5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
3IR9A 1H7MA 2LBXA 1M90H 2JNBA 5GAPK 3JCMM 3LWPC 5GIPC 1VQNF 5FLXM 2QEXF 1GO1A 1E7KA 1X7PA 3J81M 1T0KB 3GYQA 3CCJF 1N8RH 2VGNA 2VGMA 3PAFA 3RA5A 3LWOC 3CMAF 2KTVA 3LWQC 5IT9M 1VQ5F 1W3EX 3AGKA 3PLAC 1VQPF 5GANK 3MCAB 3CCMF 1YITF 3G4SF 1VQMF 3CXCF 2KG4A 5FJ4C 1VQ9F 2QA4F 4X3MA 1VQ7F 2HVYD 2OTJF 3OBYA 3SIUA 1VQKF 1VQOF 1JJ2F 1DT9A 1CK2A 1QVFF 3FFMA 1YIJF 1PXWA 3N4ZA 3CCUF 3CCRF 1W42A 1X52A 3G6EF 5DCVA 3NVKE 2OTLF 3CMEF 3ON1A 4X3LA 3CPWF 1KC8H 3NMUC 3J80M 1YI2F 1Q81H 2CZWA 5A2QM 4LCKA 3N4YA 2QI2A 3E20B 5EO3A 1W2BF 3CD6F 3CC4F 1YJWF 3HJWC 1X7OA 3NK7A 3E1YA 2ALEA 5GIOC 1XBIA 2KTUA 4NUTA 1IPAA 3CCQF 1K9MH 1K73H 3OW2F 1GZ0A 5EWRA 1YJ9F 3CCSF 3CCLF 1GO0A 1KQSF 3O85A 4BW0B 2BO1A 2FC3A 5G4UC 5GINC 3CC2F 1RA4A 1W41A 3I56F 2I6DA 2OZBA 1NJIH 3CCVF 1VQ6F 1Q7YH 1VQLF 3VI6A 4TZZA 1ZWZA 3SIVA 5G4VC 1VQ4F 3CCEF 1K8AH 3J7AR 1KD1H 1Q82H 3V7EA 4BY9D 1RLGA 3NK6A 1CN7A 1W40A 3CC7F 3I55F 1QVGF 1VQ8F 3NVIB 1M1KH 2AIFA 3OBWA 3VMFB 2OHWA 4C4WC 3V7QA 3RA6A 3JAMM 2LBWA 3LFOA 1YJNF 3CPQA 1YHQF 3LWRC 1SDSA 3HAXD 1NMUB 2WALA 3G71F 3LWVC 3CG6A 3WXMB 1Q86H 1S72F
chains in the Genus database with same CATH superfamily
4ZI7A 4I50B 1ODEA 3RYHB 3KHNA 3JCMM 3RYCB 4X1KB 5GIPC 3BYQA 1E7KA 4O4JB 3CCJF 1TUBB 3RA5A 3WGJA 3CMAF 3JALB 3RYIB 3S02A 5IT9M 4O2BB 3AGKA 1QD9A 4C81A 2IG8A 3G4SF 1VQMF 1W5BA 1OFUA 4ZHQB 2QA4F 3HKDA 1H47A 1VQVA 2OTJF 5HWEA 3F0FA 2DT4A 1OAPA 5IYZA 3RYCA 1QVFF 4X1IA 4G4XA 5LYJB 4FFBB 3CCRF 4TV8B 2F9ZC 3NVKE 3CMEF 3IMPA 3NMUC 4LNUA 1Q81H 4YJ3A 4LCKA 4HNAB 1W5EA 4O2BA 1W2BF 1JFFA 1YJWF 4IIJB 4ZHQA 5MN6A 2CSLA 1K9MH 4G4VA 1DBFA 1GZ0A 4I4TB 4BVQA 5KMGA 3CCLF 2VXYA 3MBMA 3O85A 5EZYA 4TV9A 2FC3A 3WPWA 2ZVYA 1IV2A 2R751 1SZQA 3CC2F 2HRYA 2I6DA 3N2GA 4C8IA 3FPIA 2OZBA 5BMVB 2H6LA 3V3TA 2GZLA 3CCVF 1NJIH 1NQ3A 3I3FA 3JARA 4TZZA 3CYPB 2R6R1 4NQ3A 3RYFA 2HP0A 5EYPB 1Q82H 2RB9A 5AVMA 3S06A 4U3JB 1RLGA 2DYYA 2G9IA 1QVGF 4XCQA 4G4ZA 5IJ9B 3VMFB 1ONIA 3WJQA 2VAMA 4EI8A 5KX5B 5JH7A 5J2TA 2MQEA 4O4IA 2YYEA 3HAXD 2BTQB 3JATA 1YGYA 5JCOA 1UFYA 2YXZA 2Z1TA 4BVSA 4ZI7B 3JARB 1YIJF 3WXMB 1S72F 3IR9A 2HP3A 1H7MA 2LBXA 3C9SA 4DRXA 1M90H 3JASA 5LP6A 1SA0B 3LWPC 2I6RA 5CA1A 1X7PA 3LYBA 3J81M 5LXTA 2HQSC 5HP8A 3PAFA 1JD1A 3S0HA 3VCZA 3WGLA 4G4WA 4YJ2B 5LA6B 3PLAC 1VQPF 5GANK 3E22B 2LCAA 5HY2A 2VAWA 3FD5A 3IKFA 3CXCF 3V4DA 3S0YA 3D00A 3JAKB 4ZK7A 3OBYA 3RYHA 3SIUA 1VQKF 3K0TA 1W5FA 3QHDA 5EB1B 4WBNA 4R40B 2RHHA 2CHSA 1JY8A 2Q1YA 5LP6B 1CK2A 1SA0A 5CA1B 1PXWA 3C8LA 3MDOA 3S03A 1VH8A 3VOBA 3FBAA 4O4LB 5DCVA 1J7HA 4C8EA 4KWEA 4X3LA 2KGWA 5GONA 4HNAA 1YI2F 3C9RA 3Q8HA 3ESJA 3GTZA 2Z1FA 3N4YA 2QI2A 2AIZP 5EO3A 1U43A 3E22A 2L26A 3C9UA 4X1YB 1X7OA 3NK7A 5GIOC 2KTUA 3JAKA 1IPAA 5LP6C 1K73H 3S0WA 4WBNB 4M8IA 3OW2F 4RHAA 3P4EA 5IJ0A 1UI9A 4X20B 3K12A 2UYJA 5FNVA 4BW0B 2BO1A 3TD4A 4BT3A 5G4UC 3N2GB 4E6EA 4O4LA 4BT4A 2Q1XA 1TVKB 2PMPA 3C9TA 1RA4A 4YJ3B 3DDNA 2OTMA 2GVIA 4ZHWA 3RE3A 1VQLF 5LOVB 1JN1A 3IKEA 4C82A 3SIVA 2HP0B 5G4VC 5CB4A 3N2KA 3R0PA 1RQ7A 5EIBD 5KMGB 4O4HA 4BY9D 3KE1A 5IJ9A 3CC7F 1FFXA 3I55F 4TUYA 4IHJA 1U3LA 5HY4A 5EAZA 1PF5A 1QAHA 5LYJA 4EB6B 4C4WC 5MN5A 3V7QA 3JAMM 3LFOA 1SDSA 1GX1A 1Z5WA 3VTIC 5LOVA 4BVTA 1VK3A 5B8FA 5GAPK 1U3PA 5HP7A 1H48A 2H8EA 5FLXM 1T0KB 1N8RH 1KNKA 3F0DA 4BT5A 2VGNA 3WJPA 4EI9A 2RHOA 2Z01A 1XV2A 1X25A 1W5AA 3FD6A 3I7TA 1VQ5F 1W3EX 3HKBA 3JAWB 3VYUC 3CCMF 1YITF 5HXUA 2UYNA 1U40A 5BMVA 5FJ4C 1VQ9F 5J2UB 1R1MA 2CW4A 2Z1UA 3ELCA 3VOAA 1VQ7F 1IV4A 2HS0A 2PHNA 3WJRA 5JCOC 3M1XA 5ITZB 3N4ZA 2HRUA 2ZODA 2CHTA 5GONB 3WGNA 5LXTB 1W42A 3CCUF 2HS4A 5EB0A 4NWOB 3ON1A 5CA0A 3CPWF 4C8GA 2BTUA 3WPXA 1KC8H 2IQQA 4ZHYB 2RHJA 2CZWA 4B62A 5A2QM 4ZHVA 4X1YA 2GLZA 3E20B 2LBTA 1RLUA 5JH7B 5J2TB 3TD5A 3HJWC 1Z5VA 1VHAA 1KNJA 2ALEA 3TD3A 5J2UA 1XBIA 4F6RB 4X20A 4PWTA 2B33A 4EI7A 5JQGA 2CWJA 5FNVB 4BVRA 5EIBC 1YJ9F 2RHLA 3MQWA 1YQNA 3F0EA 3HTNA 2ZOVA 2NMUA 3HKEA 3P0ZA 5GINC 1W41A 3I56F 1FSZA 1W55A 2N48A 4O2AA 1VQ6F 3ZP7A 4BT7A 1IV3A 3UT5A 3ZP4A 3D54A 3K2XA 1ZWZA 3KJJA 2ZF8A 1VQ4F 5HY0A 1QU9A 3D01A 1FFXB 1Q8RA 4TUYB 1KD1H 1CN7A 5JQGB 2V9YA 3NVIB 3DC2A 3T80A 3HKEB 1JFFB 3RA6A 5JVDB 3G71F 3WGKA 3ERNA 4O2AB 5C8YB 3QTYA 3LWVC 1K8AH 3CG6A 1XRGA 5CB4B 1Q86H 3HKDB 3MCQA 3HKCB 4RQOA 2JNBA 4O4HB 2HX0A 5EZYB 5IYZB 4I50A 2QEXF 1GO1A 3M84A 4IHJB 1VQNF 1XHOA 3GYQA 5IJ0B 4FFBA 3CB2A 4TV8A 2VGMA 4EB6A 3LWOC 2KTVA 1W59A 4O4JA 3VO8A 3LWQC 1TUBA 3F6MA 2W8BC 3WGMA 4LNUB 1TVKA 3EORA 4BT6A 4U39A 3MCAB 3RYIA 3VYTC 1W57A 1CLIA 3OONA 2KG4A 3RYFB 3U0OA 4X3MA 4IIJA 2HVYD 1COMA 3ZO8A 3VYSC 1VQOF 1JJ2F 4I55B 5ITZA 1DT9A 3N2KB 4B46A 3FFMA 2UYKA 1X52A 2VAPA 3G6EF 2ZAUA 4ERHA 4X1IB 2OTLF 4TV9B 2H8CA 3J80M 3KJKA 3JATB 3HKBB 3HWUA 3JAWA 2Z1EA 3CD6F 5HXZA 3KIZA 3CYQA 3CC4F 1IV1A 4F6RA 1W581 2P6YA 3JASB 3VIUA 3E1YA 4B45A 4NUTA 3IEWA 3CCQF 2K1SA 3JVHA 2HS3A 4I55A 4ZOLB 5EWRA 5EYPA 3CCSF 1GO0A 1KQSF 4I4TA 4BT2A 5CA0B 4G88A 5HY1A 3UT5B 3ZOPA 4G4YA 2BTOA 1FNJA 2QTPA 1Q7YH 2UYPA 3VI6A 1RQ2A 3M4SA 1FNKA 2CVLA 4B5CA 2UYNB 2AMTA 3CCEF 3LMEA 1T0AA 4X1KA 3J7AR 2FGYA 4DRXB 2UZHA 3V7EA 3B6NA 3NK6A 4DXDA 4ZOLA 1W40A 2IAFA 5MN4A 1VQ8F 3QUWA 4U3JA 1M1KH 2AIFA 3JALA 3K14A 3OBWA 2OHWA 5JVDA 3F0GA 2LBWA 4YJ2A 5LA6A 5C8YA 1YJNF 3CPQA 1YHQF 5KX5A 3LWRC 3IEQA 1NMUB 2WALA 2ZVZA 4O4IB 3GHZA 3LDTA 3HKCA 3P10A 3L7QA 2EWCA
chains in the Genus database with same CATH topology
3IR9A 1H7MA 2LBXA 1M90H 2JNBA 5GAPK 3JCMM 3CG6A 3LWPC 5GIPC 1VQNF 5FLXM 2QEXF 1GO1A 1E7KA 1X7PA 3J81M 1T0KB 3GYQA 3CCJF 1N8RH 2VGNA 2VGMA 3PAFA 3RA5A 3LWOC 4EI9A 3CMAF 2KTVA 3LWQC 5IT9M 1VQ5F 1W3EX 3AGKA 3PLAC 1VQPF 5GANK 3MCAB 5HY2A 3CCMF 1YITF 3G4SF 5HXUA 1VQMF 3CXCF 2KG4A 5FJ4C 1VQ9F 2QA4F 3D00A 4X3MA 1VQ7F 2HVYD 2OTJF 3OBYA 5HWEA 3SIUA 1VQKF 1VQOF 1JJ2F 1DT9A 1CK2A 1QVFF 3FFMA 1YIJF 1PXWA 3N4ZA 3CCUF 3CCRF 1W42A 1X52A 3G6EF 5DCVA 2F9ZC 3NVKE 2OTLF 3CMEF 3ON1A 4X3LA 3CPWF 1KC8H 3NMUC 3J80M 1YI2F 1Q81H 2CZWA 5A2QM 4LCKA 3N4YA 2GLZA 2QI2A 3E20B 5EO3A 5HXZA 1W2BF 3CD6F 3CC4F 1YJWF 3HJWC 1X7OA 3NK7A 3E1YA 2ALEA 5GIOC 1XBIA 2KTUA 4NUTA 1IPAA 3CCQF 1K9MH 4EI7A 1K73H 3OW2F 1GZ0A 4BVRA 4BVQA 5EWRA 1YJ9F 3CCSF 3CCLF 1GO0A 1KQSF 3O85A 4BW0B 2BO1A 2FC3A 5G4UC 5GINC 5HY1A 1RA4A 3CC2F 1W41A 3I56F 2I6DA 2OZBA 3V3TA 1NJIH 3CCVF 1VQ6F 1Q7YH 1VQLF 3VI6A 4TZZA 1ZWZA 3SIVA 5G4VC 1VQ4F 5HY0A 3CCEF 1K8AH 4NQ3A 3J7AR 2FGYA 1KD1H 1Q82H 3V7EA 4BY9D 1RLGA 3NK6A 1CN7A 1W40A 3CC7F 3I55F 5HY4A 1QVGF 4XCQA 1VQ8F 3NVIB 1M1KH 2AIFA 3OBWA 3VMFB 2OHWA 4C4WC 4EI8A 3V7QA 3RA6A 3JAMM 2LBWA 3LFOA 1YJNF 3CPQA 1YHQF 3LWRC 1SDSA 3HAXD 1NMUB 2WALA 3G71F 4BVSA 3LWVC 4BVTA 3WXMB 1Q86H 1S72F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR9 A;  1H7M A;  2LBX A;  1M90 H;  2JNB A;  5GAP K;  3JCM M;  3LWP C;  5GIP C;  1VQN F;  5FLX M;  2QEX F;  1GO1 A;  1E7K A;  1X7P A;  3J81 M;  1T0K B;  3GYQ A;  3CCJ F;  1N8R H;  2VGN A;  2VGM A;  3PAF A;  3RA5 A;  3LWO C;  3CMA F;  2KTV A;  3LWQ C;  5IT9 M;  1VQ5 F;  1W3E X;  3AGK A;  3PLA C;  1VQP F;  5GAN K;  3MCA B;  3CCM F;  1YIT F;  3G4S F;  1VQM F;  3CXC F;  2KG4 A;  5FJ4 C;  1VQ9 F;  2QA4 F;  4X3M A;  1VQ7 F;  2HVY D;  2OTJ F;  3OBY A;  3SIU A;  1VQK F;  1VQO F;  1JJ2 F;  1DT9 A;  1CK2 A;  1QVF F;  3FFM A;  1YIJ F;  1PXW A;  3N4Z A;  3CCU F;  3CCR F;  1W42 A;  1X52 A;  3G6E F;  5DCV A;  3NVK E;  2OTL F;  3CME F;  3ON1 A;  4X3L A;  3CPW F;  1KC8 H;  3NMU C;  3J80 M;  1YI2 F;  1Q81 H;  2CZW A;  5A2Q M;  4LCK A;  3N4Y A;  2QI2 A;  3E20 B;  5EO3 A;  1W2B F;  3CD6 F;  3CC4 F;  1YJW F;  3HJW C;  1X7O A;  3NK7 A;  3E1Y A;  2ALE A;  5GIO C;  1XBI A;  2KTU A;  4NUT A;  1IPA A;  3CCQ F;  1K9M H;  1K73 H;  3OW2 F;  1GZ0 A;  5EWR A;  1YJ9 F;  3CCS F;  3CCL F;  1GO0 A;  1KQS F;  3O85 A;  4BW0 B;  2BO1 A;  2FC3 A;  5G4U C;  5GIN C;  3CC2 F;  1RA4 A;  1W41 A;  3I56 F;  2I6D A;  2OZB A;  1NJI H;  3CCV F;  1VQ6 F;  1Q7Y H;  1VQL F;  3VI6 A;  4TZZ A;  1ZWZ A;  3SIV A;  5G4V C;  1VQ4 F;  3CCE F;  1K8A H;  3J7A R;  1KD1 H;  1Q82 H;  3V7E A;  4BY9 D;  1RLG A;  3NK6 A;  1CN7 A;  1W40 A;  3CC7 F;  3I55 F;  1QVG F;  1VQ8 F;  3NVI B;  1M1K H;  2AIF A;  3OBW A;  3VMF B;  2OHW A;  4C4W C;  3V7Q A;  3RA6 A;  3JAM M;  2LBW A;  3LFO A;  1YJN F;  3CPQ A;  1YHQ F;  3LWR C;  1SDS A;  3HAX D;  1NMU B;  2WAL A;  3G71 F;  3LWV C;  3CG6 A;  3WXM B;  1Q86 H;  1S72 F; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  4I50 B;  1ODE A;  3RYH B;  3KHN A;  3JCM M;  3RYC B;  4X1K B;  5GIP C;  3BYQ A;  1E7K A;  4O4J B;  3CCJ F;  1TUB B;  3RA5 A;  3WGJ A;  3CMA F;  3JAL B;  3RYI B;  3S02 A;  5IT9 M;  4O2B B;  3AGK A;  1QD9 A;  4C81 A;  2IG8 A;  3G4S F;  1VQM F;  1W5B A;  1OFU A;  4ZHQ B;  2QA4 F;  3HKD A;  1H47 A;  1VQV A;  2OTJ F;  5HWE A;  3F0F A;  2DT4 A;  1OAP A;  5IYZ A;  3RYC A;  1QVF F;  4X1I A;  4G4X A;  5LYJ B;  4FFB B;  3CCR F;  4TV8 B;  2F9Z C;  3NVK E;  3CME F;  3IMP A;  3NMU C;  4LNU A;  1Q81 H;  4YJ3 A;  4LCK A;  4HNA B;  1W5E A;  4O2B A;  1W2B F;  1JFF A;  1YJW F;  4IIJ B;  4ZHQ A;  5MN6 A;  2CSL A;  1K9M H;  4G4V A;  1DBF A;  1GZ0 A;  4I4T B;  4BVQ A;  5KMG A;  3CCL F;  2VXY A;  3MBM A;  3O85 A;  5EZY A;  4TV9 A;  2FC3 A;  3WPW A;  2ZVY A;  1IV2 A;  2R75 1;  1SZQ A;  3CC2 F;  2HRY A;  2I6D A;  3N2G A;  4C8I A;  3FPI A;  2OZB A;  5BMV B;  2H6L A;  3V3T A;  2GZL A;  3CCV F;  1NJI H;  1NQ3 A;  3I3F A;  3JAR A;  4TZZ A;  3CYP B;  2R6R 1;  4NQ3 A;  3RYF A;  2HP0 A;  5EYP B;  1Q82 H;  2RB9 A;  5AVM A;  3S06 A;  4U3J B;  1RLG A;  2DYY A;  2G9I A;  1QVG F;  4XCQ A;  4G4Z A;  5IJ9 B;  3VMF B;  1ONI A;  3WJQ A;  2VAM A;  4EI8 A;  5KX5 B;  5JH7 A;  5J2T A;  2MQE A;  4O4I A;  2YYE A;  3HAX D;  2BTQ B;  3JAT A;  1YGY A;  5JCO A;  1UFY A;  2YXZ A;  2Z1T A;  4BVS A;  4ZI7 B;  3JAR B;  1YIJ F;  3WXM B;  1S72 F;  3IR9 A;  2HP3 A;  1H7M A;  2LBX A;  3C9S A;  4DRX A;  1M90 H;  3JAS A;  5LP6 A;  1SA0 B;  3LWP C;  2I6R A;  5CA1 A;  1X7P A;  3LYB A;  3J81 M;  5LXT A;  2HQS C;  5HP8 A;  3PAF A;  1JD1 A;  3S0H A;  3VCZ A;  3WGL A;  4G4W A;  4YJ2 B;  5LA6 B;  3PLA C;  1VQP F;  5GAN K;  3E22 B;  2LCA A;  5HY2 A;  2VAW A;  3FD5 A;  3IKF A;  3CXC F;  3V4D A;  3S0Y A;  3D00 A;  3JAK B;  4ZK7 A;  3OBY A;  3RYH A;  3SIU A;  1VQK F;  3K0T A;  1W5F A;  3QHD A;  5EB1 B;  4WBN A;  4R40 B;  2RHH A;  2CHS A;  1JY8 A;  2Q1Y A;  5LP6 B;  1CK2 A;  1SA0 A;  5CA1 B;  1PXW A;  3C8L A;  3MDO A;  3S03 A;  1VH8 A;  3VOB A;  3FBA A;  4O4L B;  5DCV A;  1J7H A;  4C8E A;  4KWE A;  4X3L A;  2KGW A;  5GON A;  4HNA A;  1YI2 F;  3C9R A;  3Q8H A;  3ESJ A;  3GTZ A;  2Z1F A;  3N4Y A;  2QI2 A;  2AIZ P;  5EO3 A;  1U43 A;  3E22 A;  2L26 A;  3C9U A;  4X1Y B;  1X7O A;  3NK7 A;  5GIO C;  2KTU A;  3JAK A;  1IPA A;  5LP6 C;  1K73 H;  3S0W A;  4WBN B;  4M8I A;  3OW2 F;  4RHA A;  3P4E A;  5IJ0 A;  1UI9 A;  4X20 B;  3K12 A;  2UYJ A;  5FNV A;  4BW0 B;  2BO1 A;  3TD4 A;  4BT3 A;  5G4U C;  3N2G B;  4E6E A;  4O4L A;  4BT4 A;  2Q1X A;  1TVK B;  2PMP A;  3C9T A;  1RA4 A;  4YJ3 B;  3DDN A;  2OTM A;  2GVI A;  4ZHW A;  3RE3 A;  1VQL F;  5LOV B;  1JN1 A;  3IKE A;  4C82 A;  3SIV A;  2HP0 B;  5G4V C;  5CB4 A;  3N2K A;  3R0P A;  1RQ7 A;  5EIB D;  5KMG B;  4O4H A;  4BY9 D;  3KE1 A;  5IJ9 A;  3CC7 F;  1FFX A;  3I55 F;  4TUY A;  4IHJ A;  1U3L A;  5HY4 A;  5EAZ A;  1PF5 A;  1QAH A;  5LYJ A;  4EB6 B;  4C4W C;  5MN5 A;  3V7Q A;  3JAM M;  3LFO A;  1SDS A;  1GX1 A;  1Z5W A;  3VTI C;  5LOV A;  4BVT A;  1VK3 A;  5B8F A;  5GAP K;  1U3P A;  5HP7 A;  1H48 A;  2H8E A;  5FLX M;  1T0K B;  1N8R H;  1KNK A;  3F0D A;  4BT5 A;  2VGN A;  3WJP A;  4EI9 A;  2RHO A;  2Z01 A;  1XV2 A;  1X25 A;  1W5A A;  3FD6 A;  3I7T A;  1VQ5 F;  1W3E X;  3HKB A;  3JAW B;  3VYU C;  3CCM F;  1YIT F;  5HXU A;  2UYN A;  1U40 A;  5BMV A;  5FJ4 C;  1VQ9 F;  5J2U B;  1R1M A;  2CW4 A;  2Z1U A;  3ELC A;  3VOA A;  1VQ7 F;  1IV4 A;  2HS0 A;  2PHN A;  3WJR A;  5JCO C;  3M1X A;  5ITZ B;  3N4Z A;  2HRU A;  2ZOD A;  2CHT A;  5GON B;  3WGN A;  5LXT B;  1W42 A;  3CCU F;  2HS4 A;  5EB0 A;  4NWO B;  3ON1 A;  5CA0 A;  3CPW F;  4C8G A;  2BTU A;  3WPX A;  1KC8 H;  2IQQ A;  4ZHY B;  2RHJ A;  2CZW A;  4B62 A;  5A2Q M;  4ZHV A;  4X1Y A;  2GLZ A;  3E20 B;  2LBT A;  1RLU A;  5JH7 B;  5J2T B;  3TD5 A;  3HJW C;  1Z5V A;  1VHA A;  1KNJ A;  2ALE A;  3TD3 A;  5J2U A;  1XBI A;  4F6R B;  4X20 A;  4PWT A;  2B33 A;  4EI7 A;  5JQG A;  2CWJ A;  5FNV B;  4BVR A;  5EIB C;  1YJ9 F;  2RHL A;  3MQW A;  1YQN A;  3F0E A;  3HTN A;  2ZOV A;  2NMU A;  3HKE A;  3P0Z A;  5GIN C;  1W41 A;  3I56 F;  1FSZ A;  1W55 A;  2N48 A;  4O2A A;  1VQ6 F;  3ZP7 A;  4BT7 A;  1IV3 A;  3UT5 A;  3ZP4 A;  3D54 A;  3K2X A;  1ZWZ A;  3KJJ A;  2ZF8 A;  1VQ4 F;  5HY0 A;  1QU9 A;  3D01 A;  1FFX B;  1Q8R A;  4TUY B;  1KD1 H;  1CN7 A;  5JQG B;  2V9Y A;  3NVI B;  3DC2 A;  3T80 A;  3HKE B;  1JFF B;  3RA6 A;  5JVD B;  3G71 F;  3WGK A;  3ERN A;  4O2A B;  5C8Y B;  3QTY A;  3LWV C;  1K8A H;  3CG6 A;  1XRG A;  5CB4 B;  1Q86 H;  3HKD B;  3MCQ A;  3HKC B;  4RQO A;  2JNB A;  4O4H B;  2HX0 A;  5EZY B;  5IYZ B;  4I50 A;  2QEX F;  1GO1 A;  3M84 A;  4IHJ B;  1VQN F;  1XHO A;  3GYQ A;  5IJ0 B;  4FFB A;  3CB2 A;  4TV8 A;  2VGM A;  4EB6 A;  3LWO C;  2KTV A;  1W59 A;  4O4J A;  3VO8 A;  3LWQ C;  1TUB A;  3F6M A;  2W8B C;  3WGM A;  4LNU B;  1TVK A;  3EOR A;  4BT6 A;  4U39 A;  3MCA B;  3RYI A;  3VYT C;  1W57 A;  1CLI A;  3OON A;  2KG4 A;  3RYF B;  3U0O A;  4X3M A;  4IIJ A;  2HVY D;  1COM A;  3ZO8 A;  3VYS C;  1VQO F;  1JJ2 F;  4I55 B;  5ITZ A;  1DT9 A;  3N2K B;  4B46 A;  3FFM A;  2UYK A;  1X52 A;  2VAP A;  3G6E F;  2ZAU A;  4ERH A;  4X1I B;  2OTL F;  4TV9 B;  2H8C A;  3J80 M;  3KJK A;  3JAT B;  3HKB B;  3HWU A;  3JAW A;  2Z1E A;  3CD6 F;  5HXZ A;  3KIZ A;  3CYQ A;  3CC4 F;  1IV1 A;  4F6R A;  1W58 1;  2P6Y A;  3JAS B;  3VIU A;  3E1Y A;  4B45 A;  4NUT A;  3IEW A;  3CCQ F;  2K1S A;  3JVH A;  2HS3 A;  4I55 A;  4ZOL B;  5EWR A;  5EYP A;  3CCS F;  1GO0 A;  1KQS F;  4I4T A;  4BT2 A;  5CA0 B;  4G88 A;  5HY1 A;  3UT5 B;  3ZOP A;  4G4Y A;  2BTO A;  1FNJ A;  2QTP A;  1Q7Y H;  2UYP A;  3VI6 A;  1RQ2 A;  3M4S A;  1FNK A;  2CVL A;  4B5C A;  2UYN B;  2AMT A;  3CCE F;  3LME A;  1T0A A;  4X1K A;  3J7A R;  2FGY A;  4DRX B;  2UZH A;  3V7E A;  3B6N A;  3NK6 A;  4DXD A;  4ZOL A;  1W40 A;  2IAF A;  5MN4 A;  1VQ8 F;  3QUW A;  4U3J A;  1M1K H;  2AIF A;  3JAL A;  3K14 A;  3OBW A;  2OHW A;  5JVD A;  3F0G A;  2LBW A;  4YJ2 A;  5LA6 A;  5C8Y A;  1YJN F;  3CPQ A;  1YHQ F;  5KX5 A;  3LWR C;  3IEQ A;  1NMU B;  2WAL A;  2ZVZ A;  4O4I B;  3GHZ A;  3LDT A;  3HKC A;  3P10 A;  3L7Q A;  2EWC A; 
#chains in the Genus database with same CATH homology
 3IR9 A;  1H7M A;  2LBX A;  1M90 H;  2JNB A;  5GAP K;  3JCM M;  3CG6 A;  3LWP C;  5GIP C;  1VQN F;  5FLX M;  2QEX F;  1GO1 A;  1E7K A;  1X7P A;  3J81 M;  1T0K B;  3GYQ A;  3CCJ F;  1N8R H;  2VGN A;  2VGM A;  3PAF A;  3RA5 A;  3LWO C;  4EI9 A;  3CMA F;  2KTV A;  3LWQ C;  5IT9 M;  1VQ5 F;  1W3E X;  3AGK A;  3PLA C;  1VQP F;  5GAN K;  3MCA B;  5HY2 A;  3CCM F;  1YIT F;  3G4S F;  5HXU A;  1VQM F;  3CXC F;  2KG4 A;  5FJ4 C;  1VQ9 F;  2QA4 F;  3D00 A;  4X3M A;  1VQ7 F;  2HVY D;  2OTJ F;  3OBY A;  5HWE A;  3SIU A;  1VQK F;  1VQO F;  1JJ2 F;  1DT9 A;  1CK2 A;  1QVF F;  3FFM A;  1YIJ F;  1PXW A;  3N4Z A;  3CCU F;  3CCR F;  1W42 A;  1X52 A;  3G6E F;  5DCV A;  2F9Z C;  3NVK E;  2OTL F;  3CME F;  3ON1 A;  4X3L A;  3CPW F;  1KC8 H;  3NMU C;  3J80 M;  1YI2 F;  1Q81 H;  2CZW A;  5A2Q M;  4LCK A;  3N4Y A;  2GLZ A;  2QI2 A;  3E20 B;  5EO3 A;  5HXZ A;  1W2B F;  3CD6 F;  3CC4 F;  1YJW F;  3HJW C;  1X7O A;  3NK7 A;  3E1Y A;  2ALE A;  5GIO C;  1XBI A;  2KTU A;  4NUT A;  1IPA A;  3CCQ F;  1K9M H;  4EI7 A;  1K73 H;  3OW2 F;  1GZ0 A;  4BVR A;  4BVQ A;  5EWR A;  1YJ9 F;  3CCS F;  3CCL F;  1GO0 A;  1KQS F;  3O85 A;  4BW0 B;  2BO1 A;  2FC3 A;  5G4U C;  5GIN C;  5HY1 A;  1RA4 A;  3CC2 F;  1W41 A;  3I56 F;  2I6D A;  2OZB A;  3V3T A;  1NJI H;  3CCV F;  1VQ6 F;  1Q7Y H;  1VQL F;  3VI6 A;  4TZZ A;  1ZWZ A;  3SIV A;  5G4V C;  1VQ4 F;  5HY0 A;  3CCE F;  1K8A H;  4NQ3 A;  3J7A R;  2FGY A;  1KD1 H;  1Q82 H;  3V7E A;  4BY9 D;  1RLG A;  3NK6 A;  1CN7 A;  1W40 A;  3CC7 F;  3I55 F;  5HY4 A;  1QVG F;  4XCQ A;  1VQ8 F;  3NVI B;  1M1K H;  2AIF A;  3OBW A;  3VMF B;  2OHW A;  4C4W C;  4EI8 A;  3V7Q A;  3RA6 A;  3JAM M;  2LBW A;  3LFO A;  1YJN F;  3CPQ A;  1YHQ F;  3LWR C;  1SDS A;  3HAX D;  1NMU B;  2WAL A;  3G71 F;  4BVS A;  3LWV C;  4BVT A;  3WXM B;  1Q86 H;  1S72 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...