5FK9B

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
241
structure length
241
Chain Sequence
DTGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLGGYEQYFGPGTRLTVTEDLKNVFPPEVAVFVPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fk9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fk9B02
4FFVD 3K7UA 5FHAH 1C08A 5I1DB 4DFHA 5IGXL 4KMQA 2D3VA 3T0VA 5GJSH 5J6GA 1S7RA 2GTZA 3QUXD 4Y89A 5I17A 2XYCA 4JCMA 1TDQA 3DETD 1I8MB 5MEOB 4IMKA 4JR9H 4IRSB 3S8WA 4JFDE 3GI9H 3QDME 2BSSA 1AXTL 2YZ8A 2PUQT 2YPLD 1I1AB 4ETQA 5KVGL 4JFZL 3P4OB 4OZIF 1CICC 5ICXB 1M6OA 3CK0L 1SM3L 1MHCB 2MCPH 2WQRA 5DUPL 3NH7L 3KPMA 1IEAA 1YY8A 1PLGL 4ODXB 3MGTA 2D9CA 3PJSA 3DHJA 5JZ7C 4HS8H 3GJEB 2HTLC 3HC0B 4LL9A 3SGDH 3QRFM 4MJIB 2V2XA 1S7QB 1XF4B 4JDTH 5I1CH 3MRKA 2F19L 4UTAL 4X4XB 4HS3B 3MGOA 1YN6B 1UVQA 3WFCL 2NW3B 4YGVB 2BNQB 3UYOD 4EXKA 3RZCD 3NACL 1IL1B 2EXWC 2JJSA 3QEHA 3D3VE 4GRLA 3O8XD 4L1DA 4GRMB 3BP7A 5D9SA 1MJUH 1TPXC 5ESVB 1I7RA 2CUHA 2QQLL 5GSRB 4ZAKD 3IDXH 4PV9A 1FNFA 3KAAA 4JPVL 2MQCA 5CBEA 3IF1A 2DKSA 1C1EH 1M7DB 3CH1B 4DK6A 4FQJH 1LE9A 5DT1L 2F5BH 1Q9WA 3U46B 4P2RA 3MBXL 4OAWA 4EUPB 5HHMD 2EEBA 4M6OH 4U1GB 1U2CA 1FGNL 3AROA 2PYFB 4RQQB 2BCKA 2QSCH 2AAVA 4BA8A 4ODSH 3UTPE 3D69A 5A16B 3FN9A 4WCYH 1S5HA 4WRLA 3LAFA 5ITBL 1FFNB 2NY3D 2VXVL 2HFGH 5FUCC 5EN2A 3RTQD 4JHWH 4APQD 1U92B 1KC5L 1P7HL 3KPLB 2JJUA 3KLSA 1QQDB 3T2NH 3W9EB 4PJHA 2XICA 5FFLA 1KJMA 1LEGB 1IILE 5CS7A 4JFDA 3QDMA 4EXPX 4FFVC 4QRPB 1M4KA 1RSFA 1FZKA 1ACYL 1WFUA 4LARL 3BFOA 3WSQH 4LNVA 1CXIA 3MRCB 4FA8A 4LCWB 4XMLH 3JV6A 3B3IA 3L5HA 4X5LA 1LEIB 5D5MF 1U95B 3MNWB 2O26U 5F6HI 5GIRA 4CN6A 4G7YH 2NZ9D 1WICA 4C56D 3O41A 4XRCA 3WIHA 3TYFB 4DKFL 5ANMB 5IB4B 4KKAD 4Q74A 4Z0BL 1RUKH 1FRGL 1FZJB 1NAML 3MXVH 3T0BA 1G84A 4P9MH 4NC1E 2DQHH 1LMKA 2W9EH 4QHKI 4OCRL 1C12A 3T77A 2GAZA 4CBPA 4GW4B 4TNWF 3D3VA 4JLRA 3TBWB 1T2JA 3ZL4L 3T4YB 1M7XA 4U33A 4M7LL 5JDSB 1A9EB 2MFNA 3HE7B 1N0XH 5GGTH 3X12B 3S97C 1T7XA 1NDMA 2XIDA 5FGCB 5GSVA 5CWSA 3CX5K 1BJ8A 3RVWD 3VXMD 1IE5A 4E41E 2J5LB 4WI4A 5I8KH 1ZGLM 4NKIL 2R9HD 3IB4A 3ZYIA 1CK0H 4ZUTB 1D5IL 1BQUA 4PJEF 4GRWB 3FRUA 3PGCA 1F3DJ 5C71A 1OGTB 1Q9KB 3HI5H 2EKSB 4JGUA 2GK2A 3B6SA 3WS3A 1F00I 5DRZA 4L8CB 3FQNA 3OKNA 4M7LT 4X83A 4J8RB 3G6DH 3QDGA 2B1AL 1MCQA 2EH7L 4PBWD 3KG5A 2D4FA 2C1OB 4AEHH 5I1AB 5I8OL 3BKJL 4MD5B 4MB4A 1QYGH 3QXWA 5JW4N 3U6RA 4X80L 2YD8A 3V4UH 5HPOA 2BHUA 1T5WB 1W0VB 4PY8I 1DEEB 1CU4H 4P2QA 4G3YH 4OZGA 4X7TA 3IDUA 1I3UA 3OJ2C 3GJFK 2YN5A 1O0VA 2CXKA 4M48L 5H35A 5DVMA 4XAWL 5CP7A 1UG9A 4BQ6A 2CKNA 1BLNA 2ZUUA 1PG7W 1S8DA 3MLYL 3SDDC 4P9HC 5B38G 4APQC 4FQCH 4DGIH 1DQML 4Q9CA 1H3TA 2IANE 3Q1SL 1OAUH 1JUFA 5CCKL 2ADFH 2DQTH 4HCRH 4NRZA 4PJBB 1G7IA 3HNVH 4GXVH 4PJIF 3ARBA 4R0LA 3QR2A 3FTGA 4H20L 2O5YH 4UZGA 1LILA 3QUML 5KOMC 5FO7B 5FYJE 4CNIB 3O6FD 4K94C 5IFHH 4MSWA 1MCHA 1XR9A 5TJWK 4NNYA 3U7YL 5CIPH 2LAGB 1EGJA 2GSGB 3P0GB 4ODHH 1RZ8A 2NY2C 4H26B 4GKOA 4AL8L 3FN3A 5CP3H 1ZLSL 1HHJA 3OHXB 4DVBB 3WO3B 2P5ED 3KPPB 2NY0D 1GGBL 3V79C 1EDQA 2ITDB 3KS0J 3QA3B 3RP1A 4FTVE 1J0YA 4IIQB 5C0BD 1JZ4A 4ZTPH 4XCYB 2Z92B 3IDIA 5JPNB 4DKAA 5GHWH 3RVVC 4P4KA 5FOJA 3MUZ1 4HWBL 3PWUB 4PV8B 2I9TA 3LH2H 4GAJL 5CJBA 4URTB 4KTDH 4PG2C 2Y23A 3EOBB 1Q94A 3OF6A 2ARWA 4JO2L 5HGBB 4FZEH 3IXTA 3U0WL 2FBOJ 4I2XB 3MCKB 3QIBB 5I1JL 3LV3A 5DLMH 3ARVA 5DJYB 1XGPA 4UUJA 1OP5K 4PREB 1MI5E 5BRZB 3UTTB 2E27L 2Y6SD 2HT3D 1K6QH 5KN5B 1AQDB 2YPVH 2BSTA 4KI1A 4TPRH 4LNRA 4XNYL 2IANA 2NXZB 1MREL 1ADQL 1LP9E 1NL0H 3WN5B 4Y4FB 4JY6A 3RGVD 5CD5D 1KN4L 5C0NC 3X3GL 3LVEA 2KZWA 2FX8H 2DIJA 2J7LA 3NPZB 2YBRA 1CFVL 4Z7QE 1UJ3A 4EI6B 3MUGA 2H2PD 2VDQL 2VQ1A 3LKQA 4MZ3A 1JF5A 3TNMB 3H9ZA 1SJEB 1KBGL 5FUOL 4LPVA 3VXSB 3MA7A 5HYSB 1NKOA 1H5BB 1JPGB 2HN7A 3BKCH 2MNUA 5IW6A 3PL6A 3WLWC 3S4SB 4HJJL 5C09B 5IF0A 3ZT5A 3VGBA 5FA3B 4XPAL 4HWNA 3TJHC 3L5JA 5EUOE 2VDLH 2HKFL 3IFPB 5HHOD 4Y2DD 3G5VB 2CXGA 1V3LA 1F58L 5D1ZA 3WHE1 1NCDH 3GKWH 5JNYA 3ARZA 3VFTA 4HZLB 3THML 4NJ9L 4HDIB 3KNBB 4FTVA 3SKNA 4HKXA 4UI2A 3NA4A 1UYWL 3OAZK 4WWKD 1KB5A 3V6OA 5FECB 5IMKA 1TZHB 4K71B 3FFDB 3K2MC 1FLRH 1JGUL 4XXCC 4NWTL 2AEWA 4PJXB 1OAYL 2PCPA 2P24A 2PO6C 3GSWA 4JJ5A 3H42L 2PW2A 3VFWA 5LGKA 2A83A 3DSNA 1HOCA 4Z8FH 4J3WA 3E2HC 4BZ2H 1Z2KA 2JKXA 1M7IA 3SY0B 5IOPA 2P8LA 3G5XB 3I75A 4XP5L 4OKVB 4M5ZL 2XY2A 3PV6B 3DV4B 1OSPH 2NYYD 3ESUF 3KJ4B 5T1KB 3L7EB 3ARGD 5IP4A 1MI5A 1FC1A 2Y9RT 1T89A 1K8DB 2J6EA 4PY7A 4Q7DA 3T0EE 2AXFA 1MFNA 2YK1L 5I1GL 3CFKB 3WD5L 4TUJA 2GJJA 2AJUL 2X44D 2IFFH 2OL3B 2VLME 1XH3B 4XCEA 1QOKA 2HT4C 4DUVA 1LP9A 4KQ3H 4XBEL 5GRUH 1YEIL 4LHUA 4F9PC 1VACA 3IDMB 4AM0A 3U9UB 2IAMB 4KZEL 3CFCH 1FNLA 4QRQA 4KMTL 2ESVE 4HLZG 2FLRT 2Y6SC 4XPGL 1MCEA 2HT3C 1YEGL 4BFBD 5LKNA 4LEOA 5E4IA 1W8OA 5T1MA 3EZ8A 3AREC 2FECI 3RRQA 2NY7L 1HQRA 1JN6A 3LZFL 5CJOL 5FDWB 3TT1H 1QSFB 5D1XC 2I60H 4H5SA 5IM7B 2WBWB 1R5WA 3EUUA 3QFJD 4XNXL 4RGNE 4HWZA 5ESQA 3C6SA 3SDYH 4XNMA 2X4NA 1W72B 4GH7B 2AXGB 1ZA3A 3M8OL 1JYWA 2BOCB 2VXTH 5C0EA 5K9OA 1KTLA 5D71H 1EFXA 3PWPE 3KPOA 3WUWG 1ZLWK 1D9KD 2YD4A 3QQ4A 1XF3A 3RVUC 1VPOH 2YPKA 3D48R 3ARYA 2DJ4A 4OCLC 4ZO6A 4PGDA 5SWSE 1H0DB 5M7QA 1IM3A 3ILPB 2J8OA 4N0YL 4GBXD 2MHAB 3STZA 1BBDL 1FVDB 3N1MC 3RDTC 3QAZC 2ZJSH 4YFLI 3TF7C 4NN6B 1Q8MA 4LHQB 3DSFL 3O11A 4OLYH 3O9WB 1S3KH 4R2GD 2OQJA 3RI5K 3UYPA 3BZ4B 3ZE0E 3BPOB 3P0YL 3P11L 4ONGL 5IVXF 4RWYL 4PGZA 3QIUD 1B2WH 8CGTA 4FG6C 1QNZL 4XPBL 2ZUWA 4QHUB 2D7PA 4QHMA 2NY5L 5D70L 4V1DE 2GCYB 1BMGA 3JVGA 4G8GA 1CL7H 3BZEB 5HYQB 4FFZL 4NQEB 5DJZA 3DMMB 2XG5A 1U8OA 1V7MH 4LLYA 2FGWL 1AXSB 2AVGA 2DKMA 3ARSA 4G6AD 2AJVL 1AE6L 2C3VA 4U1KA 1FE8L 2IFGA 4KI5F 5FYKU 1ETZB 5F8QC 3L95A 5E8PA 3HE6B 5E4EC 1AGCA 4JRYB 4M1GH 3RX5A 3WFHB 5E2TL 2CRMA 3FOMA 3V7MA 1E4WH 4KVCL 1IAIM 3K8LA 5HI5C 2DQUH 5E2VH 1XR8B 4JPIA 2EDNA 3R1GH 3GSUB 3VJ6B 4L3CB 2FR4A 15C8H 4ZQKA 3FQTA 4L5FL 3TV3L 1J12A 5DS8A 2FEDD 4OZHA 2JLLA 3UBXA 3UTSE 3FB6A 4MCZB 4WFHE 3ZKMC 3B83A 3PWPA 4IRJB 3UJJH 5BXFA 4LU5H 3MJGX 2HJFA 3VRLF 5D7IF 3TBSA 3P30H 4LSSL 1PKQA 3RWIA 5BZDB 1PZ5B 2JJWA 3BKMH 2V9TA 5GQBA 4KKCD 1UWXK 2AJ3A 2X1XR 2DIBA 1CXHA 2NX5A 1J9CT 5C9JB 2A9ML 5JOPD 4P2RD 3GSXB 3KYOB 2DDQL 3PUCA 4Y16C 1AJ7L 1PW3A 1YYML 4HLZH 1XGYH 4XC3L 3UAJC 3BGFB 4AH2B 1K5NA 5F1NB 1INEL 4MD0A 2XZQL 3PG2A 1ACZA 3SDAC 1FO0B 3MLSL 4G7VH 1MLBA 1GGCH 3DHMA 2GUOB 2AI0H 4X6DF 4U1IB 4V1DA 2HP4A 2D0HA 3GSNA 4O2FB 1ZXQA 5CEXB 2VDKH 1JNNL 4QRUA 3SDCB 2CUIA 3SDDA 4U6XA 3GRWH 1MCWW 5TDNA 1DLFL 4JFDD 3QDMD 4N90E 2KPNA 3TH3T 3VGAC 3TYGH 4OJFL 1IGMH 4WO4B 3L3OB 3VXRE 4P3CL 3L3HA 3W9DA 3E6FB 1N3NB 4ZUWB 2FX7L 1JYXA 3VG9C 4Y5VB 4CVXA 1CIDA 1BGXL 1IAKB 2ATPB 4NDMA 3IKCA 4QOKA 4FQHB 4YNYB 3ZDYF 1NFDA 1FIGL 3QCTH 1XGUA 5CJXA 1BBJA 4EQ2A 1IJ9A 4HGKC 5BS0A 3CD4A 5JW5A 3MZTA 3H9HA 3QNYB 1IGYA 1MHHB 5GGVH 1KCRL 1LDPH 1KPRB 1P5VA 4X6CE 3LD8B 5D7JC 2ZNXA 4HC1A 3PXHA 4GG8A 3QZWG 1CG9A 2B5IB 4MJIE 1BWMA 2YUWA 3VD5A 1EEQA 1KJ2H 2Y4SA 2LV4A 1DBAH 5GGSB 3RWCB 3QJFA 4D8PB 3UTSA 3D3VD 5LBSL 3SBWC 1JJUA 4LIQE 1WAAA 2KQNA 1RZ7H 4DEPC 3P9LB 2VLRD 4NBYB 2E5EA 4HIJA 3EYVB 1Z5LB 2PW1A 4LSQL 3Q5TA 5E99H 5DF0A 3QYCA 3U4BH 1LE5B 3QDAA 5EZOH 4ZO8A 3ELAT 4GW5B 3ULVL 5IT2H 3TNNA 1S9XB 2EDEA 4KJWC 3CSYB 1A6AA 1BIIA 1EO8H 2HJKB 4JQIH 3NOIA 4F58H 1NCCL 1KCLA 1E6OH 4FQ1L 4WU7B 3UTPD 4EN3C 1VFUA 1LEKB 5DYOB 1RIVH 3DWTA 5KVDL 5E6ZA 1PG7L 4MWFB 1X5FA 5TFSH 4R4BA 4NGHH 1K2DA 2QEJA 4TRPH 3K4AA 1F90H 4PGCA 3ZO0A 1J0IA 4MXWH 1OAQH 2XTJB 3TT3L 4O00A 3NCEB 5L88H 2EEDA 2VNCA 3VXRA 3W0WB 1XF5B 3C87A 3SGDI 4PB0H 1T0NA 4JREB 3U30C 4Y5XC 5KSVA 1ZANL 4WHYG 4MCYB 5JHDD 4R4FL 3ARFD 4LHJB 3BESR 4QRPE 3HNTL 4F7MA 4JFYA 2EDLA 3OAYK 3VRIB 1BQSA 1KJ3L 1U8LA 1FL5B 5ICYB 3M1BA 1EH9A 4RFOL 4BUGA 3E1F1 4LSDA 1MHCA 4JM4H 4KRMB 4N0RA 3WIIH 3PWLA 5IVXB 3DYMA 1MAKA 3KGRA 2GITA 3O0RL 1A7PH 4X6CA 2R69H 1T04B 2CK0H 3VGEA 1DBML 2NTFA 4LEXH 4AG4L 5DRWA 1IC5L 1QBML 4MJIA 4OD1L 5L8JB 1YUHA 2DWEB 3CDGB 4ELMF 3C2AH 4RZCB 2A6DA 2VAAB 3PDDA 1IGFL 5J11C 1FNAA 3BSZL 4YHLH 1NGYB 2AJZA 4S1SL 2X05A 1T22B 3SO3B 1NCBL 1YN6A 4M61B 5DC4B 3UYRL 2DM7A 1MQ8A 5ANME 3O2VH 1JGEA 3N85H 4S1QL 5GJTH 3KHOA 5FYLD 1FORL 4ZFZA 3VU2A 3B5TA 4E41D 3AS0A 4H25A 4AENA 1FL6A 3KPQB 4NZRL 2JIXD 1AQKL 3FQWB 5AEAA 3VWKB 5DJ6A 3U4EA 4P2OC 5J6HB 2DWDB 1QEWB 4D9LL 3IDYB 4OT1H 1HHGB 3NZHH 1VENA 2EDOA 4ZD3L 3KYNB 4TOYL 1SY6A 4X7FC 2HJLA 5IMLB 2DKUA 2WUBL 4LPTA 4HULB 1X5JA 3QEQB 3SDXF 1MEXL 5HHQB 4GRWE 1CGVA 1NC4A 4AMKL 3OF6D 1F3JA 2VYRE 4K8RC 1I1CA 1Q72H 3S3SA 2H1PL 1AFVL 2EDJA 5BZWA 5DFVC 4KRPB 2B39A 4ZFFA 3WFZA 2VZSA 3MOAH 4GKZB 3TO4B 3FT2B 4P4RB 4S11A 3VD9A 4GMSL 4NNPH 1EGJH 3H9YA 5I9QC 3MJ7A 1DUZB 2CO7B 4LRNL 4D9RD 2W07A 4PP1D 1PVHA 1WSST 3DIFA 3WDHA 1CZ8L 1FL3B 1U3JA 3OR7A 3OB8A 2BVPB 4WUUA 2H6PA 3EOTH 4XTRC 3UROR 4U6VL 4LLVB 4O51A 1CFQB 2ENSA 3IJYA 4P48A 3AREA 4K7FB 1JCKA 2EH8L 5ISZB 5EOQH 4GKNA 4X6DB 5FYJD 2I07B 1AD0B 1CE6A 3KPNB 1PG7X 4HSQA 4L8SB 3IAGC 3F65A 4P5KB 3UTZA 2EIEA 3VFGH 2AJXH 5SX5H 2NW2A 3LS5H 4PJGA 3Q2CA 1DBKH 1JPSL 1CTOA 3TYFA 3PL6D 1CDHA 5ANMA 1RU9L 4F37K 3WFBL 4IEFB 4LBEA 5I8EB 3QHZH 4F7EB 2DQGH 2EKJA 1X5GA 1G9ML 3ZHLA 5D1ZD 7FABL 1PQZA 3NA9H 2VC2H 4KHTH 1A6UH 1BPVA 4MAUL 3AAZA 1ZS8B 5EU6E 4FTVD 1ED3A 3P2TA 3GMLA 5EO0A 3WUZA 4LF3B 4MDJB 3D5OF 1REIA 1CGSL 3B9AA 5E08L 5DZOA 1JPST 4WHYH 5DD0H 4IS6B 1FVCB 2JB6A 3HZKB 1EO7A 3TA3B 5KTEL 2EYRA 4O9HH 4D3CL 2APWA 2KL6A 4KTEL 2HFFB 5J89A 1MVFA 4YAQA 5GS0C 1HH6B 4GAYA 1JHKH 5FYJH 3STLA 3PNWB 3G9VA 3QUKB 2HVJA 3VMPA 1RIUH 5DRNB 1MI5D 1S78C 3E3QC 4AYFA 4I13B 5KSAC 4GXUM 1WF5A 3IDJA 4A6YA 1ES0B 2AABL 3MLVH 4QRRA 3G6AB 1HSAA 2LU7A 5IFAL 2CD0A 2NXYD 3WE6B 3HFMH 2L7UA 4IRZL 4YX2H 1T0MA 3OB0K 2JELL 1U8HA 3NTCL 4H1LG 1A7RL 2GY7B 4LHUD 1ND0B 4I48A 5H8DA 2HVKA 3UTTE 3HC4L 3TPUB 4QT5A 3QUYC 1TITA 2ICWJ 3JZ7A 1KB5H 4ZPTB 3AM8C 2VDNH 1TCMA 2DQEH 5FGSA 3KWWB 3KPSE 1UXWA 3MBEA 2R8SH 3NGBC 1RZIA 2C26A 3H7BB 2X1QA 2NY1B 5C08E 5DURD 3K0WA 3QUZD 3F58H 3EGSB 3FQUB 1FNEB 4U1LA 2FO4A 2UWEA 1N5YL 1JI2A 4XVSL 1DCLA 1DVFC 1U3HB 2ZSVB 4I3SL 1LO2L 1IKFH 3LQZB 3OXRA 4MB5A 3VXSE 3F7YB 1KXTB 1UZ6F 3IETB 2V7HA 2EYSB 5EU6A 2J6EH 4ZTOH 5GISH 2KUTA 4JZJC 3GB7A 1W0YT 4H26A 4GQ9L 3VE0B 4OZIA 4NO0D 4GKSB 3VD7A 3T4AB 4ZFGH 1PYWA 3ZKND 3QDJB 4DGYL 2DQIL 1MCBA 2Z8RA 2XRAL 3MV9E 4WDIB 3WV0A 3PQYB 4LSTH 5D5ME 3REVB 3HRZB 3DX7B 4OLUL 1ULVA 3SDAA 2N56A 4WW1A 4OLVL 4GOSA 3VD3A 1NCAL 5BOPA 4TSBH 3U7WH 1JZ7A 2ZCLH 3JV4A 3SN6N 4MDIA 1X5YA 2ITCA 3F8UB 2PXYA 2R39A 3I3EA 4HKJB 1L9MA 1A2YA 1T2XA 4FQXA 2YA0A 3GBMH 3U36A 4BQCA 1N59B 5L2JB 5ADPH 4UV4H 1A5FL 3CUPA 3T0ED 1FV1A 4N8VA 1GC1L 3ROOA 4NIKB 4FQPA 1A0QH 1KCUH 2EDBA 3HPLA 4IMLA 4QWWD 5F1OB 5IROA 1CE1H 5EU4A 1YECL 3MRLA 5KSBB 3BDBA 1AGEA 2Z35B 4RMWA 3TO2A 1FVEA 4XXDB 4EJ1C 2ESVD 1U8NB 2IADB 4ZS6C 4BH8B 5DFTA 3KPSA 1KYOK 5DZNA 4JM2D 5HHPB 4KY1H 2M26A 5B39G 1DDHB 2FYYB 7CGTA 4N0FB 3KXFA 3PDGA 5C08A 1GHFH 3P40A 5H2BA 5CSZB 2IG2H 4EI6A 1U8QB 4XVUC 4MA8H 3HCVB 4FP8L 1N64L 3CVHL 1NUNB 1VGKA 1CDJA 2P46B 1ZT1B 1VFOA 3BQUC 3OKMA 4OLWH 4RGND 3S34L 3KDMB 3NIGF 4LSPH 2GJZA 1WTLA 1PBYA 4RRPA 5JORA 5L9DL 4NQVA 5I1IL 4DAGH 1RD6A 2X2YA 5EH1A 1YY9C 2V9RA 3L3IB 2G5BB 3O45B 4MD4B 4Y19E 3QJHB 3EW3B 2OS7A 4NRYA 3TBVA 5C0FA 1WBYA 4M9OA 3MV9A 5SWSD 1OAZL 2DLEA 3OG4B 5C0AE 5D2NB 4LCYA 2DB8A 3QXDB 5L8LB 4W68A 3RHWF 5D5MA 1ZVSB 4R90L 2OR9H 3VDAA 4H1LH 1ZSDB 5F9WB 3ULUL 1UA6H 5J8OA 3TIEA 1QKZL 4PJIE 3FFDA 5IVOA 3TZVB 4WW2C 4Y7MA 3L7FB 1MNUL 3DX8B 4KI5C 3C6LA 3CFIC 3ZKNC 2DI8A 3S7GA 2YEZB 2J88L 3U9PH 4GS7C 2C4XA 2HRPH 4XP1H 1U93A 1YZZA 5I0ZA 4WUKL 1DQQA 5LG1A 2D7TL 4V1DD 3EOAA 3OKKA 1S7SB 1FZMA 4MMXC 5KG9A 1XF2A 1F11A 3HMWH 2D2OA 4Y5XA 4OB5L 2DTML 1J1OH 4RX4A 1DSFL 1K8DA 4G8IA 4RDQG 2W65A 1ZLVH 2GJ6D 4I3RH 1TFHA 3OJDB 1RHHA 3HAEB 4PJEA 2X41A 2B1HL 3LKRA 4XH2B 1WBXA 1BVLB 4ZO7A 5KVEH 1PGRB 3TVMB 3KPRB 3PV7A 3O4OC 2QADB 3FONA 1P53A 4LOUD 4JHAH 3DARA 3QI9B 3D0VB 4M6AA 1MPAL 2GHWB 1A1NA 4JQVC 5DTFA 5CEYA 4O58L 5KAQF 4YHYC 1S7VB 1UCBL 5H37H 3WXVH 3UTSD 4K3EL 4HUVB 2DD8H 2BSRB 4WFHD 2FJHB 2Q6WA 1T80A 4OCNC 5JQ6L 5AD0A 1E4XH 5I1HH 3ECBA 5DJXA 5IIEB 2CRYA 4JFPB 4Y19A 3NZ8A 3WFDH 2D0FA 3QIWC 3VXTB 1QRNA 2ARJA 3WKMH 4DW2H 3V0WH 5J56B 1KT2B 4EZMA 5C0AA 2QQKH 4OCWH 4K2UL 1G7JB 3MLRH 1AP2B 2M8XA 4Y88A 4ZXBC 4S1DD 3DECA 1LK2A 3HZYA 4PJIA 4HZAA 1U8PB 2H32H 3MMEA 2O61A 5E8NB 5L6YH 4HPYH 4S0TD 1JHLL 1QSZA 2Q76B 3HZVB 4RNRA 4PJAF 5LJYH 1OSZA 3K3QA 5HGAA 4NFBA 4EUPG 2QV2A 3QEGH 2LABA 4XB8A 4CJ1A 4OF7A 3P77A 5KJRH 3FO2A 5EZIH 4AY0A 3EKCA 1KN2H 1CLZH 3I02A 3RI5F 1GAFL 4PP2A 2D03L 2BC4A 5GRXG 1EV2E 1NCTA 3RX8A 4WTZA 4PJCF 1C8PA 2Q8AL 2W92A 4N90D 4I18C 5ALBL 4DOHB 1P4BL 5EC2B 4ISVB 2GCYA 2OTUB 1MRDL 3KLHD 4HKBB 4W6YB 5L7XL 1R6VA 3CAFA 1FAIL 5TE7L 4IRSD 1NGQH 4KDTC 3BWAB 1I1AD 2EE6A 3FRPA 5B8CB 1QR1B 3CFDA 1QSEB 1JMXA 1MFEL 3MX0A 4PLJC 1HNFA 3IJHA 2P49B 5HPMA 2YD3A 4LLMA 1PSKH 3BP4A 2I25N 3BW9A 4D9QE 2HLFD 2C7UA 4NFDA 5BMFL 1DUYA 1U8MA 1ETZA 3MCLH 5GS1B 4Q2ZA 1F8TH 2R23A 4MJID 4RAVB 2P43B 5H94A 4DFIA 3DBXB 4JG0L 4K3HA 4PJ8A 2F8OA 5IW1B 2A73B 2PTUA 5JW4Q 1G9NC 1MCRA 1EX0A 1TQBC 1INQA 3EYOB 1CBVH 1HILA 1YPZB 2VZTA 4YHOL 4TULH 4RWHA 5A2FA 1WITA 1IGIH 5I15L 1DANT 1J8HB 1MLCA 4LFHD 4YBLC 4U2ZA 1NAKL 1EJOL 2V2TB 2YXFA 5F7DB 3BPLB 4F33A 1G6RA 2ZOKA 5LAXA 2XWBB 4PD4J 2VUYA 3UTQA 5D1QB 4MB3A 1PKOA 2R1WB 1ZT7B 3QRGH 3S36H 4P23B 1NBQA 2Q7YB 3X13A 1RUQL 4MXQD 1D6EA 5ILTL 4HUKB 5CINL 5IQ7L 5LWYH 3LKOB 5K59F 5D2LB 4PR5A 4YDVB 3GSXA 2NY5C 4UV7L 4DN4L 1NGZA 5C9KA 1NC4D 4TSCH 3MFFB 4NYLA 5FV1L 1JPFB 3V5KA 1AH1A 2V2WB 4UB0H 3QXVA 3VWJC 4DTGL 3MLUL 3STBA 1Z0MA 4HBCL 3UZVB 3ULUF 4HS6A 3IJSB 5SWZB 1I4FA 5HVGB 4LIQH 4JY5H 4POUB 5EO9A 3LPWA 3QO0B 2AP2A 3ARDB 2OXHA 4LASH 4LSRH 4MA7H 5C0GB 4FQ2L 1JGDB 3MXWL 3SDCA 1JRHL 4M03A 4O02L 5I19L 5JW3H 2XTJE 5E2WH 1NAMA 4QRPD 2QTEA 3BPNC 2BMKA 3BIKB 4PRIE 1GOHA 2VZ3A 2E9JA 3VMNA 5J0BA 4X4YB 4R96B 3D85B 5TQ0H 4L3EB 1XCQA 1S7XB 2CQVA 3L3GA 1IGCH 5FA4B 1NMBH 4BQBA 4N8PA 1OPGH 4J4PC 4G9FE 4XX1E 1DTUA 5ACZB 4IRSC 3HHRB 4Q0XH 3HUJB 5IW3A 1QACA 1OL0A 2HTKD 3ALPA 1A64A 1Y6MR 4JVUA 1KCSH 1I1AC 4N5EC 4RSVA 1MHHA 5IVXE 3MREA 3O6LH 5TDOB 3RA7L 1MCIA 1VKXA 4WI5A 3FHQA 1EEYA 4JANA 6CGTA 4ZSOB 4YQXL 5FOBA 1DQJA 2H26A 5DMGD 4QY8B 2GSIA 2BVEA 4OI9A 3CXDH 3MRPA 3SE4C 4CMHB 3BH8B 4IJ3B 2VERN 1AKJB 1A7QH 4UT9H 1A6WL 1DQLH 3MYZA 3ALXA 1FJ1A 3GMRA 2BNRE 4OIAA 5D96B 3OPZL 1RFDL 5EZJA 2A77H 4AIXA 4QYOA 2D31B 2WBKA 4JHZA 4I0PB 3RNKB 1Q0YH 2HJKA 1AGDB 3FT4A 4WU7A 4PGBB 2YWZA 3FL7A 4NHUB 1I9EA 3GKZA 4YDIH 1R5VB 1VHPA 2ZUQB 4Y8AA 1AXIB 5EU5B 3P4NB 4OIBA 4YDJA 1UCTA 4U1GC 1CR9H 1RJLB 3QUMA 3O8XB 3VRLE 4PRIA 5D7IE 3TH4T 1T20B 4XCCH 1LO5B 4M6NH 4NP4L 1KFAH 4ZAKB 5IBTH 1C7SA 5GRJH 4PJAB 4BYHA 4NQSA 5CBAA 1B6DA 3NN8A 4LKCA 4M02A 5IVZA 3GSRB 4M62L 2VDMH 3VGHA 4P3DA 3BPCA 1X6NA 4RAUA 5FK9A 4G9FA 2Y5TA 4RBPH 1V8HA 4KK6C 4IOSD 1FFPB 2EC8A 2GW5A 1I9IL 3BQUA 2FSEB 4BH7B 4GRWH 1LHZA 3E6HA 4PJCB 2XKNA 1NPUA 2CRZA 3WKNA 5ISZE 4LSUH 5KW9L 2Z4QB 5F7EH 5HYSG 4X6DE 5DMKB 2NR6D 3MLZH 2GT9B 4KQ4L 1A3LH 2NY3B 2A2QT 3BYTA 5E2UL 1HNGA 4F9LC 3VXQB 1E27B 3C60C 2DQCL 1P4LA 4RRPG 3ULVC 3VXPA 4HWBA 1U8KA 1IAIH 1WTGT 3KYMA 5CZXD 4OM0L 5EU6D 3MV7A 1AR1D 4OTXL 1GIGH 1LK3H 1VEPA 5EOCJ 4A6YH 4AEIL 2VISA 3RJQB 1S7WA 3MNVA 2XQYK 1CF8H 3T1FB 3D0LA 3LIZL 5FB8B 4D0DB 2BNRA 5DEZA 1F6AB 3S96B 4CUCA 2IALB 3CLFH 3BWUC 1TVBB 3ZDYE 2R4SH 5BV7B 3BI9X 1T4KA 4FFYH 2IBZY 5E70A 1WWCA 3C5ZC 3PHOA 2BZDA 3HE7C 4TUOB 5DWUH 1XFPA 1TIUA 9CGTA 3MRBB 2VTFA 2J5LC 1A4JA 2IPUK 1ADQA 5TH2A 5LXGH 5F89B 4L8BB 4Z95H 2XN9A 4HXAH 1OP9A 4XGZB 1Q1JL 1N6QL 3U7AA 1N2RA 2XZCH 3QIBD 4ONHB 1IEBB 2BOBB 3O4LE 4HXBH 1JWSB 3IVKB 4HF5L 4YPGB 5D7IA 2EDYA 1O7SA 4NM4L 3RUGF 1WT5A 1E4KC 3UTTD 3WJLC 4WY7H 1W0WB 3VXMB 4KVNH 2AV7B 3F7VA 2ED9A 4ZDHA 5GGRB 3NCFB 4Z7WF 1Z9OA 1NMAL 1FH5L 2NXZD 1QFHA 3CMOL 3KPSD 3AXLA 1UJTA 2J8UB 1A3RH 3V4VL 4LQFH 3VDBA 2Z8WC 1LQSR 4J3SA 5FM5O 2IWGA 2FATH 3MRDA 4LLVA 4OIIH 3BX7C 5ISZA 3BRDA 3HPJA 1IC7L 2CKBB 4NOFA 2AEQL 3IU4L 4X6DA 3OAUH 1TVDA 4J3VA 1G7MB 3JWDL 3VGFA 1T1YA 3VXSD 1RUPH 3I6KB 4JO1L 1NGPL 4P5KA 1RURH 3BH9B 4TTGA 3V0VA 3EO9H 3BEWB 3KHQA 2WINB 1AC0A 3VGDA 4NQXB 2OK0H 4YUEH 1KCVL 5DA0B 4F37F 1KELL 1HZHH 1NCWL 2P45B 4FXGA 4O5LL 3MJ9H 4F7EA 3MA9H 4K9EH 4XPTL 2H3NA 2FEEL 5F96H 3UJTL 1HKLH 1DBBH 1JTPA 3I50H 2ERJC 5CGTA 1TJGH 1VCAA 3N1PC 3ETBF 5HVFB 1G7PA 1HCFX 4DKEH 5HJ3B 2AEIT 5KVFH 3FOLA 3QDJE 4MAYB 3W2DH 2IQAA 2NLJB 3C6LD 5LQBL 3PQYE 2DTSA 4AT6B 5D7LE 1JK8A 3HZKA 5KVMC 3N1GC 5AZ2H 3PGDA 3WDJA 3D25B 4WEUD 4XB7A 1CYGA 2D7OA 1I7UA 1WV7T 4IIQC 1J7VR 1HH6A 5E5MB 5CEZL 5JIPA 1KEGL 1MRCL 2R2HA 4WTZG 3O4LA 2FECL 1ZTXL 5C0RH 1QFUH 1RK1B 1YEKL 1FSKB 5T1KD 4HIHA 5DO2D 1OGAE 3BEVB 2ZUYA 4OZ4A 3HLAA 1NLDH 1PJ9A 4KDTA 5C0DA 2X10A 4TQEH 2LVEA 4PRPB 3I6GB 4ZFOB 1J05B 2RIKA 3AUVA 2NY6B 1RZKC 5FO8A 2VJXA 1A7OH 2VL5B 4YE4L 2ZCHH 1BM3L 5K9JH 2EDWA 3L5XH 4I4WB 2AV1A 4K55A 5HY9A 3RY6A 2BXZA 1ND0A 5C0BB 2IAMD 2B2XL 3GMQA 5DD3H 2Q87A 3SDXE 3EDJA 3PDOB 4LAQH 4KXZH 5I76A 4G6KH 3O2WL 1HHHA 3U0PA 1KIPA 1N0LA 4HIXL 3DUUB 3WHXB 3EJJX 3MRFB 4ODWB 4QXTA 3GMPA 1IFHH 3D9AL 3BZDA 3WN5C 2EYTB 3IFOB 4Y4FC 4UDUA 5ADOL 4KHXL 4M43L 3QH3A 4LCCC 1TCRB 3S37L 1QSFD 4KZDH 3HI6L 3GMOA 3FZUD 5JXAL 2NY4B 43C9B 2CMRL 2XKUA 4Y19D 1QO3B 3EYUL 3MROB 2A6JA 1UQSA 3ORJA 1NBYB 2XXMB 3N0PB 4ZNCD 4OCYH 2MCG1 5I71B 2V7NB 1H5BC 4NQDB 1I85C 5JDJA 3OKLB 3OX8A 4M1DH 5B38B 1S9WA 4XP9H 3DX6B 4JDZB 1MJ7H 3QQ3A 3TJEL 3QDJA 1R0AL 3RGVB 3KYKH 2NQCA 2XFXA 1NGXB 5JMRA 5D7LA 5TE4H 3BDXA 4XP6H 3VWJA 1RJZA 4CW1A 5FCUL 4H88L 5EBMA 2W60B 4ELMA 4U0RB 1UB6B 2J4WH 4LLWB 3UZEA 2QQNL 3QEUA 3O9WD 3TGXA 3T08A 5I73B 5IMOB 1IM9B 2FNBA 3VFPB 3S9DB 1AIFB 5F8RC 5I74B 1MRFH 1Y18B 4K71C 1U58B 2DJSA 2EE2A 2JJTA 4E9LA 3CC5A 3QHFH 1OGAA 5JLZB 1DZBA 1R3KB 2D4DA 2WBJB 3B2VL 4YHIB 3BP5A 2SEBB 4YHNA 3MGAA 2IPKB 2BRRH 1YJDL 4Y2DB 1HDMB 3V5DB 4S1RH 5IB2A 4M5YL 4QCIB 5LVEA 2A6IA 5J3HC 1W2KT 1W72H 4G43B 4MVBC 4UOJA 4P2YA 5ERWB 4GLRH 4PG9B 1P6FA 2H8PB 3R06B 4J4PA 4HK0B 1V7NH 5T3ZE 3KJ4C 1CFSA 4MLIA 1UENA 3LQAL 5IEKA 1T3FA 3SDXA 5JPMB 5CILL 1WWBX 2VLLB 4QRSB 2LU4A 5HD8C 5I18L 1BZ7B 1HXYB 2HLAA 2FYYA 3HE6D 3KPRE 4K23L 4LPYA 3MRQB 4JRYD 5ALCL 4EDWL 3EIFA 4PJ8D 1AXTH 3NFNB 4RFNB 5HHVH 1G7LA 4JFZH 5D7SH 5E95B 3CK0H 1SM3H 5K9QG 4P57A 4CU8A 3ARGB 1MWAB 3D18B 4TSAL 5FEBA 5BCAA 3HB3D 5FF6B 3AB0B 4YC2C 4Z7WB 1XGRA 2OXGA 4XPFL 5DJ2B 3G9AB 2CLRA 4HUXB 4HFUL 3DXAB 3O3EB 3VXNB 1CTNA 4IRJD 2N7BA 1T0PB 2G5BA 1RJYA 3GI8L 1P5UA 2F19H 2BDNL 3Q6FA 1H8OA 4ELKB 1UM4L 1HHKB 4QHNA 5C0JA 4L29A 2VLJE 4QTIL 3NACH 1V5JA 4JFOA 5ETUB 4MA1C 4YEEA 4PFEA 5IESL 1YNLH 4UNUA 3U2SA 4CN1A 3UBXI 2EDDA 4U3CA 1C5CL 5D93B 2QQLH 1XZ0B 1B0GA 1CDYA 5GRYA 4JPVH 3TBTA 1CCZA 4KKLC 3MLWL 4NCC1 3S37X 5D6DC 5EORH 2ICEA 5DT1H 1UZ6E 1LO4H 1M05B 1ZEAL 3V2AR 4Y4KC 4XC1L 4NN6C 3SDCD 1MIEL 3O9WC 4X6FB 3SGEH 1X7QB 5TGBB 4WGVB 4FZ8H 4Q9QL 1F45A 3BPOC 5DJ8A 3LKNA 2B20A 3BHBA 1F3RB 1DN0B 1U41A 4OZGF 4JFFB 1X4YA 5ITBH 2R0ZL 2OP4H 1JI1A 1D5BA 2VXVH 3BGMA 2BVOA 4XX1G 5E6IB 4KPHH 4KRNA 4WHCA 5ID1B 2IBZX 2Z31C 4M93C 3G5ZB 3TVMA 4NO5A 1VFAB 5FHAL 4X7SL 3QNZA 4TVPL 3DMMC 3H0TA 4LMQE 4HGMA 2A6KB 4Z9KB 4F9LA 1JF1B 3C60A 1UEMA 2RCSL 3D2UA 4L8DA 1MCCA 4R2GB 2ORBH 3MRHA 1YEFH 3PF2A 5IHZA 1UWEH 4ONFL 1C08B 5DD5L 4JKMA 1T2QH 1TENA 1WLHA 1FO0H 4XBGA 3B2UC 5J6GB 4GT7A 1S7RB 2GTZB 4DZ8A 5I17B 1K4DA 1WK0A 3GJFA 4H8WH 4YXHH 3VXTA 2BSSB 4DKFH 1EERB 4ETQB 3C5ZA 2CR3A 3CMGA 3QNXB 4YFLF 1ZWIA 1M6OB 2VLJA 1UXSA 4OCRH 3KPMB 1IEAB 1YY8B 5BVPL 3MGTB 3L6FA 3PJSB 3ZL4H 2BY2A 4IRJC 2DYPA 1UWGL 3OJMB 5FYKE 3J8F7 4H0IA 4EOWL 5I1EL 4YHZL 3OKEA 2V2XB 2J8HA 4Y4HA 5J1AA 1OTTC 3DI3B 4EBQL 3IS0X 3MRKB 1MCWM 4OGAC 2V5MA 5DEFA 4HBQA 3MGOB 3H8NA 4QXUL 4HJ0D 1UVQB 5CGYC 4NKIH 4JPKH 3NIGE 1RMFL 2FH6A 5M95B 5MEQA 4PLOB 3ZZ1A 3EFDH 1I1FA 1E4KA 2ADJA 3WJLA 1HI6B 2XTJD 3QEHB 4GRLB 5DFWH 3HG1E 1A7BA 3BGFC 2RGSA 3BP7B 1Q38A 2AW2A 3BXNA 4PRID 5D9SB 4E42A 4OM1H 1H8SA 1OQXA 2F5BL 1I7RB 5SWZE 2XZZA 3W0WD 1OLLA 2B1AH 2EH7H 4UU9B 1D7FA 4M6OL 5I8OH 3ILQC 1SJHA 4LPUA 2V6HA 5CBEB 3IF1B 1FYTA 4X80H 4GXUN 1MFCL 3L3DA 1LE9B 1K9TA 1Q9WB 1TZIA 4P2RB 4OAWB 1IBGL 3A6BH 2HFGL 2GFBA 3UJIL 4WO4C 2K3TA 2BCKB 5DVLA 4ODUA 1KEML 4WV1C 4HUUA 3TFKD 1YNKL 3D69B 3T2NL 1S5HB 1U6AH 1L6ZA 3GMMB 4X0KA 4YGAB 2AGJL 5EN2B 5DJAA 1UH3A 1DQMH 5ECJE 3EO0A 3C8HA 3IKKA 1B6UA 3BN9D 4LPXA 4M4RA 3EHBD 2VMFA 4OV5A 1JZ2A 5CCKH 1RZFL 4PJHB 2R0LH 1KJMB 3SKJH 1ORSA 3FO1B 3QDMB 4XMLL 4F7TA 1FZKB 5IJKC 4UT6L 3LD8C 3WXWH 3QUMH 4IOFD 2BNRD 4R7DA 1H3GA 3RKPA 2VZOA 4J3TA 1A3QA 1NBZA 4G7YL 3KLDA 1BFOA 4B41A 5GZNC 1EIBA 4UDTA 4PTUA 1TTFA 1RUKL 2AQ2A 2DQHL 4O2EA 2Y25A 5GIRB 2W9EL 3IU3A 4HEPG 4AL8H 5KANI 3O41B 4XRCB 1ZLSH 1JPTL 3JTSA 1KPVA 3WNNA 2DICA 1GGBH 5I2IA 1N0XL 1GSMA 2IQ9L 3DTXA 2VIRA 3T77B 1C12B 2GAZB 4KRPD 1FYHB 3CZFA 3D3VB 4JLRB 3HG1A 1T1ZA 1XGTA 3TO4D 5I8KL 4XMPH 1QLRA 1IT9L 4HWBH 4LP4A 4GAJH 4KH2A 1NDMB 5GSVB 3EO1A 1BQHA 5CWSB 1PX4A 2X4UA 5C8JA 3QCVL 3HI5L 5DJ0A 4K94L 4PRDA 2LVCA 3U0WH 4MJ6B 1IARB 3EOYG 3G6DL 4P46C 3FRUB 3PGCB 4MXVF 1C16A 2B0SH 3D85A 5F7HA 2P7TA 1CQKA 4PJAE 1P7QB 3B6SB 3WS3B 5DRZB 2OI9B 4CRPA 3SE8L 3FQNB 2G60L 1I9RL 2E27H 5ISZD 3V4UL 4JREC 4IOIA 4LCCA 3QDGB 5LCVL 3T04D 3OKDA 1CU4L 4EVNA 3UPRA 1F4YL 2X4PA 2ADGA 4XNYH 4KK8D 3O2DL 1MREH 1ADQH 2MKLC 5B22A 3LKSA 4PJCE 1KN4H 3X3GH 2J2ZA 4P2QB 4OZGB 1CFVH 1MJJA 4DGIL 2UZIL 3OJVC 2XWTA 3WEXA 5H35B 4XWOD 5CP7B 1BLNB 2ADFL 2DQTL 1KBGH 1S8DB 1T7WA 3ABZA 2O5YL 4NOBA 2P1YA 2F74A 4HJJH 1NMCB 4NRZB 1G7IB 4XAKE 1EBPA 4R0LB 3ARBB 1KG0B 5E9DE 1DP0A 3T0WA 2UV3A 3VWKC 2EXYC 3MLPA 1QG3A 4M7JL 1WIUA 2VAJA 5GZOD 1X4ZA 4TTDD 3IDYC 3LB6C 5J1SC 1UYWH 4MSWB 3P4MA 1HINL 1XR9B 4HGWA 4KK5C 4NNYB 5FKAB 1P7KA 3MACH 1JGUH 5EBWA 1CDGA 1AHWC 1RZ8B 4NWTH 1OAYH 1F42A 5EU5A 4N0CD 2YSSA 4C54A 1UKTA 2YWYA 1HHJB 1AI1L 3B8YA 3ZDZF 1D6VL 1YDPA 4JPWL 1GGTA 1MCDA 4XP5H 1LO5A 3LH2L 3AU1A 1A1OA 3DRQA 4KTDL 4M5ZH 1R24A 4PJAA 3IDIB 2VR5A 3SKUD 3OGCA 4P4KB 1IAII 5K59E 4ZOEA 2I9TB 5I1GH 2J8UE 3WD5H 1L9NA 1EO5A 3WFEL 5IUSA 1Q94B 3K8KA 4FFWC 2NY1D 4W81A 2Q3AA 4PRAB 1SMOA 4XBEH 3SE3A 5DUBA 5TE6H 5F1IA 1F4WH 1MHPH 1K6QL 4PRHE 3ULUE 3LV3B 1QFOA 1XGPB 1EMTH 1QD0A 1U3HD 1A6VL 4XPGH 2BNUA 4MNHA 4W4NA 3QPQD 3WS6A 1YEGH 4WTWA 4L8SC 4PJFF 2FX8L 1AR2A 3UC0L 3LOWA 2BSTB 2Y07H 4LNRB 5HDQL 4GSDL 2IANB 2GK0A 3LZFH 2W0KA 3QDJD 2Z9TA 3T1FA 4D0DA 2X4QA 4K3JH 5E9DA 3PQYD 2WIIA 2E9WA 4XNXH 2YBRB 3BKCL 4J3OC 1UJ3B 4S2SA 3MUGB 1A9BA 2VQ1B 3LKQB 2HKHL 5JTWA 5CD3A 5D6DA 3MA7B 2HN7B 4KV5F 3VGGA 4Y4KA 4Q6IA 2HWZH 5SX5K 5IW6B 3PL6B 2LE9A 3N1FC 1OGAD 3GKWL 4U4BA 3IDGA 1EVUA 1RVFH 1H3PL 5IF0B 2ED7A 4G8EA 5C0CA 2BVTA 1A21A 5DQJA 3TA3C 4F7PA 1SBSL 4CVZA 3O3DA 1PZUB 1EEZA 5D1ZB 1FLRL 3CVHA 4KJQD 5JNYB 3DSFH 2LU3A 2D7QA 4CMMA 3DYPA 2D0GA 4FTVB 3SKNB 2Z31A 3P0YH 1QSVA 3P11H 4HKXB 4LPWA 4PRPE 4ONGH 4YHMH 5FO9A 1KB5B 2ADIA 5IMKB 3HAEG 2LTQB 3CFEA 1KPUA 1QNZH 4N0CC 4MQXD 5D70H 2PCPB 2P24B 3GSWB 3GHEL 3FMGL 2EO1A 2IH3A 2OR8A 2PW2B 5GRZA 3VFWB 2A83B 4FFZH 1OSPL 2F53E 1ZK9A 1HOCB 5ID0A 2X9XA 5EC1B 5A2JH 1M7IB 2EZ0C 5J7CC 1GJIA 4M8QA 4PRHA 2P8LB 3I75B 4UQ2A 1VFBA 2FGWH 2XQBH 4NCDA 5EOTA 3V6BR 2AJVH 8FABA 1AE6H 4PLKD 4KQ3L 3V8OA 1MI5B 1QRKA 3F62A 5GRUL 1N7MH 1E6JL 1FE8H 4PY7B 2AXFB 4RGMC 1CICB 4DKDC 2BHYA 4TUJB 2NXYB 5E2TH 4XCEB 5F88A 5HDLA 1LP9B 1WAAF 2XG4A 1B3JA 4LHUB 4YDKL 2OCFD 1VEMA 1VACB 4AM0B 4PS4L 3QPQC 4NT6A 4NQDE 3KJ6H 4R3SA 3TV3H 4YXKH 4FQQB 1A6TA 2ZUTA 3D6GA 3VI3E 3DGGA 4LEOB 3TZVD 3DVGA 3OL2A 2X70A 5T1MB 3V6FA 3GM0A 4CN4A 1CXFA 4LSSH 5DURB 4C57C 1INDH 1HQRB 1JN6B 2E7MA 3MFGB 1ZLUH 1M1SA 1S9VA 4OQTL 2V9QA 4H5SB 2R2CA 5D71L 3QISA 1R5WB 3DX9A 4NHCL 2A9MH 3RNQA 4MYWB 3QFDB 5ENWB 1OTSD 4HWZB 5ESQB 2BVQA 2BY3A 3C6SB 4XNMB 2DDQH 1KB9J 1ZA3B 1G1CA 4U1SA 1ZHKA 4L4TE 4KXZI 2NZIA 4JHBA 1IKNC 1FZOA 2X7LA 5C0EB 5K9OB 1JTTA 1KTLB 1EFXB 1INEH 1IC1A 1N6VA 1G0YR 5T3ZD 1N4XH 1EA9C 3KPOB 5GS3A 3NCJL 2XZQH 3MLSH 4LCIH 3QQ4B 1XF3B 5DHVA 2QKIA 2YPKB 4XVTL 3BAEL 3B9KC 4OLYL 1MELA 4PGDB 1IM3B 2Y5EA 5D6CA 3IXAA 4WV1A 3TVMD 3STZB 1XIWA 2F53A 3KPRD 3O81A 3SGKA 2QADD 1K8IA 4FNLL 1FPTH 2IMMA 5AZEL 1MSPA 3QI9D 3O11B 3D2UD 1CDCA 2OQJB 4P3CH 2F15A 2CDFA 5IB3A 3C8KA 3MO1A 4PD4K 3C5JA 1CL7L 4JZOA 5EU7C 5BVJA 3QXAA 3DUUA 1CDBA 1BGXH 2H45A 3RVXD 4AJ0A 2ID5A 1XMWA 1FIGH 5IJKA 5DK3A 3JUZA 4G8GB 3RUGE 2EEAA 5DJZB 1OF2A 1KCRH 2FB4L 4IBLT 5IFJA 1WEJH 3MRJA 1U8OB 5AYUH 4PY8J 4LLYB 1NBYA 4M6ML 5C6WH 2W1NA 4JRXA 4Z7WE 2VLJD 5T3ZH 5D8JL 4CVWA 3VFUA 1WCBA 2XV6B 3DXAE 1D5MA 2C3VB 4U1KB 1E4WL 5LBSH 3O3AA 3RL1B 2DQUL 3HAEH 3L95B 5MI0B 5E8PB 4CAGA 4A2LA 3R1GL 2DYPD 4NZDA 3RY4A 3CSGA 3VW3L 1AGCB 1OWWA 4LSQH 1NGXA 5CLTA 4Y4HD 1IGJA 3FOMB 4M9PA 2DBLL 1UB6A 1X4XA 5AG8A 2AK4A 1U2HA 4LLWA 4NNXA 1R3LA 4GLRI 4TNVK 5F9WC 4JPIB 3UJJL 1GH7A 1BD2E 2FR4B 1IM9A 3VXOA 4RGNB 5C07E 3P30L 4ZQKB 3FQTB 4NZTL 4LDOB 5B4MC 1Y18A 5L0QB 5DS8B 1T83C 2HMID 4L4TA 1SYVA 4OZHB 3BKML 3UBXB 3FB6B 2DLFH 4FQ1H 5A3IC 2ZSWA 2SEBA 1IC4L 5T33H 3PWPB 3VA6A 5EO1A 3B5HA 5AWNL 5BXFB 2HJFB 5KVDH 3TBSB 4P46A 3INUL 1PKQB 3DLQR 3RWIB 4WI6A 4G43A 1BFVL 2NX5B 1I75A 1DBJL 1B0RA 3R06A 3UDWC 3MLXH 4JFFE 3CNKA 3TT3H 1KUMA 1GGCL 4JO4L 3C8DA 4Y1AA 2VLLA 1T21A 3UMTA 1K5NB 4MD0B 1N8ZA 1BZ7A 5T3XD 1Z9MA 2VDKL 3MRRA 1IGTA 3GRWL 1MLBB 1ZANH 3MTRA 1KLUA 2V17H 1M71A 3WNMA 3HNTH 1KSRA 3N1QC 1EUTA 4V1DB 1KJ3H 2QADC 3GSNB 3RUGA 4F2MA 4QRUB 2WWKT 3QI9C 4PJGF 3BZFB 3SDDB 2C3XA 3JV5A 4U6XB 5E94A 5TDNB 4OLXH 4OI8A 3O0RH 3QCTL 5JA9A 4P59L 3L3HB 1DBMH 3W9DB 5FF6A 4AG4H 4GW1A 4PJ5A 4Z7WA 4HIIA 5D7KE 1RZJH 4OD1H 2Q3ZA 3LRHA 2GIYA 4HJGA 4CVXB 3DXAA 1ZLVK 4F3FA 1OT2A 5HDBF 1QA9A 1IGFH 1NCNA 4MS8C 3BSZH 3IKCB 4NDMB 4QOKB 6FABH 1NFDB 4S1SH 1XGUB 4LVOC 1BBJB 3GSOA 5JXED 5IBLD 3UYRH 5D1QD 4KUCD 5FYKD 5BS0B 1VGEL 2RQ8A 1ERNA 3SJVB 5JW5B 4S1QH 3H9HB 1KJ2L 1FORH 5AYQA 3IDNA 1IGYB 1P1ZA 3SGEI 3BDYL 1MFDH 3MNZA 2X6MA 3GO1H 1BD2A 1AHWA 4GG8B 2W9DH 5C07A 1CG9B 2UVFA 3H3PL 1DJSA 3H6JA 4MNQE 4D9LH 1K3IA 1N5AA 2GY5A 2XPGB 3QJFB 2IF7A 4FQLH 3UTSB 4ZD3H 3U4BL 3HG1D 2XA3A 4TOYH 2HRLA 2CJUH 5HHXL 2DBJA 2WUBH 3VCLA 2R0KL 4FABH 3TLRA 5SWZD 5IT2L 1YMME 5TF1L 4HIJB 2PW1B 1MEXH 3ARDD 4KJPD 4WVRA 1OP5H 1EO8L 1E0OB 4JQIL 3GBNL 1GGIH 3K46A 4F58L 2FH8A 5EBGA 4R6UA 1FGVL 5I66A 4RMTA 2H1PH 4K3GA 1AFVH 3Q6GH 4KDWA 3TNNB 1VSCA 1FBIL 1A6AB 1Q9LA 1BIIB 3D85D 4F7CA 4GMSH 1NFIA 2FO1A 2IPUG 1F90L 2VWEE 2YA2A 5FYKH 4MXWL 4ZNEE 5CJ8A 1CVRA 4G6FB 5L88L 5L2KB 4R4BB 3DV6A 1L0YA 1K2DB 4OSUH 1GOGA 1RHFA 4LLDB 1R3JA 3QXUA 4PB0L 2BJML 3TBYA 1YEDA 4E0RA 2IEPA 4PGCB 2VOTA 4U6VH 4UMGA 2XWJA 2UWEF 2W0FA 2LAAA 1JV5A 2APBA 3VXRB 3VRJA 3V5HB 1TVHA 3ZHKA 4LP5A 1T0NB 3M45A 5KSVB 2FDBP 1SJVA 1AKJD 4J12A 4JM4L 4K8RL 4PJHE 1XF1A 1JPSH 4P5TA 5D72H 3TCLA 2DQFA 4F7MB 4J2XA 4JFYB 1A7PL 2XXCB 3P0VH 3WFBH 1U8LB 3QNXA 4RGOH 3M1BB 3BT2H 5FM8A 5L8KB 2E6JA 1I8LC 3C2AL 3LKPA 3PWLB 3OTTA 4BQ8A 4YHLL 5C6TL 5K9QI 1G9MH 4I0PD 2VITA 2GITB 4X6CB 4ENED 3IYLW 1ZHLA 4MAUH 4WENB 2NTFB 5DRWB 4MNQA 5AUMA 1YUHB 3BPLC 5GJTL 3W11C 2DMBA 2A6DB 5IBLC 1HWGB 3ROLA 1CGSH 4P23C 4U3XA 2AJZB 4AEFA 1AGFA 5J9PA 5T1LA 1NEZA 1YMMA 3DOSA 2IMNA 1JGEB 1MUJA 3L5IA 12E8H 2Z93A 4ZFZB 3NZHL 1FIEA 5EIIA 4H25B 4AENB 1FL6B 1HI6A 2F54E 4KTEH 1U91A 5DJ6B 3U4EB 3LSOA 2IJ0C 3EYFA 3EJZC 4UU9A 3ZLQC 2IH1A 1G6VK 4YK4B 4ZUSA 4RMRA 2HJLB 4HFWA 3EYSH 1Q72L 3E2HB 4RISH 5C92A 3GGWA 2AS5M 3MRMA 2RB8A 2AABH 1RULH 1LNUA 3SCMA 4ZNEA 5I16B 1BOYA 1A7NH 5IFAH 2ATKA 3FB5A 1NC4B 4Y5YA 3FQRA 3RWJA 2JELH 3WLBA 1F3JB 4KKBD 4X9FA 5MEPA 5BZWB 4ZFFB 3QDGE 3HC4H 3GMMA 4YBQC 5FYLL 4BFEA 4H0HB 2CDEA 5IHLB 4KMLB 5DK2A 4NPYA 1BEYH 1SHMA 3V9FA 4XVJL 1G6RL 3MJ7B 1NJ9A 4DUXA 4JO3L 5F1KC 4OD3L 5GS0L 4LGRB 4P2QE 4NKMA 3FO1A 4X9BA 3DIFB 4OZGE 2J1KA 5EOQL 3WYRA 3SKMA 3OR7B 1N5YH 3DUSA 4WUUB 4XVSH 2H6PB 2X4SA 4XAKD 3IAQA 4PBXA 1Z9SA 4I3SH 5E9DD 4O51B 1I7ZA 3BD5A 3IJYB 2WK2A 3AREB 3QUXC 3WJJA 3CDCA 1D5ZA 3E0GA 4EI5A 3DETC 4GKNB 4NN7B 4YDLB 3EAKA 1CE6B 4GAGH 3NIDF 4GQ9H 3UTZB 5IJVA 2NW2B 4PJGB 4DGYH 5DK0A 2DQIH 1P9MA 4OFYA 3L1OL 4WI2A 2VC2L 4KHTL 4J7RA 3TPKA 3BJLA 3V4PL 2DRUA 1IKNA 5D96C 4JEGB 1S5IH 4LBEB 4LLAA 1Y6KR 1FP5A 4LVNC 1I3VA 1WWWX 2X40A 5DJCA 4OLUH 4JG1L 2F54A 3CSPA 1ITBB 1BJ1H 5IEHA 1PQZB 4OLVH 1NCAH 3B9KA 3AAZB 1J0HA 5HSFA 2N4IA 1NANH 1ED3B 3LQMA 3GMLB 5EO0B 5HGDA 1T6WA 2R0WH 4HUWA 4N1CA 5I75C 3RDTB 4O9HL 2ZUQC 4ZYKA 4LKXA 3O6ML 1FFOA 3RZCC 4JJHA 1CIUA 1F02I 1JHKL 3HTLX 4MJ6A 5FYJL 5HVHC 2IPTH 4F8QA 1GC1H 4I0KA 2JB6B 1BX2A 3O8XC 4Z7UA 2EYRB 1RIUL 1P7QA 4OGYL 5BV7H 4YAQB 4ZAKC 5EBLA 3BMWA 1V3MA 5HTSA 2AJSL 3NAAL 1YECH 3AS1A 4GAYB 5GGUB 4PRHD 3STLB 3MLVL 5CKGA 2P47B 4PJ9A 3FFCA 3RFZC 1IAMA 4HUNB 2HVJB 1T5XA 1BWWA 3MJ8A 5HI3D 2H9GA 4N9OB 5EA0L 3IDJB 4A6YB 2WWMD 4JFXA 2ZUVA 3G08A 4QRRB 2BY1A 1HSAB 1CFTA 4Z7VF 5J4MA 3HMXH 4W4OC 1T0MB 3LRGA 1U8HB 4BZ1L 4FP8H 1N64H 2DQEL 3CVHH 1CGXA 1JL8A 4I48B 3GUTA 2HVKB 1F6LL 2NY3C 5CZKA 3RTQC 3PP3H 3S34H 4QT5B 4NUJA 4UBDD 2HH0L 1JHTA 5CZVL 5L9DH 5I1IH 3DVNA 2PN5A 1UXWB 3K80A 4KFZC 4RBPK 3MBEB 4MAYD 3OR6A 3S5LA 5F71A 1RZIB 3DNKA 5FUZH 2WLYA 1MCJA 3LN5B 1KG0A 3QQ9D 5EIVA 4U1LB 1T83A 2FO4B 2UWEB 1OAZH 4R90H 5E8DL 1MF2L 3BO8A 2CKBH 4G9DA 3OXRB 3VMOA 1VA9A 3FQXA 1QKZH 5MENE 5BW7C 4QF1A 5FKAA 1OTUD 1U3ZA 2V7HB 3WL9A 5EU6B 2NZ9C 4LSTL 4PRPD 3EBAA 3GB7B 3DYOA 4OZIB 2NY6D 5BO1H 1DE4A 1PYWB 4KKAC 4WUKH 5F97E 4TSBL 2E7BA 3HS0A 5EB9A 1YQ2A 5T5NG 3RL2A 3MUY1 2F53D 3SDAB 4OB5H 2ICCA 3V6OE 1SVZA 1QZ1A 3GBML 2MQ3A 4WW1B 4WTXA 1DSFH 5ADPL 3JV4B 5C86A 4HMEA 4MDIB 5FGBC 2ITCB 4N8CL 3RVWC 2PXYB 4B53A 3N06B 1ZA6A 1A2YB 1A0QL 4FQXB 2R9HC 1KCUL 2B1HH 1EFQA 3U36B 4PRAA 2VDRH 1CE1L 3CUPB 3L3JA 4LCUA 1FV1B 3JUYA 1NBVH 4N8VB 4OUOA 2DN7A 3ROOB 2MPAL 2ZG2A 1FDLL 1IQDA 2NY4D 3HR5A 3KR3L 3CIQA 3I2CH 4KTYA 3HPLB 4XCNA 2KZ1B 4WU5A 3GIVA 4IMLB 1MPAH 5EU4B 3MRLB 1AGEB 3DVFA 2R4RH 1FVEB 1GHFL 3TO2B 1U3YA 4NQDD 4O58H 1MVUB 5HI3C 5CJ5A 1VADA 1H3XA 2WM0A 5DHVH 4K3EH 3QT2A 1UFUA 3KPSB 3REWA 4L3AA 5IB1A 1WVZA 5JQ6H 4RFEB 1KENL 4OLWL 1UH2A 3KXFB 5C08B 3WIFA 1YC7A 5H2BB 2X4OB 3W81A 2YS4A 3GMNA 5F9DC 1YYLL 4NWUL 4ODVL 4K2UH 1VGKB 3MUHL 4FRWA 1A6ZA 3C9NA 3OKMB 1IM9D 3CVIL 5MENA 2R1XA 1KIRB 2GJZB 2X42A 4Z7NF 4L4TD 2VN4A 5JORB 5JW4R 4NQVB 2WBJD 4XMKL 2FHBA 1CD8A 1JNLL 4TVPE 4UOW1 1K4CA 4G8FA 3TBVB 1WISA 4NRYB 5C0FB 1WBYB 1RUAL 1R3IL 3MV9B 3O6FC 1SEBA 4LCYB 1FN4A 1ZT4A 2AQ1A 5D5MB 4UTBL 4LLQA 2D03H 2VKXA 4UT7H 1FSKC 3TIEB 4NN5C 4ODTH 1AO7A 1NLBL 2EDKA 4KROD 4Y8DC 3MQIA 3OAYH 1I9JL 5ALBH 2Q8AH 3TN0A 4QXWA 1P4BH 2G75A 2CRIA 3C6LB 1TETL 5F3BA 3RIAF 1HK6A 1KTDA 3PWNA 1IZKA 2NY0C 1J1OL 5TE7H 1U93B 3IRZA 4X7CC 4X9IA 4BZYA 4JB9H 5EC1A 5FUCE 1DQQB 4BK4A 5HI4D 3EOAB 1EAJA 3OKKB 2C3HA 3OKYA 4I3RL 1FZMB 5KG9B 3BVNA 4NQCE 1F11B 1XF2B 4M7ZB 3U30B 4Y5XB 2GI7A 1FLTX 2C4FU 4YXLL 4PJ7F 1XT5A 3AGVA 5BMFH 4G8IB 3DO3A 2GTWA 5DR5L 5IQ9A 5IG7A 5DGRA 3RGHA 2W65B 5ACMA 1CICA 5F7WC 4G8GE 3DXAD 1RHHB 3O3UN 4PJEB 3LKRB 3T65A 1WBXB 3JBG7 2JK5A 4L9LC 2OSLA 4GO6B 1RZGA 1RPQA 3FONB 2YD5A 3BUYA 1CLYL 4OLZH 3VH8A 5I15H 3NFSL 4FQQA 2HT2D 4QNPF 3MJ6A 5J11B 4XP4H 4P5MA 1A1NB 2AJYH 2P8MA 1E4XL 5I1HL 1BD2D 4M1CD 5DTFB 5C07D 1NAKH 1EJOH 5E1AA 5CEYB 1EHNA 1BJ1J 3MYJA 4M3KB 4MJ4A 4DW2L 4X6EA 3RGVC 4QO1A 4H0GA 2QQKL 5CD5C 4OCWL 5IKCA 5HYFA 2YUVA 1NFKA 2Q6WB 5MHSD 1B4RA 3TM6A 4B0MM 4PUBH 5AD0B 3X11A 1RUQH 3ECBB 5DJXB 4TNWK 5ILTH 2APFA 1LDSA 2H2PC 1ORQA 4P2OB 3NZ8B 3LN4A 4Y19B 5IQ7H 3QFDA 5ENWA 4U0RC 1J0JA 4FQIH 4PJFE 1QRNB 2ARJB 2RJMA 4UV7H 5EOCL 2X4TA 5C0AB 4OZHE 3HZMA 4HPYL 1MWAH 3IFLH 1HE7A 5DD1L 1NUFA 5J06A 4JFFD 4DTGH 1G9NL 3MLUH 1LK2B 3HZYB 4PJIB 2WBJC 2O61B 3MMEB 2H41A 3A6CL 3P3YA 5KJRL 1PKQE 4Q9RL 1HQ4A 4RNRB 4YHKH 5E6ID 4Y2DC 1OSZB 5HGAB 3RJDA 5SX4H 3WHE0 3MXWH 1I8KA 2NX5E 1JRHH 1JWMA 2FX9L 4HUMB 4O02H 2ZKHH 4HPOH 5I19H 1RIHL 3O3BA 5E8OA 3P77B 2V5RA 5JR1L 4YZFF 3HRPA 4KV5E 3FO2B 4WWKC 3I02B 5I9QB 3MR9A 4NQCA 4MA3A 4PP2B 4FS0A 4DQOH 3OQ3B 2BC4B 4JKPL 3V0AC 1NGQL 1ZHNA 1O5DT 4CKVX 3P9MA 4I5BA 1J1PH 4BKLA 4RFNC 1RAMA 1K85A 5EZLA 3E8UH 1PSKL 5DVNA 3RA7H 3QUXA 4U7SA 4I0CC 4WHTA 4XNZC 2C9AA 3CFDB 1F8TL 1WFOA 2NYYC 3ARGC 3GZKA 4ZS7H 1JYVA 4P49A 3RWEB 4W6WB 3IJHB 4NO2A 5HPMB 2YPLA 3EDKA 4LLMB 1Z3GL 4WW2F 1TQCC 3BP4B 3BW9B 4QOKE 2C7UB 3RL1A 1DUYB 1U8MB 3JTTA 1NFDE 1P2CB 4NZJA 3CFBA 3MV8E 2VZVA 4Q2ZB 2VLKE 4TULL 2R23B 5BS0E 5H94B 4U3HA 3SJVE 4A2MA 3SQOH 1A6WH 4PJ8B 4XI5D 5TPWH 1INQB 1HILB 1YMMD 3A67L 1SBBA 3EYQD 4PJFA 1BZQK 5B3NA 2EO9A 1MLCB 3QRGL 4OCMC 2AQ3A 4GRLD 5EIQA 5HGHA 3S36L 2JCCA 1B4JH 1WAAE 4OCXL 3MSPA 5F7MC 3PGFH 4U6YA 1DQDL 4F33B 1EHXA 1QVOA 1G6RB 1MAML 2ZOKB 4XPHL 5LAXB 4C58B 3UTQB 4R8WH 3SE9L 4FXKA 4J6RH 3X13B 1D6EB 4UB0L 2Z91A 5E8EA 4L9DA 5IBUB 1I3GL 4PR5B 3X3FL 3LY6A 1NGZB 3L3KB 5DSCA 3N9GL 4NYLB 3V5KB 4NP4H 1D9KC 1BZ9B 4LASL 4LSRL 4MA7L 1L4IA 1DQTA 1A4KA 2YOCA 4JM2F 2B8OT 5E6IC 4HS6B 4M62H 4GBXC 1I4FB 4W4OA 1J8KA 5L2KE 5EO9B 3RIFF 5EUKA 1RJCA 3UX9B 5INDB 4OFDA 1FNSL 5DHYA 3BZFA 3RTQA 5HYEA 4R2GC 1XCTA 3QUYB 4LMQI 1OAXH 4APQA 1NAMB 2A9NL 5SWQA 2BMKB 4F8TA 1OPGL 4M7KH 3QIUC 3QWRA 1XCQB 3L3GB 2DQCH 3DRTA 5DDHA 3O6LL 1V05A 3NFPA 1G0DA 1FC2D 4EI5D 3MV8A 4QXGL 4LSVH 2VLKA 3FN0H 2JB5H 3VFMA 3SJVA 4OTXH 4Z76A 4ALAL 3EDFA 4AEIH 2G2RA 3MREB 4OFYD 2A74A 1HSBA 3LIZH 4G80A 3ZYJA 2E6QA 2FIKA 1VKXB 5GS2H 4G6AC 4HV8A 4ZPVA 1EEYB 5F3HA 4JANB 2V5YA 4UT9L 4G42A 4JZJB 4C56A 5FOBB 1DQJB 2EDHA 2H26B 4DVRL 4AQ1B 2XPGA 2GSIB 3K81A 2F54D 1LO0L 3MRPB 2H2SD 1AY1L 2I27N 3O2DA 1TNNA 1Q0YL 3D39E 3ARXA 2PETA 1FJ1B 2FBJL 3GMRB 4FMFA 1Q1JH 2Z8VC 4X6BA 3RPIA 2FEDC 4RA0C 5EZJB 5FGBA 3VDCA 3R8BB 4QYOB 1MOEA 4GRLC 4K7PY 2QHRL 1I7TA 3P73A 3GK8L 4PG2A 5I30H 3PHQA 4POZD 4UIKH 2RAMA 3HA0A 1P7QD 3FT4B 3KLAA 4D0CB 3LEYH 3VFNA 1HN1A 2DAVA 3Q48A 3QDGD 4PJ9D 2FL5A 1NGWA 4KKCC 5DQDH 2UY6A 5L2KA 1OD7A 3CMOH 3WIHH 4EDXA 1J87A 1KTKE 4LLDA 4YDJB 1F4XH 3V4VH 3ZTNL 1JMZA 3MLTA 5CIPA 2DMKA 1R5IA 2DJUA 5JUEH 4P2QD 3QUMB 4PRIB 1HXMA 3EFFA 3OXSA 3V5HA 2AEQH 3IU4H 2C4FT 4U1JA 1KF9B 5CP3A 1HYSD 5C0IB 3JWDH 1QFWL 4NQSB 1JZ6A 5CBAB 3NN8B 4LKCB 1EAPA 3AS2A 1MH5A 5IVZB 5A43C 4WFFE 4P3DB 3BPCB 5E1HB 4RAUB 5FK9B 4G9FB 2Y5TB 4LSUL 4J3XA 3T3PF 5GRVK 4WUUE 1NCWH 1TJIH 5E03A 3BQUB 3ARBD 4OF5A 5IHBA 2WUCH 5AAMA 2VDOH 4RIRA 4HX1A 3E6HB 2XKNB 4WJ5A 1IAIL 3C08H 4NKDA 2NNAA 4EEEA 1LK3L 3LEVL 1HEZA 1LWRA 4OZFA 4UILL 1P4LB 3PHSA 1CXLA 1VFMA 3VXPB 4PJGE 4NRXA 1U8KB 3KYMB 4HH9A 1XAUA 4KJYA 4KUZH 1EXUA 3MV7B 5LQBH 1T1XA 1MFBH 2VISB 3D39A 4FFYL 1RUML 1RK0A 2VXQH 2YXMA 1S7WB 3MNVB 3D0LB 2BNRB 5HDBE 3OKOA 1TTGA 4XXCA 1UEYA 2XZAL 1SEQH 1CD0A 1ZTXH 1F6FB 5LXGL 2PO6A 4XHJD 1YEKH 1T4KB 5LGJA 4N1EA 4UINL 3ZTJH 3PHOB 4RDQF 4P4KD 4UNTA 4RCAA 4OCSL 4YE4H 1A4JB 5I16A 1EZVY 1BM3H 5TH2B 4HXBL 1KACB 2VRAA 1CD1A 3T2QA 2XN9B 4HKZA 1UKQA 5EPMA 4WY7L 3X14A 1N2RB 2B2XH 3H9SE 1X5XA 3G04A 1U8JA 2BXYA 4LDEB 5D7IB 4Z18A 2ZCKL 4DN3L 3O2WH 4QRTA 4CGTA 1LO3H 4U7MA 1UADC 4E5XA 4L9LA 4RAHA 4HIXH 4F80A 3QG6A 3QB7C 4F9PA 4JY4A 4LQFL 3QULA 3G6JF 2VR4A 4QRRE 3F7VB 5ADOH 4KHXH 4NO3A 4ZDHB 4M43H 4LHUG 4HQQL 2HA1A 2IAND 3S37H 4Q6YA 3AXLB 1KB9K 3HI6H 3OAUL 1A6PA 1QBLH 2B4CH 3R0MA 5IK3A 3MRDB 4MX7A 3EYUH 1RZKL 3EO9L 3TC9A 3QBTB 3BP6A 2PTVA 1WZ1L 3HPJB 1XGQA 5IMMA 1HYSC 4JFHE 3CDYA 2RBLA 5D1XA 2OK0L 2YRPA 1NANI 2ZPKL 3ARFC 1T1YB 3MJ9L 3RWGA 3MA9L 1SYSB 4XT1C 1H15A 5MEND 2E3VA 3QIWB 3V0VB 3CX2A 5F96L 4MGXA 3I50L 2UWEE 3ARBC 1BFTA 2ZOLA 2IGFL 3VFVA 4FXGB 2H3NB 2R2EA 1Y0LA 3ES6A 4EIZC 4PRNA 4NC1C 5CUSL 1GL4B 3FO9A 5A2KH 3JWOH 4JN1H 4IHOA 1WC7A 1G7PB 5HHOA 1IAOA 3T2PA 3DO7A 4OZIE 3ARQA 1CD9B 3RDTA 3FOLB 3TN0D 5TDPA 1T7YA 4K7PL 3U83A 4ZOAA 2IQAB 1YJDH 4WNQA 3SPVA 1QFUL 1JK8B 3KVQA 4M5YH 5HHNA 3PGDB 4MNGE 4O4YL 4C4KO 1QHPA 5T5FH 3UO1L 1I7UB 3F7PC 1OM3H 5GGUA 3H9SA 2R2HB 1A7OL 2F5AL 2ZCHL 3RWHA 3O4LB 5K9JL 3LQAH 3FB7A 5K33A 5CILH 3ULVF 1F3DH 4P4KC 4HIHB 1UM5H 2YC1A 1ZGLP 1CDUA 4OZ4B 3HLAB 5C0DB 1QLFA 5I18H 4PRBA 3ZKXB 4HK3N 5FO8B 4HWEL 4P2CG 4Z0XA 3W39A 2BX5A 1YNTA 4JE4B 1CICD 5TQ2H 4TUKL 2OJEA 4OQTA 2AV1B 4LAQL 3J7HA 3ARPA 4JDVA 5HY9B 3CCHA 1VERA 5JZ7D 4KC3B 3AMKA 1G7HA 2VQTA 3GMQB 1FG2A 1D5XA 4PGEA 1IFHL 4I3GA 2X4RA 1CXEA 4TN9A 3OWEA 5I76B 1HHHB 3U0PB 1KIPB 2QL1A 35C8L 4PP1C 4XHQA 2N1KA 4HHAB 4HFUH 2XNAA 4QXTB 4Z78A 3GMPB 3H3BC 3KXFE 3LN5A 2VH5L 4UDUB 4XNUL 1IEHA 2EXWD 3QH3B 4JFQA 4EKXA 4L4VB 4QTHA 2DIAA 2VSCA 3GMOB 4GRWF 4OCYL 4B7LA 4JKLA 4TVPD 4QTIH 3M17A 1OOAA 1DANU 4M1DL 4F57L 4MHHG 5E2JA 2A6JB 4X99B 3UBXG 2OL3L 2Y36L 5ESAA 5IESH 2DQJH 2Q7NA 1UQSB 1PFCA 1ZAGA 3QFJA 1O7VA 1EFXD 3OX8B 5HGGS 3PL6C 4XP6L 1S9WB 1HWHB 2E7CA 1PDKA 4JGMA 1FG9C 5CGMA 3QQ3B 2LFGA 5C7XL 1JBJA 2OLDA 1MJ8L 4Y16A 4OF0A 2XFXB 4ZUUA 1WQVT 5D7LB 1D9KA 4XC1H 3GEWB 5D1ZC 3VWJB 1RJZB 4CW1B 5GRWA 3W82A 3QHFL 5EBMB 3ZE1F 1MIEH 4LDLB 4MNGA 4ELMB 3NIDE 3QEUB 4GBXA 1CLOH 1L7IH 1BQLL 2DL2A 2R0ZH 2VE6A 4NQCD 3KS0H 5H37G 5GGSY 2E7LC 3CC5B 1OGAB 3MRGB 2R1YB 1W72L 4PJBF 3BP5B 4YHNB 5F7NC 3BPNB 4NM8L 2XTLA 4OF3A 1V7NL 4X7SH 3P9WB 5J13C 1BVKA 4TVPH 4G8GD 3QIUA 2VLMD 5IB2B 2A6IB 2RCSH 1Y6NR 2W59A 1TJHL 4ONFH 4N5UA 1CFSB 5DD5H 1EPFA 5IEKB 1T3FB 4U05A 3SDXB 1MVUA 1T89C 2VXSL 5IVNA 1OHQA 1KGCE 2FWOB 4PJEE 4K7PX 4NJAL 5HHVL 5D7SL 1OW0C 2PTTA 2HLAB 2NXYC 4RFEA 4XBPA 5D7JA 4ZO9A 5F44A 2X4OA 1VDGA 1YEJL 4GJTB 4UAOB 1G7LB 3SBWA 2EIZA 3FAWA 4P57B 2MQ0A 3MOQA 1H8NA 5ACLA 5BVPH 2Q8BL 4JQXC 3G6JB 3RU8H 1KIRA 5B3JF 4Z7VE 5FV2A 1UWGH 1XGRB 2CLRB 4Z5RA 3GRWA 4D0BA 5DMIH 4EOWH 5I1EH 4YHZH 3QUZC 3PWPD 4EBQH 4G5ZL 3TCXA 1RJYB 3F7RA 4QXUH 1QRNE 1YNLL 3Q6FB 2X9YA 3H3KA 4RA3A 2WIMA 2IC2A 1B0WA 1J18A 2VLRE 4QHNB 1RMFH 4L29B 5C0JB 1P4IH 4EN3A 2NX5D 25C8L 3WUWA 4JFOB 1YMHA 1Z0NA 5EORL 3U2SB 2DL9A 4HK3J 1LO4L 1B0GB 1EHAA 4PB9L 2AEPL 1ONQA 3TBTB 2ICWA 2XKSA 4FZ8L 3ESVF 1ZLUK 4CDGC 4FXLA 1MFCH 1BP3B 2ICEB 2CIIA 1VEOA 4ORGA 1KJ2A 1I1RA 2OP4L 3HNSH 3VFRA 5JO5A 1IBGH 3SDDD 4B5EA 3UJIH 5DQ9A 1AGBA 4KPHL 2XOTA 4LVHB 1KEMH 3LKNB 5DJ8B 3BHBB 4N9GA 1YNKH 4U1HA 2UUDH 1JF6A 3QWRD 1D5BB 4U1NA 1FCGA 2AGJH 2DM3A 3BGMB 2BVOB 5F70A 1H3WM 3TWCH 4R26H 3T0EC 3FT3A 2ORBL 1YEFL 4QOKD 3OGOE 5CJQL 2EDFA 3JVGC 3MV8D 4NO5B 1RZFH 1UWEL 2VLKD 5BS0D 3QNZB 1KXQE 3SJVD 2UYLA 5JHDE 3H0TB 1T2QL 4QWWC 1S7TA 3C60B 1FO0L 1R3HA 3D2UB 1EZVX 4L8DB 4UT6H 3MRHB 3ZSSA 3RZWA 2YUXA 2CLVA 2WP3O 4MMZC 1F2XK 5IHZB 2EDQA 4QGYA 4OZFG 4DZBA 4H8WL 2Y06L 4YXHL 4MQ7A 3QDHA 2NY2D 4JM2C 1YEEL 4ERSL 4Z7VA 4PJXF 4XBGB 5MI0C 1C5DA 4DZ8B 1Q0XL 1K4DB 5IHUH 2CLZA 3EDEA 3GJFB 5KANG 5SX4I 2XA8L 1JRHI 2UZXB 3GSNH 4LLUA 4P2OA 1KLFA 3QCUL 1JPTH 1ZOXA 5I1KH 4LFHG 1YEHL 4P9HH 3C5ZB 1I3RA 2VLRA 1ZWIB 2IQ9H 4RGNC 2VLJB 3V52L 1UXSB 3RVVD 5L0QC 5FYLE 3SOBH 5I1LA 1WCQA 3L6FB 1EHLH 4JPKL 2DYPB 1IT9H 4KGJA 3RPKA 1U9KA 2UY7A 3OKEB 2WNGA 3EFDL 4Y4HB 1L6XA 5J1AB 2CIKA 1PEWA 5E7FA 3QCVH 3VFSA 5DEFB 2NCMA 5F7LB 4K94H 1NC2A 4G6FD 1Q9OA 4OM1L 5L2KD 3SHSA 4Z7NE 1L0XA 5MEQB 3E3QE 1I1FB 4X5XA 2ADJB 2BFVH 3DGCR 4HC1H 5ITFA 3X17A 1QPXA 4E42B 3BXNB 3SE8H 2R56H 3BYYA 3BGAA 2G60H 4YH6A 1I9RH 3VXRD 2G9HA 5LCVH 3S98A 5GRVL 3MODL 4XWGL 2R2BA 1IMHC 3A6BL 4WI8A 4M8VA 1SJHB 1F4YH 5C0ND 4GFTB 3WBDA 3O2DH 5GGQH 1FYTB 2D7MA 2PR4L 3L3DB 4LAJH 3GHBH 1TZIB 1U6AL 4PTTA 4D9RE 5JHDA 3ARFA 3RWEA 2GFBB 1ZHBA 4C83A 2UZIH 4AIOA 4ODUB 1MCKA 4HUUB 5JHLH 1P2CA 3WLWD 2C1PA 4X0KB 2R0LL 2P44B 3SKJL 1ZKAA 2I5YH 1MCOH 2YRLA 3TJHD 5DJAB 5CJXC 4ZOCA 3EO0B 3WXWL 1WBZA 3LRSA 4OV5B 1YN7A 5C2BL 4J1UA 2ERJB 4IDLA 5DJDA 4LOUC 4PJ7E 3T0XA 5ICZA 3QZWA 1ORSB 43CAA 2BSED 4F7TB 3D39D 1KIQA 1JGVL 4OD2A 1DL7H 4R7DB 4M7JH 4GAFB 3UCRA 4J23A 1KLGA 3NPSB 1NBZB 4G6MH 1BFOB 1HINH 4E41A 5T1DL 2PO6D 4UDTB 4M00A 4PTUB 2JIXA 5DEGA 1MY7A 1HH9A 4AEEA 5IV2A 3QP3A 4O2EB 2N7AA 4QNPE 3HN3A 3IU3B 4XCFH 4HH8A 1I8IA 2QQQA 4NBZB 2VDPH 3JTSB 1KPVB 1AI1H 3CGTA 1E28B 4XMPL 1D6VH 4JPWH 3L3KA 5I2IB 2EE9A 3SGJC 4S1DC 3DTXB 2VIRB 1BZ9A 5KSAA 2DQDH 1NQBA 2DOCA 3CZFB 1GPOH 3GNMH 3HG1B 4OZFH 1T1ZB 1XGTB 2JTDA 1QLRB 2HT4D 3RAJH 4YIQA 5DUML 2KDGA 3EO1B 1BQHB 2K7QA 2X4UB 2B0SL 3WFEH 1J5OL 5INDA 5C8JB 2EC9U 5DRXA 5DJ0B 4KRLB 4HIEA 4WFFD 3U1SH 3QUYA 4NKOB 4OGXL 4PRDB 1GOFA 5F9JB 3AM8A 1KJVA 1G7QA 4WUUD 1C16B 2P7TB 1CGTA 1A6VH 1KV3A 1DLHA 1GVIA 3ARED 4XZUA 3NCBB 4IDJL 2C3GA 4IOIB 4LCCB 1W8NA 1SY6H 3LMJL 1IQWH 3KLHC 3OKDB 5D1XD 5EU3A 1T03H 4EVNB 4YZFE 4NZUH 3UC0H 3SKOA 1DVFA 1UKSA 2X4PB 3UPRB 2ADGB 5HDQH 4GSDH 1TMCB 3HI1A 3V8CA 3LKSB 3BKYL 3NBNA 1P6AB 4PJ7A 4XNQA 3ULSA 3VFOA 1J0KA 3Q3GA 1EUUA 5BJTA 4BM7A 3QO1A 4JZJA 4JZNA 3PP4L 2HLFC 1A1MA 1MJJB 3WEXB 2XWTB 2HKHH 4BSWA 4N68A 1WJ3A 1DFBH 3RVUD 1S9YA 2VABA 1C5BL 1S7UA 3MV7E 3BD4A 4ZUVA 3V6ZA 1A14L 2F74B 5BQ7A 3ZT7A 3RDTD 3RHWK 1H3PH 1CGYA 2OTWA 5DI8A 1ZVYA 1JNHA 4YWGL 2QR0A 1MHEA 1SBSH 3K2UL 4KI5E 3GIZL 4C4KT 3FCTA 3PABA