5FI8A

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bounded with dsm422 (tetrahydro-2-naphthyl and 2-indanyl triazolopyrimidine)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
374
structure length
363
Chain Sequence
NPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Tetrahydro-2-naphthyl and 2-Indanyl Triazolopyrimidines Targeting Plasmodium falciparum Dihydroorotate Dehydrogenase Display Potent and Selective Antimalarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
total genus 139
structure length 363
sequence length 374
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5fi8A00
1NFBA 3CEUA 3HQ1A 3VNDA 3BK0A 1NEYA 5FI8A 4CCDA 3EXRA 1TQXA 2DZVA 3MHGA 2YX0A 5LHEA 2ZZ3A 3SJ3A 2PCQA 4WZHA 1W5PA 3YPIA 4XZ9A 1OABA 1SZNA 3NR0A 3B0VC 4JR5A 1RQBA 1FY6A 3KRUA 2VC6A 1XM3A 5F4XA 2Z1BA 1Q6LA 1HUVA 4WOQA 3NPXA 4ADSA 3CC1A 1W1ZA 2YW4A 3VE9A 1YTKA 1TV8A 5CPMA 3U8GA 4GNJA 2Q8LA 4IUOA 3FIGA 1FBAA 2E5DA 3I7SA 2Y62A 3UWQA 4AB4A 2WNQA 3LV6A 3A23A 5D2TA 3GXNA 1L6SA 1HTIA 3W2JA 4LWWA 3N9SA 1YPIA 2ZRUA 2B7NA 1TPUA 2QCMA 4M7SA 3W86A 4MJZA 2I9EA 3C2FA 1QO5A 3FEMA 2OMAA 3E0IA 2ZZ6A 3A21A 5D09A 4OGZA 3LRLA 4AWUA 1XBZA 4EIVA 4J9JA 1H7NA 3IVSA 1ONRA 2ZRZA 1FWTA 1RPXA 5KITA 2P1FA 1JUKA 4E2DA 4JTIA 1R30A 2C13A 3K30A 1ME7A 3OIXA 5CSSA 3ZR4A 3G8EA 3G18A 1KFJA 5DY2A 1ZY9A 4IOTA 1SZFA 3ZFHA 1F2JA 5TQLA 1BKSA 3EKLA 2ZFAA 3W2UA 2V8ZA 3IEBA 5LGZA 2A1YA 1ME9A 5DBTA 3G1XA 5I3FA 2DJXA 2YSWA 1C29A 3NPWA 5F1VA 1EUAA 4ICNA 3QH2A 5K3VA 1I45A 1EP3A 1JJKA 3TC7A 2B7QA 2JKPA 1H7WA 3B05A 1MO0A 1U5JA 3MWAA 3PUEA 1YDVA 3BG5A 4K7VA 3C61A 3LHVA 1OHLA 4O16A 5AC7A 1H5YA 2CLIA 4AH7A 1GWJA 1BEUA 3W7OA 4UFKA 2FDSA 5EY5A 1J2WA 2RHGA 1FCUA 3ATZA 4R7JA 1SFLA 4A3UA 1RD5A 1CX9A 4UTTC 3MJYA 3R2GA 3F4NA 3ANYA 3R8RA 4QQ3A 3G1DA 3NOEA 3WJYA 1I2PA 3MP4A 3NQGA 1QPOA 3NL6A 1VRDA 2CLEA 1QPQA 2J9ZA 3C2VA 1TRDA 2CZDA 3QMRA 8TIMA 6ALDA 1S3HA 3MI6A 4N9CA 4YCPA 3LRMA 3Q58A 1GG1A 3B06A 2V5BA 4JDYA 5D02A 4MYAA 1VLIA 1KM1A 1NF0A 3TW7A 1LRNA 2Y70A 4QIUA 1KM0A 1G4EA 1D9EA 1O5XA 4YCOA 5G2IA 3DH7A 3QW4B 3N73A 2HTMA 2ZYFA 5D32A 3UWWA 3W1UA 2QCLA 3R13A 4NUWA 1SFJA 3G1AA 1LOLA 3PM6A 4MY9A 1PV8A 1B3OA 1K03A 1FWRA 1SW3A 2V30A 2FPYA 3UY7A 3TFCA 5LZLA 5AHNA 1OX4A 2A6NA 1LOSA 3G0XA 4DELA 1GT8A 2R91A 3M47A 3PBUA 3GXPA 1ADOA 1H50A 2DP3A 1TTQA 3W7PA 1NVMA 1KLZA 3UXAA 3M5YA 4P61A 4XTIA 3STGA 4ZZ9A 3DFTA 2QCEA 3NQ2A 4HNTA 1F05A 1JCYA 2WO5A 1F6KA 5EYWA 4AWTA 1VYPX 1GVSA 5FF2A 1WBHA 1SO5A 3LCGA 1JCNA 2A0NA 1AW5A 1CW2A 2BXVA 2YPIA 3HIJA 3E49A 3MHUA 3UWVA 4O57A 4XWUA 2IQTA 4DO4A 3W70A 4LS0A 2VFIA 1WDWA 3UD6A 3T40A 1QFEA 2DZWA 2JBMA 2NX3A 1BWKA 4JN6A 1MZHA 4EOUA 3CHVA 1V5XA 1M7PA 2OJPA 3P62A 5HUPA 5D38A 4B5NA 1QPNA 4PL1A 4Y8FA 2VFDA 1GEQA 2YYUA 1A53A 1ZAIA 1F76A 1XL9A 4K39A 3S42A 4NJIA 1JUBA 5EL1A 3P5ZA 5AC8A 5DY3A 1OYBA 2GVJA 3OVRA 3LX9A 5LSMA 2J9YA 4JX4A 5HQEA 4UNKA 1YTDA 3FFSA 2V5LA 2D73A 5AHIA 4EVZA 3M6YA 2NV2A 1TPVA 4Q33A 1IF2A 2PRHA 3BARA 4FX6M 2FB3A 2J9XA 4I9AA 4IWWA 4LUJA 4NT0A 1NAL1 4LOCA 1TV7A 3B0PA 4N9BA 3IGSA 3P61A 1H62A 1AW1A 4KWWA 3SI9A 1HFBA 1G69A 2CLMA 4UMAA 4ZVJA 5CZTA 4O18A 3W7HA 1KFLA 4UTHA 4IMGA 2RH9A 5G1YA 1G67A 4HNNA 2G95A 3FKKA 2NXGA 1EX5A 3DBPA 5HWNA 5BNKA 1TIMA 3IGUA 2ZZ7A 2FJKA 1ZHAA 3L21A 3IVTA 3VI2A 4UTMA 4LS2A 3PSWA 2DZSA 3W7DA 4UTWA 3I6RA 3BW4A 1KW1A 4M6QA 1WOBA 3HG2A 5G4EA 3C4UA 5BRBA 2RFGA 3TE9A 3FJ6A 3BG9A 3NA8A 3B04A 2FTPA 4DF0A 1WX0A 3IIOA 2DZXA 3VFLA 5U4NA 2VXNA 1W54A 4A2SA 3UQNA 3TKFA 2ZRVA 3LHWA 4CQ9A 3C6CA 2YDAA 2H3DA 1EIXA 3C3NA 4E38A 2CU0A 3M5ZA 2HMCA 3SSJA 3SY5A 1Q3NA 5D30A 1J4EA 2EGZA 5HR7A 2X1RA 3L5LA 5D2VA 5G2HA 1H7PA 2YR1A 3AJXA 3P7YA 3W7GA 1OF6A 4TU1A 5EPDA 4X22A 5HR6A 5HULA 2XN2A 2NXHA 2Y6ZA 2CFFA 5T26A 1DQXA 4QISA 5AHLA 5DN1A 3DFOA 1JCMP 4GRSA 3T4CA 2DJLA 3LBCA 1P0NA 1OF8A 3WK3A 1PS9A 4C1KA 2BZNA 3STEA 4ML9A 5KINA 3ZWTA 4WD0A 4D2JA 4RXFA 4UR7A 1KFEA 3L5AA 4MVAA 1EP2A 3SFKA 5E93A 3PG9A 4S2BA 3P5YA 1EP1A 4MZYA 4Y6GA 4O19A 4N02A 2I14A 3A24A 1OX4B 5DXXA 4MKNA 2F7FA 4WXZA 2C14A 1UCWA 4DBEA 1YXYA 3WJWA 1TPB1 3HOJA 4X9SA 1M7OA 4ADUA 2XN1A 3TNOA 1GTEA 3ABRA 5D37A 3W9ZA 3W1XA 2NUYA 1GVOA 3LLFA 3SIZA 1B57A 1H1YA 4K36A 1LTDA 4QJ1A 1KM3A 4HPJA 3UNDA 4MFDA 5CZJA 1KTNA 5BMXA 5MHBA 1XI3A 1YLVA 4MYXA 3TCEA 3R5EA 4NNAA 1UJPA 5KZDA 1MSSA 1JCJA 2Q8ZA 4NX5A 2H3BA 1U83A 1O5KA 1XUZA 3NDOA 5U7SA 3INPA 5HWMA 3S1WA 3NQDA 3TK7A 3GYEA 3N9RA 1A5SA 4HPXA 3CT7A 2ATMA 4BI6A 1KBIA 1L9WA 3PR2A 3ABSA 4LVAA 3TQKA 3NM3A 3UWUA 4HNVA 4YWIA 4AHPA 2CLOA 4MIMA 1VCVA 3G22A 1W3TA 1QOQA 1EWEA 3RLUA 4I7UA 3W1MA 2C16A 5HJLA 3QYQA 4MFEA 3BPWA 3DFSA 1LORA 4QM1A 1KTCA 3A22A 4FNUA 2QUTA 4JTHA 4QITA 3NQVA 4YLWA 3TXVA 5FF3A 5L6UA 4NJKA 1VHNA 2CLHA 4Z1CA 4AAJA 4QAIA 3TJLA 1S5TA 2R14A 4NNCA 5I3GA 3GKFA 4KWVA 3DHFA 3HGSA 3F1QA 3EWYA 3DI0A 3HO8A 3CU2A 3G3DA 3G24A 1W3NA 3BLFA 3M5XA 4IQLA 4UC5A 1IXNA 4MY8A 4RCXA 1UB3A 2VEPA 2ZA1A 5CKSA 3PG8A 5CPOA 1KBJA 5C6MA 4N4QA 2Q3RA 1F6PA 3QC3A 1VR6A 3QRHA 3TMQA 1MEIA 4RLIA 3G1FA 3LI1A 3GZ3A 1FDJA 2J6XA 2PRMA 5I3HA 4ZQPA 3C0JA 5K9CA 2DZPA 1H7RA 2Y63A 2H8XA 4HHPA 3M41A 5EKYA 3LB0A 5HUOA 4MY1A 2FPVA 3OBKA 5LNWA 3FS2A 3PBVA 2NX1A 4FNSA 4GC4A 1K8ZA 4IGHA 4NNBA 6TIMA 4AMAA 1B9BA 5HWJA 3NPUA 4MJMA 1JQVA 3TC6A 4GUHA 1FUYA 4UR8A 1RV8A 4TMBA 2ISSA 3HPXA 4LV9A 4FEZA 1W3IA 3PUOA 4NJHA 5HINA 1LLWA 3DKLA 4IXXA 5KZMA 5I3JA 3B0UX 3S8HA 2ZZ2A 3OA3A 2Y7FA 2O7SA 5K7JA 4RV8A 4GUIA 3IIXA 4TO8A 2WQPA 3RLVA 1GYNA 1DJNA 2YXGA 3IIZA 4FF7A 4HSNA 1XBXA 4M7TA 2Y61A 3KAOA 4H6KA 1ZENA 1QDSA 3HGRA 2V2DA 1LROA 3EEGA 4NQ1A 5D2WA 3DAQA 1W0MA 4JD4A 4K8EA 1DVJA 4LTSA 1VHCA 4IJBA 3QQ1A 4R34A 1OFPA 1VH7A 1RQHA 1B4EA 1Q6RA 3I65A 3NEVA 3LOTA 3NQEA 3QM3A 4OWGA 3TROA 3V75A 4WXYA 3W73A 4JNMA 2VOMA 1TPC1 3MW7A 3O16A 1G6CA 1TTIA 1KA9F 2NWRA 3QPZA 4FXRA 1NSJA 1XCFA 2CZEA 4IX2A 3U2OA 3L0NA 5C2XA 3O6DA 4O50A 4O4WA 1G7UA 2V82A 4BR1A 5AHFA 1TCDA 2VEKA 3QPYA 2Y85A 5H91A 1T8XA 2H90A 4PODA 1KM6A 1SW7A 4RXGA 3SR7A 3TW6A 1TPEA 2CZFA 4XBKA 4WOZA 1MEWA 2EAWA 2QCFA 3LHTA 3B03A 4Q4KA 3ATYA 1TTJA 2TRSA 4PH6A 3THAA 3IRDA 1KM4A 3IGXA 1G7VA 1ICSA 4M19A 4TR9A 1VZWA 4NX0A 3TIMA 3WJXA 3G1YA 1G4TA 1K3UA 3TDFA 5LNUA 2GVGA 3M7WA 3W87A 3ZS4A 1RVGA 2X1SA 2WNZA 1YYAA 3GDLA 1OFDA 1SPQA 3LCLA 4LC6A 3S9YA 4DO6A 4A22A 2P0OA 4DEFA 2CWNA 3LERA 3MO7A 2V0TA 4O10A 3S6DA 1R47A 3F03K 2YZRA 3LXAA 1WYIA 2YFNA 3FA5A 2ZZ4A 5F1UA 5C54A 5LHFA 1ZALA 2X16A 4H4IA 3QSRA 4MOZA 1A5BA 1QPRA 2P10A 1PVNA 4CCCA 3NM1A 3KRZA 1B4KA 3DFPA 4TIMA 1C8VA 3QQ0A 4YL2A 1PCWA 3BW3A 2W0UA 3L2IA 3LHUA 4N9EA 2ZDRA 4P2VA 4WX2A 1AW2A 2QUUA 4O8RA 2A7RA 4ZMGA 4YXGA 1JR1A 3IIVA 4MUZA 5I3IA 1TMHA 2J27A 4HKPA 1P5BA 4L4MA 1X1ZA 4UTTA 2W79A 4S2CA 1K02A 1DBTA 1OK4A 4LY8A 2YYTA 1GOXA 1KM2A 3O6CA 3DU0A 5D2XA 5EA9A 2YFOA 4JX5A 4UMBA 4FX7A 4CNPA 1TJPA 4ALDA 3LBMA 1QMLA 3KXQA 4IPIA 3NQFA 3W75A 5EBUA 4LC8A 5DELA 3GVGA 3H55A 2C6QA 3TV8A 3GDTA 1VCFA 1I2NA 3BLEA 1I4NA 2QJGA 3TMLA 3C8FA 4NZJA 4ZQNA 3QMTA 1SR9A 2F84A 3STFA 1SO3A 2H6RA 1H61A 1BTMA 4FHAA 3GNDA 3CIWA 2V81A 2BTMA 2ZRXA 5FF7A 5AYXA 1O4UA 3BW2A 3OVPA 1OFRA 4BF9A 1LZOA 1R2SA 4BWLC 1P0KA 3CEPA 3NQ7A 4LNYA 3THQA 1R2RA 3KVMA 4N9DA 2EF9A 3C56A 1JULA 3SGUA 1FDZA 1Z41A 4OV9A 2GQ8A 4HNUA 4LRTA 4XKYA 4Y9AA 4UFHA 2X1TA 1X7FA 3TXZA 5AYYA 1XBYA 3PB2A 3KVJA 1SW0A 1TPH1 3SECA 3EWZA 3GIYA 2NUWA 3B8DA 2J24A 3KHJA 3W7RA 3TQVA 1DOSA 5CGQA 3S1XA 1K8YA 3S5OA 4WJEA 2PRLA 1MXSA 1TPDA 3MP5A 3Q2DA 5FEWA 2H8ZA 4DQWA 1EWDA 4UTIA 3CM4A 1IIGA 4RKAA 3VKJA 4GE8A 3MP3A 4GUJA 1Z42A 3LTSA 3GXTA 1GTHA 4QNEA 3QZEA 2NX9A 4IMDA 2OZ0A 2Z2UA 5BOOA 4EF8A 3W7EA 4M6PA 2NWSA 3R89A 3HJZA 3S1VA 2QCDA 2ZTJA 3NPVA 1ZAJA 4XQ6A 5IM51 1FWNA 2QDHA 4AEOA 2E6YA 1OK6A 1OYCA 1H7OA 3S1UA 1VGAA 4JY9A 4UMCA 3CIXA 5LKYA 2AAMA 4WY0F 3W7QA 2YGYA 3EWBX 4IPJA 1FCBA 2GQAA 3EKZA 2VKZG 4U28A 1VQTA 5K4ZA 4UFJA 1UUMA 4UTUA 3E96A 1YADA 1OFBA 1Q6QA 3TSMA 4PCFA 1WQ5A 3L66A 3NL3A 2NZLA 4O54A 1YPFA 1ZCOA 1JRCA 1NF7A 3KVLA 4POCA 1W5OA 3M44A 4Q32A 1ZJIA 3S5NA 1LM1A 1M6JA 2NV1A 2WV8A 3W83A 2UV8G 1WV2A 3CLMA 3L65A 4JTGA 2A2IA 2QJIA 2FB2A 1KV5A 4TMCA 4GJ1A 3SW6A 1W8SA 3NZRA 1D3GA 3P82A 3PBYA 2A7PA 1SO4A 4Y96A 4CNOA 4PTNA 5AN7A 4UIOA 4TX9A 1VS1A 2C19A 3W3OA 2RDUA 1QCWA 3N3MA 1OFEA 3WJSA 2QR6A 1SUXA 1AMKA 2O7QA 1XBVA 3NZ1A 1DORA 3T78A 2OT0A 3SGZA 4UCGA 2DU2A 1OG0A 2OCZA 4N4PA 5DCBA 3PAJA 3M0ZA 2A21A 3OEXA 3MYOA 3TSDA 3MI3A 3BLIA 4YMZA 2ISWA 3E9AA 1FCVA 4Z0JA 1UBSA 3BG3A 5CZSA 5LGXA 2HS8A 4JYFA 3W2KA 2E09A 4GBUA 3DGRA 4X3ZA 5AHEA 3QF0A 1OFOA 2ATSA 2ABAA 5KSWA 4EF9A 1A50A 3PVFA 1Q45A 2QCNA 4LV4A 3WK2A 2C3ZA 4GXMA 3NG3A 1ZFJA 1TTPA 1PHQA 3W1QA 3QW3A 4IMFA 2E1DA 1JVNA 3EX4A 3W6YA 4JICA 3GK0A 2QAPA 5K9XA 2WOQA 3F4WA 3PSVA 1YDNA 3L9CA 4OT7A 5A8GA 3M5VA 1OX5A 3LCIA 3CB8A 3FKRA 2Y7EA 5LNRA 1SO6A 3H53A 3NXFA 2R8WA 3I68A 4RZ5A 1F74A 3N34A 4ONVA 2PC4A 2ZQ0A 5BW6A 1S5WA 1VCGA 1TO3A 2NLIA 3DKJA 4JYEA 5CG7A 5DCDA 4AXKA 5DLCA 5G5IA 1GZGA 3V1PA 1L2UA 3NYZA 1OX6A 3ABQA 2QUVA 3W84A 4HIBA 3DFQA 1H63A 5D03A 3VCRA 2VFHA 1L6YA 3JR2A 2A7NA 1FXQA 3L68A 2AGKA 2GQ9A 3O05A 2Z6IA 3W1LA 1SZGA 4JTEA 3TAOA 2ZRYA 4E0CA 5IBXC 3CTLA 4KKXA 1TPFA 1OFAA 3A9IA 3W7NA 3I7QA 1PIIA 1KFBA 1ZNNA 2QEZA 5F4WA 3W76A 3KOFA 4GUFA 3TFXA 3UPWA 4UTKA 3FOKA 2J88A 3TUUA 1LRTA 2ZCGA 4PEKA 3W88A 4JEQA 2DZTA 3NAVA 5BMWA 3PWAA 4ZQCA 1T99A 4LVBA 4OV4A 3NQAA 4K37A 5AYZA 2NXIA 3LXCA 3TX9A 4FXSA 4N6EA 4ADTA 2R94A 3N2XA 2GJNA 4EWND 2GOUA 3DI1A 1JQXA 1TREA 4U4MA 2ZZ1A 1Y0EA 3LRKA 2Y7GA 2Q3OA 1C9DA 4QNWA 4ZQMA 3P8IA 1RR2A 1TYGA 4UUIA 3CQ0A 4RX0A 5KTLA 2ZRWA 4BI5A 3GKAA 2VEIA 1EUNA 3TU9A 2TPSA 1T96A 4HN4A 1VYRA 2QCHA 2QCCA 4JDBA 1KFKA 3TQ0A 3N14A 4UXDA 1RQEA 4RK8A 2VFGA 3EWXA 1H51A 5K9DA 1ALDA 3P81A 1KLYA 1ML1A 1TPWA 3Q37A 1VLWA 4HSOA 5J5DA 3O63A 4XUGA 4Y90A 1VYSX 5AHMA 4KFOA 1XXXA 4R53A 5HNRA 2E5BA 3GR7A 3NO5A 4LVDA 2TSYA 1D3HA 3DENA 3UZ5A 4O53A 1F7BA 1L6WA 4CCEA 2ZZ5A 4CQAA 3G8RA 1W56A 3BO9A 3LLDA 5EMUA 2CW6A 1TB3A 3PS7A 5AFDA 3TR2A 5AC6A 1GVFA 3NQMA 3E12A 1I2OA 2QF7A 3NNTA 5D05A 2FLIA 1QNVA 4WY0A 4G1KA 4IMCA 3OVQA 1DKWA 5SWUA 4ORIA 5C5YA 1V7YA 5CPLA 4O11A 3CWNA 3H54A 4Z1AA 2Y89A 3FYPA 4KFNA 2BSLA 2G96A 1R2TA 7TIMA 2RDWA 4M5PA 4CQ8A 1YXDA 3HG5A 4CNNA 1XFBA 4ORMA 3L0KA 3L0GA 4NVTA 5LNSA 3P84A 4OHQA 5A5WA 3EWWA 1EB3A 5G1TA 2X1UA 2BX7A 2AQWA 2BLEA 3CWOX 2CZ5A 4DBDA 5HMSA 4DXVA 2ISVA 3UWZA 3W71A 4K38A 3HGJA 4O1DA 3DFNA 1G4SA 2GVLA 4MPQA 2ALDA 1H60A 2B7OA 5FF0A 3PY2A 4I7WA 3W74A 1W31A 3WJZA 5D04C 4XBSA 4UTLA 3W85A 2QJHA 2ZA3A 3IV3A 3O15A 2A6LA 4HT3A 4AHOA 5E0KA 3IVUA 4PL2A 4O1AA 3NQ8A 3W1NA 3W22A 3HBLA 1AK5A 4E2BA 2E77A 3P80A 3UYCA 3USBA 3NGJA 2JGQA 2WSYA 3LXBA 3RFAA 1O95A 5CSRA 4WUIA 1JRBA 3OHIA 1H7XA 3PUDA 4JY8A 2B7PA 1T0OA 2OX1A 4S1FA 1KFCA 2EKCA 1E51A 1SU5A 4JTKA 4JYDA 2ABBA 1UUOA 3LM7A 5DBUA 3G1HA 4H3DA 4MLJA 3W2LA 5K2ZA 1P1XA 3WFAA 1X8FA 3B4UA 1LCOA 1JCLA 1KM5A 3P67A 2G5WA 4UTJA 3FLUA 2E6AA 4K6AA 3CPRA 3T55A 3BVJA 4N2YA 3C52A 2C0AA 2E6FA 1OVDA 3HGOA 4NJJA 3DHDA 4C1LA 3NVTA 5TBOA 3S0CA 4O0ZA 2B0MA 2W6RA 1THFD 3PB0A 3EWUA 4DO5A 4A2RA 3MUXA 3MMTA 3EX2A 1QAPA 3NQCA 3HB9A 4RJEA 3TJXA 4O1BA 5DXYA 3M16A 3W1PA 4LUIA 5LNVA 3O06A 3G1SA 3DZ1A 2Y7DA 3QMSA 3GB6A 4KFPA 2JGYA 1WOAA 4FX8A 1AL7A 2TMDA 2VEMA 1WBJA 1X1OA 4JGDA 3GLCA 3C2OA 1MEHA 3LI0A 4LRSA 4IMEA 3W1RA 3RMJA 3HPSA 4O4VA 3WK0A 4Z0SA 1HO1A 2VFEA 2QKFA 4UNLA 3VE7A 1I2RA 4JTSA 1FWWA 2BWGA 4O14A 4LVGA 4FNQA 4RR4A 3BGGA 4AF0A 1F5ZA 2Y88A 3DXIA 3W7MA 2YW3A 3FYOA 2QAFA 2GPTA 3T44A 1PE1A 3PC0A 3GNNA 4PA8A 2EPHA 1ICQA 3GX9A 3O1NA 4UFMA 1Z44A 3LGEA 4O0KA 2B4GA 1K7XA 2A85A 4O12A 4IX0A 1TSIA 3RF9A 1ZAHA 1LYXA 3T7VA 4NJGA 3W2NA 3OG3A 3LCFA 5G4WA 1J5TA 1TQJA 3TSBA 1SSDA 5CZ0A 4GUGA 5KMYA 3W07A 3PBWA 1DHPA 2WNNA 1EPXA 4BFAA 2DZUA 4O52A 1FQ0A 1O94A 2XFWA 2V2HA 4UFIA 1LBMA 3GR8A 3UZJA 4DPQA 1LLZA 1W37A 3O07A 1Z48A 4RZ4A 5GVJA 3KVKA 2E6DA 1LBLA 1GYLA 1DJQA 4QSHA 4MZ1A 2E68A 4JTTA 1P4CA 2RDTA 4NZFA 4UTWC 3C2RA 4WY0B 3O8AA 2JK2A 4X2RA 1EEPA 4K7YA 1WXJA 3TA6A 1R46A 3A5FA 4FIRA 4DF2A 1M5WA 5F2MA 3W1AA 4OBTA 1IXOA 1CI1A 1N8FA 4A21A 4DF1A 2WSRA 5I3KA 1PL9A 1UASA 1YXCA 1BWLA 3NL5A 5CPNA 1QR7A 1Q6OA 1WA3A 3HMJG 1A5AA 4BWLA 1H1ZA 1WAUA 3P74A 3SZ8A 4AWSA 3EX1A 4N6FA 4IXHA 4ZQOA 4BI7A 4MZ8A 3HG4A 4OE7A 3NQ6A 4NXKA 1VJIA 3PF3A 3GAYA 1PHWA 2DORA 1IIHA 1EA0A 4UFLA 2A5HA 2LLEA 3LHZA 4L4LA 1LOQA 3G3MA 3Q94A 3UXDA 4FNRA 1X6UA 4DPPA 4OU1A 1XDLA 2FIQA 4OQVA 3G0SA 1GVRA 4O28A 3BGJA 2A4AA 5E1QA 1TJRA 3EXTA 3MHFA 4FB7A 2ZBTA 4CLMA 1DV7A 5FF4A 1QOPA 3HG3A 3NL2A 1XDMA 3GDKA 2CLFA 1KTBA 2QCGA 2Z0IA 2ZA2A 1K7FA 2V2CA 1FDYA 3W7CA 4ZL1A 2WPBA 3GDMA 4PFMA 5FESA 2RKXA 1N55A 1SZEA 3S5ZA 4GFSA 1K7EA 4W9TA 1XC4A 4O1CA 1ME8A 2E5CA 3RU6A 1IGSA 2FPTA 2CLLA 3JRKA 4XTDA 1W5NA 4FIQA 1GQNA 2EHHA 1FCQA 3MI2A 2VFFA 3G1VA 3LCWA 3PULA 2Z6JA 3FJLA 3LCXA 1IXQA 3W7LA 3QFEA 3L67A 2GJLA 3LCHA 1VPXA 1KV8A 3WK1A 1HO4A 3L5MA 3IIPA 3EX3A 3UWYA 2KZHA 1OJXA 2JKAA 1TV5A 5F2IA 2FFCA 5J5RA 1A5CA 2C18A 4Z08A 3TAKA 3HPZA 5F2GA 3W1TA 2C15A 4ZQRA 1RZMA 3MYPA 3R12A 3KX6A 5FEPA 1N7KA 4LU0A 5D33A 3D0CA 3LDVA 3BV4A 4LT9A 1IXPA 3W23A 3AO0A 3W7KA 4RZ6A 2VELA 4I7VA 3A5VA 2V9DA 2ZTKA 4AF0B 5F2LA 4JTJA 3GDRA 3KFTA 3N19B 1GJPA 3EB2A 3JS3A 2HS6A 2GUUA 5D2YA 1AG1O 4LS1A 3TH6A 3S5YA 1FX6A 3O6YX 2WKJA 4LVFA 3W7IA 4FNTA 2FQIA 1YDOA 4O17A 5G2WA 4JS3A 3U6WA 1DL3A 3UPBA 4JX6A 3QSTA 1HG3A 5L9FA 1TRIA 2CLKA 4LW7A 2WJZA 2PURA 1K8XA 1QO2A 3M1ZA 4FNPA 1GPWA 1AL8A 1DQWA 4PC8A 3LTPA 3LHYA 3W2MA 5ABTA 2WSQA 5AOUA 3LTYA 1OFQA 3W72A 3MBDA 4XKYB 4AHQA 4Z1BA 4O15A 5K4XA 1GVQA 5KZEA 4A29A 4K8HA 1YTEA 3ZWSA 1HL2A 3EX6A 1F73A 2X2GA 4Z1DA 1W5QA 2X30A 3E02A 2QDGA 4JXCA 2NUXA 1JUEA 5FEZA 1LRQA 4JTFA 3KRSA 5F4SA 4AVFA 2VENA 3STCA 1QWGA 4JIPA 4GWEA 5TIMA 1FXPA 1OYAA 5C55A 1FWSA 3W7JA 2JKEA 2G97A 3M9YA 4O13A 5DCEA 5H2ZA 2TYSA 3QEZA 5AB3A 1S5VA 3P8JA 1LDCA 3ABOA 2XN0A 3C2EA 3N2MA 5FEXA 2OT1A 1ICPA 2C1HA 4R33A 1JCXA 2QCDB 1LP6A 4NXSA 1G4PA 3UY8A 1VC4A 2I1OA 3M43A 4NU7A 1SQ7A 1PCKA 3MBFA 1I2QA 1SSGA 1XKYA 4WQ6A 4JTUA 3ELFA 3HF3A 3RNDA 1LBFA 2PE4A 3GAKA 3RK8A 3QJAA 1W5MA 4M6VA 4JTLA 3EXSA 5IBXA 3G0UA 1O60A 3I7RA 4MLRA 4JIQA 4BK9A 4FO4A 2YCEA 3P60A 2HSAA 1XUUA 1I8JA 1GG0A 3LV5A
chains in the Genus database with same CATH superfamily
2DDXA 1GQJA 3CEUA 2SFPA 3CZJA 1NEYA 4L80A 4B9YA 4RZBA 4QE4A 1TQXA 1UPPA 1UROA 4REQB 5LHEA 2GGIA 5HNUA 1FFQA 4WKFA 3NR0A 4ZTYA 3VTRA 5JBDA 1UC4A 3G77A 4JKLA 3ERPA 2IKIA 7REQB 3N3TA 5F4XA 3VK5A 3RR1A 2Z1BA 1PPIA 4C6CA 2POZA 3M0VA 3BMXA 4NAEA 5FJTA 2DIJA 2YW4A 2IUZA 3UP8A 4IUOA 2E9MA 4NAFB 4Z2HA 3UWQA 4AB4A 5D2TA 1V03A 1W1IE 1VFHA 1DJIA 2B7NA 3L4VA 2QCMA 3ARTA 2QVNA 3W86A 2W91A 4H7CA 1Q85A 2OMAA 3PZIA 4L64A 3E0IA 1LWIA 5D09A 1BFNA 3LRLA 4D72A 1R3TA 2IW0A 3IVSA 1EZ2A 4J3SA 1RPXA 2P1FA 3QOMA 4JTAA 4DLFA 4M82A 3QY7A 3PZVA 2C13A 1FHDA 1VFUA 5CSSA 3RMEA 3G8EA 2F8QA 1KFJA 1V8EA 2IKHA 1ZY9A 2OQLA 1BKSA 5I24A 3G1XA 4GNKB 1IR2A 1PXGA 1I45A 4PTXA 1GONA 1JJKA 3TC7A 3AUOA 4ERGA 2ZX8A 1XS2A 3SAZA 1U5JA 2F6XA 3IWPA 1W3HA 4C6IA 3LHVA 4DRSA 1OHLA 4O16A 4AH7A 1IEXA 2GWGA 3TTOA 2W67A 4Q7BA 3OJGA 1FP9A 1J2WA 2YA0A 4XD4A 3VPLA 3R2GA 3GWQA 3F4NA 4LB3A 1HL8A 2MUCA 3WJYA 3GNPA 4MAVA 1MMFA 1QPOA 3NL6A 4H8NA 1PDZA 1VB9A 1VRDA 1RJPA 3AXIA 4BCEA 2J9ZA 3C2VA 1GKQA 3NCOA 4NZ1A 1S3HA 2BODX 4N9CA 4YCPA 2IQDA 1GG1A 2YJQA 3B06A 2JF7A 1VLIA 4P5UA 4GGHA 4QIUA 3KDNA 1J18A 4ZOEA 1A0DA 3QW4B 3UWWA 2DSWA 3W1UA 5C7HA 4GHRA 2FZMA 3R13A 1O1ZA 2EG8A 4L9XA 4A05A 3QR1A 2PF0A 3AU2A 4E5TA 4S3KA 1B3OA 1K03A 1TWIA 3UY7A 4LYQA 5AHNA 4F2UA 3EAUA 2PGRA 3OB8A 3MCOA 4DELA 2O4MA 3GXPA 4US5A 1ADOA 3W7PA 1R8LA 4PBFA 2FFIA 3UXAA 3M5YA 1JZ7A 2XFYA 2Z1VA 1QK2A 1F05A 4AIOA 4A3HA 2WO5A 3MVTA 5EYWA 4AWTA 3S6OA 5REQB 1WPCA 3LCGA 2A0NA 3B9NA 2DUZA 3SUVA 2YPIA 3CJPA 3E49A 3M07A 2IQTA 3GG7A 4EK7A 2XHYA 2YDQA 5HK4A 4GX9A 4N0RA 3T40A 4HU4A 3WENA 1W2PA 1E0TA 2JBMA 2IKJA 1R3YA 2NW0A 3CHVA 1M7PA 4PCNA 5HUPA 4J3UA 4DWSB 2VFDA 4QG6A 2QPSA 1ZAIA 1EOMA 5HDRA 1XL9A 2HBVA 3UJRA 3O2LA 3REQA 2GVJA 3DERA 2HDJA 5JH2A 1I60A 3LX9A 5HQEA 4UNKA 3FFSA 1M01A 1Y5WA 1Z89A 2D73A 1XPGA 3T0TA 3UG5A 4UOZA 3DESA 5CPTA 2PRHA 4ALDA 2B31A 3GG8A 4QE1A 1NAL1 2WC3A 4YYCA 4LOCA 2BFGA 3WF3A 2Q6ZA 2KAUC 5EMYA 1UJQA 4JPGA 1XV8A 2X41A 4UMAA 3VD7A 3E2RA 1CDGA 4Q6XA 1W91A 1EHAA 2Z7GA 4Z2KA 4G7EB 4M1BA 1Z32X 2INZA 2NXGA 1EX5A 3DBPA 5HWNA 4AU0A 1PTDA 1OY0A 4GJJA 2WVSA 3QLLA 4UTMA 2I9UA 2J25A 4UTWA 3WLJA 3W01A 1KW1A 3CUIA 1X39A 1J0ZA 1MRQA 2FTPA 1ODZA 3IIOA 1OT2A 2DZXA 1CYGA 4H9ZA 4HYVA 3W38A 3TKFA 3AWOA 3VKBA 2ZRVA 1LUCA 1UKPA 3RX4A 3M5ZA 3CO8A 1Q3NA 3AIQA 2WHJA 1Q6GA 1J4EA 2EGZA 5HR7A 2DSZA 3V16A 2A3BA 1I1XA 1H7PA 4C7DA 3NFUA 5I77A 4Q8QA 2WJFA 2CBVA 2YA2A 5RUBA 1ZP3A 2Z00A 2IMRA 1XG3A 2EPOA 4X22A 2OOGA 3GC2A 2IPJA 2VGIA 1DQXA 5DN1A 2FMOA 3T4CA 5A6KA 3LBCA 1P0NA 3OBAA 1CT5A 1EF2A 1EF3A 1S5NA 2XWEA 2YCJA 3GC5A 3ZWTA 2XFRA 4RXFA 4UR7A 3UYIA 1NDYA 1XLJA 3L5AA 3C2YA 1EP2A 2X42A 3SFKA 4LALA 3P5YA 5LIXX 4P8XA 2OSXA 2I14A 3A24A 2VR5A 1OX4B 4WXZA 2VZSA 1UCWA 4DBEA 1TV3A 1YXYA 3WJWA 4MWAE 3N2OA 3HOJA 1M7OA 1REQA 4F8XA 2XN1A 4X63A 2VC7A 2WQDA 3W1XA 5I7GA 1E40A 1XKJA 3LLFA 1B57A 1H09A 4QJ1A 4QJ3B 1KTNA 4XSLA 1YMYA 1XI3A 3WH7A 1MSSA 5E5CA 1XLIA 3H4WA 3UGVA 4CNSA 1QNSA 4NX5A 1O5KA 3INPA 3UVIA 3ORWA 3UERA 3S1WA 3NQDA 4HZ7A 8RUCA 3N9RA 4HPXA 5A6BD 3CT7A 5A2CA 3WLOA 1L9WA 3TQKA 3M0MA 5CPQA 1AA1B 3LQGA 3WQEA 1W3TA 1BWVA 3TN3A 4ZB2A 1YBQA 4Y2WA 2C16A 3C0QA 2OPJA 3BPWA 3F5LA 3QV7A 2PBGA 1WDQA 1LORA 1KTCA 3CXOA 4NL1A 3EMQA 3NQVA 3TXVA 1LL4A 5FF3A 1JD9A 3AXMA 3BGAA 4FOJA 1A80A 2CLHA 4Z1CA 3AROA 4Q4QA 4KEMA 4AIBA 1B3VA 3GTNA 5I3GA 4NNCA 4EAMA 4KWVA 4EANA 3HGSA 3F1QA 3DI0A 3G24A 1XJBA 3UG4A 2OWWA 1HKIA 1DIEA 1XF0A 5CPOA 3T05A 2PBOA 1ONEA 2ZUTA 1F6PA 4KCTA 1G1YA 3QTPA 3QC3A 3QRHA 3TMQA 2QYGA 3LI1A 1K4HA 1FWAC 3BWWA 5H1WA 3C0JA 3TOPA 3K8LA 4AZCB 4MY1A 2V67A 2OB3A 4FNSA 4G2DA 4WDXA 4HCHA 1SJBA 4AMAA 1B9BA 3E1F1 3T0AA 4BF5A 3VIIA 1WCGA 1FUYA 4TX8A 1EGZA 4B92A 2ZUVA 3WLMA 3HPXA 3PUOA 1QNRA 4NJHA 3DFHA 3MDUA 3BLLA 3WD3A 3W29A 5AC4A 2O7SA 2WYSA 2WQPA 1DIKA 4RNHA 3RLVA 2GJXA 1VRXA 1DJNA 3W00A 2WWDA 1JEZA 4FR6A 3KAOA 5EMLA 4IT1A 1TE6A 2J7GA 5JUVA 5D2WA 4K8EA 4CQBA 1DVJA 4QCEA 1VH7A 3TROA 4OWGA 4F0MA 4WXYA 2BBFA 1NWTA 4JNMA 4V28A 1N82A 2WC7A 5CJ5A 2NWRA 2EPKX 4FXRA 4B91A 2P3ZA 4IX2A 3O6DA 1B30A 4I8DA 3BL3A 2VEKA 3QPYA 1DXEA 3VC6A 1VPYA 3SR7A 3VOCA 3W28A 2WCAA 2NQZA 2A3AA 1MEWA 3B03A 3ATYA 1TTJA 3I4EA 1KM4A 3M0IA 2XM1A 1XCWA 3MU7A 2VX7A 1A3XA 3RCMA 1VZWA 1CGVA 3W26A 3WJXA 4R88A 1G4TA 3THDA 1KBBA 2DT3A 4JOMA 1TA3B 2J79A 1YYAA 2DQWA 4IG2B 4AD3A 3S9YA 3LERA 3MO7A 2V0TA 3IUDA 1V4YA 3S6DA 3F03K 2EO7A 1EC7A 3BE7A 1PB0A 2ZZ4A 2XYLA 5C54A 1ZLPA 2X16A 1QPRA 2P10A 1PVNA 4XKMA 4B3ZA 3W6MA 1KRBC 2CHNA 3DFPA 1C8VA 3QQ0A 1UWTA 1TR9A 2DQXA 2ZDRA 1TKKA 4PUJA 1RPKA 3IIVA 1F3TA 4MUZA 3UXIA 3GM8A 4XISA 3KL3A 1Q6DA 1AQFA 4HKPA 1P5BA 1XWYA 2XG9A 4Z2JA 1G5AA 2D0HA 3AMGA 2ZXQA 1P7TA 1PO9A 1OK4A 2YYTA 2GDQA 5D2XA 5EA9A 5CC3A 4JX5A 4M24A 4J4KA 1A3WA 3EA3A 3LBMA 4PEEA 1E15A 1FVPA 3NQFA 1K9EA 5EBUA 4QEHA 1BGAA 4U3CA 2VUYA 4NZ4A 1F3EA 4NZJA 5H8PA 2E4TA 3KTCA 3QMTA 3HMCA 2Z4GA 3N04A 2F84A 4WVXA 4KWOA 1OADA 3OIHA 1HQTA 1VFMA 3F7JA 3ANUA 1C92A 3UJ2A 2BTMA 3CHEA 5FF7A 3WQ5A 5AYXA 2WHLA 2DZBA 1A5NC 1O4UA 1OFRA 5GNZA 5CLWA 1K6WA 2O4QA 4BWLC 1P0KA 4NAEB 3V18A 1KQZA 4F40A 3KVMA 4N9DA 2EF9A 1CECA 3SGUA 1P43A 3NO1A 3UW6A 1VFOA 1QI2A 2PF8A 1RA5A 4HNUA 4LRTA 4W84A 4XKYA 4Y9AA 3CLWA 1S2WA 5AYYA 3ARUA 2OKOA 1W1A1 3PB2A 1SW0A 1TPH1 5AY7A 2QF8A 2PTWA 3W7RA 3S47A 2VC9A 1K8YA 1YEYA 3MP5A 4YTQA 4IIDA 1HXJA 1IIGA 4RKAA 1EBGA 3FV9A 3LTSA 1GTHA 2NX9A 3B9AA 3NSNA 5FJIA 5BOOA 1OCBA 1NFGA 3PBMA 3HJZA 4RV3A 1A47A 1E0UA 5IM51 2E6YA 3S2CA 4F0RA 2I56A 1H7OA 3P6LA 5LKYA 3C3UA 3F4CA 4WY0F 1CXHA 1M03A 1RBAA 2ZC8A 1ZB5A 4UFJA 1UUMA 3WMLA 2G50A 1OZMA 1YADA 1OFBA 4R9XA 3ARQA 1EJWC 3TC3A 3NL3A 1UD6A 3LQLA 3OOQA 4O54A 1YPFA 1ZCOA 3N15A 4QLKA 5EB8A 1XD0A 1JRCA 3KVLA 3DX5A 4POCA 1W5OA 4WSKA 4Q32A 1ZJIA 1M6JA 4J2MA 1WV2A 3CLMA 3WSUA 1VP5A 1A5KC 3KRBA 1S3TC 1RY8A 4TMCA 4BQ5A 1W8SA 4W5UA 3UJFA 3PBYA 4KBXA 3W25A 4Y96A 1BXCA 3EDFA 3ECQA 5AN7A 3LK6A 2JEQA 1JDCA 3SCTA 1QI0A 3N3MA 4DJFC 2QR6A 2ZXAA 2O7QA 1T5AA 1XBVA 3NZ1A 5FKYA 1DORA 3T78A 2OT0A 4J40A 3WY1A 2FTWA 4QBXA 3EDKA 2ZICA 3QR0A 3OEXA 3MYOA 4JBRA 4JEJA 2PGFA 1UWQA 4RW5A 5HQLA 3E0WA 1JPKA 4GBUA 1R3SA 1XLMA 3URNA 4X3ZA 3OZYA 1C7TA 4EF9A 1A50A 3I3BA 2HVMA 1WXZA 1JCTA 4C6DA 1NDWA 3WK2A 4GXMA 2O9TA 1UZDA 2HEJA 3T08A 1RK5A 2GYIA 5ENLA 2E1DA 3EX4A 3M46A 4JKMA 3WBAA 3GK0A 3R7MA 5AYIA 2WOQA 3EPOA 3L9CA 3QGAC 4O0QA 2Y7EA 3LS9A 5A69A 2Y8KA 3I68A 1XX1A 4RZ5A 4MNKA 4JFWA 4ONVA 2PC4A 1QWKA 2ZQ0A 4JHOA 1VCGA 2NLIA 5DRIA 4FLSA 1EXBA 5DCDA 3REQB 2VDIA 1M9HA 1GZGA 3DYOA 1HP5A 3MUY1 2QUVA 1DXIA 4B5XA 3ONCA 3T2QA 3DFQA 1H63A 4HK7A 4DUVA 4G5DA 4FR1A 1V0KA 1R3WA 3DDMA 3L68A 2VZUA 3N17A 2HXTA 2Z6IA 3KOWA 3W1LA 3EZ4A 5XIMA 3TZNA 1JPMA 2QW5A 2ZRYA 4E0CA 4PTMA 3T8LA 4KKXA 3A9IA 2NQJA 1ZNNA 2QEZA 3KOFA 5C9RA 3VUSA 3R58A 2QVHA 2J88A 1BTCA 3S6TA 3VKDA 1LRTA 2PA6A 2ZCGA 4PE8A 3NAVA 4FI4A 5BMWA 2QIIA 3BANA 3GG0A 1UMLA 2V5KA 2FHBA 2V38A 4S3BA 2VEGA 4LBSA 4FXSA 3ABXA 3DYMA 3N2XA 1HKKA 1JQXA 1TREA 1IT8A 2OLHA 2ZZ1A 3LRKA 2Y7GA 4QNWA 4ZQMA 4I8YA 1TYGA 2Z1SA 1V3KA 4HSHA 4B5UA 1UWUA 3WBEA 1VYRA 3CIVA 5TAOA 1KFKA 3TQ0A 4UXDA 1Q63A 2DUAA 2XWDA 1LUCB 3EWXA 1ALDA 3KHDA 3ZJ8A 5FIPA 4YYFA 4H8VA 3Q37A 3UR5A 1VLWA 4HSOA 1PBGA 3FA4A 4UOQA 5J5DA 3Q65A 2HE8A 2IKGA 4CD5A 5AHMA 1VYSX 3N9KA 4ZSUA 4KFOA 3BH4A 2QNEA 1QBBA 3HQPA 2E5BA 3VD3A 3NDZA 4D6DA 3O9NA 4ZXOA 2GZXA 3UZ5A 3DENA 5FAGA 1K77A 4NI8A 3G8RA 4CQAA 5EMMA 3BO9A 5D9MA 5EMUA 3OW1A 2CW6A 4YN5A 1TB3A 3TR2A 1LT8A 1GW9A 1S1PA 1DWHM 1PZ2A 3U3HA 3FVDA 5D05A 1Q7QA 2FLIA 3MSRA 4G1KA 2WJEA 4IMCA 4ORIA 5C5YA 4D6FA 1TR1A 3JVAA 4Z1AA 1TWSA 4KFNA 4FMVA 4KRTA 1SMDA 3WDJA 2DZAA 3SDOA 2X7WA 1XRSA 3KCLA 5I2UA 5LXEA 3P84A 4OHQA 5A6AA 4KPLA 3WN6A 1REQB 2EPMX 2ISDA 1E1CA 3PNZA 2BX7A 1V3HA 1OT1A 1SJAA 2FGZA 4DXVA 1V51A 2ISVA 3IARA 3UWZA 3W71A 4K38A 1PKYA 1ZBVA 3DFNA 4O1DA 1G4SA 2GVLA 3FXYA 4F4RA 5DMNA 1MWOA 2YZ5A 3GFXA 3IK4A 3PY2A 1O12A 3PTQA 3W85A 5HANA 2QJHA 3IV3A 3O15A 4AHOA 1IZCA 5E0KA 3IVUA 5DX7A 3NQ8A 3BDKA 1X98A 3HBLA 1CENA 4XAZA 4HNLA 5H6HA 4YHEA 2HCVA 5C7VA 2J13A 3NGJA 2GL5A 3LXBA 3RFAA 1O95A 1MNZA 2F2KA 2ZXDA 5LA2A 1JFXA 2OX1A 3OGVA 2EKCA 1CGYA 2CHRA 2XGZA 4H3DA 4MLJA 1YBQB 3W2LA 2AMGA 2OQHA 1SR0A 1LCOA 3GIQA 2CZVA 4HCLA 3NURA 3VCCA 3P67A 2G5WA 2TAAA 3CPRA 3L4XA 1RCQA 3R79A 3BLOA 3T55A 3C52A 3CH0A 1QNQA 4URIA 1JDAA 3DHDA 5HPCA 1HL9A 2X8RA 3GHUA 1XLKA 2AQOA 2ISFA 1THFD 1ZGDA 3PB0A 1PZ1A 1HN1A 4RNJA 3VGBA 4DO5A 4A2RA 2XSXA 1XISA 4RJEA 3TJXA 5DXYA 3B40A 3M16A 3VIGA 3O06A 1J6OA 4KFPA 4PMUA 1WOAA 3AS1A 4D6HA 1W9DM 1WBJA 1X1OA 3DFYA 3L4YA 5FA5A 3U5YA 4ACYA 1MEHA 2Y5JA 1AH4A 4PUEA 4H6EA 1PTGA 1H2JA 5CZKA 1AD1A 3RMJA 3L4TA 5EMJA 4Z0SA 2HQAA 2QKFA 5FAJA 4Y8EA 1I2RA 3BLDA 1DQUA 1BVZA 1F5ZA 1XIIA 4AF0A 4ZFCA 4W86A 4DZAA 4LAKA 3W7MA 4WSHA 2QAFA 2GPTA 4PA8A 4DJED 4F48A 4QJ4B 1ICQA 3GX9A 1Q6EA 3WLQA 3ARVA 4LH8A 3OG2A 1KKOA 4FZIA 4IX0A 4I6KA 1IWBA 4QP0A 2UY5A 2XIMA 1GZ1A 3OHMB 4S3EA 1WZKA 1J5TA 2P0IA 1T8QA 4OJYA 3TSBA 5CZ0A 3SCOA 1XDJA 3SUWA 3TCSA 1UR1A 3O7UA 1GQLA 1NOFA 4MM1A 3UZJA 1XRVA 5ABGA 1XGDA 1HJSA 2I5GA 1Z48A 5GVJA 3KVKA 2E6DA 3V1HA 1GYLA 1P4CA 2RDTA 4NZFA 1UR0A 4KCVA 3VNLA 1R46A 2O9RA 4NF7A 4Q8PA 3VIMA 1CI1A 1N8FA 4A21A 3DECA 3WELA 3VX1A 2WSRA 5DT5A 1GOKA 1PL9A 1WKFA 1BWLA 3EBVA 1Q6OA 1WA3A 2QDDA 2VGFA 2BNJA 4BWLA 3N29A 1O68A 1XH0A 3MKVA 4N6FA 4HNOA 4KEUA 4BI7A 3HFTA 2PGEA 1XIJA 4OE7A 1VJIA 3U7VA 3UR8A 4C1NA 1IIHA 1TIWA 3L2LA 2Y5SA 3E3HA 2LLEA 3LHZA 4HVXA 3WL1A 1UIOA 3N25A 3Q94A 1UP0A 1XDLA 3U4AA 3G0SA 1GVRA 2PDIA 2XTKA 3EWDA 4X60A 4MKSA 5CCZA 2WC4A 4PRWA 4IQEA 4CLMA 3TTQA 1IZKA 5CBIA 4NRSA 5FF4A 3NL2A 2OWXA 4GO8A 4XV0A 5C0QA 2Z0IA 3QV6A 3V5CA 4JNYA 1S46A 4XD3A 4PFMA 1HVXA 1E6RA 4GA8A 1H5VA 3S5ZA 4GFSA 4Q4RA 5HMFA 4NSBA 4QEEA 1ME8A 2FPTA 3WEMA 3D47A 2PDUA 4PMRA 4EWJA 1GQNA 2CYGA 2EHHA 4B3KA 1QI3A 4TVCA 3FJLA 1GUVA 1IXQA 3LCXA 3R10A 4H6RA 2Z24A 3WK1A 1J0KA 3SUUA 2OYLA 1RD6A 2KZHA 3RITA 5HJYA 5FJRA 3E5BA 2BS9A 1A5CA 3JZEA 3BZGA 3K4AA 3URQA 4ZODA 1BF6A 4ZQRA 2O56A 3MYPA 3R12A 2VQTA 4HCDA 4W4QA 2JIEA 2AKMA 3E0LA 4HA4A 3CZEA 1ZJBA 3CAVA 2DSUA 4PSRA 3W7KA 4I7VA 4MB5A 4GQBA 2ZTKA 4KESA 4WLCA 4JTJA 5BXSA 3GDRA 3KFTA 4GVIA 4MB1A 1TV4A 4DJFA 3EB2A 3JS3A 4GJIA 5D2YA 4LS1A 4PTVA 4B4FA 2IPWA 4H8HA 1FX6A 1TVNA 4LVFA 4H9UA 3GVQA 4FXFA 1HGYA 1XLHA 4JS3A 2G3FA 4PB5A 1GJUA 3UPBA 3VNKA 4WHBA 4C5YA 1CBGA 3A4WA 1HJWA 2CLKA 3S2MA 4QDMA 2VC5A 4GYPC 4FNPA 5FJOA 1LL7A 3LHYA 3W2MA 5I02A 1E9IA 2BASA 5ABTA 4ATWA 4C6FA 4XKYB 4AHQA 4V27A 4Z1BA 4O15A 4DWSD 1GVQA 1UKQA 1VAHA 3M64A 4K8HA 3T07A 1YTEA 1HL2A 3V35A 1R7OA 2PDXA 4Z1DA 3U5UA 5IFTA 3LENA 1JAEA 3KRSA 4J1OA 2R1PA 2JIWA 1QWGA 1ZJAA 1NFPA 3P0XA 1QI5A 1NWUA 1W9BM 2JKEA 2PDQA 1E6XM 5H2ZA 3GFZA 3QEZA 3KS6A 5AB3A 1GOOA 3C2EA 3N2MA 4CKQA 2C1HA 4Z2IA 1CGWA 1VFTA 1G4PA 3BCJA 3F2DA 4LQ1A 1AMYA 2XJ7A 1VKFA 4CEUC 1XKYA 4OBSA 1OC7A 2P53A 1WKYA 2XFFA 2ZVRA 3HF3A 4H9XA 1LBFA 2VVNA 2JE8A 3GAKA 3UWEA 2RUSA 3RK8A 1OD8A 5XINA 4AC7C 3LPFA 1W5MA 3U2ZA 4GH1A 1WDRA 3G0UA 3I7RA 4HPGA 1V77A 1NFBA 3QXBA 2J74A 2OXNA 4H9YA 3AQUA 1LL6A 5LYRA 4C6BA 3BAWA 1BF2A 2CEQA 5FI8A 3B8VA 3EXRA 3MZNA 3GQYA 3GNXA 3KOXA 1Q8AA 2YX0A 2FZNA 1GOMA 2ZZ3A 3SJ3A 3YPIA 1W5PA 1WKDA 2Q71A 4XZ9A 1OABA 3H4GA 3BCDA 1BVWA 1RQBA 4CN1A 3WMCA 2VC6A 3VOFA 1HUVA 4WOQA 4TVDA 1W1ZA 1TV8A 2HNEA 5CPMA 2Q8LA 1FBAA 2OZ3A 2OKTA 3WLPA 1MRAA 2FZDA 1HTIA 4LWWA 2O55A 4PFHA 4DHGA 1NIUA 1YPIA 2GWNA 1WDDA 2ZRUA 1TPUA 3VDBA 2Z2AA 1F8MA 3FGCB 2I9EA 1OSEA 3F4DA 2C91A 3EOSA 3E2SA 2ZZ6A 4BEUA 3S2LA 4OGZA 2ZKMX 4DVOA 3EYPA 2CETA 1H7NA 3BCFA 3R8GA 3XISA 4JTRA 4L65A 1JUKA 3WUFA 4E2DA 4U2YA 3UG3A 2R82A 4DJDC 1R30A 3K30A 1ME7A 3OIXA 1PEZA 4PUDA 4E2OA 2WMIB 3RYSA 5FOOA 1M65A 4U31A 2A3CA 1K70A 2PS2A 3ZFHA 1F2JA 5TQLA 3EKLA 3PTDA 2ZFAA 1WKEA 2YCLA 2A1YA 3QKZA 5DBTA 2DJXA 4HJFA 4R5EA 3NPWA 3MCMA 1ZQ5A 1GYMA 3GH5A 4PCTA 1EP3A 3WCZA 3UZZA 2B7QA 4IPNB 1GORA 4JFSA 3WBYA 4W89A 1YDVA 3BG5A 2BHYA 3NZGA 3WDRA 4LF2A 1CGUA 4H8UA 5A8OA 1GWJA 3KUMA 3W7OA 4L1XA 3ZSTA 2WKLA 4UFKA 4XK2A 2INFA 2HRWA 3CAWA 2RHGA 1FCUA 3A47A 1TZZA 3MJYA 3CHCA 1C8QA 3K1DA 5HA7A 2W9MA 4QQ3A 3PZOA 1I2PA 3CZLA 2CLEA 5IFPA 4LCRA 3COTA 3VNMA 3MI6A 3Q58A 1J0HA 5GJMA 3NOYA 1EJSC 1LRNA 4GGBA 1ZRQA 4MGGA 2XVKA 1Y65A 3A4JA 5I78A 1G4EA 3SCRA 1D9EA 1O5XA 3H23A 4YCOA 5G2IA 3MT1A 3N73A 3U4FA 5D32A 1ZS2A 3T09A 4GG9A 4NUWA 2DT1A 1SFJA 3G1AA 3TTEA 1LOLA 3R1ZA 4MY9A 4ZB0A 3BOXA 1J6PA 1SW3A 3TFCA 1GCYA 4UCFA 4GPNA 5DRCA 2PZNA 4QS5A 3VAVA 2DP3A 1Y5XA 1EXPA 2HVNA 1NQKA 2Y24A 1KLZA 1NP2A 4DZIA 4XTIA 3STGA 4ZZ9A 2Z2BA 5FD0A 4HA1A 2AOSA 1WE5A 1VYPX 1GVSA 5FF2A 1WBHA 1A5UA 1W3JA 1XPYA 1JCNA 1U22A 1HKVA 3TQPA 3MHUA 2D2JA 4GKLA 4O57A 4XWUA 3CQHA 5GNXA 3UD6A 2Q02A 1J79A 2X2YA 1QFEA 4H1ZA 3WH5A 5CEWA 1BWKA 3N4EA 4JN6A 3KBSA 1BYAA 1EQCA 3AWNA 1QU4A 4PL1A 3SCUA 3TNBA 1GOIA 1F76A 4K39A 3S42A 1QASA 1JUBA 5EL1A 3KBWA 1MUCA 1OYBA 1UZ4A 5A8NA 4HQVA 4JX4A 1YTDA 2V5LA 4JTCA 4EVZA 1V02A 1K4GA 8XIAA 2ZUUA 3BARA 1PAMA 2FB3A 2FVLA 2C1IA 3GC4A 2CIPA 3SN1A 3CUGA 4JQAA 2FZBA 4R27A 4G7FA 3E2VA 1AW1A 3O6AA 1G69A 1XGEA 5A94A 1E1CB 5JBFA 1KFLA 3GBDA 4UTHA 1GVIA 2J66A 1BYBA 4HNNA 1UD4A 4FAMA 2Z1KA 4B15A 5BNKA 1TIMA 2FJKA 1RCOB 3VI2A 1NP0A 4U2ZA 3I6RA 1WOBA 1HKJA 1HVQA 1ZZMA 2RFGA 3K1GA 2YL9A 3TONA 1WX0A 4UQEA 3VFLA 4LUTA 3JUGA 2VXNA 1YDYA 4MB4A 2YDAA 1EIXA 5HNNA 1ITQA 2CU0A 2HMCA 3SSJA 3SY5A 3WDHA 5D30A 1AODA 3ZO9A 1DJYA 2HPMA 3O3RA 1US2A 1EH9A 3UF9A 2X1RA 2ZUWA 5D2VA 2QDEA 1XSJA 4KRZA 1IEVA 3P7YA 1FKWA 3UGRA 4IPLA 6PTDA 1UR2A 3WIJA 1OF6A 2HROA 4DM1A 2J7HA 2UZ9A 2NXHA 2Y6ZA 4HOZA 5T26A 3MSDA 5AHLA 5MKGA 3TYUA 2NT0A 3UG8A 1I75A 1PS9A 2BZNA 4PBEA 1KBLA 4ML9A 5KZ6A 4X0NA 3KP0A 5CXPA 1QTWA 4JQ1A 3MMDA 4WK9A 3APTA 4HJWA 4L6HA 2A3LA 5DXXA 2GVEA 4EKJA 3BUVA 3EB4A 3MV01 1BHGA 4ADUA 3M0HA 3W9ZA 4BHYA 2QV5A 1CXKA 1GVOA 5DEZA 5HJXA 1FKXA 2CXEA 2UY3A 2F2HA 1DWIM 1LTDA 5JIPA 4QXIA 4HPJA 3UNDA 3RPDA 1YLVA 2QZRA 4MYXA 1NM9A 3R5EA 1XLAA 4NNAA 5BWFA 2WMGA 1OCNA 1KB3A 2CXGA 2Q8ZA 4L6DA 3AALA 3GH7A 1Q6CA 3PPFA 2H3BA 1U83A 5CJNA 3VIOA 1XUZA 4D6CA 5U7SA 5MF5A 2HBXA 3TK7A 2J8TA 3PFRA 4BKNA 5C9XA 1KBIA 2DH3A 3PR2A 4LVAA 4XD6A 2CERA 3VXGA 1MVYA 3IJ6A 4ZCWA 4YWIA 3CQKA 3H8AA 3AIVA 1E4IA 1QOQA 2CC0A 3QFWA 1FWHC 5E0CA 4HA0A 3QYQA 1L2QA 2DFAA 3DFSA 4S38A 3ITGA 1XLGA 1KCXA 1VFSA 1ZL1A 4Q8MA 2XH7A 2OTDA 4YLWA 2OEMA 4DBUA 1FFRA 3KDOA 4JN8A 1NU5A 2QXWA 4GYPA 3LU2A 3WQOA 3OLGA 1CEOA 4LUSB 2F6KA 1L6GA 3U2EA 4P7QA 1BRLA 4C1NB 3SSZA 3J7HA 3HO8A 3MUZ1 3CU2A 3G3DA 4ZO9A 3M5XA 3QKEA 4IQLA 3APGA 1IXNA 4MY8A 1E56A 3TYBA 1KBJA 3OLIA 1BXBA 3WFZA 1NDVA 3CB3A 3BMWA 5PTDA 2YIHA 1W17A 4XSMA 3I3DA 1MEIA 4RLIA 3GZ3A 1SZRA 4ZQPA 4WR3A 2E7FA 2VZVA 1J01A 2ALRA 1H7RA 3CH9A 3FA3A 2G41A 1VJSA 5EKYA 1S5MA 3C86A 3H2AA 1I1WA 4BF7A 1MW3A 3PBVA 1UZ1A 2P3EA 2NX1A 4GC4A 3U7BA 4NNBA 1A4LA 3UXLA 4UR8A 3ZVIA 4JN7A 3PTKA 5DFAA 3WUGA 3NDYA 4LV9A 1LLWA 3CWHA 3DKLA 3VZYA 2D0FA 4IXXA 5I3JA 3B0UX 3S8HA 2ZZ2A 2Y7FA 4HD5A 1DPMA 2ACUA 1KXVA 4GUIA 2PLCA 4C91A 3IIZA 3CHFA 5EFFA 4HSNA 3PFMA 2QLYA 4QS6A 1LT7A 1LROA 3EEGA 4NQ1A 1W8GA 3GE7A 3DAQA 4TUFA 1EOKA 1X1NA 4KF1A 1W0MA 4DUWA 4LTSA 3VNYA 3QQ1A 4CD6A 4CQDA 1RQHA 3LOTA 3QM3A 1JAKA 2DT2A 3WO8A 3WF1A 3T81A 3MW7A 4M8UA 3MQTA 1KA9F 4F2BA 2DPEA 4US5D 2CZEA 4US6A 3AHYA 1FTXA 4DYEA 3U2OA 5DMLA 1G7UA 4BR1A 4MKVA 1TCDA 3DG6A 4GINA 5JVLA 1FH7A 4LYKA 2NQ5A 1SW7A 2CZFA 2EAWA 2QCFA 3A3XA 3TN4A 1B9ZA 4Q4KA 4IL2A 1EX1A 6CGTA 4PH6A 1JYXA 3THAA 3IRDA 3GDBA 4ICCX 3IGXA 4O8AA 3OU8A 4TR9A 1UP3A 1IWAA 1EGMA 4PTDA 3G1YA 3RM4A 3VMNA 1F6YA 3VIPA 1P6BA 4M81A 5HXMA 1E9YB 2PUZA 4DJDA 3BTNA 3M7WA 1RVGA 3SEPA 4W93A 2X1SA 1OFDA 3N12A 4KGJA 4LC6A 1MXGA 4DO6A 2P0OA 2CWNA 1H11A 4YHGA 1R47A 4UQAA 2YZRA 4JAWA 3LXAA 1JZ4A 2YFNA 3FA5A 1ESWA 2C79A 4F3HA 1IEWA 3C8NA 4H4IA 7ODCA 3QSRA 2BY3A 3NM1A 4K1WA 3KRZA 2WZTA 4TQTA 5CC6A 1B4KA 3H2EA 3WMSA 4YL2A 3KWSA 4HNCA 2PP1A 3NSMA 3LHUA 2W4XA 1DWJM 3D3FA 1OGBA 4CCZA 2QUUA 4ZMGA 1BPLB 4E8CA 1O7AA 5I3IA 1ECQA 2H9AB 2VCBA 1TMHA 2P76A 3EEZA 4EPBC 4KCWA 1IR1A 2QQ6A 2HK1A 3N6QA 2W79A 4S2CA 1K02A 3K8MA 3MMUA 4FX7A 1TJPA 3BJTA 3KBMA 4IPIA 4X61A 3HJEA 3GDTA 1VCFA 1I2NA 1JPHA 3B9DA 1I4NA 2CKRA 2X0YA 2OLAA 3C8FA 4ZQNA 4MTVA 1SR9A 1Z3NA 2BDQA 4L7ZA 2H6RA 1BTMA 3GNDA 1E5NA 3CIWA 2V81A 3BQ5A 3BW2A 1LG1A 4P7OA 3NQ7A 2POTA 5DANA 1JZ8A 3THQA 1R2RA 4F0LA 3TTSA 4GZJA 5JXQA 6ENLA 4AC1X 3C56A 2WM0A 3WH9A 4A8NA 3B9EA 1DWFM 2OO6A 1FDZA 1Z41A 3VDGA 1J12A 1W6TA 3ZSSA 1P6CA 1POKA 1GK8A 2HJPA 3WF2A 3THUA 3KVJA 5LA1A 3GIYA 4XB3A 2NUWA 4LBRA 3H2FA 3KHJA 4OUIA 1KC7A 1JGMA 3ARSA 5CGQA 1N8IA 3S1XA 3S5OA 3WQDA 4HPHA 4UQBA 4D6GA 4DQWA 1EWDA 4LB4A 1XSIA 1CLKA 3TA9A 3AMCA 4IMDA 2OZ0A 2Z2UA 3GIPA 4EF8A 1TJ1A 3RILA 1RH9A 2OELA 2NWSA 3VZXA 4PULA 3VNZA 5FACA 3AIEA 3S1VA 2QCDA 3NXLA 2YCLB 3NPVA 4QG8A 1UH3A 1EJXC 4MJ2A 4AEFA 2QMKA 3S1UA 3WBXA 2PDGA 4HP5A 4JY9A 2WVVB 4DLMA 2AAMA 3ZZ1A 2VKZG 4U28A 4ZEPA 3E96A 3A9BA 3L66A 2NZLA 1P0EA 2XVPA 1FP8A 3GNOA 2O92A 3CZ8A 5BYWA 1LM1A 5CBBA 1I0BA 2D1ZA 3T0BA 3L4WA 2GSJA 3ZT5A 1U5HA 3F2CA 2QJIA 2FB2A 3BMVA 1YPXA 4GFIA 1JNEA 4W7WA 4HN8A 1AJZA 3GUGA 3SW6A 3NZRA 1ITCA 1A5MC 1Y5VA 3KOZA 2J77A 3WNNA 4UIOA 1TZ7A 4PUNA 1GVEA 1HF6A 1U2YA 1YW1A 1H0IA 3AS2A 1J0YA 2C19A 4OZOA 1A0CA 1ISXA 1QCWA 3W3OA 4JHZA 3AJ7A 3WJSA 1SUXA 4W8LA 3RO8A 2X09A 3AS3A 5DQPA 4ZO6A 3OLDA 1OG0A 2OCZA 3PAJA 4HZ8A 3IS4A 3M0ZA 4MHBA 2EPNA 4YMZA 3E9AA 4YVXA 1V6VA 2DVXA 4GVGA 2GK1B 1H3GA 1VPQA 7ENLA 5LGXA 4GOAA 4JYFA 2E09A 1C8XA 1QW8A 5AHEA 3RX2A 1XINA 3ZVHA 3QF0A 4W5ZA 1Q45A 4QHRA 4EAYA 1OBAA 4H2HA 4YTTA 1BGGA 1EFZA 2PDYA 1SJDA 2C8NA 4IMFA 3HN3A 4C7GA 4F2TA 3GO2A 2QAPA 5K9XA 1H41A 2ZADA 3N13A 1EDQA 3UCDA 4CD8A 3FKRA 4MWAD 2VO5A 3H53A 2R8WA 4JFVA 2CITA 2REQA 2R1NA 1F74A 3QY6A 1S5WA 5CG7A 4JYEA 4NHVA 2WZEA 4MUPA 4AXKA 2GJRA 2JFEX 1K9TA 3N11A 5G5IA 2XSAA 5TF0A 4RUBA 3ABQA 6XIMA 2QUNA 3TVAA 5D03A 3I3EA 3ITCA 5E9XA 2VFHA 4C6KA 4TXEA 1Q8JA 5A8QA 1G01A 2FZ8A 3O05A 4B5VA 3TAOA 5IBXC 3CTLA 1TPFA 2PD5A 3TR9A 3LEPA 2WBKA 3UA3A 3I7QA 1FWBC 1KFBA 2YDRA 2ESCA 3MS8A 3TFXA 2G0WA 4UTKA 4PEKA 4ZQCA 4YPJA 3V4BA 4OV4A 4YIWA 5AYZA 4PMJA 2YBVA 3TX9A 3ALFA 2R94A 3VOIA 1ZU8A 4GACA 4EWND 4U4MA 3DI1A 1AJ0A 4F0KA 1C9DA 5LIWX 4IM4A 2ICSA 3P8IA 1ADDA 4RX0A 4DWSC 1V3MA 2ZRWA 3TN5A 1UR3M 2J7DA 4BI5A 3GKAA 1EUNA 4IFRA 3VYLA 1OQFA 1UWSA 4UB9A 3V0TA 1EJ7L 1Q2SA 3N14A 1NY1A 4RK8A 4ZOAA 5K9DA 3MJMA 3P81A 1TUXA 2WJDA 4KIRA 1TPWA 3OQ8A 3O63A 1J2BA 1ODUA 4XUGA 4NRRA 3P2VA 1PYMA 3QV9A 3WNKA 4ZO7A 5BXRA 3GR7A 3AU6A 1XYCA 1VBHA 1GNXA 4PZVA 1XP3A 3RCYA 2OEKA 3SADA 1R5YA 3MY9A 1FWGC 1W56A 2VI0A 3LLDA 2XZ9A 3MDWA 3BQ6A 1QNPA 5A6SA 3HU7A 3PS7A 4A8IA 3SN0A 3QBUA 1GVFA 2QF7A 5ABHA 4KMQA 5EMKA 5A6TC 3WQ8A 1EJUC 1V7YA 4X9YA 1A3HA 3FYYA 2W5FA 1U30A 5JU6A 2ZVIA 2G96A 2RDWA 4I5UA 3B9OA 5BU6A 1V08A 4CQ8A 2BVDA 1R9YA 1XFBA 1Q13A 1OGSA 3L0GA 4NVTA 3GG1A 3PJWA 4MSSA 3IUHA 5BZAA 7CGTA 4FK9A 3CWOX 2CZ5A 4DBDA 4KWUA 1U5VA 5HMSA 1IZJA 3T6CA 2G3MA 4IIFA 2D69A 3T8QA 4RNIA 5FSDC 3OGSA 2PDHA 2RAGA 4LY4A 4I7WA 2B81A 4XBSA 1PSCA 3GTXA 1B54A 4EPKA 5DO8A 3W1NA 3W22A 2E77A 1E4NA 4RL3A 4FSAA 2VL4A 3UYCA 1Z9AA 2Q09A 4HK6A 1UMYA 2EBNA 4M80A 2JGQA 1U1JA 2WSYA 3SCNA 4MADA 2ON3A 4JY8A 2B7PA 1T0OA 3QGKC 4S1FA 1KFCA 3PPGA 5E70A 3RM8A 3PZQA 2ABBA 1UUOA 5DBUA 3G1HA 1M53A 4J2PA 2OVLA 5LIYX 3SGGA 4H6QA 1XICA 1QNOA 1KM5A 3A13A 3DC8A 3FLUA 2E6AA 3RPMA 5CG0A 1N2VA 4S39A 4JKKA 3GXMA 4H00A 1J5SA 4ZOBA 3NVTA 2YL6A 5TBOA 3T2PA 4AUBA 3S0CA 1R9XA 4O0ZA 1RBLA 1MFUA 2J8FA 4AY1A 3MMTA 1UC5A 3EX2A 1BRLB 3DG7A 3HB9A 1DJZA 3FSUA 1DJGA 3W1PA 4L61A 4CEXC 3G1SA 4QFUA 2V69A 1FRBA 2ZE0A 3VGDA 5A2AA 3QN3A 3MSYA 2YL8A 3GU2A 1A49A 4LRSA 4I9MA 2HVOA 3ARYA 3HPSA 4O4VA 7XIMA 3BSGA 3BAKA 2XVLA 4UNLA 3P3BA 3VE7A 3VILA 2RGMA 1FWWA 4JTSA 2BWGA 4LVGA 4FNQA 4RR4A 3IJ8A 3DXIA 5KETA 1CLVA 2O0TA 2GUYA 1PE1A 8A3HA 2EPHA 1K9FA 4ACZA 4LEFA 4UFMA 3LGEA 2B4GA 4HYRA 2A85A 4O12A 3KWXA 3E6EA 3WLTA 4IQJA 3QGVA 1O1HA 3RF9A 4CQCA 4NJGA 5G4WA 5BWAA 4QG9A 3QTGA 4AD4A 4AFYA 4GUGA 5KMYA 3VU2A 4BFAA 1YHTA 3VO0A 4E3VA 1GOQA 4O52A 1O94A 2XFWA 1LBMA 2ZWYA 4QLJA 4AX6A 2J62A 4UQ9A 1ZCCA 4EPEC 4DPQA 3WD4A 1W37A 2XH0A 3GFYA 1DJQA 4QSHA 3C2RA 2OZTA 4WY0B 4X2RA 4IGNA 4K7YA 1WXJA 3TA6A 4FIRA 3AISA 4DF2A 4RE0A 3ARPA 1NOUA 4R7OA 1KGXA 3VGGA 4DF1A 1OC6A 1UASA 5M2FX 3H7RA 3NL5A 4Z17A 4UTFA 3EOEA 1WAUA 1KFWA 4B4HA 3UESA 1ZUAX 5B7YA 1LWHA 3NQ6A 2VX5A 4CN6A 4DM2A 2HE5A 4NXKA 3PF3A 4FF5A 3GAYA 1PHWA 1TWZA 2DORA 4UFLA 2VT0A 4DY1A 1RSCA 2VRQA 1X8CA 4L4LA 1LOQA 3G3MA 3EOLA 4PRRA 3RN6A 1X6UA 4OU1A 3AHXA 3T0DA 1CGTA 5E1QA 1TJRA 1J0IA 3EXTA 1T41A 1BVNP 3FW6A 1DV7A 1UD2A 1QOPA 3AUJA 3GDKA 1M7XA 2CLFA 1TVPA 3FSTA 1MDLA 1FA2A 3W7CA 3V5OA 4ZL1A 1TE1A 5FESA 5JQ9A 1N55A 3ZJKA 3ZXWA 1K7EA 2PB1A 1MZRA 7REQA 3QQWA 4QRNA 3EDDA 3MC5A 3AIRA 3R25A 4JL2A 2VFFA 3GHRA 3W7LA 1WB0A 2FDMA 2GJLA 1VPXA 2IS7A 3IIPA 4HMDA 5AECA 4B5SA 4Q4OA 3EX3A 1WZAA 4GQQA 4I9TA 3EB3A 1KR0A 4GIYA 4B2DD 1SMAA 4PCPA 3H2OA 3UETA 4OBRA 1JZ5A 1HJXA 4QTGA 3TAKA 1X6LA 3MUAA 3DUGA 4RPPA 3SUSA 3W1TA 1WP6A 3VDCA 3AYTA 3HZ3A 1O6IA 1N7KA 3D0CA 1ENUA 4G6CA 4LT9A 3FJ4A 4E6MA 5CC5A 3W23A 3AO0A 3ITLA 2PODA 1B5TA 3UA4A 3BJFA 2QHAA 5JBEA 3PHAA 4Z42C 3RLHA 3TH6A 3MZ2A 1EA9C 3O6YX 3TP4A 3W7IA 1WDSA 2OSWA 3U6WA 3BURA 1XH2A 1QW9A 1K8XA 1EC8A 4F0HA 1GPWA 2QV4A 2CNCA 9RUBA 3EPNA 4C6JA 3WH8A 1RP9A 2WSQA 4HMNA 5AOUA 1R87A 1RLCL 3RUBL 3W72A 1ZJHA 3SIMA 5K4XA 4R85A 4QQUA 1FH8A 2X30A 1TELA 3E02A 1C93A 3AAMA 1XC6A 2NUXA 3DHPA 3ZJ6A 3PK7A 1LRQA 1VBGA 1FWFC 3M4HA 2BY0A 4J3TA 4AVFA 2C1GA 3CAKA 2W3ZA 4JIPA 1FXPA 1OYAA 3W7JA 4J3VA 3WLKX 3M9YA 4O13A 4FA3A 4I5RA 1A5LC 3ABOA 2XN0A 2O9OA 4R33A 2W66A 3H6OA 1P48A 4D8LA 1JCXA 2QCDB 2WAGA 3PAOA 2WKGA 9CGTA 2OGYA 1E73M 3UY8A 1VC4A 2NSXA 2QJNA 3M43A 3LUTA 3ZYZA 4IPPA 3BOFA 4NU7A 4HHHA 3RRAA 4D1JA 4JTUA 3ELFA 4S3CA 2PE4A 3UFYA 3GHSA 4M6VA 5IBXA 1O60A 4JIQA 1KQYA 2NQ9A 4GLEA 2BHZA 1GG0A 3LV5A 1RXOB 3SCWA 3BK0A 1IQ8A 2ZX5A 2I5QA 3TWBA 1XLLA 2DZVA 3S5SA 1WNOA 4GQGA 5AZ1A 4H83A 4KH2A 4IIEA 1Q66A 1ZTVA 3MANA 1B3ZA 2VD8A 2Z26A 3GRIA 3KRUA 1XM3A 2UBPC 1KWKA 4DIAA 1Q6LA 3QHMA 4DWSA 1ZBCA 3H7UA 3NPXA 3CC1A 4RDZA 3AICA 3VE9A 1YTKA 3U8GA 4GNJA 1MQPA 3I7SA 4DNMA 2CHOA 2WNQA 3LV6A 4GXPA 3A23A 3GXNA 1L6SA 3TWAA 3N9SA 2D22A 3CYJA 4M7SA 2VDHA 1XIDA 2NQLA 4MJZA 3VGFA 2YDSA 4DXKA 4DB7A 1VFFA 3A21A 4LAZA 4QCFA 1MW0A 4AWUA 1XBZA 4NP7A 1ONRA 3ZVHB 1FWTA 4KEVA 4FPSA 4LAUA 4U5KA 3H26A 2BHUA 3ZR4A 3G18A 4BA0A 2PDFA 4V15A 5DY2A 4XIAA 3T9PA 3TJ4A 4GIRA 2V8ZA 5LGZA 3WD1A 4G56A 1ME9A 5I3FA 1C29A 4JFUA 3RCNA 3CZGA 1S2TA 4S23A 4ICNA 2Y8VA 1DE6A 5J04A 2QJJA 2VDGA 4KCUA 4D9PA 3VIJA 5FL0A 2ZX9A 2JKPA 1JPDX 3M7SA 2PTYA 3B05A 2X0HA 2VR4A 1UR8A 4K7VA 3C61A 5AC7A 2CLIA 4AZBA 1BEUA 2DW6A 1W1VA 3N6HA 4XZWA 1ELSA 4WDWA 1UD8A 3LLXA 5CJMA 3LSBA 1EL3A 1SFLA 3AXXA 4A3UA 2DV0A 1YX1A 4KEZA 1CX9A 3R8RA 3FY1A 1GZJA 2FTYA 3C5QA 3H24A 1TRDA 2CZDA 2YLLA 3IGHX 3R4IA 8TIMA 4J3XA 3GTIA 3LRMA 5BOEA 5EFDA 4MYAA 1RP8A 3TW7A 2Y70A 4KW2A 4IP7A 4GI4A 4NY2A 3ARWA 2XINA 4C6QA 3CO4A 4S3FA 1VF8A 1FWRA 5LZLA 4XZBA 1OX4A 2A6NA 2RJHA 4LGXA 1KD0A 3G0XA 1GT8A 3B8TA 1BXNA 3PBUA 1XYMA 3W82A 1TTQA 4AZIA 1NVMA 1MQQA 1BSLA 4HU0A 2E8ZA 4PYSA 2G4FA 3PTMA 4HNTA 1H49A 1JCYA 1F6KA 2G3NA 1SO5A 2XIIA 3G2GA 1CW2A 2BXVA 3ZT7A 1XRTA 2J4GA 3VIFA 1CCWB 4V1XA 4HZMA 3B8UA 1EBHA 3K4WA 3V36A 4P7LA 1MZHA 1XLCA 4C90A 4LANA 1E4MM 3D5HA 4EOUA 1V5XA 2EKGA 3P62A 2AMXA 4B5NA 1QPNA 1SFSA 1JDEA 1GEQA 3KZPA 3AIWA 4Q8WA 2VP8A 3OVRA 3LPGA 5BCAA 1PUDA 4D8ZA 2GQ3A 3DC0A 5AHIA 3M6YA 3CQJA 2NV2A 1TPVA 4Q33A 1IF2A 4FX6M 4IWWA 4LUJA 4NASA 3N6JA 3OYXA 3RU8X 3OO2A 1UPMB 3GVVA 1TV7A 3B0PA 3WQCA 4AZHA 4XAGA 2V68A 4DZHA 3RXZA 4NZ5A 3SI9A 2CLMA 4ZVJA 3HV9A 4PMXA 4RE4A 1GHRA 2DT0A 3UVAA 5KEZA 2RH9A 1G67A 1JNDA 1UKTA 2G95A 3BZJA 4BQ2A 3N4FA 3M0XA 5XIAA 3IGUA 3IJIA 2UY2A 5C71A 5EGRA 1ZHAA 5B7ZA 2WW5A 1R6WA 3L21A 4LS2A 3HTWA 3VDAA 3PSWA 2CWXA 4JHMA 1O66A 3BW4A 4V2XA 3WF4A 2WVUA 4M6QA 1RLDA 1TJ2A 3LSCA 3CUHA 4AD1A 5G4EA 3C4UA 3OGRA 1NELA 2Z28A 4RPQA 3FJ6A 3H2MA 3KEHA 3KBNA 4OTKA 3BG9A 3B04A 4A6GA 4QDPA 5U4NA 4IL0A 1W54A 4AZCA 4A2SA 1AH3A 4ILSA 1US0A 1DJWA 4CQ9A 3H70A 3C6CA 1S39A 4E38A 3C3NA 4LCQA 4M1RA 1E6ZA 1MUWA 1E4LA 3TOYA 2GUBA 1IEQA 1AH0A 2XIQA 2PFHA 2VRKA 3L5LA 1T40A 4HGXA 3RO6A 3W7GA 4IQDA 1DJHA 4TU1A 4AVOA 2NV9A 4XAYA 2BMBA 4H9VA 5HR6A 4JQ2A 1JI1A 5T9BG 1CPUA 4E4PA 4QISA 4ZOCA 3DFOA 1JCMP 3APYA 4XAFA 2DJLA 3LNMA 1OF8A 1BQCA 5LXXA 4C1KA 1PX8A 3UCQA 4CVUA 1UHVA 3STEA 5KINA 3B8WA 1S1RA 4MVAA 4YU1A 5E93A 4S2BA 4UQDA 1FHVA 4Y6GA 4N02A 1EO5A 3E38A 2F7FA 1QHOA 4MKNA 2C14A 4QDWA 2OOFA 3FHAA 1TPB1 4PUWA 4LUYA 3TNOA 3ABRA 5D37A 4QLLA 2NUYA 3S9IA 1CB2A 5M1TA 4H01A 4K36A 1KM3A 2OEJA 3ALGA 4MFDA 5FJUA 3GU1A 3ZJ7A 3EMCA 1EGVA 1UBPC 4DYJA 1LF1A 1RCXB 3DGBA 3NDOA 5E6YA 5HWMA 3TZFA 4IP5A 3GYEA 3WQGA 3D46A 4BI6A 3ABSA 3VM7A 3UWUA 3AHZA 1JFHA 4HNVA 4CD4A 3CZKA 4ZE5A 4AHPA 2MANA 2CLOA 3SRHA 3ZOAA 3WQ4A 5FSEC 4W87A 1TA3A 1LJYA 4HOWA 1VCVA 3G22A 1ZP4A 2I7GA 1XIMA 1E55A 3QZ6A 4I7UA 3GW3A 4IJRA 4MFEA 3FVMA 4ICMA 3A22A 2QUTA 2PZ0A 1J11A 3NUKA 1EJRC 2ACSA 4CNTA 5L6UA 3NJ3A 4ZA0A 3KL5A 4J35A 4GISA 3U9IA 2XZ7A 4AAJA 5E09A 4PSPA 4QAIA 3TJLA 4MWAC 3VA8A 3DHFA 2GDUA 4MDPA 3WD0A 2EPLX 1AD4A 1W3NA 2BVYA 3BLFA 4RCXA 5CKSA 1W9XA 3PG8A 4ASTA 4HTBA 3G6MA 3H4XA 2Q3RA 2QUMA 1UIPA 1YNQA 2X05A 4J27A 1R3VA 4DI8A 1FDJA 2BGQA 2J6XA 2PRMA 5I3HA 5K9CA 2DZPA 2Y63A 2H8XA 4HHPA 3M41A 2BXYA 3LB0A 5IXEA 3EOUA 4PUUA 2PGWA 3FS2A 3MB9A 3MA8A 2W27A 3LBOA 2I16A 2PPGA 1K8ZA 4IGHA 6TIMA 2UWFA 4Y9PA 3NPUA 3TC6A 2VOTA 4LBUA 1RV8A 2V3FA 3H7VA 3UCCA 4WDUA 2ISSA 3C0LA 4FEZA 4AY8A 1E0XA 1EKOA 5KZMA 5GJNA 1YNPA 1FWEC 1GOWA 4NZCA 4RV8A 5K7JA 3B0YA 4WGHA 4TO8A 1VBUA 4WGXA 1GYNA 1Y8BA 2VYOA 2YXGA 1MNSA 2WCSA 3NVDA 1X38A 2VX4A 3UR2A 4GYJA 1XBXA 2Y61A 3ID7A 3GBEA 3HGRA 5BROA 6XIAA 2P5NA 2V2DA 3HPFA 3QV8A 1R7AA 4JD4A 2DW7A 4IJBA 5G1MA 4R34A 1XR2A 1EEXA 1Q6RA 3ITVA 3NEVA 4WKAA 4LCSA 3AIBA 1FWIC 2VOMA 1A0EA 1TPC1 1G6CA 1CWYA 3W53A 5C9ZA 3QPZA 1NSJA 5C2XA 2E28A 4O4WA 3R43A 2WLYA 5AHFA 1JF6A 1OCQA 1T8XA 4PODA 1W2VA 1EJTC 4GIAA 4RXGA 2QIWA 3TW6A 1E1EA 4I90A 1E9ZB 3FDGA 4XBKA 4WOZA 2Y5EA 2VHLA 3URBA 3LHTA 4ERAA 4H7ZA 4DNHA 2ZIDA 4WCJA 7PTDA 2PLJA 1ITUA 4DBSA 2ZWZA 3QVQA 4M19A 1XIGA 3NIYA 3T1GA 1FH9A 1GVYA 1UG6A 3WMBA 3W24A 1OWQA 3TDFA 4KT2A 1YE6A 4IMAA 3D3AA 3RHGA 1KGWA 3S1GA 3ZS4A 1JDFA 1SPQA 3LCLA 5IRPA 1A5OC 1V0LA 3B3DA 2J47A 4O10A 2FKPA 4A3QA 1TV2A 4DBWA 1WYIA 4FLRA 5F1UA 1ZALA 1A5BA 5G4HC 4CCCA 5AYBA 5T91A 3BLPX 4UR9A 1E72M 2VNCA 4F0SA 4KRUA 4L4PA 1QATA 2ZE3A 4ZTXA 3L2IA 4N9EA 1KXTA 2PWFA 1UA7A 4WX2A 1AW2A 4A3YA 4O8RA 1OGGA 1UH2A 6A3HA 4TX6A 1JR1A 4L1WA 3W6LA 4DAFA 5E0FA 2J27A 2BP1A 2DVUA 1QK0A 1X1ZA 4QE5A 1DBTA 1GOXA 3O6CA 1EYEA 2YA1A 2YFOA 1AZ2A 4UMBA 1EC9A 4I5XA 3IJ9A 2HWGA 4CNPA 4OFCA 4GVHA 2EJAA 1QMLA 2GSEA 3KXQA 1XHGA 3W75A 3CAQA 3H55A 3W37A 5C2GA 3TN6A 3BLEA 1RA0A 4PMOA 3POCA 1XD1A 4S3AA 1SO3A 3ZQ9<