5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
1PXWA 4TZZA 2OZBA 1SDSA 2QI2A 3FFMA 1VQ6F 1W42A 3CC2F 1W3EX 3GYQA 4BW0B 1VQ9F 1VQ5F 5GIOC 5G4VC 2OTLF 1KC8H 3SIVA 3RA6A 2LBXA 3VMFB 3E20B 1VQ8F 5FJ4C 3VI6A 1YI2F 1W2BF 1QVFF 1YIJF 2CZWA 1M1KH 1VQLF 3ON1A 5FLXM 1NMUB 3I55F 1YITF 1E7KA 1GO1A 3LWPC 1H7MA 4C4WC 3MCAB 3IR9A 3OBYA 1Q86H 2VGNA 3WXMB 3AGKA 3G6EF 2I6DA 1RA4A 3CCRF 5DCVA 2QA4F 3CCQF 2BO1A 1ZWZA 5GINC 1NJIH 1T0KB 1GO0A 5G4UC 3NVKE 4X3LA 3E1YA 2FC3A 3LWOC 1K8AH 1YJNF 3CCVF 5GIPC 3CCMF 1QVGF 3J7AR 1VQKF 1Q82H 3HJWC 5GAPK 3PLAC 1IPAA 3V7QA 3CCEF 4BY9D 4LCKA 3CC7F 3LWRC 3V7EA 1DT9A 3CMEF 3CPWF 1VQOF 2ALEA 1VQ7F 1Q81H 2KTUA 2WALA 2KG4A 3RA5A 1Q7YH 3OBWA 3G71F 5A2QM 1RLGA 3G4SF 3NMUC 1GZ0A 2HVYD 1JJ2F 1VQ4F 3CPQA 3CXCF 2QEXF 3N4YA 3CCLF 1YHQF 3CD6F 3J81M 3I56F 3OW2F 1YJ9F 1K73H 1N8RH 2KTVA 3CMAF 1X7OA 1KD1H 3LFOA 5IT9M 1K9MH 3CC4F 3CCUF 2LBWA 2VGMA 1W40A 1YJWF 3CG6A 3J80M 4X3MA 3O85A 3LWVC 2OHWA 2AIFA 1VQMF 2JNBA 1W41A 1CK2A 3HAXD 3LWQC 3NVIB 5EWRA 3JAMM 3NK7A 5EO3A 4NUTA 3NK6A 3N4ZA 1X7PA 3JCMM 1X52A 1S72F 3SIUA 1M90H 3PAFA 1VQPF 1VQNF 3CCSF 3CCJF 1CN7A 1XBIA 1KQSF 5GANK 2OTJF
chains in the Genus database with same CATH superfamily
5CB4B 5JQGB 2OZBA 3P4EA 1SDSA 2QI2A 3FFMA 1W42A 3HKCA 3RE3A 1SZQA 3N2KB 4O4IB 3GYQA 1VQ9F 3M4SA 1VQ5F 3WJQA 3R0PA 3HWUA 2I6RA 3IMPA 2OTLF 1FFXB 2CSLA 2HS0A 5EZYA 3GTZA 4DRXA 2HS4A 4O4HB 3HKEB 3N2GA 3VMFB 2RB9A 3OONA 3S0WA 1IV1A 2RHOA 4ZI7A 3JVHA 1VQLF 3TD5A 2PHNA 3JALB 4TV9B 4C8EA 3FD5A 1NMUB 2DYYA 1YITF 1QAHA 1E7KA 3JAWA 3LWPC 4O4JA 4BT5A 3FPIA 5EIBC 4TUYB 1QD9A 1ZWZA 1NJIH 1DBFA 5G4UC 2VAMA 2FGYA 3E1YA 3CB2A 1K8AH 4ZHWA 5IJ9A 1VH8A 4DXDA 4O2AB 5GIPC 3CCMF 2R6R1 2YYEA 3EORA 3ZOPA 1VQKF 3HJWC 2UYJA 3PLAC 3V7QA 1W5EA 3LWRC 1UI9A 4YJ3A 3CPWF 4I50B 5BMVB 2KG4A 5MN5A 3B6NA 1IV2A 3F0DA 4G88A 3C9SA 1Z5WA 5EYPA 3ZP7A 4X20B 4U39A 2UYKA 3KJJA 5KX5B 2RHJA 3N4YA 1YHQF 3WPWA 3VYSC 5IYZA 4LNUA 1TVKB 4E6EA 5JVDB 3IEWA 2ZVYA 1YJ9F 2H6LA 3I3FA 3Q8HA 1JY8A 2KTVA 2VXYA 5EAZA 2UYNB 3CMAF 1KD1H 3CC4F 2GVIA 5KX5A 3VOAA 4G4XA 3CG6A 4IHJA 3LWVC 5FNVA 1W581 1W41A 3V4DA 5BMVA 1XV2A 3F0GA 3NVIB 3NK7A 5EO3A 3JCMM 2BTQB 2P6YA 2Q1XA 4ZOLA 1FSZA 2V9YA 3JASB 3CCJF 3D54A 5JCOA 1CN7A 3WJRA 3K14A 2HRYA 2HP0A 4C8GA 5GANK 2OTJF 1PXWA 4HNAB 4ERHA 3U0OA 5LP6A 3CC2F 1W3EX 2L26A 4NWOB 3ELCA 3LDTA 4TUYA 4B5CA 3BYQA 5EB0A 2Z1FA 3WGJA 5GIOC 5HXUA 5LXTA 2HRUA 3ZO8A 2ZOVA 3RA6A 4C8IA 1W5FA 3JALA 4BVQA 1VQ8F 5LA6A 3VYUC 3MDOA 3VI6A 1W2BF 5C8YA 1GX1A 3RYHB 5LA6B 1M1KH 4G4WA 2NMUA 4O4HA 3VYTC 1H47A 3OBYA 1Q86H 3S03A 4B45A 2HP3A 3S0HA 2I6DA 4U3JB 5DCVA 2IQQA 3CCQF 1R1MA 1J7HA 3WPXA 2BO1A 3HKCB 5GINC 2HX0A 5JQGA 5C8YB 3LWOC 3JASA 3GHZA 4O2BB 5GONB 4ZOLB 4C82A 5HY2A 3TD4A 1VQOF 3S06A 1W55A 3F6MA 4EI8A 1RLUA 3M1XA 3F0FA 1RLGA 1GZ0A 4X1YB 2HVYD 1NQ3A 3CYQA 4C81A 3TD3A 3CPQA 2CWJA 3J81M 3OW2F 2UYNA 4ZK7A 1VHAA 1IV3A 3RYHA 3FBAA 1K73H 1N8RH 4LNUB 3JAKA 2GLZA 1K9MH 3DDNA 1Z5VA 4BVRA 3CCUF 2ZODA 3VOBA 1YJWF 5LXTB 2Z1EA 3F0EA 2OHWA 1YQNA 3RYIB 2YXZA 2JNBA 1ODEA 5LP6B 4NUTA 4HNAA 3NK6A 1X7PA 3SIUA 4O4LA 3PAFA 4EB6B 5J2UB 1VQNF 5IJ9B 1KQSF 4O4LB 3MBMA 4TZZA 4WBNB 3S02A 1FNKA 3D00A 1RQ2A 3C9UA 3WGKA 3MCQA 5MN6A 3LMEA 4BW0B 5MN4A 4BT7A 2ZVZA 4B62A 1KNJA 1U3LA 3RYIA 5G4VC 2Z1UA 4O4JB 4IHJB 2CW4A 1KC8H 2K1SA 1CLIA 3P10A 4RHAA 1JN1A 2LBXA 2LBTA 3JAKB 3E20B 4X1KB 3WGLA 4ZHVA 4ZI7B 3FD6A 5IJ0B 5JVDA 1YIJF 3UT5A 1TVKA 1OFUA 3I55F 1IV4A 1YGYA 2HQSC 3MCAB 5EZYB 4DRXB 1SA0A 1FFXA 2VGNA 3WXMB 4X1YA 4BT4A 3G6EF 5LYJA 2GZLA 4M8IA 3CCRF 4TV8B 3WGMA 4ZHQA 4YJ3B 4R40B 1T0KB 2PMPA 2Z01A 3NVKE 1Q8RA 1W5AA 2FC3A 4O2BA 4O2AA 1COMA 2BTUA 1UFYA 3J7AR 3E22B 3RYFB 3HKDA 1IPAA 4YJ2B 3CCEF 3ERNA 3CMEF 1VQ7F 4X1IB 1Q81H 2KTUA 2WALA 1KNKA 3G71F 5A2QM 2AMTA 4U3JA 3G4SF 3NMUC 3JATB 1JJ2F 3K0TA 4I4TA 3RYCA 3CD6F 3WGNA 1JD1A 3C9RA 3HKBB 3I56F 2CVLA 3MQWA 1XHOA 1XRGA 2AIZP 2EWCA 3P0ZA 4F6RA 1X7OA 5HY4A 3LFOA 5IT9M 3HKBA 1U40A 3RYCB 3VCZA 2LBWA 2VGMA 1W40A 2CHSA 2IG8A 5CA0A 4X3MA 3O85A 2AIFA 3K12A 1VQMF 1CK2A 5EB1B 3N2KA 1ONIA 3LWQC 2ZAUA 4XCQA 5EWRA 3RYFA 1X52A 3E22A 4G4ZA 2HP0B 5B8FA 3S0YA 2BTOA 3CYPB 1W57A 2UZHA 2ZF8A 5HWEA 1X25A 4RQOA 3D01A 2R751 2HS3A 1VQ6F 2IAFA 4G4VA 2Z1TA 4ZHQB 3KE1A 2UYPA 3I7TA 4TV8A 5ITZA 5CA1B 3L7QA 5JH7B 5LYJB 1T0AA 1U43A 5FNVB 5KMGB 5J2TB 1TUBA 2VAPA 3C9TA 1SA0B 2MQEA 2Q1YA 3SIVA 3QTYA 4G4YA 3IEQA 3QUWA 4I55A 4IIJB 3UT5B 5FJ4C 5IJ0A 1YI2F 1QU9A 5LOVB 1QVFF 2CZWA 4IIJA 4X1KA 3ON1A 5FLXM 5IYZB 2OTMA 1GO1A 1H7MA 4C4WC 3IR9A 4EI9A 3JARB 4X20A 4FFBB 4PWTA 5KMGA 5J2TA 3AGKA 5EYPB 1RA4A 2G9IA 4BT6A 5CA1A 2QA4F 1W59A 3C8LA 4I50A 4KWEA 1JFFA 5JCOC 3K2XA 1GO0A 3VIUA 4WBNA 4X3LA 3IKFA 3KJKA 3T80A 2RHLA 1YJNF 3CCVF 2LCAA 5J2UA 4EB6A 1QVGF 4BVTA 1Q82H 5GAPK 2VAWA 5HP8A 2QTPA 4BY9D 3QHDA 4LCKA 1JFFB 3CC7F 3V7EA 2RHHA 1DT9A 2N48A 2ALEA 3DC2A 4BVSA 3RA5A 1Q7YH 1W5BA 3OBWA 2H8CA 4BT3A 3WJPA 1PF5A 4FFBA 4ZHYB 2DT4A 3HTNA 3JARA 5CA0B 1VQ4F 3CXCF 3JAWB 2QEXF 3CCLF 2W8BC 4BT2A 4EI7A 3ZP4A 2H8EA 4TV9A 2F9ZC 4F6RB 3IKEA 5HY0A 5LOVA 3VTIC 5HY1A 4I55B 1RQ7A 3HKEA 3N2GB 2B33A 1FNJA 3ESJA 4I4TB 1VK3A 5AVMA 3LYBA 3KHNA 3JATA 3J80M 1U3PA 1TUBB 5HP7A 1H48A 5JH7A 3VO8A 5ITZB 3M84A 2CHTA 4X1IA 4O4IA 1OAPA 3HAXD 4YJ2A 3JAMM 3N4ZA 3HKDB 5CB4A 5HXZA 1S72F 3V3TA 1M90H 1VQVA 5GONA 1VQPF 3CCSF 5EIBD 5LP6C 4NQ3A 1XBIA 4B46A 3KIZA 2KGWA
chains in the Genus database with same CATH topology
1PXWA 4TZZA 2OZBA 1SDSA 2QI2A 3FFMA 1VQ6F 1W42A 3D00A 3CC2F 1W3EX 3GYQA 4BW0B 1VQ9F 1VQ5F 5GIOC 5G4VC 2OTLF 1KC8H 5HXUA 3SIVA 3RA6A 2LBXA 3VMFB 3E20B 4BVQA 1VQ8F 5FJ4C 3VI6A 1YI2F 1W2BF 1QVFF 1YIJF 2CZWA 1M1KH 1VQLF 3ON1A 5FLXM 1NMUB 3I55F 1YITF 1E7KA 1GO1A 3LWPC 1H7MA 4C4WC 3MCAB 3IR9A 3OBYA 4EI9A 1Q86H 2VGNA 3WXMB 3AGKA 3G6EF 2I6DA 1RA4A 3CCRF 5DCVA 2QA4F 3CCQF 2BO1A 1ZWZA 5GINC 1NJIH 1T0KB 1GO0A 5G4UC 3NVKE 4X3LA 2FGYA 3E1YA 2FC3A 3LWOC 1K8AH 1YJNF 3CCVF 1KQSF 5GIPC 3CCMF 1QVGF 3J7AR 4BVTA 1Q82H 1VQKF 3HJWC 5GAPK 3PLAC 1IPAA 3V7QA 3CCEF 5HY2A 4BY9D 4LCKA 3CC7F 3LWRC 3V7EA 1DT9A 3CMEF 3CPWF 1VQOF 2ALEA 1VQ7F 1Q81H 2KTUA 2WALA 4BVSA 2KG4A 3RA5A 4EI8A 1Q7YH 3OBWA 3G71F 5A2QM 1RLGA 3G4SF 3NMUC 1GZ0A 2HVYD 1JJ2F 1VQ4F 3CPQA 3CXCF 2QEXF 3N4YA 3CCLF 1YHQF 3CD6F 3J81M 4EI7A 3I56F 3OW2F 2F9ZC 5HY0A 1YJ9F 5HY1A 1K73H 1N8RH 2KTVA 3CMAF 1X7OA 5HY4A 3LFOA 1KD1H 5IT9M 2GLZA 1K9MH 3CC4F 4BVRA 3CCUF 2LBWA 2VGMA 1W40A 1YJWF 3CG6A 3J80M 4X3MA 3O85A 3LWVC 2OHWA 2AIFA 1VQMF 2JNBA 1W41A 1CK2A 3HAXD 3LWQC 3NVIB 5EWRA 4XCQA 3NK7A 5EO3A 3JAMM 4NUTA 3NK6A 3N4ZA 1X7PA 3JCMM 5HXZA 1X52A 1S72F 3V3TA 1M90H 3PAFA 3SIUA 1VQPF 1VQNF 3CCSF 3CCJF 1CN7A 4NQ3A 1XBIA 5HWEA 5GANK 2OTJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXW A;  4TZZ A;  2OZB A;  1SDS A;  2QI2 A;  3FFM A;  1VQ6 F;  1W42 A;  3CC2 F;  1W3E X;  3GYQ A;  4BW0 B;  1VQ9 F;  1VQ5 F;  5GIO C;  5G4V C;  2OTL F;  1KC8 H;  3SIV A;  3RA6 A;  2LBX A;  3VMF B;  3E20 B;  1VQ8 F;  5FJ4 C;  3VI6 A;  1YI2 F;  1W2B F;  1QVF F;  1YIJ F;  2CZW A;  1M1K H;  1VQL F;  3ON1 A;  5FLX M;  1NMU B;  3I55 F;  1YIT F;  1E7K A;  1GO1 A;  3LWP C;  1H7M A;  4C4W C;  3MCA B;  3IR9 A;  3OBY A;  1Q86 H;  2VGN A;  3WXM B;  3AGK A;  3G6E F;  2I6D A;  1RA4 A;  3CCR F;  5DCV A;  2QA4 F;  3CCQ F;  2BO1 A;  1ZWZ A;  5GIN C;  1NJI H;  1T0K B;  1GO0 A;  5G4U C;  3NVK E;  4X3L A;  3E1Y A;  2FC3 A;  3LWO C;  1K8A H;  1YJN F;  3CCV F;  5GIP C;  3CCM F;  1QVG F;  3J7A R;  1VQK F;  1Q82 H;  3HJW C;  5GAP K;  3PLA C;  1IPA A;  3V7Q A;  3CCE F;  4BY9 D;  4LCK A;  3CC7 F;  3LWR C;  3V7E A;  1DT9 A;  3CME F;  3CPW F;  1VQO F;  2ALE A;  1VQ7 F;  1Q81 H;  2KTU A;  2WAL A;  2KG4 A;  3RA5 A;  1Q7Y H;  3OBW A;  3G71 F;  5A2Q M;  1RLG A;  3G4S F;  3NMU C;  1GZ0 A;  2HVY D;  1JJ2 F;  1VQ4 F;  3CPQ A;  3CXC F;  2QEX F;  3N4Y A;  3CCL F;  1YHQ F;  3CD6 F;  3J81 M;  3I56 F;  3OW2 F;  1YJ9 F;  1K73 H;  1N8R H;  2KTV A;  3CMA F;  1X7O A;  1KD1 H;  3LFO A;  5IT9 M;  1K9M H;  3CC4 F;  3CCU F;  2LBW A;  2VGM A;  1W40 A;  1YJW F;  3CG6 A;  3J80 M;  4X3M A;  3O85 A;  3LWV C;  2OHW A;  2AIF A;  1VQM F;  2JNB A;  1W41 A;  1CK2 A;  3HAX D;  3LWQ C;  3NVI B;  5EWR A;  3JAM M;  3NK7 A;  5EO3 A;  4NUT A;  3NK6 A;  3N4Z A;  1X7P A;  3JCM M;  1X52 A;  1S72 F;  3SIU A;  1M90 H;  3PAF A;  1VQP F;  1VQN F;  3CCS F;  3CCJ F;  1CN7 A;  1XBI A;  1KQS F;  5GAN K;  2OTJ F; 
#chains in the Genus database with same CATH topology
 5CB4 B;  5JQG B;  2OZB A;  3P4E A;  1SDS A;  2QI2 A;  3FFM A;  1W42 A;  3HKC A;  3RE3 A;  1SZQ A;  3N2K B;  4O4I B;  3GYQ A;  1VQ9 F;  3M4S A;  1VQ5 F;  3WJQ A;  3R0P A;  3HWU A;  2I6R A;  3IMP A;  2OTL F;  1FFX B;  2CSL A;  2HS0 A;  5EZY A;  3GTZ A;  4DRX A;  2HS4 A;  4O4H B;  3HKE B;  3N2G A;  3VMF B;  2RB9 A;  3OON A;  3S0W A;  1IV1 A;  2RHO A;  4ZI7 A;  3JVH A;  1VQL F;  3TD5 A;  2PHN A;  3JAL B;  4TV9 B;  4C8E A;  3FD5 A;  1NMU B;  2DYY A;  1YIT F;  1QAH A;  1E7K A;  3JAW A;  3LWP C;  4O4J A;  4BT5 A;  3FPI A;  5EIB C;  4TUY B;  1QD9 A;  1ZWZ A;  1NJI H;  1DBF A;  5G4U C;  2VAM A;  2FGY A;  3E1Y A;  3CB2 A;  1K8A H;  4ZHW A;  5IJ9 A;  1VH8 A;  4DXD A;  4O2A B;  5GIP C;  3CCM F;  2R6R 1;  2YYE A;  3EOR A;  3ZOP A;  1VQK F;  3HJW C;  2UYJ A;  3PLA C;  3V7Q A;  1W5E A;  3LWR C;  1UI9 A;  4YJ3 A;  3CPW F;  4I50 B;  5BMV B;  2KG4 A;  5MN5 A;  3B6N A;  1IV2 A;  3F0D A;  4G88 A;  3C9S A;  1Z5W A;  5EYP A;  3ZP7 A;  4X20 B;  4U39 A;  2UYK A;  3KJJ A;  5KX5 B;  2RHJ A;  3N4Y A;  1YHQ F;  3WPW A;  3VYS C;  5IYZ A;  4LNU A;  1TVK B;  4E6E A;  5JVD B;  3IEW A;  2ZVY A;  1YJ9 F;  2H6L A;  3I3F A;  3Q8H A;  1JY8 A;  2KTV A;  2VXY A;  5EAZ A;  2UYN B;  3CMA F;  1KD1 H;  3CC4 F;  2GVI A;  5KX5 A;  3VOA A;  4G4X A;  3CG6 A;  4IHJ A;  3LWV C;  5FNV A;  1W58 1;  1W41 A;  3V4D A;  5BMV A;  1XV2 A;  3F0G A;  3NVI B;  3NK7 A;  5EO3 A;  3JCM M;  2BTQ B;  2P6Y A;  2Q1X A;  4ZOL A;  1FSZ A;  2V9Y A;  3JAS B;  3CCJ F;  3D54 A;  5JCO A;  1CN7 A;  3WJR A;  3K14 A;  2HRY A;  2HP0 A;  4C8G A;  5GAN K;  2OTJ F;  1PXW A;  4HNA B;  4ERH A;  3U0O A;  5LP6 A;  3CC2 F;  1W3E X;  2L26 A;  4NWO B;  3ELC A;  3LDT A;  4TUY A;  4B5C A;  3BYQ A;  5EB0 A;  2Z1F A;  3WGJ A;  5GIO C;  5HXU A;  5LXT A;  2HRU A;  3ZO8 A;  2ZOV A;  3RA6 A;  4C8I A;  1W5F A;  3JAL A;  4BVQ A;  1VQ8 F;  5LA6 A;  3VYU C;  3MDO A;  3VI6 A;  1W2B F;  5C8Y A;  1GX1 A;  3RYH B;  5LA6 B;  1M1K H;  4G4W A;  2NMU A;  4O4H A;  3VYT C;  1H47 A;  3OBY A;  1Q86 H;  3S03 A;  4B45 A;  2HP3 A;  3S0H A;  2I6D A;  4U3J B;  5DCV A;  2IQQ A;  3CCQ F;  1R1M A;  1J7H A;  3WPX A;  2BO1 A;  3HKC B;  5GIN C;  2HX0 A;  5JQG A;  5C8Y B;  3LWO C;  3JAS A;  3GHZ A;  4O2B B;  5GON B;  4ZOL B;  4C82 A;  5HY2 A;  3TD4 A;  1VQO F;  3S06 A;  1W55 A;  3F6M A;  4EI8 A;  1RLU A;  3M1X A;  3F0F A;  1RLG A;  1GZ0 A;  4X1Y B;  2HVY D;  1NQ3 A;  3CYQ A;  4C81 A;  3TD3 A;  3CPQ A;  2CWJ A;  3J81 M;  3OW2 F;  2UYN A;  4ZK7 A;  1VHA A;  1IV3 A;  3RYH A;  3FBA A;  1K73 H;  1N8R H;  4LNU B;  3JAK A;  2GLZ A;  1K9M H;  3DDN A;  1Z5V A;  4BVR A;  3CCU F;  2ZOD A;  3VOB A;  1YJW F;  5LXT B;  2Z1E A;  3F0E A;  2OHW A;  1YQN A;  3RYI B;  2YXZ A;  2JNB A;  1ODE A;  5LP6 B;  4NUT A;  4HNA A;  3NK6 A;  1X7P A;  3SIU A;  4O4L A;  3PAF A;  4EB6 B;  5J2U B;  1VQN F;  5IJ9 B;  1KQS F;  4O4L B;  3MBM A;  4TZZ A;  4WBN B;  3S02 A;  1FNK A;  3D00 A;  1RQ2 A;  3C9U A;  3WGK A;  3MCQ A;  5MN6 A;  3LME A;  4BW0 B;  5MN4 A;  4BT7 A;  2ZVZ A;  4B62 A;  1KNJ A;  1U3L A;  3RYI A;  5G4V C;  2Z1U A;  4O4J B;  4IHJ B;  2CW4 A;  1KC8 H;  2K1S A;  1CLI A;  3P10 A;  4RHA A;  1JN1 A;  2LBX A;  2LBT A;  3JAK B;  3E20 B;  4X1K B;  3WGL A;  4ZHV A;  4ZI7 B;  3FD6 A;  5IJ0 B;  5JVD A;  1YIJ F;  3UT5 A;  1TVK A;  1OFU A;  3I55 F;  1IV4 A;  1YGY A;  2HQS C;  3MCA B;  5EZY B;  4DRX B;  1SA0 A;  1FFX A;  2VGN A;  3WXM B;  4X1Y A;  4BT4 A;  3G6E F;  5LYJ A;  2GZL A;  4M8I A;  3CCR F;  4TV8 B;  3WGM A;  4ZHQ A;  4YJ3 B;  4R40 B;  1T0K B;  2PMP A;  2Z01 A;  3NVK E;  1Q8R A;  1W5A A;  2FC3 A;  4O2B A;  4O2A A;  1COM A;  2BTU A;  1UFY A;  3J7A R;  3E22 B;  3RYF B;  3HKD A;  1IPA A;  4YJ2 B;  3CCE F;  3ERN A;  3CME F;  1VQ7 F;  4X1I B;  1Q81 H;  2KTU A;  2WAL A;  1KNK A;  3G71 F;  5A2Q M;  2AMT A;  4U3J A;  3G4S F;  3NMU C;  3JAT B;  1JJ2 F;  3K0T A;  4I4T A;  3RYC A;  3CD6 F;  3WGN A;  1JD1 A;  3C9R A;  3HKB B;  3I56 F;  2CVL A;  3MQW A;  1XHO A;  1XRG A;  2AIZ P;  2EWC A;  3P0Z A;  4F6R A;  1X7O A;  5HY4 A;  3LFO A;  5IT9 M;  3HKB A;  1U40 A;  3RYC B;  3VCZ A;  2LBW A;  2VGM A;  1W40 A;  2CHS A;  2IG8 A;  5CA0 A;  4X3M A;  3O85 A;  2AIF A;  3K12 A;  1VQM F;  1CK2 A;  5EB1 B;  3N2K A;  1ONI A;  3LWQ C;  2ZAU A;  4XCQ A;  5EWR A;  3RYF A;  1X52 A;  3E22 A;  4G4Z A;  2HP0 B;  5B8F A;  3S0Y A;  2BTO A;  3CYP B;  1W57 A;  2UZH A;  2ZF8 A;  5HWE A;  1X25 A;  4RQO A;  3D01 A;  2R75 1;  2HS3 A;  1VQ6 F;  2IAF A;  4G4V A;  2Z1T A;  4ZHQ B;  3KE1 A;  2UYP A;  3I7T A;  4TV8 A;  5ITZ A;  5CA1 B;  3L7Q A;  5JH7 B;  5LYJ B;  1T0A A;  1U43 A;  5FNV B;  5KMG B;  5J2T B;  1TUB A;  2VAP A;  3C9T A;  1SA0 B;  2MQE A;  2Q1Y A;  3SIV A;  3QTY A;  4G4Y A;  3IEQ A;  3QUW A;  4I55 A;  4IIJ B;  3UT5 B;  5FJ4 C;  5IJ0 A;  1YI2 F;  1QU9 A;  5LOV B;  1QVF F;  2CZW A;  4IIJ A;  4X1K A;  3ON1 A;  5FLX M;  5IYZ B;  2OTM A;  1GO1 A;  1H7M A;  4C4W C;  3IR9 A;  4EI9 A;  3JAR B;  4X20 A;  4FFB B;  4PWT A;  5KMG A;  5J2T A;  3AGK A;  5EYP B;  1RA4 A;  2G9I A;  4BT6 A;  5CA1 A;  2QA4 F;  1W59 A;  3C8L A;  4I50 A;  4KWE A;  1JFF A;  5JCO C;  3K2X A;  1GO0 A;  3VIU A;  4WBN A;  4X3L A;  3IKF A;  3KJK A;  3T80 A;  2RHL A;  1YJN F;  3CCV F;  2LCA A;  5J2U A;  4EB6 A;  1QVG F;  4BVT A;  1Q82 H;  5GAP K;  2VAW A;  5HP8 A;  2QTP A;  4BY9 D;  3QHD A;  4LCK A;  1JFF B;  3CC7 F;  3V7E A;  2RHH A;  1DT9 A;  2N48 A;  2ALE A;  3DC2 A;  4BVS A;  3RA5 A;  1Q7Y H;  1W5B A;  3OBW A;  2H8C A;  4BT3 A;  3WJP A;  1PF5 A;  4FFB A;  4ZHY B;  2DT4 A;  3HTN A;  3JAR A;  5CA0 B;  1VQ4 F;  3CXC F;  3JAW B;  2QEX F;  3CCL F;  2W8B C;  4BT2 A;  4EI7 A;  3ZP4 A;  2H8E A;  4TV9 A;  2F9Z C;  4F6R B;  3IKE A;  5HY0 A;  5LOV A;  3VTI C;  5HY1 A;  4I55 B;  1RQ7 A;  3HKE A;  3N2G B;  2B33 A;  1FNJ A;  3ESJ A;  4I4T B;  1VK3 A;  5AVM A;  3LYB A;  3KHN A;  3JAT A;  3J80 M;  1U3P A;  1TUB B;  5HP7 A;  1H48 A;  5JH7 A;  3VO8 A;  5ITZ B;  3M84 A;  2CHT A;  4X1I A;  4O4I A;  1OAP A;  3HAX D;  4YJ2 A;  3JAM M;  3N4Z A;  3HKD B;  5CB4 A;  5HXZ A;  1S72 F;  3V3T A;  1M90 H;  1VQV A;  5GON A;  1VQP F;  3CCS F;  5EIB D;  5LP6 C;  4NQ3 A;  1XBI A;  4B46 A;  3KIZ A;  2KGW A; 
#chains in the Genus database with same CATH homology
 1PXW A;  4TZZ A;  2OZB A;  1SDS A;  2QI2 A;  3FFM A;  1VQ6 F;  1W42 A;  3D00 A;  3CC2 F;  1W3E X;  3GYQ A;  4BW0 B;  1VQ9 F;  1VQ5 F;  5GIO C;  5G4V C;  2OTL F;  1KC8 H;  5HXU A;  3SIV A;  3RA6 A;  2LBX A;  3VMF B;  3E20 B;  4BVQ A;  1VQ8 F;  5FJ4 C;  3VI6 A;  1YI2 F;  1W2B F;  1QVF F;  1YIJ F;  2CZW A;  1M1K H;  1VQL F;  3ON1 A;  5FLX M;  1NMU B;  3I55 F;  1YIT F;  1E7K A;  1GO1 A;  3LWP C;  1H7M A;  4C4W C;  3MCA B;  3IR9 A;  3OBY A;  4EI9 A;  1Q86 H;  2VGN A;  3WXM B;  3AGK A;  3G6E F;  2I6D A;  1RA4 A;  3CCR F;  5DCV A;  2QA4 F;  3CCQ F;  2BO1 A;  1ZWZ A;  5GIN C;  1NJI H;  1T0K B;  1GO0 A;  5G4U C;  3NVK E;  4X3L A;  2FGY A;  3E1Y A;  2FC3 A;  3LWO C;  1K8A H;  1YJN F;  3CCV F;  1KQS F;  5GIP C;  3CCM F;  1QVG F;  3J7A R;  4BVT A;  1Q82 H;  1VQK F;  3HJW C;  5GAP K;  3PLA C;  1IPA A;  3V7Q A;  3CCE F;  5HY2 A;  4BY9 D;  4LCK A;  3CC7 F;  3LWR C;  3V7E A;  1DT9 A;  3CME F;  3CPW F;  1VQO F;  2ALE A;  1VQ7 F;  1Q81 H;  2KTU A;  2WAL A;  4BVS A;  2KG4 A;  3RA5 A;  4EI8 A;  1Q7Y H;  3OBW A;  3G71 F;  5A2Q M;  1RLG A;  3G4S F;  3NMU C;  1GZ0 A;  2HVY D;  1JJ2 F;  1VQ4 F;  3CPQ A;  3CXC F;  2QEX F;  3N4Y A;  3CCL F;  1YHQ F;  3CD6 F;  3J81 M;  4EI7 A;  3I56 F;  3OW2 F;  2F9Z C;  5HY0 A;  1YJ9 F;  5HY1 A;  1K73 H;  1N8R H;  2KTV A;  3CMA F;  1X7O A;  5HY4 A;  3LFO A;  1KD1 H;  5IT9 M;  2GLZ A;  1K9M H;  3CC4 F;  4BVR A;  3CCU F;  2LBW A;  2VGM A;  1W40 A;  1YJW F;  3CG6 A;  3J80 M;  4X3M A;  3O85 A;  3LWV C;  2OHW A;  2AIF A;  1VQM F;  2JNB A;  1W41 A;  1CK2 A;  3HAX D;  3LWQ C;  3NVI B;  5EWR A;  4XCQ A;  3NK7 A;  5EO3 A;  3JAM M;  4NUT A;  3NK6 A;  3N4Z A;  1X7P A;  3JCM M;  5HXZ A;  1X52 A;  1S72 F;  3V3T A;  1M90 H;  3PAF A;  3SIU A;  1VQP F;  1VQN F;  3CCS F;  3CCJ F;  1CN7 A;  4NQ3 A;  1XBI A;  5HWE A;  5GAN K;  2OTJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...