5FHPA

Semet regulator of nicotine degradation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
b'MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHREGGQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQATQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NicR
molecule tags Apoptosis
source organism Pseudomonas putida (strain s16)
publication title Co-crystal Structure of NicR2_Hsp
rcsb
total genus 74
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fhpA00
3GZIA 5K7FA 2DG7A 3PPBA 2UXOA 2YVHA 2ZCXA 2DTZA 2Y2ZA 2I10A 4NN1A 3QBMA 5EFYA 2NX4A 2VKEA 3VOXA 2XGEA 3BQZA 5F27A 4AC0A 3DEWA 2G0EA 3COLA 5IOZA 5AQCA 5K7ZA 3HTIA 2NS7A 3QQAA 5GPAA 3CDLA 2GBYA 3WHBA 3BR5A 2WV1A 3KZ9A 4W97A 3AQTA 2FQ4A 3ZQFA 4KWAA 3T6NA 3BHQA 5D18A 5HSZA 3HGYA 2Q24A 4GFKA 3B6CA 3BQYA 5GP9A 1JTXA 4D5FA 3VOKA 3LOCA 3LSJA 2Y31A 2Y30A 3BR1A 3CWRA 3BR6A 3NPIA 4NELA 2V57A 2ZB9A 3Q0WA 2XPVA 4ME9A 3BR0A 2XGCA 4GCTA 3B81A 2HQ5A 2W53A 2TCTA 3FK6A 2FJ1A 3ZQGA 2RHAA 3KKCA 4PXIA 5FKLA 3BRUA 2NP5A 5DAJA 3ANPA 3E7QA 2JK3A 5J1YA 5FHPA 3F0CA 3BTIA 3FK7A 3C07A 2XPUA 3BR2A 2NS8A 3VIBA 2F07A 2XRLA 3O60A 3F1BA 2OPTA 3LSPA 2QIBA 3VVXA 3SDGA 3G1LA 1U9OA 3MNLA 2IU5A 2ID3A 2XDNA 3HTAA 5FKNA 4I6ZA 2HXIA 3ZQLA 2VPRA 4D7NA 1T33A 3BNIA 5F0CA 5CXIA 2DG8A 2ID6A 2QTQA 3KNWA 4ICHA 4UDSA 3VVYA 4XK4A 3V78A 5F1JA 5K7HA 4M3GA 5FMPA 3ON2A 4ACIA 4X1EA 4YZEA 4MO7A 5F0HA 3NXCA 3G7RA 5FKKA 3VVZA 2ZCNA 3VW0A 3O8HA 4W1UA 3FRQA 2X9DA 4M3BA 5D1RA 3DPJA 5F08A 3FIWA 2UXPA 5IOYA 5FKOA 4L62A 3Q0VA 3EGQA 2QOPA 2HXOA 2ZOZA 2GFNA 2OF7A 5CXGA 4AC6A 1SGMA 2UXUA 3ANGA 2GUHA 4HKUA 3TP3A 2GENA 3P9TA 3NRGA 2UXHA 4GFLA 2FBQA 3RH2A 3WHCA 1QVUA 2TRTA 4B3AA 3C2BA 5D19A 2FX0A 3S5RA 5C4YA 4JKZA 4JYKA 3HE0A 3GEUA 3LSRA 4M3EA 3QPLA 5J1UA 3QKXA 4GCKA 2QCOA 3HTJA 3BCGA 1RKWA 3O8GA 5F0FA 3G1OA 5K58A 5FGLA 1Z77A 2RAEA 3IH3A 3V6GA 1JT6A 3Q3SA 5HBUA 2G7GA 3LWJA 5H9TA 2QWTA 3ON4A 1JT0A 2REKA 4V2GA 3BTJA 3G56A 5J3LA 4AF5A 1QVTA 1U9NA 1RKTA 2XB5A 3G1MA 3VUQA 2FD5A 4DW6A 2PBXA 3HGGA 3IUVA 2X6OA 2D6YA 3HIMA 3B6AA 3IH4A 2G3BA 2OERA 1QPIA 2O7OA 2HYTA 2G7SA 3VW2A 4ABZA 2IAIA 4GCLA 3EUPA 3BT9A 4D7MA 2G7LA 3BR3A 2ZCMA 1ZK8A 4M3DA 2NP3A 5EZHA 5IP6A 3BTLA 4M3FA 3PM1A 1VI0A 2UXIA 2IBDA 2HKUA 1JUPA 1RPWA 2WUIA 3CRJA 3PASA 3SFIA 4G12A 2VKVA 3NI7A 4I76A 3CJDA 4MK6A 3MVPA 1T56A 3IH2A 4B1RA 3TP0A 2IEKA 4AUXA 3NNRA 3VP5A 4JL3A 3KKDA 2ZOYA 2RASA 3JSJA 3RD3A 2PZ9A 4V2FA 5F04A 3DCFA 2XGDA 1UI6A 1UI5A 3Q0UA 1JUMA 1A6IA 3AQSA 3VW1A 2YVEA 3LHQA 5HAWA 3HTHA 1JTYA 2EH3A 5GPCA 3LJLA 1JUSA 2WGBA 4CGRA 3ZQIA 2HYJA 4D5CA 5EYRA 3VPRA 1ORKA 2OI8A 3QPSA 4JNNA 3BJBA 2JJ7A 2QKOA 1ZKGA 3BTCA 2O7TA 5FKMA 4MXMA 2XPWA 5J1RA 3CCYA 5EZGA 3ZQHA 5CW8A 5IPAA 1BJZA 1Z0XA
chains in the Genus database with same CATH superfamily
2R7XA 3GZIA 5K7FA 2DG7A 3PPBA 2UXOA 2YVHA 2ZCXA 2DTZA 2Y2ZA 2I10A 4NN1A 3DU5A 3QBMA 5EFYA 2NX4A 2VKEA 3VOXA 2XGEA 3BQZA 5F27A 4AC0A 3DEWA 2G0EA 3COLA 5IOZA 5AQCA 2R7OA 5K7ZA 3HTIA 2NS7A 3QQAA 5GPAA 3CDLA 2GBYA 3WHBA 3BR5A 2WV1A 3KZ9A 4W97A 3AQTA 2FQ4A 3ZQFA 4KWAA 3T6NA 3BHQA 2A2FX 5D18A 5HSZA 3HGYA 2Q24A 4GFKA 3B6CA 3BQYA 5GP9A 1JTXA 4D5FA 3VOKA 3LOCA 3LSJA 2B1EA 2Y31A 2Y30A 3BR1A 3CWRA 3BR6A 3NPIA 4NELA 2V57A 2R7UA 2ZB9A 3Q0WA 2XPVA 4ME9A 4C2MA 3BR0A 2XGCA 4GCTA 2R7VA 3B81A 5CQGA 2HQ5A 2W53A 2TCTA 3FK6A 2FJ1A 3ZQGA 2RHAA 3KKCA 3FHNA 4PXIA 5FKLA 3SWHA 3BRUA 3NS4A 2NP5A 5DAJA 3ANPA 3E7QA 2JK3A 5J1YA 5FHPA 3F0CA 3BTIA 3FK7A 3C07A 2XPUA 3DU6A 3BR2A 2NS8A 3VIBA 2F07A 2XRLA 3O60A 3F1BA 2OPTA 3LSPA 2QIBA 3VVXA 3SDGA 3G1LA 1U9OA 3MNLA 2PFVA 2IU5A 2ID3A 2XDNA 3HTAA 5FKNA 4I6ZA 2HXIA 3ZQLA 2VPRA 4D7NA 1T33A 3BNIA 5F0CA 5CXIA 2DG8A 2ID6A 2B3WA 2QTQA 3KNWA 4ICHA 4UDSA 3VVYA 4XK4A 4OD4A 3V78A 5F1JA 5K7HA 4M3GA 5FMPA 3ON2A 4ACIA 4X1EA 4OD5A 4YZEA 4MO7A 5F0HA 3NXCA 3G7RA 5FKKA 3VVZA 2ZCNA 3VW0A 3O8HA 4W1UA 3FRQA 2X9DA 4M3BA 5D1RA 3DPJA 5F08A 3FIWA 2UXPA 5IOYA 5FKOA 4L62A 3Q0VA 3EGQA 2QOPA 2HXOA 2ZOZA 2GFNA 2OF7A 5CXGA 4AC6A 1SGMA 2UXUA 3ANGA 2ZY9A 2GUHA 4HKUA 3TP3A 2GENA 3P9TA 3NRGA 2UXHA 4GFLA 2FBQA 3RH2A 3WHCA 1QVUA 2TRTA 4B3AA 3C2BA 5D19A 2FX0A 3S5RA 5C4YA 4JKZA 4JYKA 3HE0A 3GEUA 3LSRA 4M3EA 3QPLA 5J1UA 2R7QA 3QKXA 4GCKA 2QCOA 3HTJA 3BCGA 3VTIA 1RKWA 3O8GA 5F0FA 3G1OA 5K58A 3K8PC 5FGLA 1Z77A 2RAEA 3IH3A 3V6GA 1JT6A 3Q3SA 5HBUA 2G7GA 3LWJA 2R7SA 2R7WA 5H9TA 2QWTA 4WIBA 3ON4A 1JT0A 2REKA 4V2GA 3BTJA 3G56A 5J3LA 4AF5A 1QVTA 1U9NA 1RKTA 2XB5A 3G1MA 3VUQA 2FD5A 4DW6A 2PBXA 3HGGA 3IUVA 2X6OA 2D6YA 3HIMA 3B6AA 3IH4A 2G3BA 2OERA 1QPIA 2O7OA 2HYTA 2FJI1 2G7SA 3VW2A 4ABZA 2IAIA 4GCLA 3EUPA 3BT9A 4D7MA 2G7LA 3BR3A 2ZCMA 1ZK8A 4M3DA 2NP3A 5EZHA 4IRVA 5IP6A 3BTLA 4M3FA 3PM1A 1VI0A 2UXIA 2IBDA 2HKUA 1JUPA 1RPWA 2R7TA 2WUIA 3CRJA 3PASA 3SFIA 4G12A 2VKVA 3NI7A 4I76A 3CJDA 4MK6A 3MVPA 1T56A 3IH2A 4B1RA 3TP0A 2IEKA 4AUXA 3NNRA 3VP5A 4U9NA 4JL3A 3KKDA 2ZOYA 2RASA 3JSJA 3RD3A 2PZ9A 4V2FA 5F04A 3DCFA 2XGDA 1UI6A 1UI5A 3Q0UA 1JUMA 4U9LA 1A6IA 3AQSA 3VW1A 2YVEA 3LHQA 5HAWA 3HTHA 1JTYA 2EH3A 4DVYP 5GPCA 3LJLA 1JUSA 2WGBA 4CGRA 3ZQIA 2HYJA 4D5CA 5EYRA 3VPRA 1ORKA 2OI8A 3QPSA 4JNNA 3BJBA 2JJ7A 2QKOA 1ZKGA 3BTCA 3KYLA 2O7TA 2YVXA 5FKMA 4MXMA 2XPWA 5J1RA 3CCYA 5EZGA 3ZQHA 5CW8A 5IPAA 1BJZA 2R7RA 1Z0XA
chains in the Genus database with same CATH topology
3GZIA 5K7FA 2DG7A 3PPBA 2UXOA 2YVHA 2ZCXA 2DTZA 2Y2ZA 2I10A 4NN1A 3QBMA 5EFYA 2NX4A 2VKEA 3VOXA 2XGEA 3BQZA 5F27A 4AC0A 3DEWA 2G0EA 3COLA 5IOZA 5AQCA 5K7ZA 3HTIA 2NS7A 3QQAA 5GPAA 3CDLA 2GBYA 3WHBA 3BR5A 2WV1A 3KZ9A 4W97A 3AQTA 2FQ4A 3ZQFA 4KWAA 3T6NA 3BHQA 5D18A 5HSZA 3HGYA 2Q24A 4GFKA 3B6CA 3BQYA 5GP9A 1JTXA 4D5FA 3VOKA 3LOCA 3LSJA 2Y31A 2Y30A 3BR1A 3CWRA 3BR6A 3NPIA 4NELA 2V57A 2ZB9A 3Q0WA 2XPVA 4ME9A 3BR0A 2XGCA 4GCTA 3B81A 2HQ5A 2W53A 2TCTA 3FK6A 2FJ1A 3ZQGA 2RHAA 3KKCA 4PXIA 5FKLA 3BRUA 2NP5A 5DAJA 3ANPA 3E7QA 2JK3A 5J1YA 5FHPA 3F0CA 3BTIA 3FK7A 3C07A 2XPUA 3BR2A 2NS8A 3VIBA 2F07A 2XRLA 3O60A 3F1BA 2OPTA 3LSPA 2QIBA 3VVXA 3SDGA 3G1LA 1U9OA 3MNLA 2IU5A 2ID3A 2XDNA 3HTAA 5FKNA 4I6ZA 2HXIA 3ZQLA 2VPRA 4D7NA 1T33A 3BNIA 5F0CA 5CXIA 2DG8A 2ID6A 2QTQA 3KNWA 4ICHA 4UDSA 3VVYA 4XK4A 3V78A 5F1JA 5K7HA 4M3GA 5FMPA 3ON2A 4ACIA 4X1EA 4YZEA 4MO7A 5F0HA 3NXCA 3G7RA 5FKKA 3VVZA 2ZCNA 3VW0A 3O8HA 4W1UA 3FRQA 2X9DA 4M3BA 5D1RA 3DPJA 5F08A 3FIWA 2UXPA 5IOYA 5FKOA 4L62A 3Q0VA 3EGQA 2QOPA 2HXOA 2ZOZA 2GFNA 2OF7A 5CXGA 4AC6A 1SGMA 2UXUA 3ANGA 2GUHA 4HKUA 3TP3A 2GENA 3P9TA 3NRGA 2UXHA 4GFLA 2FBQA 3RH2A 3WHCA 1QVUA 2TRTA 4B3AA 3C2BA 5D19A 2FX0A 3S5RA 5C4YA 4JKZA 4JYKA 3HE0A 3GEUA 3LSRA 4M3EA 3QPLA 5J1UA 3QKXA 4GCKA 2QCOA 3HTJA 3BCGA 1RKWA 3O8GA 5F0FA 3G1OA 5K58A 5FGLA 1Z77A 2RAEA 3IH3A 3V6GA 1JT6A 3Q3SA 5HBUA 2G7GA 3LWJA 5H9TA 2QWTA 3ON4A 1JT0A 2REKA 4V2GA 3BTJA 3G56A 5J3LA 4AF5A 1QVTA 1U9NA 1RKTA 2XB5A 3G1MA 3VUQA 2FD5A 4DW6A 2PBXA 3HGGA 3IUVA 2X6OA 2D6YA 3HIMA 3B6AA 3IH4A 2G3BA 2OERA 1QPIA 2O7OA 2HYTA 2G7SA 3VW2A 4ABZA 2IAIA 4GCLA 3EUPA 3BT9A 4D7MA 2G7LA 3BR3A 2ZCMA 1ZK8A 4M3DA 2NP3A 5EZHA 5IP6A 3BTLA 4M3FA 3PM1A 1VI0A 2UXIA 2IBDA 2HKUA 1JUPA 1RPWA 2WUIA 3CRJA 3PASA 3SFIA 4G12A 2VKVA 3NI7A 4I76A 3CJDA 4MK6A 3MVPA 1T56A 3IH2A 4B1RA 3TP0A 2IEKA 4AUXA 3NNRA 3VP5A 4JL3A 3KKDA 2ZOYA 2RASA 3JSJA 3RD3A 2PZ9A 4V2FA 5F04A 3DCFA 2XGDA 1UI6A 1UI5A 3Q0UA 1JUMA 1A6IA 3AQSA 3VW1A 2YVEA 3LHQA 5HAWA 3HTHA 1JTYA 2EH3A 5GPCA 3LJLA 1JUSA 2WGBA 4CGRA 3ZQIA 2HYJA 4D5CA 5EYRA 3VPRA 1ORKA 2OI8A 3QPSA 4JNNA 3BJBA 2JJ7A 2QKOA 1ZKGA 3BTCA 2O7TA 5FKMA 4MXMA 2XPWA 5J1RA 3CCYA 5EZGA 3ZQHA 5CW8A 5IPAA 1BJZA 1Z0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZI A;  5K7F A;  2DG7 A;  3PPB A;  2UXO A;  2YVH A;  2ZCX A;  2DTZ A;  2Y2Z A;  2I10 A;  4NN1 A;  3QBM A;  5EFY A;  2NX4 A;  2VKE A;  3VOX A;  2XGE A;  3BQZ A;  5F27 A;  4AC0 A;  3DEW A;  2G0E A;  3COL A;  5IOZ A;  5AQC A;  5K7Z A;  3HTI A;  2NS7 A;  3QQA A;  5GPA A;  3CDL A;  2GBY A;  3WHB A;  3BR5 A;  2WV1 A;  3KZ9 A;  4W97 A;  3AQT A;  2FQ4 A;  3ZQF A;  4KWA A;  3T6N A;  3BHQ A;  5D18 A;  5HSZ A;  3HGY A;  2Q24 A;  4GFK A;  3B6C A;  3BQY A;  5GP9 A;  1JTX A;  4D5F A;  3VOK A;  3LOC A;  3LSJ A;  2Y31 A;  2Y30 A;  3BR1 A;  3CWR A;  3BR6 A;  3NPI A;  4NEL A;  2V57 A;  2ZB9 A;  3Q0W A;  2XPV A;  4ME9 A;  3BR0 A;  2XGC A;  4GCT A;  3B81 A;  2HQ5 A;  2W53 A;  2TCT A;  3FK6 A;  2FJ1 A;  3ZQG A;  2RHA A;  3KKC A;  4PXI A;  5FKL A;  3BRU A;  2NP5 A;  5DAJ A;  3ANP A;  3E7Q A;  2JK3 A;  5J1Y A;  5FHP A;  3F0C A;  3BTI A;  3FK7 A;  3C07 A;  2XPU A;  3BR2 A;  2NS8 A;  3VIB A;  2F07 A;  2XRL A;  3O60 A;  3F1B A;  2OPT A;  3LSP A;  2QIB A;  3VVX A;  3SDG A;  3G1L A;  1U9O A;  3MNL A;  2IU5 A;  2ID3 A;  2XDN A;  3HTA A;  5FKN A;  4I6Z A;  2HXI A;  3ZQL A;  2VPR A;  4D7N A;  1T33 A;  3BNI A;  5F0C A;  5CXI A;  2DG8 A;  2ID6 A;  2QTQ A;  3KNW A;  4ICH A;  4UDS A;  3VVY A;  4XK4 A;  3V78 A;  5F1J A;  5K7H A;  4M3G A;  5FMP A;  3ON2 A;  4ACI A;  4X1E A;  4YZE A;  4MO7 A;  5F0H A;  3NXC A;  3G7R A;  5FKK A;  3VVZ A;  2ZCN A;  3VW0 A;  3O8H A;  4W1U A;  3FRQ A;  2X9D A;  4M3B A;  5D1R A;  3DPJ A;  5F08 A;  3FIW A;  2UXP A;  5IOY A;  5FKO A;  4L62 A;  3Q0V A;  3EGQ A;  2QOP A;  2HXO A;  2ZOZ A;  2GFN A;  2OF7 A;  5CXG A;  4AC6 A;  1SGM A;  2UXU A;  3ANG A;  2GUH A;  4HKU A;  3TP3 A;  2GEN A;  3P9T A;  3NRG A;  2UXH A;  4GFL A;  2FBQ A;  3RH2 A;  3WHC A;  1QVU A;  2TRT A;  4B3A A;  3C2B A;  5D19 A;  2FX0 A;  3S5R A;  5C4Y A;  4JKZ A;  4JYK A;  3HE0 A;  3GEU A;  3LSR A;  4M3E A;  3QPL A;  5J1U A;  3QKX A;  4GCK A;  2QCO A;  3HTJ A;  3BCG A;  1RKW A;  3O8G A;  5F0F A;  3G1O A;  5K58 A;  5FGL A;  1Z77 A;  2RAE A;  3IH3 A;  3V6G A;  1JT6 A;  3Q3S A;  5HBU A;  2G7G A;  3LWJ A;  5H9T A;  2QWT A;  3ON4 A;  1JT0 A;  2REK A;  4V2G A;  3BTJ A;  3G56 A;  5J3L A;  4AF5 A;  1QVT A;  1U9N A;  1RKT A;  2XB5 A;  3G1M A;  3VUQ A;  2FD5 A;  4DW6 A;  2PBX A;  3HGG A;  3IUV A;  2X6O A;  2D6Y A;  3HIM A;  3B6A A;  3IH4 A;  2G3B A;  2OER A;  1QPI A;  2O7O A;  2HYT A;  2G7S A;  3VW2 A;  4ABZ A;  2IAI A;  4GCL A;  3EUP A;  3BT9 A;  4D7M A;  2G7L A;  3BR3 A;  2ZCM A;  1ZK8 A;  4M3D A;  2NP3 A;  5EZH A;  5IP6 A;  3BTL A;  4M3F A;  3PM1 A;  1VI0 A;  2UXI A;  2IBD A;  2HKU A;  1JUP A;  1RPW A;  2WUI A;  3CRJ A;  3PAS A;  3SFI A;  4G12 A;  2VKV A;  3NI7 A;  4I76 A;  3CJD A;  4MK6 A;  3MVP A;  1T56 A;  3IH2 A;  4B1R A;  3TP0 A;  2IEK A;  4AUX A;  3NNR A;  3VP5 A;  4JL3 A;  3KKD A;  2ZOY A;  2RAS A;  3JSJ A;  3RD3 A;  2PZ9 A;  4V2F A;  5F04 A;  3DCF A;  2XGD A;  1UI6 A;  1UI5 A;  3Q0U A;  1JUM A;  1A6I A;  3AQS A;  3VW1 A;  2YVE A;  3LHQ A;  5HAW A;  3HTH A;  1JTY A;  2EH3 A;  5GPC A;  3LJL A;  1JUS A;  2WGB A;  4CGR A;  3ZQI A;  2HYJ A;  4D5C A;  5EYR A;  3VPR A;  1ORK A;  2OI8 A;  3QPS A;  4JNN A;  3BJB A;  2JJ7 A;  2QKO A;  1ZKG A;  3BTC A;  2O7T A;  5FKM A;  4MXM A;  2XPW A;  5J1R A;  3CCY A;  5EZG A;  3ZQH A;  5CW8 A;  5IPA A;  1BJZ A;  1Z0X A; 
#chains in the Genus database with same CATH topology
 2R7X A;  3GZI A;  5K7F A;  2DG7 A;  3PPB A;  2UXO A;  2YVH A;  2ZCX A;  2DTZ A;  2Y2Z A;  2I10 A;  4NN1 A;  3DU5 A;  3QBM A;  5EFY A;  2NX4 A;  2VKE A;  3VOX A;  2XGE A;  3BQZ A;  5F27 A;  4AC0 A;  3DEW A;  2G0E A;  3COL A;  5IOZ A;  5AQC A;  2R7O A;  5K7Z A;  3HTI A;  2NS7 A;  3QQA A;  5GPA A;  3CDL A;  2GBY A;  3WHB A;  3BR5 A;  2WV1 A;  3KZ9 A;  4W97 A;  3AQT A;  2FQ4 A;  3ZQF A;  4KWA A;  3T6N A;  3BHQ A;  2A2F X;  5D18 A;  5HSZ A;  3HGY A;  2Q24 A;  4GFK A;  3B6C A;  3BQY A;  5GP9 A;  1JTX A;  4D5F A;  3VOK A;  3LOC A;  3LSJ A;  2B1E A;  2Y31 A;  2Y30 A;  3BR1 A;  3CWR A;  3BR6 A;  3NPI A;  4NEL A;  2V57 A;  2R7U A;  2ZB9 A;  3Q0W A;  2XPV A;  4ME9 A;  4C2M A;  3BR0 A;  2XGC A;  4GCT A;  2R7V A;  3B81 A;  5CQG A;  2HQ5 A;  2W53 A;  2TCT A;  3FK6 A;  2FJ1 A;  3ZQG A;  2RHA A;  3KKC A;  3FHN A;  4PXI A;  5FKL A;  3SWH A;  3BRU A;  3NS4 A;  2NP5 A;  5DAJ A;  3ANP A;  3E7Q A;  2JK3 A;  5J1Y A;  5FHP A;  3F0C A;  3BTI A;  3FK7 A;  3C07 A;  2XPU A;  3DU6 A;  3BR2 A;  2NS8 A;  3VIB A;  2F07 A;  2XRL A;  3O60 A;  3F1B A;  2OPT A;  3LSP A;  2QIB A;  3VVX A;  3SDG A;  3G1L A;  1U9O A;  3MNL A;  2PFV A;  2IU5 A;  2ID3 A;  2XDN A;  3HTA A;  5FKN A;  4I6Z A;  2HXI A;  3ZQL A;  2VPR A;  4D7N A;  1T33 A;  3BNI A;  5F0C A;  5CXI A;  2DG8 A;  2ID6 A;  2B3W A;  2QTQ A;  3KNW A;  4ICH A;  4UDS A;  3VVY A;  4XK4 A;  4OD4 A;  3V78 A;  5F1J A;  5K7H A;  4M3G A;  5FMP A;  3ON2 A;  4ACI A;  4X1E A;  4OD5 A;  4YZE A;  4MO7 A;  5F0H A;  3NXC A;  3G7R A;  5FKK A;  3VVZ A;  2ZCN A;  3VW0 A;  3O8H A;  4W1U A;  3FRQ A;  2X9D A;  4M3B A;  5D1R A;  3DPJ A;  5F08 A;  3FIW A;  2UXP A;  5IOY A;  5FKO A;  4L62 A;  3Q0V A;  3EGQ A;  2QOP A;  2HXO A;  2ZOZ A;  2GFN A;  2OF7 A;  5CXG A;  4AC6 A;  1SGM A;  2UXU A;  3ANG A;  2ZY9 A;  2GUH A;  4HKU A;  3TP3 A;  2GEN A;  3P9T A;  3NRG A;  2UXH A;  4GFL A;  2FBQ A;  3RH2 A;  3WHC A;  1QVU A;  2TRT A;  4B3A A;  3C2B A;  5D19 A;  2FX0 A;  3S5R A;  5C4Y A;  4JKZ A;  4JYK A;  3HE0 A;  3GEU A;  3LSR A;  4M3E A;  3QPL A;  5J1U A;  2R7Q A;  3QKX A;  4GCK A;  2QCO A;  3HTJ A;  3BCG A;  3VTI A;  1RKW A;  3O8G A;  5F0F A;  3G1O A;  5K58 A;  3K8P C;  5FGL A;  1Z77 A;  2RAE A;  3IH3 A;  3V6G A;  1JT6 A;  3Q3S A;  5HBU A;  2G7G A;  3LWJ A;  2R7S A;  2R7W A;  5H9T A;  2QWT A;  4WIB A;  3ON4 A;  1JT0 A;  2REK A;  4V2G A;  3BTJ A;  3G56 A;  5J3L A;  4AF5 A;  1QVT A;  1U9N A;  1RKT A;  2XB5 A;  3G1M A;  3VUQ A;  2FD5 A;  4DW6 A;  2PBX A;  3HGG A;  3IUV A;  2X6O A;  2D6Y A;  3HIM A;  3B6A A;  3IH4 A;  2G3B A;  2OER A;  1QPI A;  2O7O A;  2HYT A;  2FJI 1;  2G7S A;  3VW2 A;  4ABZ A;  2IAI A;  4GCL A;  3EUP A;  3BT9 A;  4D7M A;  2G7L A;  3BR3 A;  2ZCM A;  1ZK8 A;  4M3D A;  2NP3 A;  5EZH A;  4IRV A;  5IP6 A;  3BTL A;  4M3F A;  3PM1 A;  1VI0 A;  2UXI A;  2IBD A;  2HKU A;  1JUP A;  1RPW A;  2R7T A;  2WUI A;  3CRJ A;  3PAS A;  3SFI A;  4G12 A;  2VKV A;  3NI7 A;  4I76 A;  3CJD A;  4MK6 A;  3MVP A;  1T56 A;  3IH2 A;  4B1R A;  3TP0 A;  2IEK A;  4AUX A;  3NNR A;  3VP5 A;  4U9N A;  4JL3 A;  3KKD A;  2ZOY A;  2RAS A;  3JSJ A;  3RD3 A;  2PZ9 A;  4V2F A;  5F04 A;  3DCF A;  2XGD A;  1UI6 A;  1UI5 A;  3Q0U A;  1JUM A;  4U9L A;  1A6I A;  3AQS A;  3VW1 A;  2YVE A;  3LHQ A;  5HAW A;  3HTH A;  1JTY A;  2EH3 A;  4DVY P;  5GPC A;  3LJL A;  1JUS A;  2WGB A;  4CGR A;  3ZQI A;  2HYJ A;  4D5C A;  5EYR A;  3VPR A;  1ORK A;  2OI8 A;  3QPS A;  4JNN A;  3BJB A;  2JJ7 A;  2QKO A;  1ZKG A;  3BTC A;  3KYL A;  2O7T A;  2YVX A;  5FKM A;  4MXM A;  2XPW A;  5J1R A;  3CCY A;  5EZG A;  3ZQH A;  5CW8 A;  5IPA A;  1BJZ A;  2R7R A;  1Z0X A; 
#chains in the Genus database with same CATH homology
 3GZI A;  5K7F A;  2DG7 A;  3PPB A;  2UXO A;  2YVH A;  2ZCX A;  2DTZ A;  2Y2Z A;  2I10 A;  4NN1 A;  3QBM A;  5EFY A;  2NX4 A;  2VKE A;  3VOX A;  2XGE A;  3BQZ A;  5F27 A;  4AC0 A;  3DEW A;  2G0E A;  3COL A;  5IOZ A;  5AQC A;  5K7Z A;  3HTI A;  2NS7 A;  3QQA A;  5GPA A;  3CDL A;  2GBY A;  3WHB A;  3BR5 A;  2WV1 A;  3KZ9 A;  4W97 A;  3AQT A;  2FQ4 A;  3ZQF A;  4KWA A;  3T6N A;  3BHQ A;  5D18 A;  5HSZ A;  3HGY A;  2Q24 A;  4GFK A;  3B6C A;  3BQY A;  5GP9 A;  1JTX A;  4D5F A;  3VOK A;  3LOC A;  3LSJ A;  2Y31 A;  2Y30 A;  3BR1 A;  3CWR A;  3BR6 A;  3NPI A;  4NEL A;  2V57 A;  2ZB9 A;  3Q0W A;  2XPV A;  4ME9 A;  3BR0 A;  2XGC A;  4GCT A;  3B81 A;  2HQ5 A;  2W53 A;  2TCT A;  3FK6 A;  2FJ1 A;  3ZQG A;  2RHA A;  3KKC A;  4PXI A;  5FKL A;  3BRU A;  2NP5 A;  5DAJ A;  3ANP A;  3E7Q A;  2JK3 A;  5J1Y A;  5FHP A;  3F0C A;  3BTI A;  3FK7 A;  3C07 A;  2XPU A;  3BR2 A;  2NS8 A;  3VIB A;  2F07 A;  2XRL A;  3O60 A;  3F1B A;  2OPT A;  3LSP A;  2QIB A;  3VVX A;  3SDG A;  3G1L A;  1U9O A;  3MNL A;  2IU5 A;  2ID3 A;  2XDN A;  3HTA A;  5FKN A;  4I6Z A;  2HXI A;  3ZQL A;  2VPR A;  4D7N A;  1T33 A;  3BNI A;  5F0C A;  5CXI A;  2DG8 A;  2ID6 A;  2QTQ A;  3KNW A;  4ICH A;  4UDS A;  3VVY A;  4XK4 A;  3V78 A;  5F1J A;  5K7H A;  4M3G A;  5FMP A;  3ON2 A;  4ACI A;  4X1E A;  4YZE A;  4MO7 A;  5F0H A;  3NXC A;  3G7R A;  5FKK A;  3VVZ A;  2ZCN A;  3VW0 A;  3O8H A;  4W1U A;  3FRQ A;  2X9D A;  4M3B A;  5D1R A;  3DPJ A;  5F08 A;  3FIW A;  2UXP A;  5IOY A;  5FKO A;  4L62 A;  3Q0V A;  3EGQ A;  2QOP A;  2HXO A;  2ZOZ A;  2GFN A;  2OF7 A;  5CXG A;  4AC6 A;  1SGM A;  2UXU A;  3ANG A;  2GUH A;  4HKU A;  3TP3 A;  2GEN A;  3P9T A;  3NRG A;  2UXH A;  4GFL A;  2FBQ A;  3RH2 A;  3WHC A;  1QVU A;  2TRT A;  4B3A A;  3C2B A;  5D19 A;  2FX0 A;  3S5R A;  5C4Y A;  4JKZ A;  4JYK A;  3HE0 A;  3GEU A;  3LSR A;  4M3E A;  3QPL A;  5J1U A;  3QKX A;  4GCK A;  2QCO A;  3HTJ A;  3BCG A;  1RKW A;  3O8G A;  5F0F A;  3G1O A;  5K58 A;  5FGL A;  1Z77 A;  2RAE A;  3IH3 A;  3V6G A;  1JT6 A;  3Q3S A;  5HBU A;  2G7G A;  3LWJ A;  5H9T A;  2QWT A;  3ON4 A;  1JT0 A;  2REK A;  4V2G A;  3BTJ A;  3G56 A;  5J3L A;  4AF5 A;  1QVT A;  1U9N A;  1RKT A;  2XB5 A;  3G1M A;  3VUQ A;  2FD5 A;  4DW6 A;  2PBX A;  3HGG A;  3IUV A;  2X6O A;  2D6Y A;  3HIM A;  3B6A A;  3IH4 A;  2G3B A;  2OER A;  1QPI A;  2O7O A;  2HYT A;  2G7S A;  3VW2 A;  4ABZ A;  2IAI A;  4GCL A;  3EUP A;  3BT9 A;  4D7M A;  2G7L A;  3BR3 A;  2ZCM A;  1ZK8 A;  4M3D A;  2NP3 A;  5EZH A;  5IP6 A;  3BTL A;  4M3F A;  3PM1 A;  1VI0 A;  2UXI A;  2IBD A;  2HKU A;  1JUP A;  1RPW A;  2WUI A;  3CRJ A;  3PAS A;  3SFI A;  4G12 A;  2VKV A;  3NI7 A;  4I76 A;  3CJD A;  4MK6 A;  3MVP A;  1T56 A;  3IH2 A;  4B1R A;  3TP0 A;  2IEK A;  4AUX A;  3NNR A;  3VP5 A;  4JL3 A;  3KKD A;  2ZOY A;  2RAS A;  3JSJ A;  3RD3 A;  2PZ9 A;  4V2F A;  5F04 A;  3DCF A;  2XGD A;  1UI6 A;  1UI5 A;  3Q0U A;  1JUM A;  1A6I A;  3AQS A;  3VW1 A;  2YVE A;  3LHQ A;  5HAW A;  3HTH A;  1JTY A;  2EH3 A;  5GPC A;  3LJL A;  1JUS A;  2WGB A;  4CGR A;  3ZQI A;  2HYJ A;  4D5C A;  5EYR A;  3VPR A;  1ORK A;  2OI8 A;  3QPS A;  4JNN A;  3BJB A;  2JJ7 A;  2QKO A;  1ZKG A;  3BTC A;  2O7T A;  5FKM A;  4MXM A;  2XPW A;  5J1R A;  3CCY A;  5EZG A;  3ZQH A;  5CW8 A;  5IPA A;  1BJZ A;  1Z0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...