FJ1A 5IOZA 3SFIA 3BNIA 3F0CA 2UXHA 2WGBA 4DW6A 4B3AA 1RKWA 4JNNA 5F27A 1JUMA 2FBQA 3PM1A 5D1RA 3B6AA 2UXPA 5IPAA 2XPUA 2OPTA 3JSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP6 A;  1T33 A;  4GCL A;  2QKO A;  2VPR A;  2ZCM A;  2IAI A;  5J1U A;  3TP3 A;  3IUV A;  3KKD A;  3BR1 A;  5FGL A;  5F0H A;  4ICH A;  1U9N A;  2YVE A;  4NN1 A;  3MVP A;  1JTY A;  3Q0W A;  1JT0 A;  3G1M A;  2D6Y A;  4V2G A;  5D18 A;  2G3B A;  3NNR A;  3IH3 A;  2XGD A;  2RAE A;  2G0E A;  2JK3 A;  2JJ7 A;  3BR5 A;  3BCG A;  1Z77 A;  3ZQI A;  3TP0 A;  4V2F A;  2W53 A;  3NI7 A;  3Q0U A;  2NX4 A;  2XGC A;  2NS8 A;  4JL3 A;  3BR2 A;  4ME9 A;  3T6N A;  1JUP A;  3NRG A;  4HKU A;  3LJL A;  5J1Y A;  3VW1 A;  5GP9 A;  2WUI A;  3BTC A;  3V78 A;  3FRQ A;  3CWR A;  3PPB A;  5CW8 A;  3DCF A;  2FX0 A;  4MO7 A;  3VVY A;  2HYT A;  3P9T A;  2XPW A;  2HYJ A;  2QWT A;  3KNW A;  3ON2 A;  2IEK A;  4ABZ A;  3VIB A;  2XPV A;  3B6C A;  3IH2 A;  2PZ9 A;  3G56 A;  5CXG A;  3GZI A;  1ORK A;  5C4Y A;  3BQY A;  3BR0 A;  2ZCX A;  1Z0X A;  2DG8 A;  4AC0 A;  4GCK A;  3QKX A;  2XDN A;  3QQA A;  2IBD A;  3IH4 A;  4AC6 A;  2UXI A;  2GEN A;  3BTI A;  3VOK A;  5K7Z A;  2TCT A;  1T56 A;  2G7S A;  3QPS A;  4D5F A;  1ZKG A;  4M3B A;  4NEL A;  2O7O A;  3HIM A;  3KKC A;  5F0F A;  3V6G A;  2NP5 A;  3BHQ A;  4L62 A;  1U9O A;  2HKU A;  4AUX A;  2X9D A;  4GCT A;  3G1O A;  3F1B A;  5GPC A;  4JKZ A;  4M3F A;  2NS7 A;  5K58 A;  5CXI A;  3HGG A;  2QTQ A;  3C07 A;  3VVZ A;  5FKK A;  3HTA A;  2G7G A;  2V57 A;  1UI6 A;  3NXC A;  5HBU A;  2GBY A;  3BTJ A;  3BR6 A;  2FQ4 A;  3CRJ A;  5F0C A;  1QVT A;  2G7L A;  2OI8 A;  3WHC A;  3HGY A;  3ANG A;  5EFY A;  4B1R A;  1QPI A;  5EYR A;  1RPW A;  3MNL A;  2VKE A;  5FKO A;  5F08 A;  5FKL A;  2ZOY A;  3BR3 A;  4W97 A;  3QPL A;  2UXO A;  3BJB A;  2REK A;  3B81 A;  2VKV A;  3ZQG A;  2Y30 A;  4I6Z A;  3FK6 A;  3BQZ A;  5F1J A;  3G7R A;  3CCY A;  3VW0 A;  3O60 A;  2DTZ A;  5DAJ A;  3ON4 A;  3C2B A;  5FKM A;  2GUH A;  1JUS A;  4M3D A;  3LHQ A;  5FHP A;  4W1U A;  4MK6 A;  2GFN A;  4I76 A;  5J3L A;  5F04 A;  3VOX A;  4D5C A;  3DEW A;  3VPR A;  1JTX A;  4M3G A;  3LOC A;  3QBM A;  3SDG A;  3CJD A;  2DG7 A;  5HAW A;  1UI5 A;  2OF7 A;  5AQC A;  2WV1 A;  3RD3 A;  4GFL A;  3LSJ A;  2RAS A;  2TRT A;  2QOP A;  1ZK8 A;  3AQT A;  2NP3 A;  3ZQF A;  3KZ9 A;  3WHB A;  3G1L A;  3VUQ A;  2ID6 A;  2Y31 A;  1BJZ A;  5FKN A;  3LWJ A;  4GFK A;  4KWA A;  3PAS A;  2ID3 A;  2PBX A;  3NPI A;  3LSR A;  5EZH A;  5H9T A;  3Q3S A;  2UXU A;  5IOY A;  2RHA A;  2QIB A;  3HTJ A;  5K7F A;  3FK7 A;  3S5R A;  4G12 A;  2I10 A;  5GPA A;  4ACI A;  4M3E A;  3VW2 A;  1A6I A;  3RH2 A;  2HXI A;  3HTI A;  2X6O A;  3HE0 A;  1JT6 A;  4CGR A;  3AQS A;  3BRU A;  3EUP A;  3O8H A;  2FD5 A;  4D7M A;  2IU5 A;  2XGE A;  4D7N A;  3EGQ A;  3ZQL A;  3FIW A;  5HSZ A;  5J1R A;  3GEU A;  3COL A;  3ZQH A;  1SGM A;  1QVU A;  4JYK A;  3BTL A;  2HXO A;  4PXI A;  3E7Q A;  2ZOZ A;  2ZB9 A;  5FMP A;  2XB5 A;  4MXM A;  3VP5 A;  2ZCN A;  2XRL A;  3O8G A;  1RKT A;  3VVX A;  2Q24 A;  2QCO A;  2YVH A;  3BT9 A;  3ANP A;  3LSP A;  3Q0V A;  2EH3 A;  5EZG A;  2OER A;  1VI0 A;  4XK4 A;  2O7T A;  4X1E A;  5K7H A;  4AF5 A;  4UDS A;  2HQ5 A;  2F07 A;  3HTH A;  3CDL A;  2Y2Z A;  3DPJ A;  4YZE A;  5D19 A;  2FJ1 A;  5IOZ A;  3SFI A;  3BNI A;  3F0C A;  2UXH A;  2WGB A;  4DW6 A;  4B3A A;  1RKW A;  4JNN A;  5F27 A;  1JUM A;  2FBQ A;  3PM1 A;  5D1R A;  3B6A A;  2UXP A;  5IPA A;  2XPU A;  2OPT A;  3JSJ A; 
#chains in the Genus database with same CATH topology
 5IP6 A;  1T33 A;  4GCL A;  2QKO A;  2VPR A;  2ZCM A;  2IAI A;  5J1U A;  3TP3 A;  3IUV A;  3KKD A;  3BR1 A;  5FGL A;  5F0H A;  4ICH A;  4OD4 A;  2B3W A;  1U9N A;  2R7O A;  2YVE A;  4NN1 A;  3MVP A;  1JTY A;  2PFV A;  3Q0W A;  1JT0 A;  3G1M A;  2D6Y A;  4V2G A;  5D18 A;  2G3B A;  3NNR A;  3KYL A;  3IH3 A;  2XGD A;  2R7X A;  2RAE A;  2G0E A;  2JK3 A;  2JJ7 A;  3BR5 A;  3BCG A;  1Z77 A;  3ZQI A;  3TP0 A;  4V2F A;  2W53 A;  3NI7 A;  3Q0U A;  2NX4 A;  2XGC A;  2NS8 A;  4JL3 A;  3BR2 A;  4ME9 A;  3T6N A;  1JUP A;  3NRG A;  4HKU A;  3LJL A;  5J1Y A;  3VW1 A;  5GP9 A;  2WUI A;  3BTC A;  3NS4 A;  3V78 A;  2R7T A;  3FRQ A;  2B1E A;  3CWR A;  3PPB A;  5CW8 A;  3DCF A;  2FX0 A;  4MO7 A;  3VVY A;  2HYT A;  3P9T A;  2XPW A;  2HYJ A;  2QWT A;  3KNW A;  3ON2 A;  2IEK A;  4DVY P;  4IRV A;  4ABZ A;  3VIB A;  2XPV A;  3B6C A;  3IH2 A;  2PZ9 A;  3G56 A;  2R7V A;  5CXG A;  3GZI A;  1ORK A;  5C4Y A;  3BQY A;  3BR0 A;  2ZCX A;  1Z0X A;  2DG8 A;  4AC0 A;  4GCK A;  3QKX A;  2XDN A;  3QQA A;  2IBD A;  3IH4 A;  4AC6 A;  2UXI A;  2GEN A;  3BTI A;  3VOK A;  5K7Z A;  3DU5 A;  2TCT A;  1T56 A;  2G7S A;  3QPS A;  4D5F A;  1ZKG A;  4M3B A;  5CQG A;  4NEL A;  2O7O A;  3HIM A;  3KKC A;  5F0F A;  3V6G A;  2ZY9 A;  2NP5 A;  3BHQ A;  4L62 A;  1U9O A;  2HKU A;  4AUX A;  2X9D A;  4GCT A;  3G1O A;  3F1B A;  5GPC A;  4JKZ A;  4M3F A;  2NS7 A;  5K58 A;  5CXI A;  3HGG A;  2QTQ A;  3C07 A;  3VVZ A;  5FKK A;  3HTA A;  2G7G A;  2V57 A;  1UI6 A;  3NXC A;  5HBU A;  4U9N A;  2GBY A;  3BTJ A;  2A2F X;  3BR6 A;  2FQ4 A;  3CRJ A;  5F0C A;  1QVT A;  2G7L A;  2OI8 A;  3WHC A;  4OD5 A;  3HGY A;  3ANG A;  5EFY A;  4B1R A;  1QPI A;  5EYR A;  1RPW A;  3MNL A;  2VKE A;  5FKO A;  5F08 A;  5FKL A;  3K8P C;  2ZOY A;  4U9L A;  3BR3 A;  4W97 A;  3QPL A;  2UXO A;  3BJB A;  2REK A;  3B81 A;  2VKV A;  3ZQG A;  2Y30 A;  4I6Z A;  3FK6 A;  3BQZ A;  5F1J A;  3G7R A;  3CCY A;  3VW0 A;  3O60 A;  2DTZ A;  5DAJ A;  3ON4 A;  3C2B A;  5FKM A;  2GUH A;  1JUS A;  4M3D A;  3LHQ A;  5FHP A;  4W1U A;  4MK6 A;  2GFN A;  4I76 A;  5J3L A;  5F04 A;  3VOX A;  4D5C A;  4C2M A;  3DEW A;  3VPR A;  1JTX A;  4M3G A;  3LOC A;  3QBM A;  3SDG A;  3CJD A;  2DG7 A;  5HAW A;  1UI5 A;  2OF7 A;  5AQC A;  2WV1 A;  3RD3 A;  4GFL A;  3LSJ A;  2RAS A;  3DU6 A;  2TRT A;  2QOP A;  3FHN A;  1ZK8 A;  3AQT A;  2R7U A;  2NP3 A;  3ZQF A;  3KZ9 A;  3WHB A;  3G1L A;  2R7W A;  2YVX A;  3VUQ A;  2ID6 A;  2Y31 A;  1BJZ A;  5FKN A;  3LWJ A;  4GFK A;  4KWA A;  3PAS A;  4WIB A;  2ID3 A;  2PBX A;  3NPI A;  3LSR A;  5EZH A;  5H9T A;  3Q3S A;  2UXU A;  5IOY A;  2RHA A;  2QIB A;  3HTJ A;  5K7F A;  3FK7 A;  3S5R A;  4G12 A;  2I10 A;  5GPA A;  4ACI A;  4M3E A;  3VW2 A;  1A6I A;  3RH2 A;  2HXI A;  3VTI A;  3HTI A;  2X6O A;  3HE0 A;  1JT6 A;  4CGR A;  3AQS A;  3BRU A;  3EUP A;  3O8H A;  2FD5 A;  4D7M A;  2IU5 A;  2XGE A;  4D7N A;  3EGQ A;  3ZQL A;  3FIW A;  2R7S A;  5HSZ A;  5J1R A;  2FJI 1;  3GEU A;  3COL A;  3ZQH A;  1SGM A;  1QVU A;  4JYK A;  3BTL A;  2HXO A;  4PXI A;  3E7Q A;  2ZOZ A;  2ZB9 A;  5FMP A;  2XB5 A;  4MXM A;  3VP5 A;  2ZCN A;  2XRL A;  3O8G A;  1RKT A;  3VVX A;  2Q24 A;  2QCO A;  2YVH A;  3BT9 A;  3ANP A;  3LSP A;  3Q0V A;  2EH3 A;  5EZG A;  2OER A;  2R7R A;  2R7Q A;  1VI0 A;  4XK4 A;  2O7T A;  4X1E A;  5K7H A;  4AF5 A;  4UDS A;  2HQ5 A;  2F07 A;  3HTH A;  3SWH A;  3CDL A;  2Y2Z A;  3DPJ A;  4YZE A;  5D19 A;  2FJ1 A;  5IOZ A;  3SFI A;  3BNI A;  3F0C A;  2UXH A;  2WGB A;  4DW6 A;  4B3A A;  1RKW A;  4JNN A;  5F27 A;  1JUM A;  2FBQ A;  3PM1 A;  5D1R A;  3B6A A;  2UXP A;  5IPA A;  2XPU A;  2OPT A;  3JSJ A; 
#chains in the Genus database with same CATH homology
 5IP6 A;  1T33 A;  4GCL A;  2QKO A;  2VPR A;  2ZCM A;  2IAI A;  5J1U A;  3TP3 A;  3IUV A;  3KKD A;  3BR1 A;  5FGL A;  5F0H A;  4ICH A;  1U9N A;  2YVE A;  4NN1 A;  3MVP A;  1JTY A;  3Q0W A;  1JT0 A;  3G1M A;  2D6Y A;  4V2G A;  5D18 A;  2G3B A;  3NNR A;  3IH3 A;  2XGD A;  2RAE A;  2G0E A;  2JK3 A;  2JJ7 A;  3BR5 A;  3BCG A;  1Z77 A;  3ZQI A;  3TP0 A;  4V2F A;  2W53 A;  3NI7 A;  3Q0U A;  2NX4 A;  2XGC A;  2NS8 A;  4JL3 A;  3BR2 A;  4ME9 A;  3T6N A;  1JUP A;  3NRG A;  4HKU A;  3LJL A;  5J1Y A;  3VW1 A;  5GP9 A;  2WUI A;  3BTC A;  3V78 A;  3FRQ A;  3CWR A;  3PPB A;  5CW8 A;  3DCF A;  2FX0 A;  4MO7 A;  3VVY A;  2HYT A;  3P9T A;  2XPW A;  2HYJ A;  2QWT A;  3KNW A;  3ON2 A;  2IEK A;  4ABZ A;  3VIB A;  2XPV A;  3B6C A;  3IH2 A;  2PZ9 A;  3G56 A;  5CXG A;  3GZI A;  1ORK A;  5C4Y A;  3BQY A;  3BR0 A;  2ZCX A;  1Z0X A;  2DG8 A;  4AC0 A;  4GCK A;  3QKX A;  2XDN A;  3QQA A;  2IBD A;  3IH4 A;  4AC6 A;  2UXI A;  2GEN A;  3BTI A;  3VOK A;  5K7Z A;  2TCT A;  1T56 A;  2G7S A;  3QPS A;  4D5F A;  1ZKG A;  4M3B A;  4NEL A;  2O7O A;  3HIM A;  3KKC A;  5F0F A;  3V6G A;  2NP5 A;  3BHQ A;  4L62 A;  1U9O A;  2HKU A;  4AUX A;  2X9D A;  4GCT A;  3G1O A;  3F1B A;  5GPC A;  4JKZ A;  4M3F A;  2NS7 A;  5K58 A;  5CXI A;  3HGG A;  2QTQ A;  3C07 A;  3VVZ A;  5FKK A;  3HTA A;  2G7G A;  2V57 A;  1UI6 A;  3NXC A;  5HBU A;  2GBY A;  3BTJ A;  3BR6 A;  2FQ4 A;  3CRJ A;  5F0C A;  1QVT A;  2G7L A;  2OI8 A;  3WHC A;  3HGY A;  3ANG A;  5EFY A;  4B1R A;  1QPI A;  5EYR A;  1RPW A;  3MNL A;  2VKE A;  5FKO A;  5F08 A;  5FKL A;  2ZOY A;  3BR3 A;  4W97 A;  3QPL A;  2UXO A;  3BJB A;  2REK A;  3B81 A;  2VKV A;  3ZQG A;  2Y30 A;  4I6Z A;  3FK6 A;  3BQZ A;  5F1J A;  3G7R A;  3CCY A;  3VW0 A;  3O60 A;  2DTZ A;  5DAJ A;  3ON4 A;  3C2B A;  5FKM A;  2GUH A;  1JUS A;  4M3D A;  3LHQ A;  5FHP A;  4W1U A;  4MK6 A;  2GFN A;  4I76 A;  5J3L A;  5F04 A;  3VOX A;  4D5C A;  3DEW A;  3VPR A;  1JTX A;  4M3G A;  3LOC A;  3QBM A;  3SDG A;  3CJD A;  2DG7 A;  5HAW A;  1UI5 A;  2OF7 A;  5AQC A;  2WV1 A;  3RD3 A;  4GFL A;  3LSJ A;  2RAS A;  2TRT A;  2QOP A;  1ZK8 A;  3AQT A;  2NP3 A;  3ZQF A;  3KZ9 A;  3WHB A;  3G1L A;  3VUQ A;  2ID6 A;  2Y31 A;  1BJZ A;  5FKN A;  3LWJ A;  4GFK A;  4KWA A;  3PAS A;  2ID3 A;  2PBX A;  3NPI A;  3LSR A;  5EZH A;  5H9T A;  3Q3S A;  2UXU A;  5IOY A;  2RHA A;  2QIB A;  3HTJ A;  5K7F A;  3FK7 A;  3S5R A;  4G12 A;  2I10 A;  5GPA A;  4ACI A;  4M3E A;  3VW2 A;  1A6I A;  3RH2 A;  2HXI A;  3HTI A;  2X6O A;  3HE0 A;  1JT6 A;  4CGR A;  3AQS A;  3BRU A;  3EUP A;  3O8H A;  2FD5 A;  4D7M A;  2IU5 A;  2XGE A;  4D7N A;  3EGQ A;  3ZQL A;  3FIW A;  5HSZ A;  5J1R A;  3GEU A;  3COL A;  3ZQH A;  1SGM A;  1QVU A;  4JYK A;  3BTL A;  2HXO A;  4PXI A;  3E7Q A;  2ZOZ A;  2ZB9 A;  5FMP A;  2XB5 A;  4MXM A;  3VP5 A;  2ZCN A;  2XRL A;  3O8G A;  1RKT A;  3VVX A;  2Q24 A;  2QCO A;  2YVH A;  3BT9 A;  3ANP A;  3LSP A;  3Q0V A;  2EH3 A;  5EZG A;  2OER A;  1VI0 A;  4XK4 A;  2O7T A;  4X1E A;  5K7H A;  4AF5 A;  4UDS A;  2HQ5 A;  2F07 A;  3HTH A;  3CDL A;  2Y2Z A;  3DPJ A;  4YZE A;  5D19 A;  2FJ1 A;  5IOZ A;  3SFI A;  3BNI A;  3F0C A;  2UXH A;  2WGB A;  4DW6 A;  4B3A A;  1RKW A;  4JNN A;  5F27 A;  1JUM A;  2FBQ A;  3PM1 A;  5D1R A;  3B6A A;  2UXP A;  5IPA A;  2XPU A;  2OPT A;  3JSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...