5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
b'ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
molecule tags Transcription
source organism Homo sapiens
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
2QI2A 5G4VC 2WALA 3ON1A 1YITF 3LWQC 3LWVC 3N4ZA 4X3LA 3CMEF 1XBIA 1QVFF 3CG6A 2QEXF 5DCVA 5FLXM 3WXMB 1VQ7F 2BO1A 3JAMM 3I55F 1H7MA 3RA6A 3OW2F 1VQOF 3G4SF 1DT9A 1GO0A 1RA4A 3CCEF 1VQ8F 1VQKF 1VQPF 1N8RH 5EWRA 3J7AR 3OBYA 1VQ6F 2KG4A 3CCMF 3PAFA 2OZBA 3MCAB 3RA5A 2VGNA 1QVGF 1T0KB 3FFMA 3CCUF 5IT9M 1KD1H 2KTUA 2OTLF 3N4YA 1Q81H 5A2QM 5G4UC 3O85A 3CCVF 1YIJF 3SIUA 3IR9A 3NK6A 3NK7A 4BW0B 5GIOC 1YJNF 3GYQA 3G71F 3LFOA 3HAXD 1GO1A 1YJ9F 1YJWF 3CC2F 4X3MA 1YHQF 2OTJF 1NJIH 1K9MH 5EO3A 3HJWC 1K73H 3CMAF 3JCMM 3J80M 3LWPC 1KC8H 1JJ2F 3CC7F 2FC3A 5GINC 1Q86H 2AIFA 1S72F 3CXCF 1W2BF 3CD6F 1VQNF 1W41A 1SDSA 1Q7YH 1Q82H 1X7PA 3J81M 1W40A 3CC4F 3I56F 1VQ9F 3LWOC 3NVKE 3CCQF 3NVIB 3PLAC 4TZZA 3VMFB 5GANK 2LBWA 1VQLF 2LBXA 1VQ4F 1VQ5F 1CN7A 3SIVA 1KQSF 2KTVA 5GAPK 1K8AH 3CPQA 2HVYD 1YI2F 3E1YA 5GIPC 1CK2A 1X52A 1M1KH 3CCJF 3CCLF 1ZWZA 2CZWA 3CCSF 3E20B 1W42A 1X7OA 4NUTA 1GZ0A 1E7KA 2ALEA 3OBWA 2OHWA 3G6EF 3AGKA 3LWRC 2JNBA 4BY9D 4LCKA 3CPWF 3V7EA 3CCRF 1IPAA 3NMUC 1VQMF 2QA4F 2I6DA 1NMUB 2VGMA 3V7QA 1W3EX 1PXWA 1M90H 4C4WC 5FJ4C 1RLGA 3VI6A
chains in the Genus database with same CATH superfamily
5MN4A 4LNUB 3LWVC 3D00A 1QVFF 3CG6A 4ZK7A 4BT6A 4C82A 3JAMM 1VQOF 1GO0A 2IQQA 2NMUA 3WPXA 2CSLA 1VQPF 5HY4A 4YJ3A 2UYJA 3F6MA 3OBYA 4M8IA 4BT4A 2KG4A 1QVGF 3KJKA 5J2UB 1U40A 2F9ZC 3FFMA 1T0KB 2KTUA 2OTLF 3JALA 3N4YA 3RYIA 3TD3A 5G4UC 3C9SA 4G4YA 4ZOLA 2ZODA 3CYQA 3IR9A 2BTUA 3HKCA 3M84A 1CLIA 5GIOC 1KNJA 1OAPA 2OTMA 4X1IB 2GLZA 3VCZA 3GYQA 2HX0A 5EB0A 4X1YB 4BT5A 1NJIH 1K9MH 1W59A 2YXZA 1SZQA 4I55A 5GONA 5HXUA 1VHAA 4G88A 5LYJB 3F0EA 1K73H 1QAHA 3J80M 3K2XA 3LWPC 3LYBA 3QUWA 3RYIB 4X1KA 3S06A 3HKDB 3K12A 2ZOVA 4O2BA 2MQEA 1FFXB 1SDSA 4FFBB 4ZHYB 4B5CA 2GVIA 4O2AA 3MDOA 2K1SA 2CWJA 3IEWA 3PLAC 4TZZA 2Z1UA 3VMFB 3P10A 3VYTC 2LBWA 2Q1YA 2LBXA 3RYFA 4O4HA 2R6R1 5HP8A 5KX5B 5HY2A 5IJ9A 3V3TA 3JASA 2CW4A 4G4ZA 4O4LA 2HS4A 4YJ2B 2RHJA 5KMGA 4EB6A 3CCJF 1ZWZA 2CZWA 1W42A 4O2AB 5AVMA 3VO8A 1RLUA 3CB2A 2ALEA 1W55A 2Z1FA 1ONIA 1QU9A 2JNBA 4BY9D 5HY0A 4LCKA 5CA0B 3S03A 3JATA 3WJQA 2L26A 2ZAUA 2P6YA 5LYJA 4I55B 1FNKA 3IKEA 4IHJA 4X20A 5GONB 2QA4F 1VQMF 1W5FA 1U3LA 3LDTA 3C9RA 5FJ4C 2QI2A 2RB9A 4E6EA 3ON1A 1W57A 3ZO8A 2H8CA 4F6RA 2QEXF 5DCVA 2I6RA 5CA1B 3OW2F 5JH7A 4C8EA 1DT9A 3JALB 1XV2A 3I3FA 4G4XA 2UYNA 3KIZA 1W581 2YYEA 1VQKF 2DT4A 1N8RH 3J7AR 2PHNA 5IYZB 3JATB 3CCMF 3PAFA 5CB4A 3MCAB 3RA5A 2VGNA 1ODEA 1FNJA 1TUBB 4I50B 1KD1H 1Q81H 3M1XA 4NWOB 3ELCA 3IEQA 5FNVB 1Z5VA 3CCVF 3SIUA 1OFUA 2ZF8A 3NK7A 4YJ3B 3MBMA 3QTYA 4I4TA 2GZLA 4G4WA 3JASB 5JVDB 4O4JA 3HJWC 3UT5B 3C9TA 1KC8H 3RYFB 4ZI7B 3RYCA 3CC7F 2FC3A 5GINC 1Q86H 1X25A 2V9YA 5EYPA 4TUYB 5LOVA 3CXCF 2H6LA 4TV8A 4BT2A 1W41A 5MN6A 4RHAA 3L7QA 1Q7YH 1FFXA 4O2BB 1H47A 3K14A 3VTIC 2HS3A 3JARB 1TVKA 3EORA 4IIJA 1H48A 2ZVZA 1CN7A 3HTNA 5BMVA 5LP6C 3S0HA 3N2KA 5ITZB 3VIUA 2CHSA 3E22B 2RHLA 5LXTA 2LCAA 3E1YA 4RQOA 1CK2A 4ZHWA 4B62A 3RYCB 3CYPB 3F0DA 1VH8A 4NUTA 2Z1TA 1JY8A 3HKCB 1E7KA 3N2GA 1IV3A 2HP3A 4U39A 3FD6A 3OBWA 1JFFB 3WGLA 3WJRA 3HKEA 1YGYA 4I4TB 1J7HA 3VYUC 5J2UA 3C9UA 3V7EA 3KHNA 3CCRF 4BT3A 2H8EA 2I6DA 4BVTA 3S02A 2FGYA 1M90H 4WBNB 4U3JA 1RLGA 5LP6B 3HKEB 4WBNA 3P0ZA 5G4VC 2Z01A 1YITF 3LWQC 2UYKA 4KWEA 3RE3A 5EAZA 2HS0A 5FLXM 2CVLA 3WXMB 2BO1A 1H7MA 1YQNA 3G4SF 3JAKA 4BT7A 2EWCA 5LXTB 5J2TB 3CCEF 3QHDA 5EWRA 1W5AA 5B8FA 4HNAA 1T0AA 1VK3A 3N2GB 5IJ0B 1VQ6F 4BVSA 2OZBA 1W5BA 1UI9A 2R751 3HKBB 3CCUF 1TVKB 1SA0A 3GTZA 1W5EA 5A2QM 1XRGA 3O85A 3Q8HA 3WGNA 5HXZA 1YIJF 4BW0B 4DRXA 5EB1B 2Z1EA 1YJNF 2W8BC 1XHOA 2VXYA 3JAWA 3R0PA 1FSZA 1GO1A 3GHZA 1YJ9F 4X3MA 2AMTA 4EI7A 1YHQF 3BYQA 1IV4A 2CHTA 4HNAB 2B33A 5EZYB 3JCMM 5JQGA 4EB6B 2ZVYA 2AIFA 4C8IA 3C8LA 1S72F 1W2BF 3CD6F 1PF5A 3HKBA 1Q8RA 3VOAA 1VQNF 3VOBA 4O4IA 3RYHA 3IMPA 3MQWA 1Q82H 1X7PA 3UT5A 5FNVA 3CC4F 3I56F 3S0WA 3LWOC 2LBTA 3NVKE 5JVDA 3V4DA 4B46A 3CCQF 2HRYA 2QTPA 3S0YA 1DBFA 1RQ7A 3VYSC 1VQ4F 3I7TA 5HP7A 3SIVA 5JCOC 5LA6B 1KQSF 2KTVA 5GAPK 1K8AH 2BTOA 2HVYD 1IV1A 2VAWA 2UYNB 1GX1A 4C81A 5GIPC 1TUBA 4I50A 4EI8A 1M1KH 4X1KB 3KJJA 1KNKA 3CCSF 1JFFA 3E20B 1X7OA 3LMEA 4F6RB 5IYZA 1U43A 1IV2A 3F0FA 3ZP7A 3G6EF 3LWRC 5HWEA 3P4EA 5ITZA 5MN5A 2AIZP 3CPWF 4X20B 5CA1A 5EZYA 1IPAA 4C8GA 1NMUB 3V7QA 1W3EX 5CA0A 1PXWA 2KGWA 4C4WC 3VI6A 3JARA 3FPIA 2RHHA 2WALA 3F0GA 2N48A 3IKFA 3N4ZA 4X3LA 3CMEF 2HP0B 1XBIA 4IHJB 3B6NA 2HP0A 3FBAA 2VAPA 4BVQA 4TUYA 2Q1XA 3I55F 1VQ7F 3RA6A 2IAFA 1NQ3A 4YJ2A 5EYPB 5LOVB 1RA4A 3JAWB 1JN1A 3M4SA 1VQ8F 4XCQA 2IG8A 4DRXB 2HRUA 2UZHA 4BVRA 3DDNA 5KMGB 1SA0B 5IT9M 4O4LB 4PWTA 3DC2A 4ZHQA 5EIBD 3HWUA 5KX5A 3NK6A 3T80A 4O4HB 3HKDA 5EIBC 3FD5A 2BTQB 2G9IA 3TD4A 3G71F 3ESJA 2UYPA 3LFOA 3WPWA 5J2TA 3HAXD 1U3PA 5C8YA 1YJWF 3CC2F 2OTJF 3ERNA 1UFYA 3JAKB 5LA6A 5EO3A 4DXDA 4FFBA 3CMAF 2VAMA 1Z5WA 5HY1A 1JJ2F 4X1YA 4TV9A 3WJPA 5LP6A 3K0TA 1JD1A 4U3JB 5JCOA 4X1IA 4B45A 5JH7B 4G4VA 4NQ3A 3WGMA 5CB4B 3ZP4A 4EI9A 4O4IB 3RYHB 3J81M 4ZHVA 1W40A 1VQ9F 3NVIB 3E22A 1QD9A 5GANK 1VQLF 5BMVB 5JQGB 1VQ5F 4ZOLB 4R40B 1VQVA 4IIJB 3CPQA 3D01A 1YI2F 2DYYA 3TD5A 1X52A 3U0OA 3CCLF 4TV9B 3N2KB 1GZ0A 1R1MA 1RQ2A 2PMPA 4ERHA 3MCQA 3OONA 3ZOPA 2OHWA 4LNUA 3WGJA 3JVHA 3AGKA 5C8YB 2RHOA 3D54A 4ZI7A 5IJ9B 5IJ0A 3NMUC 4O4JB 1COMA 3KE1A 2VGMA 4TV8B 4ZHQB 3WGKA 2HQSC
chains in the Genus database with same CATH topology
2QI2A 5G4VC 2WALA 3ON1A 1YITF 3LWQC 3LWVC 3N4ZA 4X3LA 3CMEF 3D00A 1XBIA 1QVFF 3CG6A 2QEXF 5DCVA 5FLXM 4BVQA 3WXMB 1VQ7F 2BO1A 3JAMM 3I55F 1H7MA 3RA6A 3OW2F 1VQOF 3G4SF 1DT9A 1GO0A 1RA4A 3CCEF 1VQ8F 1VQKF 1VQPF 1N8RH 4XCQA 5HY4A 5EWRA 3J7AR 3OBYA 1VQ6F 2KG4A 3CCMF 4BVSA 3PAFA 2OZBA 3MCAB 3RA5A 2VGNA 1QVGF 4BVRA 2F9ZC 3FFMA 3CCUF 1T0KB 5IT9M 1KD1H 2KTUA 2OTLF 3N4YA 1Q81H 5A2QM 5G4UC 3O85A 5HXZA 3CCVF 1YIJF 3SIUA 3IR9A 3NK6A 3NK7A 4BW0B 5GIOC 1YJNF 2GLZA 3GYQA 3G71F 3LFOA 3HAXD 1GO1A 1YJ9F 1YJWF 3CC2F 4X3MA 1YHQF 4EI7A 1NJIH 2OTJF 1K9MH 5EO3A 3HJWC 5HXUA 1K73H 3CMAF 3JCMM 3J80M 3LWPC 1KC8H 5HY1A 1JJ2F 3CC7F 2FC3A 5GINC 1Q86H 2AIFA 1S72F 3CXCF 1W2BF 3CD6F 1VQNF 4NQ3A 1W41A 1SDSA 4EI9A 1Q7YH 1Q82H 1X7PA 3J81M 1W40A 3CC4F 3I56F 1VQ9F 3LWOC 3NVKE 3CCQF 3NVIB 3PLAC 4TZZA 3VMFB 5GANK 2LBWA 1VQLF 2LBXA 1VQ4F 1VQ5F 1CN7A 3SIVA 5HY2A 3V3TA 1KQSF 2KTVA 5GAPK 1K8AH 3CPQA 2HVYD 1YI2F 3E1YA 5GIPC 1CK2A 4EI8A 1X52A 1M1KH 3CCJF 3CCLF 1ZWZA 2CZWA 3CCSF 3E20B 1W42A 1X7OA 4NUTA 1GZ0A 1E7KA 2ALEA 3OBWA 2OHWA 3G6EF 3AGKA 3LWRC 5HWEA 2JNBA 4BY9D 5HY0A 4LCKA 3CPWF 3V7EA 3CCRF 1IPAA 3NMUC 1VQMF 2QA4F 2I6DA 4BVTA 1NMUB 2VGMA 3V7QA 1W3EX 2FGYA 1PXWA 1M90H 4C4WC 5FJ4C 1RLGA 3VI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QI2 A;  5G4V C;  2WAL A;  3ON1 A;  1YIT F;  3LWQ C;  3LWV C;  3N4Z A;  4X3L A;  3CME F;  1XBI A;  1QVF F;  3CG6 A;  2QEX F;  5DCV A;  5FLX M;  3WXM B;  1VQ7 F;  2BO1 A;  3JAM M;  3I55 F;  1H7M A;  3RA6 A;  3OW2 F;  1VQO F;  3G4S F;  1DT9 A;  1GO0 A;  1RA4 A;  3CCE F;  1VQ8 F;  1VQK F;  1VQP F;  1N8R H;  5EWR A;  3J7A R;  3OBY A;  1VQ6 F;  2KG4 A;  3CCM F;  3PAF A;  2OZB A;  3MCA B;  3RA5 A;  2VGN A;  1QVG F;  1T0K B;  3FFM A;  3CCU F;  5IT9 M;  1KD1 H;  2KTU A;  2OTL F;  3N4Y A;  1Q81 H;  5A2Q M;  5G4U C;  3O85 A;  3CCV F;  1YIJ F;  3SIU A;  3IR9 A;  3NK6 A;  3NK7 A;  4BW0 B;  5GIO C;  1YJN F;  3GYQ A;  3G71 F;  3LFO A;  3HAX D;  1GO1 A;  1YJ9 F;  1YJW F;  3CC2 F;  4X3M A;  1YHQ F;  2OTJ F;  1NJI H;  1K9M H;  5EO3 A;  3HJW C;  1K73 H;  3CMA F;  3JCM M;  3J80 M;  3LWP C;  1KC8 H;  1JJ2 F;  3CC7 F;  2FC3 A;  5GIN C;  1Q86 H;  2AIF A;  1S72 F;  3CXC F;  1W2B F;  3CD6 F;  1VQN F;  1W41 A;  1SDS A;  1Q7Y H;  1Q82 H;  1X7P A;  3J81 M;  1W40 A;  3CC4 F;  3I56 F;  1VQ9 F;  3LWO C;  3NVK E;  3CCQ F;  3NVI B;  3PLA C;  4TZZ A;  3VMF B;  5GAN K;  2LBW A;  1VQL F;  2LBX A;  1VQ4 F;  1VQ5 F;  1CN7 A;  3SIV A;  1KQS F;  2KTV A;  5GAP K;  1K8A H;  3CPQ A;  2HVY D;  1YI2 F;  3E1Y A;  5GIP C;  1CK2 A;  1X52 A;  1M1K H;  3CCJ F;  3CCL F;  1ZWZ A;  2CZW A;  3CCS F;  3E20 B;  1W42 A;  1X7O A;  4NUT A;  1GZ0 A;  1E7K A;  2ALE A;  3OBW A;  2OHW A;  3G6E F;  3AGK A;  3LWR C;  2JNB A;  4BY9 D;  4LCK A;  3CPW F;  3V7E A;  3CCR F;  1IPA A;  3NMU C;  1VQM F;  2QA4 F;  2I6D A;  1NMU B;  2VGM A;  3V7Q A;  1W3E X;  1PXW A;  1M90 H;  4C4W C;  5FJ4 C;  1RLG A;  3VI6 A; 
#chains in the Genus database with same CATH topology
 5MN4 A;  4LNU B;  3LWV C;  3D00 A;  1QVF F;  3CG6 A;  4ZK7 A;  4BT6 A;  4C82 A;  3JAM M;  1VQO F;  1GO0 A;  2IQQ A;  2NMU A;  3WPX A;  2CSL A;  1VQP F;  5HY4 A;  4YJ3 A;  2UYJ A;  3F6M A;  3OBY A;  4M8I A;  4BT4 A;  2KG4 A;  1QVG F;  3KJK A;  5J2U B;  1U40 A;  2F9Z C;  3FFM A;  1T0K B;  2KTU A;  2OTL F;  3JAL A;  3N4Y A;  3RYI A;  3TD3 A;  5G4U C;  3C9S A;  4G4Y A;  4ZOL A;  2ZOD A;  3CYQ A;  3IR9 A;  2BTU A;  3HKC A;  3M84 A;  1CLI A;  5GIO C;  1KNJ A;  1OAP A;  2OTM A;  4X1I B;  2GLZ A;  3VCZ A;  3GYQ A;  2HX0 A;  5EB0 A;  4X1Y B;  4BT5 A;  1NJI H;  1K9M H;  1W59 A;  2YXZ A;  1SZQ A;  4I55 A;  5GON A;  5HXU A;  1VHA A;  4G88 A;  5LYJ B;  3F0E A;  1K73 H;  1QAH A;  3J80 M;  3K2X A;  3LWP C;  3LYB A;  3QUW A;  3RYI B;  4X1K A;  3S06 A;  3HKD B;  3K12 A;  2ZOV A;  4O2B A;  2MQE A;  1FFX B;  1SDS A;  4FFB B;  4ZHY B;  4B5C A;  2GVI A;  4O2A A;  3MDO A;  2K1S A;  2CWJ A;  3IEW A;  3PLA C;  4TZZ A;  2Z1U A;  3VMF B;  3P10 A;  3VYT C;  2LBW A;  2Q1Y A;  2LBX A;  3RYF A;  4O4H A;  2R6R 1;  5HP8 A;  5KX5 B;  5HY2 A;  5IJ9 A;  3V3T A;  3JAS A;  2CW4 A;  4G4Z A;  4O4L A;  2HS4 A;  4YJ2 B;  2RHJ A;  5KMG A;  4EB6 A;  3CCJ F;  1ZWZ A;  2CZW A;  1W42 A;  4O2A B;  5AVM A;  3VO8 A;  1RLU A;  3CB2 A;  2ALE A;  1W55 A;  2Z1F A;  1ONI A;  1QU9 A;  2JNB A;  4BY9 D;  5HY0 A;  4LCK A;  5CA0 B;  3S03 A;  3JAT A;  3WJQ A;  2L26 A;  2ZAU A;  2P6Y A;  5LYJ A;  4I55 B;  1FNK A;  3IKE A;  4IHJ A;  4X20 A;  5GON B;  2QA4 F;  1VQM F;  1W5F A;  1U3L A;  3LDT A;  3C9R A;  5FJ4 C;  2QI2 A;  2RB9 A;  4E6E A;  3ON1 A;  1W57 A;  3ZO8 A;  2H8C A;  4F6R A;  2QEX F;  5DCV A;  2I6R A;  5CA1 B;  3OW2 F;  5JH7 A;  4C8E A;  1DT9 A;  3JAL B;  1XV2 A;  3I3F A;  4G4X A;  2UYN A;  3KIZ A;  1W58 1;  2YYE A;  1VQK F;  2DT4 A;  1N8R H;  3J7A R;  2PHN A;  5IYZ B;  3JAT B;  3CCM F;  3PAF A;  5CB4 A;  3MCA B;  3RA5 A;  2VGN A;  1ODE A;  1FNJ A;  1TUB B;  4I50 B;  1KD1 H;  1Q81 H;  3M1X A;  4NWO B;  3ELC A;  3IEQ A;  5FNV B;  1Z5V A;  3CCV F;  3SIU A;  1OFU A;  2ZF8 A;  3NK7 A;  4YJ3 B;  3MBM A;  3QTY A;  4I4T A;  2GZL A;  4G4W A;  3JAS B;  5JVD B;  4O4J A;  3HJW C;  3UT5 B;  3C9T A;  1KC8 H;  3RYF B;  4ZI7 B;  3RYC A;  3CC7 F;  2FC3 A;  5GIN C;  1Q86 H;  1X25 A;  2V9Y A;  5EYP A;  4TUY B;  5LOV A;  3CXC F;  2H6L A;  4TV8 A;  4BT2 A;  1W41 A;  5MN6 A;  4RHA A;  3L7Q A;  1Q7Y H;  1FFX A;  4O2B B;  1H47 A;  3K14 A;  3VTI C;  2HS3 A;  3JAR B;  1TVK A;  3EOR A;  4IIJ A;  1H48 A;  2ZVZ A;  1CN7 A;  3HTN A;  5BMV A;  5LP6 C;  3S0H A;  3N2K A;  5ITZ B;  3VIU A;  2CHS A;  3E22 B;  2RHL A;  5LXT A;  2LCA A;  3E1Y A;  4RQO A;  1CK2 A;  4ZHW A;  4B62 A;  3RYC B;  3CYP B;  3F0D A;  1VH8 A;  4NUT A;  2Z1T A;  1JY8 A;  3HKC B;  1E7K A;  3N2G A;  1IV3 A;  2HP3 A;  4U39 A;  3FD6 A;  3OBW A;  1JFF B;  3WGL A;  3WJR A;  3HKE A;  1YGY A;  4I4T B;  1J7H A;  3VYU C;  5J2U A;  3C9U A;  3V7E A;  3KHN A;  3CCR F;  4BT3 A;  2H8E A;  2I6D A;  4BVT A;  3S02 A;  2FGY A;  1M90 H;  4WBN B;  4U3J A;  1RLG A;  5LP6 B;  3HKE B;  4WBN A;  3P0Z A;  5G4V C;  2Z01 A;  1YIT F;  3LWQ C;  2UYK A;  4KWE A;  3RE3 A;  5EAZ A;  2HS0 A;  5FLX M;  2CVL A;  3WXM B;  2BO1 A;  1H7M A;  1YQN A;  3G4S F;  3JAK A;  4BT7 A;  2EWC A;  5LXT B;  5J2T B;  3CCE F;  3QHD A;  5EWR A;  1W5A A;  5B8F A;  4HNA A;  1T0A A;  1VK3 A;  3N2G B;  5IJ0 B;  1VQ6 F;  4BVS A;  2OZB A;  1W5B A;  1UI9 A;  2R75 1;  3HKB B;  3CCU F;  1TVK B;  1SA0 A;  3GTZ A;  1W5E A;  5A2Q M;  1XRG A;  3O85 A;  3Q8H A;  3WGN A;  5HXZ A;  1YIJ F;  4BW0 B;  4DRX A;  5EB1 B;  2Z1E A;  1YJN F;  2W8B C;  1XHO A;  2VXY A;  3JAW A;  3R0P A;  1FSZ A;  1GO1 A;  3GHZ A;  1YJ9 F;  4X3M A;  2AMT A;  4EI7 A;  1YHQ F;  3BYQ A;  1IV4 A;  2CHT A;  4HNA B;  2B33 A;  5EZY B;  3JCM M;  5JQG A;  4EB6 B;  2ZVY A;  2AIF A;  4C8I A;  3C8L A;  1S72 F;  1W2B F;  3CD6 F;  1PF5 A;  3HKB A;  1Q8R A;  3VOA A;  1VQN F;  3VOB A;  4O4I A;  3RYH A;  3IMP A;  3MQW A;  1Q82 H;  1X7P A;  3UT5 A;  5FNV A;  3CC4 F;  3I56 F;  3S0W A;  3LWO C;  2LBT A;  3NVK E;  5JVD A;  3V4D A;  4B46 A;  3CCQ F;  2HRY A;  2QTP A;  3S0Y A;  1DBF A;  1RQ7 A;  3VYS C;  1VQ4 F;  3I7T A;  5HP7 A;  3SIV A;  5JCO C;  5LA6 B;  1KQS F;  2KTV A;  5GAP K;  1K8A H;  2BTO A;  2HVY D;  1IV1 A;  2VAW A;  2UYN B;  1GX1 A;  4C81 A;  5GIP C;  1TUB A;  4I50 A;  4EI8 A;  1M1K H;  4X1K B;  3KJJ A;  1KNK A;  3CCS F;  1JFF A;  3E20 B;  1X7O A;  3LME A;  4F6R B;  5IYZ A;  1U43 A;  1IV2 A;  3F0F A;  3ZP7 A;  3G6E F;  3LWR C;  5HWE A;  3P4E A;  5ITZ A;  5MN5 A;  2AIZ P;  3CPW F;  4X20 B;  5CA1 A;  5EZY A;  1IPA A;  4C8G A;  1NMU B;  3V7Q A;  1W3E X;  5CA0 A;  1PXW A;  2KGW A;  4C4W C;  3VI6 A;  3JAR A;  3FPI A;  2RHH A;  2WAL A;  3F0G A;  2N48 A;  3IKF A;  3N4Z A;  4X3L A;  3CME F;  2HP0 B;  1XBI A;  4IHJ B;  3B6N A;  2HP0 A;  3FBA A;  2VAP A;  4BVQ A;  4TUY A;  2Q1X A;  3I55 F;  1VQ7 F;  3RA6 A;  2IAF A;  1NQ3 A;  4YJ2 A;  5EYP B;  5LOV B;  1RA4 A;  3JAW B;  1JN1 A;  3M4S A;  1VQ8 F;  4XCQ A;  2IG8 A;  4DRX B;  2HRU A;  2UZH A;  4BVR A;  3DDN A;  5KMG B;  1SA0 B;  5IT9 M;  4O4L B;  4PWT A;  3DC2 A;  4ZHQ A;  5EIB D;  3HWU A;  5KX5 A;  3NK6 A;  3T80 A;  4O4H B;  3HKD A;  5EIB C;  3FD5 A;  2BTQ B;  2G9I A;  3TD4 A;  3G71 F;  3ESJ A;  2UYP A;  3LFO A;  3WPW A;  5J2T A;  3HAX D;  1U3P A;  5C8Y A;  1YJW F;  3CC2 F;  2OTJ F;  3ERN A;  1UFY A;  3JAK B;  5LA6 A;  5EO3 A;  4DXD A;  4FFB A;  3CMA F;  2VAM A;  1Z5W A;  5HY1 A;  1JJ2 F;  4X1Y A;  4TV9 A;  3WJP A;  5LP6 A;  3K0T A;  1JD1 A;  4U3J B;  5JCO A;  4X1I A;  4B45 A;  5JH7 B;  4G4V A;  4NQ3 A;  3WGM A;  5CB4 B;  3ZP4 A;  4EI9 A;  4O4I B;  3RYH B;  3J81 M;  4ZHV A;  1W40 A;  1VQ9 F;  3NVI B;  3E22 A;  1QD9 A;  5GAN K;  1VQL F;  5BMV B;  5JQG B;  1VQ5 F;  4ZOL B;  4R40 B;  1VQV A;  4IIJ B;  3CPQ A;  3D01 A;  1YI2 F;  2DYY A;  3TD5 A;  1X52 A;  3U0O A;  3CCL F;  4TV9 B;  3N2K B;  1GZ0 A;  1R1M A;  1RQ2 A;  2PMP A;  4ERH A;  3MCQ A;  3OON A;  3ZOP A;  2OHW A;  4LNU A;  3WGJ A;  3JVH A;  3AGK A;  5C8Y B;  2RHO A;  3D54 A;  4ZI7 A;  5IJ9 B;  5IJ0 A;  3NMU C;  4O4J B;  1COM A;  3KE1 A;  2VGM A;  4TV8 B;  4ZHQ B;  3WGK A;  2HQS C; 
#chains in the Genus database with same CATH homology
 2QI2 A;  5G4V C;  2WAL A;  3ON1 A;  1YIT F;  3LWQ C;  3LWV C;  3N4Z A;  4X3L A;  3CME F;  3D00 A;  1XBI A;  1QVF F;  3CG6 A;  2QEX F;  5DCV A;  5FLX M;  4BVQ A;  3WXM B;  1VQ7 F;  2BO1 A;  3JAM M;  3I55 F;  1H7M A;  3RA6 A;  3OW2 F;  1VQO F;  3G4S F;  1DT9 A;  1GO0 A;  1RA4 A;  3CCE F;  1VQ8 F;  1VQK F;  1VQP F;  1N8R H;  4XCQ A;  5HY4 A;  5EWR A;  3J7A R;  3OBY A;  1VQ6 F;  2KG4 A;  3CCM F;  4BVS A;  3PAF A;  2OZB A;  3MCA B;  3RA5 A;  2VGN A;  1QVG F;  4BVR A;  2F9Z C;  3FFM A;  3CCU F;  1T0K B;  5IT9 M;  1KD1 H;  2KTU A;  2OTL F;  3N4Y A;  1Q81 H;  5A2Q M;  5G4U C;  3O85 A;  5HXZ A;  3CCV F;  1YIJ F;  3SIU A;  3IR9 A;  3NK6 A;  3NK7 A;  4BW0 B;  5GIO C;  1YJN F;  2GLZ A;  3GYQ A;  3G71 F;  3LFO A;  3HAX D;  1GO1 A;  1YJ9 F;  1YJW F;  3CC2 F;  4X3M A;  1YHQ F;  4EI7 A;  1NJI H;  2OTJ F;  1K9M H;  5EO3 A;  3HJW C;  5HXU A;  1K73 H;  3CMA F;  3JCM M;  3J80 M;  3LWP C;  1KC8 H;  5HY1 A;  1JJ2 F;  3CC7 F;  2FC3 A;  5GIN C;  1Q86 H;  2AIF A;  1S72 F;  3CXC F;  1W2B F;  3CD6 F;  1VQN F;  4NQ3 A;  1W41 A;  1SDS A;  4EI9 A;  1Q7Y H;  1Q82 H;  1X7P A;  3J81 M;  1W40 A;  3CC4 F;  3I56 F;  1VQ9 F;  3LWO C;  3NVK E;  3CCQ F;  3NVI B;  3PLA C;  4TZZ A;  3VMF B;  5GAN K;  2LBW A;  1VQL F;  2LBX A;  1VQ4 F;  1VQ5 F;  1CN7 A;  3SIV A;  5HY2 A;  3V3T A;  1KQS F;  2KTV A;  5GAP K;  1K8A H;  3CPQ A;  2HVY D;  1YI2 F;  3E1Y A;  5GIP C;  1CK2 A;  4EI8 A;  1X52 A;  1M1K H;  3CCJ F;  3CCL F;  1ZWZ A;  2CZW A;  3CCS F;  3E20 B;  1W42 A;  1X7O A;  4NUT A;  1GZ0 A;  1E7K A;  2ALE A;  3OBW A;  2OHW A;  3G6E F;  3AGK A;  3LWR C;  5HWE A;  2JNB A;  4BY9 D;  5HY0 A;  4LCK A;  3CPW F;  3V7E A;  3CCR F;  1IPA A;  3NMU C;  1VQM F;  2QA4 F;  2I6D A;  4BVT A;  1NMU B;  2VGM A;  3V7Q A;  1W3E X;  2FGY A;  1PXW A;  1M90 H;  4C4W C;  5FJ4 C;  1RLG A;  3VI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...