5FHPA

Semet regulator of nicotine degradation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
MELILNEAEKVFAMHGFLGATLKQIAQNSNVTQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFEHREGGQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWGAVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQATQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NicR
publication title Co-crystal Structure of NicR2_Hsp
rcsb
source organism Pseudomonas putida (strain s16)
molecule tags Apoptosis
total genus 74
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fhpA00
2G7SA 3BQYA 5FMPA 3QQAA 2UXUA 4V2FA 1SGMA 3S5RA 3Q3SA 4AC0A 2DG8A 4D5FA 3LSRA 3DEWA 2QKOA 3BR6A 3ZQFA 2D6YA 2NP3A 1Z77A 3RH2A 2OPTA 4UDSA 3BJBA 3GZIA 5IPAA 2HQ5A 4X1EA 1RPWA 3HTJA 3F0CA 5IOZA 3ON4A 3PASA 2QIBA 3HTAA 2FJ1A 3KNWA 3VVZA 5F1JA 2REKA 2IAIA 3G1OA 2XDNA 2GBYA 5J1UA 3ANPA 5FHPA 3NPIA 3B6AA 1VI0A 5D19A 5EZGA 5C4YA 2ZB9A 3BCGA 2ZOZA 3KKCA 3T6NA 4W97A 3QPLA 4I76A 2X9DA 3HTIA 3WHCA 2XPUA 1RKTA 1JUPA 5EYRA 4GCKA 2XGEA 2QTQA 2XRLA 3JSJA 1UI6A 3PM1A 3BHQA 5FKMA 3BRUA 3VOXA 3BR2A 3BTIA 1BJZA 5K58A 1JTYA 2UXIA 2NS8A 2YVHA 3BR5A 2GFNA 5GP9A 2ZCXA 1UI5A 2IBDA 3WHBA 3VW2A 4NN1A 1JT6A 1QVUA 3SDGA 2PZ9A 2HXOA 3IH2A 3Q0UA 5IOYA 4PXIA 5DAJA 3C2BA 3O8GA 1A6IA 4B1RA 5GPCA 2XPWA 2XPVA 2HXIA 1RKWA 3VUQA 3LSPA 3LHQA 3FK6A 3DPJA 5HAWA 5F08A 2O7TA 3VIBA 5J1YA 2OF7A 2Y2ZA 1Z0XA 3FRQA 3QKXA 3KZ9A 3VVYA 2FX0A 1ZKGA 2G0EA 4G12A 2DG7A 2WV1A 2WUIA 3HGYA 3BTJA 3BT9A 3MVPA 3LWJA 3DCFA 3Q0VA 5F04A 2XGDA 4CGRA 3ZQHA 4W1UA 3EUPA 5F0HA 2V57A 2NP5A 1U9OA 3CRJA 2VKEA 2XB5A 3O60A 5CXIA 1T33A 3HTHA 3V6GA 2I10A 3HIMA 2UXOA 3V78A 3LSJA 3P9TA 3LJLA 2QCOA 4GFKA 4GCTA 4AC6A 2UXPA 5IP6A 2O7OA 3LOCA 2FQ4A 4M3BA 3MNLA 3BTLA 4M3EA 1JTXA 2FD5A 3CJDA 3VPRA 2W53A 4ABZA 2GENA 3CCYA 2RASA 2DTZA 2OI8A 2QWTA 3TP3A 3FK7A 5H9TA 4GCLA 2TRTA 5GPAA 2ZCMA 4JKZA 2JJ7A 2PBXA 5F0CA 3BNIA 3RD3A 3VW0A 4D7NA 4MK6A 5AQCA 1ZK8A 3O8HA 3GEUA 5FKOA 5J1RA 3ANGA 2EH3A 2Q24A 4GFLA 5CW8A 4YZEA 3PPBA 5HSZA 3G7RA 2IU5A 3TP0A 4D7MA 5FKLA 3KKDA 4ACIA 5HBUA 2VPRA 3BTCA 3BR0A 3CWRA 2UXHA 3NNRA 2ID3A 3AQTA 5EZHA 3G1LA 4L62A 2G7LA 4I6ZA 4B3AA 2Y30A 3F1BA 5K7HA 2JK3A 2Y31A 3BR3A 2IEKA 5FKNA 2XGCA 3ON2A 3NRGA 2GUHA 4MO7A 3ZQLA 3BR1A 4JYKA 3Q0WA 3VOKA 3HGGA 4MXMA 3VVXA 4JL3A 4NELA 3C07A 2WGBA 5CXGA 5F27A 5K7ZA 4HKUA 2VKVA 2G3BA 4AUXA 3VW1A 3ZQIA 3BQZA 2RHAA 4V2GA 2RAEA 5D1RA 3B6CA 1JUMA 3IUVA 1U9NA 5D18A 4D5CA 2X6OA 2ZOYA 3G56A 3G1MA 2YVEA 1JT0A 3SFIA 2FBQA 3B81A 1ORKA 4M3DA 2OERA 4XK4A 4M3FA 2NX4A 1T56A 2NS7A 5FKKA 3FIWA 1QPIA 2ZCNA 4KWAA 5K7FA 4AF5A 2TCTA 3NXCA 5F0FA 2ID6A 2HKUA 3NI7A 5FGLA 3QPSA 4ICHA 5EFYA 3E7QA 3CDLA 3COLA 2QOPA 1JUSA 3ZQGA 3QBMA 4M3GA 3AQSA 3EGQA 2HYJA 2HYTA 1QVTA 3IH4A 5J3LA 2F07A 2G7GA 4JNNA 4DW6A 4ME9A 3VP5A 3IH3A 3HE0A
chains in the Genus database with same CATH superfamily
2G7SA 3BQYA 5FMPA 3QQAA 2UXUA 4V2FA 1SGMA 3S5RA 3Q3SA 4AC0A 2DG8A 4D5FA 4C2MA 3LSRA 3DEWA 2QKOA 3BR6A 3ZQFA 2D6YA 2NP3A 1Z77A 3RH2A 2OPTA 4UDSA 3BJBA 3GZIA 5IPAA 2HQ5A 4X1EA 1RPWA 3HTJA 3F0CA 5IOZA 3ON4A 3PASA 2QIBA 3HTAA 2FJ1A 3KNWA 3VVZA 5F1JA 2REKA 2IAIA 3G1OA 2XDNA 2GBYA 5J1UA 3ANPA 5FHPA 4OD4A 3NPIA 3B6AA 1VI0A 2PFVA 5D19A 5EZGA 5C4YA 2ZB9A 3BCGA 2ZOZA 3KKCA 4OD5A 3T6NA 4W97A 3QPLA 4I76A 2X9DA 3HTIA 3WHCA 2XPUA 1RKTA 1JUPA 5EYRA 4GCKA 2XGEA 2QTQA 2XRLA 3JSJA 1UI6A 3PM1A 3BHQA 5FKMA 3BRUA 3VOXA 3BR2A 3BTIA 1BJZA 5K58A 1JTYA 2UXIA 2NS8A 2YVHA 3BR5A 2GFNA 5GP9A 2ZCXA 1UI5A 2IBDA 3WHBA 3VW2A 4NN1A 1JT6A 1QVUA 3SDGA 2PZ9A 2HXOA 3IH2A 3Q0UA 5IOYA 4PXIA 5DAJA 3C2BA 3O8GA 1A6IA 2FJI1 4B1RA 5GPCA 2XPWA 2XPVA 2HXIA 1RKWA 3VUQA 3LSPA 3LHQA 3FK6A 3DPJA 5HAWA 5F08A 2O7TA 3VIBA 5J1YA 2OF7A 2Y2ZA 1Z0XA 2R7WA 3FRQA 3QKXA 3KZ9A 3VVYA 2FX0A 1ZKGA 2G0EA 3SWHA 4G12A 2DG7A 2WV1A 2R7SA 2WUIA 4WIBA 3HGYA 3BTJA 3BT9A 3MVPA 3LWJA 3DCFA 3Q0VA 5F04A 2R7TA 2XGDA 3FHNA 4CGRA 3ZQHA 4W1UA 3EUPA 5F0HA 4U9NA 2V57A 2NP5A 1U9OA 3CRJA 2VKEA 2XB5A 3O60A 5CXIA 1T33A 3HTHA 2R7XA 3V6GA 2I10A 3HIMA 2UXOA 3V78A 3LSJA 3P9TA 3LJLA 2QCOA 4GFKA 4GCTA 4AC6A 2UXPA 5IP6A 2O7OA 3LOCA 2FQ4A 4M3BA 3VTIA 3MNLA 3BTLA 4M3EA 1JTXA 2FD5A 3CJDA 3VPRA 2R7OA 2W53A 4ABZA 2GENA 3CCYA 2RASA 3NS4A 2B1EA 2DTZA 2OI8A 2QWTA 3TP3A 3FK7A 5H9TA 4GCLA 2TRTA 5GPAA 2ZCMA 4JKZA 2JJ7A 2PBXA 5F0CA 3BNIA 3RD3A 3VW0A 4D7NA 4MK6A 5AQCA 1ZK8A 5CQGA 3O8HA 3GEUA 5FKOA 5J1RA 3ANGA 2EH3A 2Q24A 4GFLA 5CW8A 4YZEA 3DU6A 3PPBA 5HSZA 3G7RA 2IU5A 3TP0A 4D7MA 5FKLA 3KKDA 4ACIA 5HBUA 2VPRA 3BTCA 3BR0A 3CWRA 2UXHA 3NNRA 2ID3A 3AQTA 5EZHA 3G1LA 4L62A 2G7LA 4I6ZA 4B3AA 2Y30A 3F1BA 5K7HA 2JK3A 2Y31A 3BR3A 2IEKA 5FKNA 2XGCA 3ON2A 3NRGA 2GUHA 4MO7A 3ZQLA 3BR1A 4JYKA 3Q0WA 3VOKA 2A2FX 3HGGA 4MXMA 3VVXA 4JL3A 4NELA 3C07A 2B3WA 2WGBA 5CXGA 5F27A 5K7ZA 4HKUA 2VKVA 2G3BA 4AUXA 3VW1A 3ZQIA 3BQZA 2RHAA 4V2GA 2RAEA 5D1RA 3B6CA 1JUMA 3IUVA 1U9NA 5D18A 4D5CA 2X6OA 2ZOYA 2R7UA 3G56A 3G1MA 2YVEA 1JT0A 3SFIA 2FBQA 3B81A 3KYLA 1ORKA 4M3DA 2OERA 4IRVA 4M3FA 4XK4A 2NX4A 1T56A 2NS7A 5FKKA 3FIWA 1QPIA 3DU5A 2ZCNA 4KWAA 5K7FA 4AF5A 4U9LA 2TCTA 3NXCA 5F0FA 2ZY9A 2ID6A 2HKUA 3NI7A 5FGLA 3QPSA 4ICHA 5EFYA 2R7RA 3E7QA 3CDLA 3COLA 2QOPA 1JUSA 3K8PC 3ZQGA 3QBMA 4M3GA 3AQSA 3EGQA 2HYJA 2HYTA 1QVTA 3IH4A 5J3LA 2R7QA 2F07A 2G7GA 4JNNA 4DW6A 4ME9A 3VP5A 3IH3A 4DVYP 2YVXA 3HE0A 2R7VA
chains in the Genus database with same CATH topology
2G7SA 3BQYA 5FMPA 3QQAA 2UXUA 4V2FA 1SGMA 3S5RA 3Q3SA 4AC0A 2DG8A 4D5FA 3LSRA 3DEWA 2QKOA 3BR6A 3ZQFA 2D6YA 2NP3A 1Z77A 3RH2A 2OPTA 4UDSA 3BJBA 3GZIA 5IPAA 2HQ5A 4X1EA 1RPWA 3HTJA 3F0CA 5IOZA 3ON4A 3PASA 2QIBA 3HTAA 2FJ1A 3KNWA 3VVZA 5F1JA 2REKA 2IAIA 3G1OA 2XDNA 2GBYA 5J1UA 3ANPA 5FHPA 3NPIA 3B6AA 1VI0A 5D19A 5EZGA 5C4YA 2ZB9A 3BCGA 2ZOZA 3KKCA 3T6NA 4W97A 3QPLA 4I76A 2X9DA 3HTIA 3WHCA 2XPUA 1RKTA 1JUPA 5EYRA 4GCKA 2XGEA 2QTQA 2XRLA 3JSJA 1UI6A 3PM1A 3BHQA 5FKMA 3BRUA 3VOXA 3BR2A 3BTIA 1BJZA 5K58A 1JTYA 2UXIA 2NS8A 2YVHA 3BR5A 2GFNA 5GP9A 2ZCXA 1UI5A 2IBDA 3WHBA 3VW2A 4NN1A 1JT6A 1QVUA 3SDGA 2PZ9A 2HXOA 3IH2A 3Q0UA 5IOYA 4PXIA 5DAJA 3C2BA 3O8GA 1A6IA 4B1RA 5GPCA 2XPWA 2XPVA 2HXIA 1RKWA 3VUQA 3LSPA 3LHQA 3FK6A 3DPJA 5HAWA 5F08A 2O7TA 3VIBA 5J1YA 2OF7A 2Y2ZA 1Z0XA 3FRQA 3QKXA 3KZ9A 3VVYA 2FX0A 1ZKGA 2G0EA 4G12A 2DG7A 2WV1A 2WUIA 3HGYA 3BTJA 3BT9A 3MVPA 3LWJA 3DCFA 3Q0VA 5F04A 2XGDA 4CGRA 3ZQHA 4W1UA 3EUPA 5F0HA 2V57A 2NP5A 1U9OA 3CRJA 2VKEA 2XB5A 3O60A 5CXIA 1T33A 3HTHA 3V6GA 2I10A 3HIMA 2UXOA 3V78A 3LSJA 3P9TA 3LJLA 2QCOA 4GFKA 4GCTA 4AC6A 2UXPA 5IP6A 2O7OA 3LOCA 2FQ4A 4M3BA 3MNLA 3BTLA 4M3EA 1JTXA 2FD5A 3CJDA 3VPRA 2W53A 4ABZA 2GENA 3CCYA 2RASA 2DTZA 2OI8A 2QWTA 3TP3A 3FK7A 5H9TA 4GCLA 2TRTA 5GPAA 2ZCMA 4JKZA 2JJ7A 2PBXA 5F0CA 3BNIA 3RD3A 3VW0A 4D7NA 4MK6A 5AQCA 1ZK8A 3O8HA 3GEUA 5FKOA 5J1RA 3ANGA 2EH3A 2Q24A 4GFLA 5CW8A 4YZEA 3PPBA 5HSZA 3G7RA 2IU5A 3TP0A 4D7MA 5FKLA 3KKDA 4ACIA 5HBUA 2VPRA 3BTCA 3BR0A 3CWRA 2UXHA 3NNRA 2ID3A 3AQTA 5EZHA 3G1LA 4L62A 2G7LA 4I6ZA 4B3AA 2Y30A 3F1BA 5K7HA 2JK3A 2Y31A 3BR3A 2IEKA 5FKNA 2XGCA 3ON2A 3NRGA 2GUHA 4MO7A 3ZQLA 3BR1A 4JYKA 3Q0WA 3VOKA 3HGGA 4MXMA 3VVXA 4JL3A 4NELA 3C07A 2WGBA 5CXGA 5F27A 5K7ZA 4HKUA 2VKVA 2G3BA 4AUXA 3VW1A 3ZQIA 3BQZA 2RHAA 4V2GA 2RAEA 5D1RA 3B6CA 1JUMA 3IUVA 1U9NA 5D18A 4D5CA 2X6OA 2ZOYA 3G56A 3G1MA 2YVEA 1JT0A 3SFIA 2FBQA 3B81A 1ORKA 4M3DA 2OERA 4XK4A 4M3FA 2NX4A 1T56A 2NS7A 5FKKA 3FIWA 1QPIA 2ZCNA 4KWAA 5K7FA 4AF5A 2TCTA 3NXCA 5F0FA 2ID6A 2HKUA 3NI7A 5FGLA 3QPSA 4ICHA 5EFYA 3E7QA 3CDLA 3COLA 2QOPA 1JUSA 3ZQGA 3QBMA 4M3GA 3AQSA 3EGQA 2HYJA 2HYTA 1QVTA 3IH4A 5J3LA 2F07A 2G7GA 4JNNA 4DW6A 4ME9A 3VP5A 3IH3A 3HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7S A;  3BQY A;  5FMP A;  3QQA A;  2UXU A;  4V2F A;  1SGM A;  3S5R A;  3Q3S A;  4AC0 A;  2DG8 A;  4D5F A;  3LSR A;  3DEW A;  2QKO A;  3BR6 A;  3ZQF A;  2D6Y A;  2NP3 A;  1Z77 A;  3RH2 A;  2OPT A;  4UDS A;  3BJB A;  3GZI A;  5IPA A;  2HQ5 A;  4X1E A;  1RPW A;  3HTJ A;  3F0C A;  5IOZ A;  3ON4 A;  3PAS A;  2QIB A;  3HTA A;  2FJ1 A;  3KNW A;  3VVZ A;  5F1J A;  2REK A;  2IAI A;  3G1O A;  2XDN A;  2GBY A;  5J1U A;  3ANP A;  5FHP A;  3NPI A;  3B6A A;  1VI0 A;  5D19 A;  5EZG A;  5C4Y A;  2ZB9 A;  3BCG A;  2ZOZ A;  3KKC A;  3T6N A;  4W97 A;  3QPL A;  4I76 A;  2X9D A;  3HTI A;  3WHC A;  2XPU A;  1RKT A;  1JUP A;  5EYR A;  4GCK A;  2XGE A;  2QTQ A;  2XRL A;  3JSJ A;  1UI6 A;  3PM1 A;  3BHQ A;  5FKM A;  3BRU A;  3VOX A;  3BR2 A;  3BTI A;  1BJZ A;  5K58 A;  1JTY A;  2UXI A;  2NS8 A;  2YVH A;  3BR5 A;  2GFN A;  5GP9 A;  2ZCX A;  1UI5 A;  2IBD A;  3WHB A;  3VW2 A;  4NN1 A;  1JT6 A;  1QVU A;  3SDG A;  2PZ9 A;  2HXO A;  3IH2 A;  3Q0U A;  5IOY A;  4PXI A;  5DAJ A;  3C2B A;  3O8G A;  1A6I A;  4B1R A;  5GPC A;  2XPW A;  2XPV A;  2HXI A;  1RKW A;  3VUQ A;  3LSP A;  3LHQ A;  3FK6 A;  3DPJ A;  5HAW A;  5F08 A;  2O7T A;  3VIB A;  5J1Y A;  2OF7 A;  2Y2Z A;  1Z0X A;  3FRQ A;  3QKX A;  3KZ9 A;  3VVY A;  2FX0 A;  1ZKG A;  2G0E A;  4G12 A;  2DG7 A;  2WV1 A;  2WUI A;  3HGY A;  3BTJ A;  3BT9 A;  3MVP A;  3LWJ A;  3DCF A;  3Q0V A;  5F04 A;  2XGD A;  4CGR A;  3ZQH A;  4W1U A;  3EUP A;  5F0H A;  2V57 A;  2NP5 A;  1U9O A;  3CRJ A;  2VKE A;  2XB5 A;  3O60 A;  5CXI A;  1T33 A;  3HTH A;  3V6G A;  2I10 A;  3HIM A;  2UXO A;  3V78 A;  3LSJ A;  3P9T A;  3LJL A;  2QCO A;  4GFK A;  4GCT A;  4AC6 A;  2UXP A;  5IP6 A;  2O7O A;  3LOC A;  2FQ4 A;  4M3B A;  3MNL A;  3BTL A;  4M3E A;  1JTX A;  2FD5 A;  3CJD A;  3VPR A;  2W53 A;  4ABZ A;  2GEN A;  3CCY A;  2RAS A;  2DTZ A;  2OI8 A;  2QWT A;  3TP3 A;  3FK7 A;  5H9T A;  4GCL A;  2TRT A;  5GPA A;  2ZCM A;  4JKZ A;  2JJ7 A;  2PBX A;  5F0C A;  3BNI A;  3RD3 A;  3VW0 A;  4D7N A;  4MK6 A;  5AQC A;  1ZK8 A;  3O8H A;  3GEU A;  5FKO A;  5J1R A;  3ANG A;  2EH3 A;  2Q24 A;  4GFL A;  5CW8 A;  4YZE A;  3PPB A;  5HSZ A;  3G7R A;  2IU5 A;  3TP0 A;  4D7M A;  5FKL A;  3KKD A;  4ACI A;  5HBU A;  2VPR A;  3BTC A;  3BR0 A;  3CWR A;  2UXH A;  3NNR A;  2ID3 A;  3AQT A;  5EZH A;  3G1L A;  4L62 A;  2G7L A;  4I6Z A;  4B3A A;  2Y30 A;  3F1B A;  5K7H A;  2JK3 A;  2Y31 A;  3BR3 A;  2IEK A;  5FKN A;  2XGC A;  3ON2 A;  3NRG A;  2GUH A;  4MO7 A;  3ZQL A;  3BR1 A;  4JYK A;  3Q0W A;  3VOK A;  3HGG A;  4MXM A;  3VVX A;  4JL3 A;  4NEL A;  3C07 A;  2WGB A;  5CXG A;  5F27 A;  5K7Z A;  4HKU A;  2VKV A;  2G3B A;  4AUX A;  3VW1 A;  3ZQI A;  3BQZ A;  2RHA A;  4V2G A;  2RAE A;  5D1R A;  3B6C A;  1JUM A;  3IUV A;  1U9N A;  5D18 A;  4D5C A;  2X6O A;  2ZOY A;  3G56 A;  3G1M A;  2YVE A;  1JT0 A;  3SFI A;  2FBQ A;  3B81 A;  1ORK A;  4M3D A;  2OER A;  4XK4 A;  4M3F A;  2NX4 A;  1T56 A;  2NS7 A;  5FKK A;  3FIW A;  1QPI A;  2ZCN A;  4KWA A;  5K7F A;  4AF5 A;  2TCT A;  3NXC A;  5F0F A;  2ID6 A;  2HKU A;  3NI7 A;  5FGL A;  3QPS A;  4ICH A;  5EFY A;  3E7Q A;  3CDL A;  3COL A;  2QOP A;  1JUS A;  3ZQG A;  3QBM A;  4M3G A;  3AQS A;  3EGQ A;  2HYJ A;  2HYT A;  1QVT A;  3IH4 A;  5J3L A;  2F07 A;  2G7G A;  4JNN A;  4DW6 A;  4ME9 A;  3VP5 A;  3IH3 A;  3HE0 A; 
#chains in the Genus database with same CATH topology
 2G7S A;  3BQY A;  5FMP A;  3QQA A;  2UXU A;  4V2F A;  1SGM A;  3S5R A;  3Q3S A;  4AC0 A;  2DG8 A;  4D5F A;  4C2M A;  3LSR A;  3DEW A;  2QKO A;  3BR6 A;  3ZQF A;  2D6Y A;  2NP3 A;  1Z77 A;  3RH2 A;  2OPT A;  4UDS A;  3BJB A;  3GZI A;  5IPA A;  2HQ5 A;  4X1E A;  1RPW A;  3HTJ A;  3F0C A;  5IOZ A;  3ON4 A;  3PAS A;  2QIB A;  3HTA A;  2FJ1 A;  3KNW A;  3VVZ A;  5F1J A;  2REK A;  2IAI A;  3G1O A;  2XDN A;  2GBY A;  5J1U A;  3ANP A;  5FHP A;  4OD4 A;  3NPI A;  3B6A A;  1VI0 A;  2PFV A;  5D19 A;  5EZG A;  5C4Y A;  2ZB9 A;  3BCG A;  2ZOZ A;  3KKC A;  4OD5 A;  3T6N A;  4W97 A;  3QPL A;  4I76 A;  2X9D A;  3HTI A;  3WHC A;  2XPU A;  1RKT A;  1JUP A;  5EYR A;  4GCK A;  2XGE A;  2QTQ A;  2XRL A;  3JSJ A;  1UI6 A;  3PM1 A;  3BHQ A;  5FKM A;  3BRU A;  3VOX A;  3BR2 A;  3BTI A;  1BJZ A;  5K58 A;  1JTY A;  2UXI A;  2NS8 A;  2YVH A;  3BR5 A;  2GFN A;  5GP9 A;  2ZCX A;  1UI5 A;  2IBD A;  3WHB A;  3VW2 A;  4NN1 A;  1JT6 A;  1QVU A;  3SDG A;  2PZ9 A;  2HXO A;  3IH2 A;  3Q0U A;  5IOY A;  4PXI A;  5DAJ A;  3C2B A;  3O8G A;  1A6I A;  2FJI 1;  4B1R A;  5GPC A;  2XPW A;  2XPV A;  2HXI A;  1RKW A;  3VUQ A;  3LSP A;  3LHQ A;  3FK6 A;  3DPJ A;  5HAW A;  5F08 A;  2O7T A;  3VIB A;  5J1Y A;  2OF7 A;  2Y2Z A;  1Z0X A;  2R7W A;  3FRQ A;  3QKX A;  3KZ9 A;  3VVY A;  2FX0 A;  1ZKG A;  2G0E A;  3SWH A;  4G12 A;  2DG7 A;  2WV1 A;  2R7S A;  2WUI A;  4WIB A;  3HGY A;  3BTJ A;  3BT9 A;  3MVP A;  3LWJ A;  3DCF A;  3Q0V A;  5F04 A;  2R7T A;  2XGD A;  3FHN A;  4CGR A;  3ZQH A;  4W1U A;  3EUP A;  5F0H A;  4U9N A;  2V57 A;  2NP5 A;  1U9O A;  3CRJ A;  2VKE A;  2XB5 A;  3O60 A;  5CXI A;  1T33 A;  3HTH A;  2R7X A;  3V6G A;  2I10 A;  3HIM A;  2UXO A;  3V78 A;  3LSJ A;  3P9T A;  3LJL A;  2QCO A;  4GFK A;  4GCT A;  4AC6 A;  2UXP A;  5IP6 A;  2O7O A;  3LOC A;  2FQ4 A;  4M3B A;  3VTI A;  3MNL A;  3BTL A;  4M3E A;  1JTX A;  2FD5 A;  3CJD A;  3VPR A;  2R7O A;  2W53 A;  4ABZ A;  2GEN A;  3CCY A;  2RAS A;  3NS4 A;  2B1E A;  2DTZ A;  2OI8 A;  2QWT A;  3TP3 A;  3FK7 A;  5H9T A;  4GCL A;  2TRT A;  5GPA A;  2ZCM A;  4JKZ A;  2JJ7 A;  2PBX A;  5F0C A;  3BNI A;  3RD3 A;  3VW0 A;  4D7N A;  4MK6 A;  5AQC A;  1ZK8 A;  5CQG A;  3O8H A;  3GEU A;  5FKO A;  5J1R A;  3ANG A;  2EH3 A;  2Q24 A;  4GFL A;  5CW8 A;  4YZE A;  3DU6 A;  3PPB A;  5HSZ A;  3G7R A;  2IU5 A;  3TP0 A;  4D7M A;  5FKL A;  3KKD A;  4ACI A;  5HBU A;  2VPR A;  3BTC A;  3BR0 A;  3CWR A;  2UXH A;  3NNR A;  2ID3 A;  3AQT A;  5EZH A;  3G1L A;  4L62 A;  2G7L A;  4I6Z A;  4B3A A;  2Y30 A;  3F1B A;  5K7H A;  2JK3 A;  2Y31 A;  3BR3 A;  2IEK A;  5FKN A;  2XGC A;  3ON2 A;  3NRG A;  2GUH A;  4MO7 A;  3ZQL A;  3BR1 A;  4JYK A;  3Q0W A;  3VOK A;  2A2F X;  3HGG A;  4MXM A;  3VVX A;  4JL3 A;  4NEL A;  3C07 A;  2B3W A;  2WGB A;  5CXG A;  5F27 A;  5K7Z A;  4HKU A;  2VKV A;  2G3B A;  4AUX A;  3VW1 A;  3ZQI A;  3BQZ A;  2RHA A;  4V2G A;  2RAE A;  5D1R A;  3B6C A;  1JUM A;  3IUV A;  1U9N A;  5D18 A;  4D5C A;  2X6O A;  2ZOY A;  2R7U A;  3G56 A;  3G1M A;  2YVE A;  1JT0 A;  3SFI A;  2FBQ A;  3B81 A;  3KYL A;  1ORK A;  4M3D A;  2OER A;  4IRV A;  4M3F A;  4XK4 A;  2NX4 A;  1T56 A;  2NS7 A;  5FKK A;  3FIW A;  1QPI A;  3DU5 A;  2ZCN A;  4KWA A;  5K7F A;  4AF5 A;  4U9L A;  2TCT A;  3NXC A;  5F0F A;  2ZY9 A;  2ID6 A;  2HKU A;  3NI7 A;  5FGL A;  3QPS A;  4ICH A;  5EFY A;  2R7R A;  3E7Q A;  3CDL A;  3COL A;  2QOP A;  1JUS A;  3K8P C;  3ZQG A;  3QBM A;  4M3G A;  3AQS A;  3EGQ A;  2HYJ A;  2HYT A;  1QVT A;  3IH4 A;  5J3L A;  2R7Q A;  2F07 A;  2G7G A;  4JNN A;  4DW6 A;  4ME9 A;  3VP5 A;  3IH3 A;  4DVY P;  2YVX A;  3HE0 A;  2R7V A; 
#chains in the Genus database with same CATH homology
 2G7S A;  3BQY A;  5FMP A;  3QQA A;  2UXU A;  4V2F A;  1SGM A;  3S5R A;  3Q3S A;  4AC0 A;  2DG8 A;  4D5F A;  3LSR A;  3DEW A;  2QKO A;  3BR6 A;  3ZQF A;  2D6Y A;  2NP3 A;  1Z77 A;  3RH2 A;  2OPT A;  4UDS A;  3BJB A;  3GZI A;  5IPA A;  2HQ5 A;  4X1E A;  1RPW A;  3HTJ A;  3F0C A;  5IOZ A;  3ON4 A;  3PAS A;  2QIB A;  3HTA A;  2FJ1 A;  3KNW A;  3VVZ A;  5F1J A;  2REK A;  2IAI A;  3G1O A;  2XDN A;  2GBY A;  5J1U A;  3ANP A;  5FHP A;  3NPI A;  3B6A A;  1VI0 A;  5D19 A;  5EZG A;  5C4Y A;  2ZB9 A;  3BCG A;  2ZOZ A;  3KKC A;  3T6N A;  4W97 A;  3QPL A;  4I76 A;  2X9D A;  3HTI A;  3WHC A;  2XPU A;  1RKT A;  1JUP A;  5EYR A;  4GCK A;  2XGE A;  2QTQ A;  2XRL A;  3JSJ A;  1UI6 A;  3PM1 A;  3BHQ A;  5FKM A;  3BRU A;  3VOX A;  3BR2 A;  3BTI A;  1BJZ A;  5K58 A;  1JTY A;  2UXI A;  2NS8 A;  2YVH A;  3BR5 A;  2GFN A;  5GP9 A;  2ZCX A;  1UI5 A;  2IBD A;  3WHB A;  3VW2 A;  4NN1 A;  1JT6 A;  1QVU A;  3SDG A;  2PZ9 A;  2HXO A;  3IH2 A;  3Q0U A;  5IOY A;  4PXI A;  5DAJ A;  3C2B A;  3O8G A;  1A6I A;  4B1R A;  5GPC A;  2XPW A;  2XPV A;  2HXI A;  1RKW A;  3VUQ A;  3LSP A;  3LHQ A;  3FK6 A;  3DPJ A;  5HAW A;  5F08 A;  2O7T A;  3VIB A;  5J1Y A;  2OF7 A;  2Y2Z A;  1Z0X A;  3FRQ A;  3QKX A;  3KZ9 A;  3VVY A;  2FX0 A;  1ZKG A;  2G0E A;  4G12 A;  2DG7 A;  2WV1 A;  2WUI A;  3HGY A;  3BTJ A;  3BT9 A;  3MVP A;  3LWJ A;  3DCF A;  3Q0V A;  5F04 A;  2XGD A;  4CGR A;  3ZQH A;  4W1U A;  3EUP A;  5F0H A;  2V57 A;  2NP5 A;  1U9O A;  3CRJ A;  2VKE A;  2XB5 A;  3O60 A;  5CXI A;  1T33 A;  3HTH A;  3V6G A;  2I10 A;  3HIM A;  2UXO A;  3V78 A;  3LSJ A;  3P9T A;  3LJL A;  2QCO A;  4GFK A;  4GCT A;  4AC6 A;  2UXP A;  5IP6 A;  2O7O A;  3LOC A;  2FQ4 A;  4M3B A;  3MNL A;  3BTL A;  4M3E A;  1JTX A;  2FD5 A;  3CJD A;  3VPR A;  2W53 A;  4ABZ A;  2GEN A;  3CCY A;  2RAS A;  2DTZ A;  2OI8 A;  2QWT A;  3TP3 A;  3FK7 A;  5H9T A;  4GCL A;  2TRT A;  5GPA A;  2ZCM A;  4JKZ A;  2JJ7 A;  2PBX A;  5F0C A;  3BNI A;  3RD3 A;  3VW0 A;  4D7N A;  4MK6 A;  5AQC A;  1ZK8 A;  3O8H A;  3GEU A;  5FKO A;  5J1R A;  3ANG A;  2EH3 A;  2Q24 A;  4GFL A;  5CW8 A;  4YZE A;  3PPB A;  5HSZ A;  3G7R A;  2IU5 A;  3TP0 A;  4D7M A;  5FKL A;  3KKD A;  4ACI A;  5HBU A;  2VPR A;  3BTC A;  3BR0 A;  3CWR A;  2UXH A;  3NNR A;  2ID3 A;  3AQT A;  5EZH A;  3G1L A;  4L62 A;  2G7L A;  4I6Z A;  4B3A A;  2Y30 A;  3F1B A;  5K7H A;  2JK3 A;  2Y31 A;  3BR3 A;  2IEK A;  5FKN A;  2XGC A;  3ON2 A;  3NRG A;  2GUH A;  4MO7 A;  3ZQL A;  3BR1 A;  4JYK A;  3Q0W A;  3VOK A;  3HGG A;  4MXM A;  3VVX A;  4JL3 A;  4NEL A;  3C07 A;  2WGB A;  5CXG A;  5F27 A;  5K7Z A;  4HKU A;  2VKV A;  2G3B A;  4AUX A;  3VW1 A;  3ZQI A;  3BQZ A;  2RHA A;  4V2G A;  2RAE A;  5D1R A;  3B6C A;  1JUM A;  3IUV A;  1U9N A;  5D18 A;  4D5C A;  2X6O A;  2ZOY A;  3G56 A;  3G1M A;  2YVE A;  1JT0 A;  3SFI A;  2FBQ A;  3B81 A;  1ORK A;  4M3D A;  2OER A;  4XK4 A;  4M3F A;  2NX4 A;  1T56 A;  2NS7 A;  5FKK A;  3FIW A;  1QPI A;  2ZCN A;  4KWA A;  5K7F A;  4AF5 A;  2TCT A;  3NXC A;  5F0F A;  2ID6 A;  2HKU A;  3NI7 A;  5FGL A;  3QPS A;  4ICH A;  5EFY A;  3E7Q A;  3CDL A;  3COL A;  2QOP A;  1JUS A;  3ZQG A;  3QBM A;  4M3G A;  3AQS A;  3EGQ A;  2HYJ A;  2HYT A;  1QVT A;  3IH4 A;  5J3L A;  2F07 A;  2G7G A;  4JNN A;  4DW6 A;  4ME9 A;  3VP5 A;  3IH3 A;  3HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...