5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
5IT9M 3AGKA 1VQ7F 4LCKA 2OTJF 1VQPF 1K9MH 2JNBA 3CCVF 1DT9A 3NVIB 3CPQA 2QI2A 1K8AH 3RA6A 2AIFA 2LBXA 1X7PA 1XBIA 3CMAF 3SIUA 3CC7F 3WXMB 1T0KB 3O85A 3NMUC 5GIOC 1M1KH 1H7MA 3CXCF 1GZ0A 1X7OA 3E1YA 1Q82H 3SIVA 4NUTA 2VGNA 2LBWA 3PLAC 3CCSF 3CCRF 1YJNF 3V7QA 1VQ4F 1W3EX 1K73H 2QEXF 3CG6A 3NK7A 1RA4A 5FLXM 1Q7YH 1W42A 2KTVA 1RLGA 2OHWA 3CC2F 3HJWC 1PXWA 1E7KA 2OZBA 3HAXD 1Q81H 2OTLF 3I55F 1IPAA 1VQOF 3OBWA 3G4SF 5GIPC 3RA5A 4BW0B 5GINC 3CPWF 2FC3A 5GANK 4X3MA 3NK6A 1CN7A 3G71F 1KC8H 3CCMF 3N4YA 1CK2A 1YIJF 2WALA 4X3LA 3E20B 1YJWF 3ON1A 1VQ5F 2HVYD 3J81M 3CCEF 4BY9D 3FFMA 3LWVC 1VQMF 1X52A 1QVGF 3G6EF 3CCQF 3CCUF 1YHQF 1NJIH 3NVKE 1W41A 1N8RH 1VQ9F 1VQ8F 2QA4F 5G4UC 3CCLF 1VQKF 3CMEF 3JCMM 3CC4F 3LFOA 5EO3A 1ZWZA 3N4ZA 1KQSF 3LWPC 1KD1H 1S72F 2CZWA 3OW2F 2BO1A 5EWRA 3LWQC 1VQ6F 3IR9A 1M90H 1W40A 2KG4A 1GO1A 3CD6F 3JAMM 3LWRC 4C4WC 1VQLF 1YITF 3MCAB 1NMUB 1Q86H 1JJ2F 1QVFF 1GO0A 3OBYA 2KTUA 3J80M 1VQNF 2ALEA 2VGMA 4TZZA 3V7EA 3PAFA 3CCJF 3GYQA 3VI6A 5G4VC 1SDSA 5A2QM 3I56F 5DCVA 1YJ9F 3J7AR 3LWOC 5FJ4C 1YI2F 5GAPK 2I6DA 3VMFB 1W2BF
chains in the Genus database with same CATH superfamily
2L26A 1W5FA 1K9MH 2JNBA 1DT9A 3CPQA 3RA6A 1XBIA 2GLZA 2CW4A 5JH7B 2W8BC 1T0AA 5CA0B 3NMUC 4X1IB 5GIOC 5CA1A 4X1KB 1X7OA 3SIVA 3JAKB 4NUTA 3PLAC 3KJKA 3CCRF 3IKFA 4TUYB 3IMPA 3S02A 5LYJA 3VTIC 2QEXF 1W59A 4TV8B 1RA4A 5J2UB 3UT5B 1W42A 1RLGA 3HJWC 1PXWA 2OZBA 3HAXD 3S0WA 3DC2A 2P6YA 2UYKA 4IHJA 2HP3A 4BT6A 2CSLA 3JATA 3F0DA 5IJ0B 3CPWF 3K0TA 2GVIA 1GX1A 5JCOA 3E20B 3JALA 2BTUA 5JVDA 2H6LA 3MBMA 2IG8A 4NWOB 1H47A 4LNUB 5LP6C 3FBAA 1X52A 3RYHB 3G6EF 1ODEA 3NVKE 4DXDA 4O4JB 3P10A 4ZI7A 3KIZA 2B33A 4I50B 1VQ8F 3P0ZA 1SA0A 4O2AA 3LDTA 3LFOA 3WPXA 4G4YA 5LA6A 2ZOVA 3C9UA 1U3LA 1U43A 3S0YA 1KQSF 3LWPC 3K2XA 2Z1EA 1SZQA 2HRUA 3JAWB 5BMVA 5ITZB 4I55B 5EZYB 2IAFA 2RHJA 5HWEA 2Z01A 3IR9A 1M90H 3HKDB 5EB0A 4YJ2A 1CLIA 1VQLF 5EB1B 4G4XA 3ZP4A 2PHNA 4F6RA 3WGLA 4DRXB 1GO0A 1VQNF 3CCJF 4O4LA 5LOVA 1W5EA 1SDSA 4RQOA 5DCVA 1W57A 2HP0A 2Q1YA 4HNAA 5CB4B 3LWOC 5FJ4C 3GTZA 3VMFB 3FPIA 2UYNA 3RE3A 5EIBD 1JN1A 3F0EA 3RYIA 2I6RA 3CCVF 1W5AA 2QI2A 1K8AH 3ZOPA 2AIFA 5LP6A 2LBXA 3N2GA 4ERHA 4EI9A 3C8LA 3CB2A 3WGKA 3WGMA 3JATB 3CC7F 1R1MA 1T0KB 3O85A 1U3PA 2MQEA 4B46A 3CXCF 1TVKA 1GZ0A 1Q82H 2RHHA 1YQNA 5FNVA 2VGNA 2LBWA 4E6EA 5KMGA 1RQ7A 4U3JB 3V7QA 1W3EX 1K73H 3I7TA 1VQ4F 3D00A 3HKBA 3WPWA 2R6R1 4ZOLA 4PWTA 5FLXM 1Q7YH 2KTVA 3RYFA 4BT4A 4G4VA 4WBNA 1RLUA 4ZI7B 3I55F 1SA0B 1FNKA 3IEQA 4O2AB 5KX5A 3TD5A 3ELCA 4BW0B 4G4ZA 3V3TA 2PMPA 2H8EA 4KWEA 2FC3A 5GANK 2Z1TA 3NK6A 1W55A 4C8IA 3G71F 2ZF8A 4EI7A 3HKCA 1KC8H 3ZO8A 1CK2A 4X20B 2LBTA 3ON1A 1YJWF 2H8CA 1COMA 3M84A 3J81M 5J2TA 3FD5A 3CCEF 3FFMA 4O2BA 3LWVC 4YJ2B 1VQMF 2IQQA 3ESJA 2CWJA 1NJIH 1W41A 5IYZA 1VQ9F 3KE1A 2RHOA 4BT5A 1VQKF 5EO3A 3N2KA 1ZWZA 5MN5A 2HX0A 1YGYA 4B62A 5LOVB 1OFUA 4BT3A 4R40B 5C8YB 1S72F 2CZWA 3OW2F 2R751 3JARA 3BYQA 2HP0B 4HNAB 5EWRA 3FD6A 1TUBA 3WGJA 3TD3A 1IV1A 4ZHWA 3P4EA 2UYNB 2KG4A 1GO1A 3HKEA 4B45A 1XV2A 3CD6F 3S06A 4ZHQA 3LWRC 4C4WC 4BT7A 5LP6B 1XHOA 3VOBA 1NMUB 3F0FA 3VOAA 2LCAA 4B5CA 1QVFF 5GONA 1VQVA 4O4IA 4IIJA 5HXZA 1Z5VA 2VGMA 2HRYA 5EYPB 3VYSC 5JQGA 4O4HA 5FNVB 2VAWA 5EAZA 4BVRA 1FSZA 4I4TA 3WJPA 3J7AR 4ZOLB 4YJ3A 1YI2F 4BVSA 3NVIB 3AGKA 2RHLA 4LCKA 5B8FA 1VQPF 4EI8A 1U40A 4BT2A 5MN6A 3SIUA 3KHNA 3WXMB 3F0GA 4BVTA 5CA1B 5CA0A 3K12A 4X1IA 2YXZA 1H7MA 2FGYA 1OAPA 3E1YA 5AVMA 3JAKA 2ZAUA 2EWCA 1DBFA 5LYJB 3E22A 4O2BB 4C81A 1UI9A 3CG6A 3LYBA 3NK7A 5HY2A 3CYPB 5J2UA 3CC2F 3C9RA 1IPAA 3N2KB 3QTYA 4IHJB 3G4SF 2G9IA 1X25A 3RA5A 3HTNA 4ZHYB 3JARB 1IV4A 3IKEA 3QHDA 3TD4A 2HS0A 1TUBB 2UYJA 3N4YA 3I3FA 3RYCA 3CCMF 1YIJF 2WALA 1W581 3JALB 1RQ2A 3CYQA 5JVDB 1IV2A 2HVYD 4ZHQB 2CHSA 3EORA 4U39A 3B6NA 4M8IA 3WJRA 1QVGF 3CCQF 3CCUF 1YHQF 1N8RH 5G4UC 5GONB 1FFXA 4ZHVA 4IIJB 3CMEF 3JCMM 3VIUA 5LA6B 2QTPA 5JQGB 5HY1A 4O4HB 3R0PA 2HS4A 3MCQA 3HWUA 5BMVB 1QU9A 3JASA 4I4TB 1XRGA 5ITZA 2BO1A 4YJ3B 5EZYA 4FFBA 2VAPA 3D54A 3ERNA 4EB6A 2Z1FA 3HKDA 2V9YA 1YITF 1VHAA 2VXYA 4F6RB 3MCAB 3KJJA 1Q86H 3F6MA 1JJ2F 3K14A 4DRXA 4TV9A 2BTQB 4NQ3A 2Q1XA 5EIBC 2ALEA 4TZZA 3V7EA 3PAFA 4O4LB 1Q8RA 3C9TA 5A2QM 3C9SA 3E22B 3T80A 3I56F 1YJ9F 1FNJA 2RB9A 2ZVZA 5HY0A 5CB4A 2ZODA 3CMAF 5IT9M 1VQ7F 2OTJF 3RYIB 2DT4A 2VAMA 3N2GB 2K1SA 3U0OA 2GZLA 3D01A 1VH8A 1JFFA 1X7PA 3V4DA 5IJ9A 2N48A 5MN4A 3WGNA 4C8EA 3S03A 1M1KH 1TVKB 2DYYA 3RYCB 4X1YA 5KMGB 2HQSC 3CCSF 1YJNF 3VYTC 4U3JA 3HKBB 1ONIA 2F9ZC 2ZVYA 2AIZP 1IV3A 5HP8A 5LXTA 1UFYA 1W5BA 3RYFB 1J7HA 2CVLA 4WBNB 2OHWA 1E7KA 4G88A 1FFXB 2AMTA 2UYPA 1Q81H 3IEWA 2OTLF 4C82A 5HXUA 1JD1A 5KX5B 1VQOF 1JY8A 3OBWA 5GIPC 5JH7A 3M1XA 3JVHA 3WJQA 2HS3A 3QUWA 5GINC 3JASB 3S0HA 4XCQA 4X3MA 1CN7A 3HKCB 4X1KA 4FFBB 3VO8A 1H48A 4X3LA 4EB6B 1VQ5F 5J2TB 4TUYA 4X20A 3ZP7A 4BY9D 1PF5A 2CHTA 4TV8A 4ZK7A 3UT5A 3LMEA 4C8GA 3Q8HA 4BVQA 3M4SA 5IYZB 2UZHA 4TV9B 2QA4F 3CCLF 3VYUC 3CC4F 2BTOA 4RHAA 1Z5WA 3L7QA 3N4ZA 2OTMA 4G4WA 1KD1H 5IJ0A 5C8YA 1VK3A 3LWQC 5HP7A 1VQ6F 1NQ3A 3OONA 3HKEB 3VCZA 3JAMM 5HY4A 4LNUA 1JFFB 5IJ9B 2Z1UA 3RYHA 4O4JA 3OBYA 2KTUA 4I50A 4O4IB 3J80M 3MQWA 2YYEA 2NMUA 5EYPA 2KGWA 4X1YB 1QAHA 3GYQA 3VI6A 5JCOC 5G4VC 5LXTB 3JAWA 3GHZA 4I55A 1QD9A 1KNKA 1KNJA 3DDNA 3MDOA 5GAPK 2I6DA 1W40A 1W2BF
chains in the Genus database with same CATH topology
5IT9M 3AGKA 1VQ7F 4LCKA 2OTJF 1VQPF 1K9MH 2JNBA 3CCVF 1DT9A 4EI8A 3CPQA 2QI2A 1K8AH 3RA6A 3NVIB 2AIFA 2LBXA 1X7PA 1XBIA 2GLZA 4EI9A 3CMAF 3SIUA 3CC7F 3WXMB 4BVTA 1T0KB 3O85A 3NMUC 5GIOC 1M1KH 1H7MA 2FGYA 3CXCF 1GZ0A 1X7OA 3E1YA 1Q82H 3SIVA 4NUTA 2VGNA 2LBWA 3PLAC 3CCSF 3CCRF 1YJNF 3V7QA 1VQ4F 1W3EX 1K73H 3D00A 2QEXF 3CG6A 2F9ZC 3NK7A 1RA4A 5FLXM 5HY2A 1Q7YH 1W42A 2KTVA 1RLGA 2OHWA 3CC2F 3HJWC 1PXWA 1E7KA 2OZBA 3HAXD 1Q81H 2OTLF 3I55F 5HXUA 1IPAA 1VQOF 3OBWA 3G4SF 5GIPC 3RA5A 4BW0B 3V3TA 5GINC 3CPWF 2FC3A 5GANK 4XCQA 4X3MA 3NK6A 1CN7A 3G71F 4EI7A 1KC8H 3CCMF 3N4YA 1CK2A 1YIJF 2WALA 4X3LA 3E20B 1YJWF 3ON1A 1VQ5F 2HVYD 3J81M 3CCEF 4BY9D 3FFMA 3LWVC 1VQMF 1X52A 1QVGF 4BVQA 3G6EF 3CCQF 3CCUF 1YHQF 1NJIH 3NVKE 1W41A 1N8RH 1VQ9F 1VQ8F 2QA4F 5G4UC 3CCLF 1VQKF 3CMEF 3JCMM 3CC4F 3LFOA 5EO3A 1ZWZA 5HY1A 3N4ZA 1KQSF 3LWPC 1KD1H 1S72F 2CZWA 3OW2F 2BO1A 5EWRA 5HWEA 3LWQC 1VQ6F 3IR9A 1M90H 1W40A 2KG4A 1GO1A 3CD6F 3JAMM 5HY4A 3LWRC 4C4WC 1VQLF 1YITF 3MCAB 1NMUB 1Q86H 1JJ2F 1QVFF 1GO0A 3OBYA 2KTUA 3J80M 4NQ3A 5HXZA 1VQNF 2ALEA 2VGMA 4TZZA 3V7EA 3PAFA 3CCJF 3GYQA 3VI6A 5G4VC 1SDSA 5A2QM 4BVRA 3I56F 5DCVA 1YJ9F 3J7AR 3LWOC 5HY0A 5FJ4C 1YI2F 5GAPK 4BVSA 2I6DA 3VMFB 1W2BF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  3AGK A;  1VQ7 F;  4LCK A;  2OTJ F;  1VQP F;  1K9M H;  2JNB A;  3CCV F;  1DT9 A;  3NVI B;  3CPQ A;  2QI2 A;  1K8A H;  3RA6 A;  2AIF A;  2LBX A;  1X7P A;  1XBI A;  3CMA F;  3SIU A;  3CC7 F;  3WXM B;  1T0K B;  3O85 A;  3NMU C;  5GIO C;  1M1K H;  1H7M A;  3CXC F;  1GZ0 A;  1X7O A;  3E1Y A;  1Q82 H;  3SIV A;  4NUT A;  2VGN A;  2LBW A;  3PLA C;  3CCS F;  3CCR F;  1YJN F;  3V7Q A;  1VQ4 F;  1W3E X;  1K73 H;  2QEX F;  3CG6 A;  3NK7 A;  1RA4 A;  5FLX M;  1Q7Y H;  1W42 A;  2KTV A;  1RLG A;  2OHW A;  3CC2 F;  3HJW C;  1PXW A;  1E7K A;  2OZB A;  3HAX D;  1Q81 H;  2OTL F;  3I55 F;  1IPA A;  1VQO F;  3OBW A;  3G4S F;  5GIP C;  3RA5 A;  4BW0 B;  5GIN C;  3CPW F;  2FC3 A;  5GAN K;  4X3M A;  3NK6 A;  1CN7 A;  3G71 F;  1KC8 H;  3CCM F;  3N4Y A;  1CK2 A;  1YIJ F;  2WAL A;  4X3L A;  3E20 B;  1YJW F;  3ON1 A;  1VQ5 F;  2HVY D;  3J81 M;  3CCE F;  4BY9 D;  3FFM A;  3LWV C;  1VQM F;  1X52 A;  1QVG F;  3G6E F;  3CCQ F;  3CCU F;  1YHQ F;  1NJI H;  3NVK E;  1W41 A;  1N8R H;  1VQ9 F;  1VQ8 F;  2QA4 F;  5G4U C;  3CCL F;  1VQK F;  3CME F;  3JCM M;  3CC4 F;  3LFO A;  5EO3 A;  1ZWZ A;  3N4Z A;  1KQS F;  3LWP C;  1KD1 H;  1S72 F;  2CZW A;  3OW2 F;  2BO1 A;  5EWR A;  3LWQ C;  1VQ6 F;  3IR9 A;  1M90 H;  1W40 A;  2KG4 A;  1GO1 A;  3CD6 F;  3JAM M;  3LWR C;  4C4W C;  1VQL F;  1YIT F;  3MCA B;  1NMU B;  1Q86 H;  1JJ2 F;  1QVF F;  1GO0 A;  3OBY A;  2KTU A;  3J80 M;  1VQN F;  2ALE A;  2VGM A;  4TZZ A;  3V7E A;  3PAF A;  3CCJ F;  3GYQ A;  3VI6 A;  5G4V C;  1SDS A;  5A2Q M;  3I56 F;  5DCV A;  1YJ9 F;  3J7A R;  3LWO C;  5FJ4 C;  1YI2 F;  5GAP K;  2I6D A;  3VMF B;  1W2B F; 
#chains in the Genus database with same CATH topology
 2L26 A;  1W5F A;  1K9M H;  2JNB A;  1DT9 A;  3CPQ A;  3RA6 A;  1XBI A;  2GLZ A;  2CW4 A;  5JH7 B;  2W8B C;  1T0A A;  5CA0 B;  3NMU C;  4X1I B;  5GIO C;  5CA1 A;  4X1K B;  1X7O A;  3SIV A;  3JAK B;  4NUT A;  3PLA C;  3KJK A;  3CCR F;  3IKF A;  4TUY B;  3IMP A;  3S02 A;  5LYJ A;  3VTI C;  2QEX F;  1W59 A;  4TV8 B;  1RA4 A;  5J2U B;  3UT5 B;  1W42 A;  1RLG A;  3HJW C;  1PXW A;  2OZB A;  3HAX D;  3S0W A;  3DC2 A;  2P6Y A;  2UYK A;  4IHJ A;  2HP3 A;  4BT6 A;  2CSL A;  3JAT A;  3F0D A;  5IJ0 B;  3CPW F;  3K0T A;  2GVI A;  1GX1 A;  5JCO A;  3E20 B;  3JAL A;  2BTU A;  5JVD A;  2H6L A;  3MBM A;  2IG8 A;  4NWO B;  1H47 A;  4LNU B;  5LP6 C;  3FBA A;  1X52 A;  3RYH B;  3G6E F;  1ODE A;  3NVK E;  4DXD A;  4O4J B;  3P10 A;  4ZI7 A;  3KIZ A;  2B33 A;  4I50 B;  1VQ8 F;  3P0Z A;  1SA0 A;  4O2A A;  3LDT A;  3LFO A;  3WPX A;  4G4Y A;  5LA6 A;  2ZOV A;  3C9U A;  1U3L A;  1U43 A;  3S0Y A;  1KQS F;  3LWP C;  3K2X A;  2Z1E A;  1SZQ A;  2HRU A;  3JAW B;  5BMV A;  5ITZ B;  4I55 B;  5EZY B;  2IAF A;  2RHJ A;  5HWE A;  2Z01 A;  3IR9 A;  1M90 H;  3HKD B;  5EB0 A;  4YJ2 A;  1CLI A;  1VQL F;  5EB1 B;  4G4X A;  3ZP4 A;  2PHN A;  4F6R A;  3WGL A;  4DRX B;  1GO0 A;  1VQN F;  3CCJ F;  4O4L A;  5LOV A;  1W5E A;  1SDS A;  4RQO A;  5DCV A;  1W57 A;  2HP0 A;  2Q1Y A;  4HNA A;  5CB4 B;  3LWO C;  5FJ4 C;  3GTZ A;  3VMF B;  3FPI A;  2UYN A;  3RE3 A;  5EIB D;  1JN1 A;  3F0E A;  3RYI A;  2I6R A;  3CCV F;  1W5A A;  2QI2 A;  1K8A H;  3ZOP A;  2AIF A;  5LP6 A;  2LBX A;  3N2G A;  4ERH A;  4EI9 A;  3C8L A;  3CB2 A;  3WGK A;  3WGM A;  3JAT B;  3CC7 F;  1R1M A;  1T0K B;  3O85 A;  1U3P A;  2MQE A;  4B46 A;  3CXC F;  1TVK A;  1GZ0 A;  1Q82 H;  2RHH A;  1YQN A;  5FNV A;  2VGN A;  2LBW A;  4E6E A;  5KMG A;  1RQ7 A;  4U3J B;  3V7Q A;  1W3E X;  1K73 H;  3I7T A;  1VQ4 F;  3D00 A;  3HKB A;  3WPW A;  2R6R 1;  4ZOL A;  4PWT A;  5FLX M;  1Q7Y H;  2KTV A;  3RYF A;  4BT4 A;  4G4V A;  4WBN A;  1RLU A;  4ZI7 B;  3I55 F;  1SA0 B;  1FNK A;  3IEQ A;  4O2A B;  5KX5 A;  3TD5 A;  3ELC A;  4BW0 B;  4G4Z A;  3V3T A;  2PMP A;  2H8E A;  4KWE A;  2FC3 A;  5GAN K;  2Z1T A;  3NK6 A;  1W55 A;  4C8I A;  3G71 F;  2ZF8 A;  4EI7 A;  3HKC A;  1KC8 H;  3ZO8 A;  1CK2 A;  4X20 B;  2LBT A;  3ON1 A;  1YJW F;  2H8C A;  1COM A;  3M84 A;  3J81 M;  5J2T A;  3FD5 A;  3CCE F;  3FFM A;  4O2B A;  3LWV C;  4YJ2 B;  1VQM F;  2IQQ A;  3ESJ A;  2CWJ A;  1NJI H;  1W41 A;  5IYZ A;  1VQ9 F;  3KE1 A;  2RHO A;  4BT5 A;  1VQK F;  5EO3 A;  3N2K A;  1ZWZ A;  5MN5 A;  2HX0 A;  1YGY A;  4B62 A;  5LOV B;  1OFU A;  4BT3 A;  4R40 B;  5C8Y B;  1S72 F;  2CZW A;  3OW2 F;  2R75 1;  3JAR A;  3BYQ A;  2HP0 B;  4HNA B;  5EWR A;  3FD6 A;  1TUB A;  3WGJ A;  3TD3 A;  1IV1 A;  4ZHW A;  3P4E A;  2UYN B;  2KG4 A;  1GO1 A;  3HKE A;  4B45 A;  1XV2 A;  3CD6 F;  3S06 A;  4ZHQ A;  3LWR C;  4C4W C;  4BT7 A;  5LP6 B;  1XHO A;  3VOB A;  1NMU B;  3F0F A;  3VOA A;  2LCA A;  4B5C A;  1QVF F;  5GON A;  1VQV A;  4O4I A;  4IIJ A;  5HXZ A;  1Z5V A;  2VGM A;  2HRY A;  5EYP B;  3VYS C;  5JQG A;  4O4H A;  5FNV B;  2VAW A;  5EAZ A;  4BVR A;  1FSZ A;  4I4T A;  3WJP A;  3J7A R;  4ZOL B;  4YJ3 A;  1YI2 F;  4BVS A;  3NVI B;  3AGK A;  2RHL A;  4LCK A;  5B8F A;  1VQP F;  4EI8 A;  1U40 A;  4BT2 A;  5MN6 A;  3SIU A;  3KHN A;  3WXM B;  3F0G A;  4BVT A;  5CA1 B;  5CA0 A;  3K12 A;  4X1I A;  2YXZ A;  1H7M A;  2FGY A;  1OAP A;  3E1Y A;  5AVM A;  3JAK A;  2ZAU A;  2EWC A;  1DBF A;  5LYJ B;  3E22 A;  4O2B B;  4C81 A;  1UI9 A;  3CG6 A;  3LYB A;  3NK7 A;  5HY2 A;  3CYP B;  5J2U A;  3CC2 F;  3C9R A;  1IPA A;  3N2K B;  3QTY A;  4IHJ B;  3G4S F;  2G9I A;  1X25 A;  3RA5 A;  3HTN A;  4ZHY B;  3JAR B;  1IV4 A;  3IKE A;  3QHD A;  3TD4 A;  2HS0 A;  1TUB B;  2UYJ A;  3N4Y A;  3I3F A;  3RYC A;  3CCM F;  1YIJ F;  2WAL A;  1W58 1;  3JAL B;  1RQ2 A;  3CYQ A;  5JVD B;  1IV2 A;  2HVY D;  4ZHQ B;  2CHS A;  3EOR A;  4U39 A;  3B6N A;  4M8I A;  3WJR A;  1QVG F;  3CCQ F;  3CCU F;  1YHQ F;  1N8R H;  5G4U C;  5GON B;  1FFX A;  4ZHV A;  4IIJ B;  3CME F;  3JCM M;  3VIU A;  5LA6 B;  2QTP A;  5JQG B;  5HY1 A;  4O4H B;  3R0P A;  2HS4 A;  3MCQ A;  3HWU A;  5BMV B;  1QU9 A;  3JAS A;  4I4T B;  1XRG A;  5ITZ A;  2BO1 A;  4YJ3 B;  5EZY A;  4FFB A;  2VAP A;  3D54 A;  3ERN A;  4EB6 A;  2Z1F A;  3HKD A;  2V9Y A;  1YIT F;  1VHA A;  2VXY A;  4F6R B;  3MCA B;  3KJJ A;  1Q86 H;  3F6M A;  1JJ2 F;  3K14 A;  4DRX A;  4TV9 A;  2BTQ B;  4NQ3 A;  2Q1X A;  5EIB C;  2ALE A;  4TZZ A;  3V7E A;  3PAF A;  4O4L B;  1Q8R A;  3C9T A;  5A2Q M;  3C9S A;  3E22 B;  3T80 A;  3I56 F;  1YJ9 F;  1FNJ A;  2RB9 A;  2ZVZ A;  5HY0 A;  5CB4 A;  2ZOD A;  3CMA F;  5IT9 M;  1VQ7 F;  2OTJ F;  3RYI B;  2DT4 A;  2VAM A;  3N2G B;  2K1S A;  3U0O A;  2GZL A;  3D01 A;  1VH8 A;  1JFF A;  1X7P A;  3V4D A;  5IJ9 A;  2N48 A;  5MN4 A;  3WGN A;  4C8E A;  3S03 A;  1M1K H;  1TVK B;  2DYY A;  3RYC B;  4X1Y A;  5KMG B;  2HQS C;  3CCS F;  1YJN F;  3VYT C;  4U3J A;  3HKB B;  1ONI A;  2F9Z C;  2ZVY A;  2AIZ P;  1IV3 A;  5HP8 A;  5LXT A;  1UFY A;  1W5B A;  3RYF B;  1J7H A;  2CVL A;  4WBN B;  2OHW A;  1E7K A;  4G88 A;  1FFX B;  2AMT A;  2UYP A;  1Q81 H;  3IEW A;  2OTL F;  4C82 A;  5HXU A;  1JD1 A;  5KX5 B;  1VQO F;  1JY8 A;  3OBW A;  5GIP C;  5JH7 A;  3M1X A;  3JVH A;  3WJQ A;  2HS3 A;  3QUW A;  5GIN C;  3JAS B;  3S0H A;  4XCQ A;  4X3M A;  1CN7 A;  3HKC B;  4X1K A;  4FFB B;  3VO8 A;  1H48 A;  4X3L A;  4EB6 B;  1VQ5 F;  5J2T B;  4TUY A;  4X20 A;  3ZP7 A;  4BY9 D;  1PF5 A;  2CHT A;  4TV8 A;  4ZK7 A;  3UT5 A;  3LME A;  4C8G A;  3Q8H A;  4BVQ A;  3M4S A;  5IYZ B;  2UZH A;  4TV9 B;  2QA4 F;  3CCL F;  3VYU C;  3CC4 F;  2BTO A;  4RHA A;  1Z5W A;  3L7Q A;  3N4Z A;  2OTM A;  4G4W A;  1KD1 H;  5IJ0 A;  5C8Y A;  1VK3 A;  3LWQ C;  5HP7 A;  1VQ6 F;  1NQ3 A;  3OON A;  3HKE B;  3VCZ A;  3JAM M;  5HY4 A;  4LNU A;  1JFF B;  5IJ9 B;  2Z1U A;  3RYH A;  4O4J A;  3OBY A;  2KTU A;  4I50 A;  4O4I B;  3J80 M;  3MQW A;  2YYE A;  2NMU A;  5EYP A;  2KGW A;  4X1Y B;  1QAH A;  3GYQ A;  3VI6 A;  5JCO C;  5G4V C;  5LXT B;  3JAW A;  3GHZ A;  4I55 A;  1QD9 A;  1KNK A;  1KNJ A;  3DDN A;  3MDO A;  5GAP K;  2I6D A;  1W40 A;  1W2B F; 
#chains in the Genus database with same CATH homology
 5IT9 M;  3AGK A;  1VQ7 F;  4LCK A;  2OTJ F;  1VQP F;  1K9M H;  2JNB A;  3CCV F;  1DT9 A;  4EI8 A;  3CPQ A;  2QI2 A;  1K8A H;  3RA6 A;  3NVI B;  2AIF A;  2LBX A;  1X7P A;  1XBI A;  2GLZ A;  4EI9 A;  3CMA F;  3SIU A;  3CC7 F;  3WXM B;  4BVT A;  1T0K B;  3O85 A;  3NMU C;  5GIO C;  1M1K H;  1H7M A;  2FGY A;  3CXC F;  1GZ0 A;  1X7O A;  3E1Y A;  1Q82 H;  3SIV A;  4NUT A;  2VGN A;  2LBW A;  3PLA C;  3CCS F;  3CCR F;  1YJN F;  3V7Q A;  1VQ4 F;  1W3E X;  1K73 H;  3D00 A;  2QEX F;  3CG6 A;  2F9Z C;  3NK7 A;  1RA4 A;  5FLX M;  5HY2 A;  1Q7Y H;  1W42 A;  2KTV A;  1RLG A;  2OHW A;  3CC2 F;  3HJW C;  1PXW A;  1E7K A;  2OZB A;  3HAX D;  1Q81 H;  2OTL F;  3I55 F;  5HXU A;  1IPA A;  1VQO F;  3OBW A;  3G4S F;  5GIP C;  3RA5 A;  4BW0 B;  3V3T A;  5GIN C;  3CPW F;  2FC3 A;  5GAN K;  4XCQ A;  4X3M A;  3NK6 A;  1CN7 A;  3G71 F;  4EI7 A;  1KC8 H;  3CCM F;  3N4Y A;  1CK2 A;  1YIJ F;  2WAL A;  4X3L A;  3E20 B;  1YJW F;  3ON1 A;  1VQ5 F;  2HVY D;  3J81 M;  3CCE F;  4BY9 D;  3FFM A;  3LWV C;  1VQM F;  1X52 A;  1QVG F;  4BVQ A;  3G6E F;  3CCQ F;  3CCU F;  1YHQ F;  1NJI H;  3NVK E;  1W41 A;  1N8R H;  1VQ9 F;  1VQ8 F;  2QA4 F;  5G4U C;  3CCL F;  1VQK F;  3CME F;  3JCM M;  3CC4 F;  3LFO A;  5EO3 A;  1ZWZ A;  5HY1 A;  3N4Z A;  1KQS F;  3LWP C;  1KD1 H;  1S72 F;  2CZW A;  3OW2 F;  2BO1 A;  5EWR A;  5HWE A;  3LWQ C;  1VQ6 F;  3IR9 A;  1M90 H;  1W40 A;  2KG4 A;  1GO1 A;  3CD6 F;  3JAM M;  5HY4 A;  3LWR C;  4C4W C;  1VQL F;  1YIT F;  3MCA B;  1NMU B;  1Q86 H;  1JJ2 F;  1QVF F;  1GO0 A;  3OBY A;  2KTU A;  3J80 M;  4NQ3 A;  5HXZ A;  1VQN F;  2ALE A;  2VGM A;  4TZZ A;  3V7E A;  3PAF A;  3CCJ F;  3GYQ A;  3VI6 A;  5G4V C;  1SDS A;  5A2Q M;  4BVR A;  3I56 F;  5DCV A;  1YJ9 F;  3J7A R;  3LWO C;  5HY0 A;  5FJ4 C;  1YI2 F;  5GAP K;  4BVS A;  2I6D A;  3VMF B;  1W2B F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...