5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
1GO1A 1DT9A 3HAXD 1VQ5F 3CCJF 1X7OA 2CZWA 2AIFA 1YI2F 3PLAC 3VI6A 1RA4A 3JCMM 1XBIA 3WXMB 1W40A 3CCEF 3CG6A 1VQMF 1KQSF 2VGMA 3E1YA 1Q7YH 1GZ0A 2BO1A 2JNBA 2LBWA 2HVYD 3CCRF 3AGKA 3SIUA 3N4YA 4LCKA 1VQPF 1YITF 1PXWA 2QEXF 3RA5A 3LWRC 2ALEA 5A2QM 3V7QA 3LWPC 4C4WC 2QI2A 1VQ9F 1RLGA 1X52A 5FLXM 3OW2F 3G4SF 3NVIB 3I55F 1QVFF 3NK7A 1Q81H 3CPQA 3CPWF 3LWVC 3HJWC 2FC3A 1VQLF 3SIVA 1Q82H 4X3MA 2OTJF 3V7EA 1VQKF 4NUTA 3CCMF 1KC8H 3CC4F 2KTUA 3LFOA 3CMEF 3CCUF 1YHQF 4TZZA 3ON1A 3CCVF 1CN7A 3OBYA 3JAMM 3VMFB 3G71F 3LWOC 5G4UC 3NMUC 1Q86H 1GO0A 4BY9D 1H7MA 2KG4A 1M90H 1IPAA 1QVGF 1S72F 3LWQC 3FFMA 2WALA 1K73H 1N8RH 5GANK 1T0KB 1YJ9F 3MCAB 1KD1H 4BW0B 3IR9A 1YJWF 2KTVA 5EO3A 2I6DA 2VGNA 3PAFA 1W41A 3N4ZA 1W3EX 5GAPK 4X3LA 3CCLF 1M1KH 3E20B 1CK2A 3CCSF 5DCVA 3NK6A 1K8AH 5GIPC 3CC7F 1NJIH 5EWRA 1VQNF 5FJ4C 1JJ2F 3I56F 1VQ4F 3CC2F 1VQ7F 1ZWZA 1NMUB 5G4VC 2OTLF 2OZBA 2LBXA 1VQ6F 3NVKE 1W42A 3CD6F 3GYQA 1X7PA 2OHWA 3CMAF 5IT9M 1SDSA 3G6EF 3O85A 1VQOF 3RA6A 1W2BF 3J80M 3J7AR 1K9MH 2QA4F 1YJNF 5GIOC 3CCQF 5GINC 3CXCF 1VQ8F 1YIJF 1E7KA 3J81M 3OBWA
chains in the Genus database with same CATH superfamily
4EB6A 4ZHQA 1X7OA 1YI2F 4IIJB 4G4YA 4YJ2A 3RYCB 2Z1EA 3T80A 4ZI7A 3DDNA 4O2AA 2N48A 3ZP4A 5EB1B 3WXMB 3IKFA 3CCEF 1VQMF 3CG6A 1FNKA 2VGMA 1Q7YH 4X1KB 2BTUA 1ODEA 2BO1A 2JNBA 1XHOA 2LBWA 4ERHA 3JVHA 5LP6C 3WGKA 4BVRA 3N4YA 3WGJA 3JAWB 3LDTA 1U3PA 5A2QM 3V7QA 2UYNB 3P4EA 2HS3A 2QI2A 4C4WC 5KX5B 1SA0A 3MBMA 2UZHA 2YYEA 3RYHB 1CLIA 3CPWF 3LWVC 3D00A 2ZODA 1VQLF 2OTJF 1QU9A 3V7EA 3HKEB 3MQWA 5EYPB 2VAWA 4O4JB 4G88A 3LFOA 4U3JB 1YHQF 5LXTB 5EZYA 1CN7A 3OBYA 3WGLA 2Z1FA 4F6RA 2Z01A 2L26A 3VMFB 3D54A 4X1YB 1GO0A 5KMGB 1H7MA 1IPAA 1QVGF 1S72F 3FFMA 3IKEA 5GANK 4WBNA 1T0KB 4IHJA 5IYZB 2QTPA 1VH8A 1KD1H 1ONIA 4O4HA 1YJWF 3IMPA 2CW4A 5EO3A 3JALB 3PAFA 4G4ZA 2VGNA 1JFFA 1VQVA 2EWCA 2CVLA 3P0ZA 5MN4A 3CCLF 2VAPA 2VAMA 4TUYA 1M1KH 1CK2A 3HKDB 1KNJA 2HRYA 2IAFA 4YJ3A 5GONB 5GIPC 4PWTA 4ZK7A 3U0OA 2BTQB 5CA1B 4ZOLA 3S0WA 5G4VC 3UT5A 4FFBB 4C8IA 4BT4A 1UFYA 4ZHYB 4I55A 4I50A 3EORA 4BVQA 5LYJA 3CYPB 3FD6A 3JATA 5LA6A 1T0AA 3C9TA 3RA6A 5JQGA 2HS4A 5CB4A 5HY0A 2QA4F 3CXCF 4M8IA 1FFXB 5C8YB 2AIZP 3WJRA 4C82A 2KTVA 3JARA 1GO1A 2ZAUA 3VO8A 3HAXD 1VQ5F 1IV4A 2RHLA 5EIBC 1OAPA 2AIFA 3ESJA 1U40A 3JASB 1RA4A 3RYCA 4EI7A 3C9UA 3RYFB 1X25A 3BYQA 3S0YA 1W40A 4O4LB 1KQSF 1W5EA 3E1YA 1GZ0A 5JCOC 1R1MA 1RQ2A 2RHOA 3C9SA 4X1KA 3ZO8A 5IJ9B 3WGMA 3SIUA 5EAZA 1XV2A 3JAKB 1TUBB 5ITZA 3F0EA 3JAWA 3C8LA 3LWPC 1JD1A 1TVKA 1RLGA 2UYNA 1X52A 5FLXM 3NVIB 1QVFF 2UYJA 5EIBD 3HJWC 3RYHA 2W8BC 3SIVA 2GVIA 5CA0B 1VQKF 4NUTA 1GX1A 3HKEA 3D01A 4TV9B 5EYPA 4O4IA 3CCUF 3VOBA 5LXTA 3MCQA 3NMUC 1Q86H 4BVTA 5FNVB 3HKCB 1IV3A 1YGYA 2KG4A 2ZVZA 1YQNA 5KMGA 3LWQC 1K73H 5LOVA 3VTIC 2B33A 3WPWA 1YJ9F 3MCAB 4BT7A 3N2GB 1RLUA 3RE3A 5J2TB 1U3LA 4HNAB 3N4ZA 2UYPA 2HP0B 3ERNA 3QHDA 5BMVB 5MN5A 2KGWA 5HXZA 3DC2A 5J2UB 3E20B 3CCSF 3K2XA 1K8AH 4C81A 2H8EA 1JN1A 2DYYA 3HKDA 3TD4A 4NQ3A 1H47A 2ZF8A 3E22A 3LMEA 1VQ4F 1VQ7F 1ZWZA 3CYQA 4RHAA 2UYKA 5AVMA 5CA1A 2OZBA 2HS0A 3TD5A 4ZI7B 3HKBB 5IJ0A 3N2KB 3K14A 5JVDB 3S0HA 3R0PA 4BT6A 1FNJA 1W581 2MQEA 3IEQA 3G6EF 2P6YA 3J7AR 1FSZA 5GIOC 1QD9A 3FPIA 4TV8B 4I4TB 5LP6B 3K12A 3P10A 1IV2A 1FFXA 3OBWA 5C8YA 3J81M 4X20B 3F6MA 1DT9A 5MN6A 4C8EA 1SA0B 3CCJF 2CZWA 2BTOA 3MDOA 5HP7A 1W57A 2GZLA 3KIZA 3JASA 1IV1A 2VXYA 3GHZA 3JCMM 1XBIA 3RYFA 3KE1A 4EI9A 4BT3A 1Q8RA 4O4LA 3S03A 5HP8A 3VYSC 2YXZA 2HP3A 3QTYA 4B5CA 3AGKA 2CHSA 4LCKA 3RA5A 2Q1XA 3ELCA 2LCAA 4G4VA 4WBNB 3S06A 4B62A 4X1IB 3NK7A 1Q81H 4IIJA 2CWJA 3RYIB 2LBTA 3TD3A 3WJQA 1Q82H 4X3MA 2V9YA 3CCMF 1W59A 4TUYB 3HTNA 3FBAA 1J7HA 2KTUA 4G4XA 3FD5A 4G4WA 4TZZA 3WJPA 3JAMM 5G4UC 3LWOC 1DBFA 4LNUB 3B6NA 3IEWA 2RHJA 1M90H 5FNVA 4I55B 3ZOPA 4I50B 2WALA 3Q8HA 4O2BB 1N8RH 3ZP7A 5LYJB 5KX5A 4BW0B 3IR9A 3N2GA 4XCQA 5J2TA 1W41A 3VYTC 5GAPK 3K0TA 4HNAA 5B8FA 4O4JA 5BMVA 4DRXB 3L7QA 5JH7B 5DCVA 3JARB 4U3JA 3CC7F 1NJIH 5EB0A 2Q1YA 1U43A 1VQNF 1JJ2F 3I56F 5HY4A 4X1YA 2PMPA 3HWUA 4B45A 2LBXA 3VCZA 2ZOVA 3HKBA 3N2KA 3CD6F 5JVDA 3GYQA 4ZHWA 2NMUA 5IT9M 5IYZA 1SDSA 1Z5WA 3O85A 5HXUA 1VQOF 4BT2A 3JALA 1K9MH 3S02A 3CCQF 5GINC 1NQ3A 1W5BA 4R40B 4TV8A 4I4TA 2F9ZC 4EB6B 5ITZB 5LP6A 2R6R1 4ZHQB 2IQQA 3M84A 5GONA 2K1SA 1TVKB 4B46A 4X20A 2AMTA 1RQ7A 2HRUA 4YJ2B 3PLAC 3VI6A 2Z1TA 4FFBA 4O2AB 2IG8A 3KHNA 4NWOB 3WGNA 4O4IB 2CSLA 2HQSC 4KWEA 3V4DA 2HX0A 2H6LA 3F0FA 2HVYD 3CCRF 4U39A 3CB2A 2RHHA 1VQPF 1YITF 1PXWA 4RQOA 5LOVB 2QEXF 3LWRC 2ALEA 1KNKA 1UI9A 3F0GA 1PF5A 1VQ9F 4X1IA 3G4SF 3OW2F 3I55F 3CPQA 3I3FA 2FC3A 3QUWA 3RYIA 1XRGA 1KC8H 3CC4F 1OFUA 1W5FA 2FGYA 5EZYB 3CMEF 3I7TA 3OONA 3ON1A 4F6RB 3CCVF 3GTZA 3E22B 3G71F 5IJ9A 1Z5VA 3VIUA 4BY9D 4LNUA 4DXDA 3LYBA 5IJ0B 3JAKA 1TUBA 4BVSA 4IHJB 4O2BA 4O4HB 2DT4A 2RB9A 4E6EA 3VYUC 1JFFB 5HY2A 2I6DA 3M4SA 1VK3A 1W3EX 5CA0A 1VHAA 4X3LA 4TV9A 4YJ3B 3NK6A 5HWEA 4DRXA 5JH7A 1W55A 5EWRA 4ZOLB 4BT5A 5FJ4C 2CHTA 2OTMA 3UT5B 3CC2F 2GLZA 1W5AA 4C8GA 1NMUB 2R751 2OTLF 3HKCA 2H8CA 3V3TA 3WPXA 2Z1UA 1VQ6F 2I6RA 2PHNA 3NVKE 1W42A 3F0DA 1X7PA 3JATB 2OHWA 3CMAF 5LA6B 5HY1A 1H48A 5JQGB 4ZHVA 5CB4B 1JY8A 3M1XA 1W2BF 3J80M 3C9RA 5JCOA 2ZVYA 2G9IA 1YJNF 4EI8A 1SZQA 2HP0A 3KJJA 3KJKA 1VQ8F 1YIJF 5J2UA 1E7KA 3VOAA 1COMA 1QAHA
chains in the Genus database with same CATH topology
1GO1A 1DT9A 3HAXD 1VQ5F 3CCJF 1X7OA 2CZWA 2AIFA 1YI2F 3PLAC 3VI6A 1RA4A 4EI7A 3JCMM 1XBIA 3WXMB 1W40A 3CCEF 3CG6A 1VQMF 4EI9A 1KQSF 2VGMA 3E1YA 1Q7YH 1GZ0A 2BO1A 2JNBA 2LBWA 2HVYD 3CCRF 3AGKA 4BVRA 3SIUA 3N4YA 4LCKA 1VQPF 1YITF 1PXWA 2QEXF 3RA5A 3LWRC 2ALEA 5A2QM 3V7QA 3LWPC 4C4WC 2QI2A 1VQ9F 1RLGA 1X52A 5FLXM 3OW2F 3G4SF 3NVIB 3I55F 1QVFF 3NK7A 1Q81H 3CPQA 3CPWF 3LWVC 3D00A 3HJWC 2FC3A 1VQLF 3SIVA 1Q82H 4X3MA 2OTJF 3V7EA 1VQKF 4NUTA 3CCMF 1KC8H 3CC4F 2FGYA 2KTUA 3LFOA 3CMEF 3CCUF 1YHQF 4TZZA 3ON1A 3CCVF 1CN7A 3OBYA 3JAMM 3VMFB 3G71F 3LWOC 5G4UC 3NMUC 1Q86H 4BVTA 1GO0A 4BY9D 1H7MA 2KG4A 1M90H 1IPAA 1QVGF 1S72F 3LWQC 3FFMA 2WALA 1K73H 1N8RH 4BVSA 5GANK 1T0KB 1YJ9F 3MCAB 1KD1H 4BW0B 3IR9A 1YJWF 2KTVA 4XCQA 5HY2A 5EO3A 2I6DA 2VGNA 3PAFA 1W41A 3N4ZA 1W3EX 5GAPK 4X3LA 5HXZA 3CCLF 1M1KH 3E20B 1CK2A 3CCSF 5DCVA 3NK6A 1K8AH 5HWEA 5GIPC 3CC7F 1NJIH 4NQ3A 5EWRA 1VQNF 5FJ4C 1JJ2F 3I56F 1VQ4F 3CC2F 2GLZA 1ZWZA 1VQ7F 1NMUB 5HY4A 5G4VC 2OTLF 2OZBA 3V3TA 2LBXA 1VQ6F 3NVKE 1W42A 3CD6F 3GYQA 1X7PA 4BVQA 2OHWA 3CMAF 5IT9M 5HY1A 1SDSA 3G6EF 3O85A 5HXUA 1VQOF 3RA6A 1W2BF 5HY0A 3J80M 3J7AR 1K9MH 2QA4F 1YJNF 4EI8A 5GIOC 3CCQF 5GINC 3CXCF 1VQ8F 1YIJF 2F9ZC 1E7KA 3J81M 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO1 A;  1DT9 A;  3HAX D;  1VQ5 F;  3CCJ F;  1X7O A;  2CZW A;  2AIF A;  1YI2 F;  3PLA C;  3VI6 A;  1RA4 A;  3JCM M;  1XBI A;  3WXM B;  1W40 A;  3CCE F;  3CG6 A;  1VQM F;  1KQS F;  2VGM A;  3E1Y A;  1Q7Y H;  1GZ0 A;  2BO1 A;  2JNB A;  2LBW A;  2HVY D;  3CCR F;  3AGK A;  3SIU A;  3N4Y A;  4LCK A;  1VQP F;  1YIT F;  1PXW A;  2QEX F;  3RA5 A;  3LWR C;  2ALE A;  5A2Q M;  3V7Q A;  3LWP C;  4C4W C;  2QI2 A;  1VQ9 F;  1RLG A;  1X52 A;  5FLX M;  3OW2 F;  3G4S F;  3NVI B;  3I55 F;  1QVF F;  3NK7 A;  1Q81 H;  3CPQ A;  3CPW F;  3LWV C;  3HJW C;  2FC3 A;  1VQL F;  3SIV A;  1Q82 H;  4X3M A;  2OTJ F;  3V7E A;  1VQK F;  4NUT A;  3CCM F;  1KC8 H;  3CC4 F;  2KTU A;  3LFO A;  3CME F;  3CCU F;  1YHQ F;  4TZZ A;  3ON1 A;  3CCV F;  1CN7 A;  3OBY A;  3JAM M;  3VMF B;  3G71 F;  3LWO C;  5G4U C;  3NMU C;  1Q86 H;  1GO0 A;  4BY9 D;  1H7M A;  2KG4 A;  1M90 H;  1IPA A;  1QVG F;  1S72 F;  3LWQ C;  3FFM A;  2WAL A;  1K73 H;  1N8R H;  5GAN K;  1T0K B;  1YJ9 F;  3MCA B;  1KD1 H;  4BW0 B;  3IR9 A;  1YJW F;  2KTV A;  5EO3 A;  2I6D A;  2VGN A;  3PAF A;  1W41 A;  3N4Z A;  1W3E X;  5GAP K;  4X3L A;  3CCL F;  1M1K H;  3E20 B;  1CK2 A;  3CCS F;  5DCV A;  3NK6 A;  1K8A H;  5GIP C;  3CC7 F;  1NJI H;  5EWR A;  1VQN F;  5FJ4 C;  1JJ2 F;  3I56 F;  1VQ4 F;  3CC2 F;  1VQ7 F;  1ZWZ A;  1NMU B;  5G4V C;  2OTL F;  2OZB A;  2LBX A;  1VQ6 F;  3NVK E;  1W42 A;  3CD6 F;  3GYQ A;  1X7P A;  2OHW A;  3CMA F;  5IT9 M;  1SDS A;  3G6E F;  3O85 A;  1VQO F;  3RA6 A;  1W2B F;  3J80 M;  3J7A R;  1K9M H;  2QA4 F;  1YJN F;  5GIO C;  3CCQ F;  5GIN C;  3CXC F;  1VQ8 F;  1YIJ F;  1E7K A;  3J81 M;  3OBW A; 
#chains in the Genus database with same CATH topology
 4EB6 A;  4ZHQ A;  1X7O A;  1YI2 F;  4IIJ B;  4G4Y A;  4YJ2 A;  3RYC B;  2Z1E A;  3T80 A;  4ZI7 A;  3DDN A;  4O2A A;  2N48 A;  3ZP4 A;  5EB1 B;  3WXM B;  3IKF A;  3CCE F;  1VQM F;  3CG6 A;  1FNK A;  2VGM A;  1Q7Y H;  4X1K B;  2BTU A;  1ODE A;  2BO1 A;  2JNB A;  1XHO A;  2LBW A;  4ERH A;  3JVH A;  5LP6 C;  3WGK A;  4BVR A;  3N4Y A;  3WGJ A;  3JAW B;  3LDT A;  1U3P A;  5A2Q M;  3V7Q A;  2UYN B;  3P4E A;  2HS3 A;  2QI2 A;  4C4W C;  5KX5 B;  1SA0 A;  3MBM A;  2UZH A;  2YYE A;  3RYH B;  1CLI A;  3CPW F;  3LWV C;  3D00 A;  2ZOD A;  1VQL F;  2OTJ F;  1QU9 A;  3V7E A;  3HKE B;  3MQW A;  5EYP B;  2VAW A;  4O4J B;  4G88 A;  3LFO A;  4U3J B;  1YHQ F;  5LXT B;  5EZY A;  1CN7 A;  3OBY A;  3WGL A;  2Z1F A;  4F6R A;  2Z01 A;  2L26 A;  3VMF B;  3D54 A;  4X1Y B;  1GO0 A;  5KMG B;  1H7M A;  1IPA A;  1QVG F;  1S72 F;  3FFM A;  3IKE A;  5GAN K;  4WBN A;  1T0K B;  4IHJ A;  5IYZ B;  2QTP A;  1VH8 A;  1KD1 H;  1ONI A;  4O4H A;  1YJW F;  3IMP A;  2CW4 A;  5EO3 A;  3JAL B;  3PAF A;  4G4Z A;  2VGN A;  1JFF A;  1VQV A;  2EWC A;  2CVL A;  3P0Z A;  5MN4 A;  3CCL F;  2VAP A;  2VAM A;  4TUY A;  1M1K H;  1CK2 A;  3HKD B;  1KNJ A;  2HRY A;  2IAF A;  4YJ3 A;  5GON B;  5GIP C;  4PWT A;  4ZK7 A;  3U0O A;  2BTQ B;  5CA1 B;  4ZOL A;  3S0W A;  5G4V C;  3UT5 A;  4FFB B;  4C8I A;  4BT4 A;  1UFY A;  4ZHY B;  4I55 A;  4I50 A;  3EOR A;  4BVQ A;  5LYJ A;  3CYP B;  3FD6 A;  3JAT A;  5LA6 A;  1T0A A;  3C9T A;  3RA6 A;  5JQG A;  2HS4 A;  5CB4 A;  5HY0 A;  2QA4 F;  3CXC F;  4M8I A;  1FFX B;  5C8Y B;  2AIZ P;  3WJR A;  4C82 A;  2KTV A;  3JAR A;  1GO1 A;  2ZAU A;  3VO8 A;  3HAX D;  1VQ5 F;  1IV4 A;  2RHL A;  5EIB C;  1OAP A;  2AIF A;  3ESJ A;  1U40 A;  3JAS B;  1RA4 A;  3RYC A;  4EI7 A;  3C9U A;  3RYF B;  1X25 A;  3BYQ A;  3S0Y A;  1W40 A;  4O4L B;  1KQS F;  1W5E A;  3E1Y A;  1GZ0 A;  5JCO C;  1R1M A;  1RQ2 A;  2RHO A;  3C9S A;  4X1K A;  3ZO8 A;  5IJ9 B;  3WGM A;  3SIU A;  5EAZ A;  1XV2 A;  3JAK B;  1TUB B;  5ITZ A;  3F0E A;  3JAW A;  3C8L A;  3LWP C;  1JD1 A;  1TVK A;  1RLG A;  2UYN A;  1X52 A;  5FLX M;  3NVI B;  1QVF F;  2UYJ A;  5EIB D;  3HJW C;  3RYH A;  2W8B C;  3SIV A;  2GVI A;  5CA0 B;  1VQK F;  4NUT A;  1GX1 A;  3HKE A;  3D01 A;  4TV9 B;  5EYP A;  4O4I A;  3CCU F;  3VOB A;  5LXT A;  3MCQ A;  3NMU C;  1Q86 H;  4BVT A;  5FNV B;  3HKC B;  1IV3 A;  1YGY A;  2KG4 A;  2ZVZ A;  1YQN A;  5KMG A;  3LWQ C;  1K73 H;  5LOV A;  3VTI C;  2B33 A;  3WPW A;  1YJ9 F;  3MCA B;  4BT7 A;  3N2G B;  1RLU A;  3RE3 A;  5J2T B;  1U3L A;  4HNA B;  3N4Z A;  2UYP A;  2HP0 B;  3ERN A;  3QHD A;  5BMV B;  5MN5 A;  2KGW A;  5HXZ A;  3DC2 A;  5J2U B;  3E20 B;  3CCS F;  3K2X A;  1K8A H;  4C81 A;  2H8E A;  1JN1 A;  2DYY A;  3HKD A;  3TD4 A;  4NQ3 A;  1H47 A;  2ZF8 A;  3E22 A;  3LME A;  1VQ4 F;  1VQ7 F;  1ZWZ A;  3CYQ A;  4RHA A;  2UYK A;  5AVM A;  5CA1 A;  2OZB A;  2HS0 A;  3TD5 A;  4ZI7 B;  3HKB B;  5IJ0 A;  3N2K B;  3K14 A;  5JVD B;  3S0H A;  3R0P A;  4BT6 A;  1FNJ A;  1W58 1;  2MQE A;  3IEQ A;  3G6E F;  2P6Y A;  3J7A R;  1FSZ A;  5GIO C;  1QD9 A;  3FPI A;  4TV8 B;  4I4T B;  5LP6 B;  3K12 A;  3P10 A;  1IV2 A;  1FFX A;  3OBW A;  5C8Y A;  3J81 M;  4X20 B;  3F6M A;  1DT9 A;  5MN6 A;  4C8E A;  1SA0 B;  3CCJ F;  2CZW A;  2BTO A;  3MDO A;  5HP7 A;  1W57 A;  2GZL A;  3KIZ A;  3JAS A;  1IV1 A;  2VXY A;  3GHZ A;  3JCM M;  1XBI A;  3RYF A;  3KE1 A;  4EI9 A;  4BT3 A;  1Q8R A;  4O4L A;  3S03 A;  5HP8 A;  3VYS C;  2YXZ A;  2HP3 A;  3QTY A;  4B5C A;  3AGK A;  2CHS A;  4LCK A;  3RA5 A;  2Q1X A;  3ELC A;  2LCA A;  4G4V A;  4WBN B;  3S06 A;  4B62 A;  4X1I B;  3NK7 A;  1Q81 H;  4IIJ A;  2CWJ A;  3RYI B;  2LBT A;  3TD3 A;  3WJQ A;  1Q82 H;  4X3M A;  2V9Y A;  3CCM F;  1W59 A;  4TUY B;  3HTN A;  3FBA A;  1J7H A;  2KTU A;  4G4X A;  3FD5 A;  4G4W A;  4TZZ A;  3WJP A;  3JAM M;  5G4U C;  3LWO C;  1DBF A;  4LNU B;  3B6N A;  3IEW A;  2RHJ A;  1M90 H;  5FNV A;  4I55 B;  3ZOP A;  4I50 B;  2WAL A;  3Q8H A;  4O2B B;  1N8R H;  3ZP7 A;  5LYJ B;  5KX5 A;  4BW0 B;  3IR9 A;  3N2G A;  4XCQ A;  5J2T A;  1W41 A;  3VYT C;  5GAP K;  3K0T A;  4HNA A;  5B8F A;  4O4J A;  5BMV A;  4DRX B;  3L7Q A;  5JH7 B;  5DCV A;  3JAR B;  4U3J A;  3CC7 F;  1NJI H;  5EB0 A;  2Q1Y A;  1U43 A;  1VQN F;  1JJ2 F;  3I56 F;  5HY4 A;  4X1Y A;  2PMP A;  3HWU A;  4B45 A;  2LBX A;  3VCZ A;  2ZOV A;  3HKB A;  3N2K A;  3CD6 F;  5JVD A;  3GYQ A;  4ZHW A;  2NMU A;  5IT9 M;  5IYZ A;  1SDS A;  1Z5W A;  3O85 A;  5HXU A;  1VQO F;  4BT2 A;  3JAL A;  1K9M H;  3S02 A;  3CCQ F;  5GIN C;  1NQ3 A;  1W5B A;  4R40 B;  4TV8 A;  4I4T A;  2F9Z C;  4EB6 B;  5ITZ B;  5LP6 A;  2R6R 1;  4ZHQ B;  2IQQ A;  3M84 A;  5GON A;  2K1S A;  1TVK B;  4B46 A;  4X20 A;  2AMT A;  1RQ7 A;  2HRU A;  4YJ2 B;  3PLA C;  3VI6 A;  2Z1T A;  4FFB A;  4O2A B;  2IG8 A;  3KHN A;  4NWO B;  3WGN A;  4O4I B;  2CSL A;  2HQS C;  4KWE A;  3V4D A;  2HX0 A;  2H6L A;  3F0F A;  2HVY D;  3CCR F;  4U39 A;  3CB2 A;  2RHH A;  1VQP F;  1YIT F;  1PXW A;  4RQO A;  5LOV B;  2QEX F;  3LWR C;  2ALE A;  1KNK A;  1UI9 A;  3F0G A;  1PF5 A;  1VQ9 F;  4X1I A;  3G4S F;  3OW2 F;  3I55 F;  3CPQ A;  3I3F A;  2FC3 A;  3QUW A;  3RYI A;  1XRG A;  1KC8 H;  3CC4 F;  1OFU A;  1W5F A;  2FGY A;  5EZY B;  3CME F;  3I7T A;  3OON A;  3ON1 A;  4F6R B;  3CCV F;  3GTZ A;  3E22 B;  3G71 F;  5IJ9 A;  1Z5V A;  3VIU A;  4BY9 D;  4LNU A;  4DXD A;  3LYB A;  5IJ0 B;  3JAK A;  1TUB A;  4BVS A;  4IHJ B;  4O2B A;  4O4H B;  2DT4 A;  2RB9 A;  4E6E A;  3VYU C;  1JFF B;  5HY2 A;  2I6D A;  3M4S A;  1VK3 A;  1W3E X;  5CA0 A;  1VHA A;  4X3L A;  4TV9 A;  4YJ3 B;  3NK6 A;  5HWE A;  4DRX A;  5JH7 A;  1W55 A;  5EWR A;  4ZOL B;  4BT5 A;  5FJ4 C;  2CHT A;  2OTM A;  3UT5 B;  3CC2 F;  2GLZ A;  1W5A A;  4C8G A;  1NMU B;  2R75 1;  2OTL F;  3HKC A;  2H8C A;  3V3T A;  3WPX A;  2Z1U A;  1VQ6 F;  2I6R A;  2PHN A;  3NVK E;  1W42 A;  3F0D A;  1X7P A;  3JAT B;  2OHW A;  3CMA F;  5LA6 B;  5HY1 A;  1H48 A;  5JQG B;  4ZHV A;  5CB4 B;  1JY8 A;  3M1X A;  1W2B F;  3J80 M;  3C9R A;  5JCO A;  2ZVY A;  2G9I A;  1YJN F;  4EI8 A;  1SZQ A;  2HP0 A;  3KJJ A;  3KJK A;  1VQ8 F;  1YIJ F;  5J2U A;  1E7K A;  3VOA A;  1COM A;  1QAH A; 
#chains in the Genus database with same CATH homology
 1GO1 A;  1DT9 A;  3HAX D;  1VQ5 F;  3CCJ F;  1X7O A;  2CZW A;  2AIF A;  1YI2 F;  3PLA C;  3VI6 A;  1RA4 A;  4EI7 A;  3JCM M;  1XBI A;  3WXM B;  1W40 A;  3CCE F;  3CG6 A;  1VQM F;  4EI9 A;  1KQS F;  2VGM A;  3E1Y A;  1Q7Y H;  1GZ0 A;  2BO1 A;  2JNB A;  2LBW A;  2HVY D;  3CCR F;  3AGK A;  4BVR A;  3SIU A;  3N4Y A;  4LCK A;  1VQP F;  1YIT F;  1PXW A;  2QEX F;  3RA5 A;  3LWR C;  2ALE A;  5A2Q M;  3V7Q A;  3LWP C;  4C4W C;  2QI2 A;  1VQ9 F;  1RLG A;  1X52 A;  5FLX M;  3OW2 F;  3G4S F;  3NVI B;  3I55 F;  1QVF F;  3NK7 A;  1Q81 H;  3CPQ A;  3CPW F;  3LWV C;  3D00 A;  3HJW C;  2FC3 A;  1VQL F;  3SIV A;  1Q82 H;  4X3M A;  2OTJ F;  3V7E A;  1VQK F;  4NUT A;  3CCM F;  1KC8 H;  3CC4 F;  2FGY A;  2KTU A;  3LFO A;  3CME F;  3CCU F;  1YHQ F;  4TZZ A;  3ON1 A;  3CCV F;  1CN7 A;  3OBY A;  3JAM M;  3VMF B;  3G71 F;  3LWO C;  5G4U C;  3NMU C;  1Q86 H;  4BVT A;  1GO0 A;  4BY9 D;  1H7M A;  2KG4 A;  1M90 H;  1IPA A;  1QVG F;  1S72 F;  3LWQ C;  3FFM A;  2WAL A;  1K73 H;  1N8R H;  4BVS A;  5GAN K;  1T0K B;  1YJ9 F;  3MCA B;  1KD1 H;  4BW0 B;  3IR9 A;  1YJW F;  2KTV A;  4XCQ A;  5HY2 A;  5EO3 A;  2I6D A;  2VGN A;  3PAF A;  1W41 A;  3N4Z A;  1W3E X;  5GAP K;  4X3L A;  5HXZ A;  3CCL F;  1M1K H;  3E20 B;  1CK2 A;  3CCS F;  5DCV A;  3NK6 A;  1K8A H;  5HWE A;  5GIP C;  3CC7 F;  1NJI H;  4NQ3 A;  5EWR A;  1VQN F;  5FJ4 C;  1JJ2 F;  3I56 F;  1VQ4 F;  3CC2 F;  2GLZ A;  1ZWZ A;  1VQ7 F;  1NMU B;  5HY4 A;  5G4V C;  2OTL F;  2OZB A;  3V3T A;  2LBX A;  1VQ6 F;  3NVK E;  1W42 A;  3CD6 F;  3GYQ A;  1X7P A;  4BVQ A;  2OHW A;  3CMA F;  5IT9 M;  5HY1 A;  1SDS A;  3G6E F;  3O85 A;  5HXU A;  1VQO F;  3RA6 A;  1W2B F;  5HY0 A;  3J80 M;  3J7A R;  1K9M H;  2QA4 F;  1YJN F;  4EI8 A;  5GIO C;  3CCQ F;  5GIN C;  3CXC F;  1VQ8 F;  1YIJ F;  2F9Z C;  1E7K A;  3J81 M;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...