5FLIA

Enzyme-substrate complex of ni-quercetinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
183
structure length
183
Chain Sequence
b'IEYATRHRARSFIPPEPGKPYFIEKGLGDRAHLFGDLITIYAGGEQTENTFNFFTCEGPKGEVIPAHSHADTYEVFYITQGAVRLFVEDLEGEQHEKLLTPGDFGFVPKNCVHAYRMERHHSQVVGVAAGPGGTFERFFESLGTPAEELGLPVRPFVPEPEKFRTVPEQYDVRFRPDHQWHTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUERCETINASE QUED
publication title Quercetin 2,4-Dioxygenase Activates Dioxygen in a Side-On O2-Ni Complex.
pubmed doi rcsb
source organism Streptomyces sp. fla
molecule tags Oxidoreductase
total genus 38
structure length 183
sequence length 183
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fliA00
3PVBB 2IXIA 4XFGA 4IEYA 2GC2A 3MPBA 1J3RA 1DZRA 5I0TA 2WC2A 4HSJA 3FE5A 2H6CA 3QACA 4WVZA 2DCTA 2ET1A 4JVAA 4KWKA 1J3QA 2C0ZA 3H1MA 2BEOA 1XE8A 2CAVA 2VECA 1ZREA 1O3RA 4QMAA 1GQHA 5JAXA 1UCXA 4QGNA 3H1YA 3M3IA 4HLTA 2PHLA 3NJZA 4ZU7A 1OD5A 4IEPA 5C6CA 3WW4A 4BHPA 3ELNA 3I7DA 2HJIA 3CF6E 1ZRFA 3BCWA 3RYRA 2XKPA 3NL1A 4I2OA 3KGZA 3EBRA 4ZU4A 4HVQA 3CLPA 1IPKA 3RDIA 2IC1A 2H0VA 1CX4A 1J59A 2XL7A 1QXJA 3NSTA 4HVOA 4HN0A 4IETA 1YFYA 2EAAA 4F8AA 4IEZA 3VHRA 3RYPA 3BB6A 1OFNA 4I0AA 4B29A 2F4PA 4UBHA 3H8UA 4AVCA 3GBFA 4BYYA 3USSA 2O8QA 1I6XA 5LEKA 2I45A 4LA2A 4NVPA 3DV8A 3CL1A 4WBBA 5J7MA 4LULA 1YFXA 3ACLA 1YFWA 5I0RA 1Y3TA 2GAUA 1ZX5A 3O14A 4JV4A 2PYTA 1LKNA 5EFUA 4AVAA 4RD7A 3PLQA 3G7DA 1L3JA 5BUVA 2UY8A 1CGPA 3SXWA 4R52A 2PQQA 4ZU5A 3ES4A 2FQPA 4WZCA 2PAKA 1YHFA 3BPZA 2UY9A 1CAXB 1O3QA 3SCGA 3H50A 4LLOA 4XFFA 4J1XA 5KHIA 4H7LA 4IERA 2OA2A 1CAUB 4QX5A 4Q0VA 3KSCA 1RUNA 1YWKA 1VP6A 3FHIB 2IXKA 1UIJA 3PNAA 3N4MA 3H3ZA 1CAVA 5KHGA 4X6RB 3M70A 4XF9A 2D40A 5KHJA 4XETA 4HZFA 1VJ2A 3R6SA 3ZDSA 2Q4SA 3IWZA 4PJYA 3HT1A 5FQ0B 4L11A 1QWRA 3D0SA 4KWLA 1EY2A 3DN7A 2XLFA 2PAMA 2CAUA 2KXLA 4JTNA 4YARA 5CVRA 5BXXA 2EA7A 3H1WA 1J3PA 3SCFA 5FPXA 1LB2A 1OMIA 4OLLA 5FPZA 1J1LA 4XFAA 5FLIA 3ES1A 2BNOA 5K8SA 3E6CC 4IESA 4EWAA 2GC3A 1O4TA 1TQ5A 4BIFA 5KBFA 4F7ZA 2GH2A 1ZZ7A 4E2GA 1EYBA 1ZVFA 4R8HA 5FLJA 3NW4A 1ZZ6A 3E5QA 1EP0A 2BNNA 5CU1A 3ST7A 4QM8A 1ZRDA 2QDRA 4I02A 5J3UA 4FT8A 4JTOA 2QJVA 1FI2A 3S7EA 1NE6A 1CAVB 4MUVA 3ETQA 1WGPA 1WA4A 4PIXA 4LUMA 2OPKA 2GC1A 3RNSA 5C8WA 4N9IA 4AQ2A 3FWEA 3UKNA 2ETEA 3DKWA 2P17A 4MGIE 3H7YA 3L2HA 1QY4A 4CYDA 3LZZA 3D82A 3IIAA 4J1WA 2BYVE 2ET7A 3HIFA 3U11A 3OTFA 1J58A 3CJXA 1FT9A 4EWEA 4I09A 2FMYA 5JR7B 2PA7A 4TLFA 3LOIA 1O3TA 2OZJA 4IEUA 1PMIA 2D5HA 1SEFA 2CGPA 1DGRA 3S0MA 3BALA 2PFWA 2XGXA 4XFHA 1RL3A 1SQ4A 2N7GA 2D5FA 4XFCA 2H6BA 2XLAA 4E2SA 1UW8A 4IEQA 4Q29A 2UYBA 4XEZA 2WFPA 3KGLA 3FX3A 5J48A 4I01A 1Q5OA 1RGSA 4EWDA 5CADA 5I0SA 2VQAA 4UBGA 4KU8A 4Q0PA 3TNQA 2CV6A 1JUHA 2IXJA 4O9EA 2O1QA 3FZ3A 4YYOA 5I8SA 2PTMA 2XLGA 1X8EA 3LWCA 1DZTA 4EROA 4YSFA 3EQEA 4FAHA 4META 4KU7A 4XFIA 4MH0E 4IEOA 4IEXA 1U12A 1PM7A 4L2NA 4HVRA 1Y9QA 1DGWA 2Y0OA 1ZZCA 4MV2A 4LUKA 4AVBA 1CAWA 5F1RA 4ONUA 2Z2SB 2VPVA 1UIKA 3IDCB 1ZRRA 3RZZA 3NVCA 2BNMA 4IEVA 1H1MA 1Q43A 1UD1A 3LA3A 3ROUA 1HW5A 5JSPA 4HN1A 5D1IA 1IPJA 4LTAA 3LA7A 3HT2A 2XKOA 2XL9A 2QVSB 3E6DA 3H7JA 5BV6A 1NXMA 4X6QB 1I5ZA 4KL1A 4KWJA 1WLTA 3FJSA 3E97A 3SCHA 3LA2A 3S7IA 3E5XA 4DINB 1RTVA 4AQ6A 5FDBA 1ZZ9A 4HBNA 3EHKA 3MZHA 2OZ6A 4Q0SA 4MX3A 1X8MA 3DL3A 4MGYE 3OD0A 3C3VA 4N9HA 5JCTA 3GYDA 3E6BA 4LA3A 1RC6A 3MYXA 4YRDA 2QCSB 3OGJA 2Z69A 1V70A 2UYAA 2IXHA 3IDBB 4BH9A 3H9AA 5I93A 5BPXA 3EO6A 1ZZ8A 2B8MA 5AVPA 3HQXA 3KCCA 4XF1A 1O3SA 1NE4A 1CAWB 3SHRA 3D0JA 2Q0AA 2OYZA 1X82A 4PIZA 4I3PA 2GZWA 3BU7A 1XRUA 2MHFA 3U0ZA 2PHDA 3CO2A 1ZNPA 4QM9A 1ZRCA 2Q30A 3WW2A 4OFGA 1O7FA 1YLLA 3WW3A 1NYWA 4XF0A 2E9QA 4I0BA 2D93A 3IBMA 4GULA 2ZKLA 4PIYA 4AXOA 3OCPA 1UPIA 2HKXA 2IXCA 5E1RA 2PAEA 4XFBA 5LRSA 1CAXA 1X7NA 3U10A 1H1IA 3MDPA 1XE7A 5T3NA 2EVXA 1O5LA 1SFNA 3I59A 2ATFA 3UKVA 1CAUA 3KMHA 5FLHA 4D7TA 5BY5A 5I0UA 1O5UA 5EZWA 1LRHA 3RYKA 2K9ZA 1LR5A 2IXLA 4XF4A 1FXZA 4HMZA 4MZUA 4MGZE 2Q1ZB 3I54A 3EJKA 5I8TA 2MPFA 5FQ0A 3TNPB 1NZCA 2V09A 5E16A 2BGCA 1G6NA 4FAGA 4D7SA 3RPQA 5LEJA 4LEJA 4QXKA 4P9GA 2GU9A 4O9GA 3LAGA 3B02A 1QXRA 5KHKA 5LRRA 2B9UA 2XHKA 2B5HA 4K8FA 3E5UA 5KHHA 4UXAA 4A2UA 3JZVA 4MGKE 4Z82A 4Q0UA 3I59B 2QNKA 4QGMA 4YNIA 3QOPA 1EPZA 3H3UA 1ZZBA 1YFUA 5I91A 3OF1A 2GC0A 4Z07A 3UKTA 4FBFA 4HSLA 5HI0A 4ORFA 4XF3A 4EV0A 4E2QA 5I8YA 5JSOA 3NKTA 5JSRA 1GQGA 1RUOA 3WW1A 1Q3EA 1VR3A 2MNGA 2K0GA 5FCCA 4IEWA 3SMHA 1OI6A 4QGLA 4Q0QA 3CEWA 2ZCWA 1YUDA 3FFQA
chains in the Genus database with same CATH superfamily
3NNGA 4K7JA 3TAYA 5F9TA 5DAVA 4LLFA 5LA9A 3AFGA 5AVAA 1MPXA 3AZVA 1BEV2 1VBB2 1JUIA 1RUH1 4O7XA 4LQRA 4ITCA 1LOAA 3CMGA 1J3RA 3OY8B 5I0TA 3TYJA 4AHYA 4CUGA 1RUG2 3POSA 4LOSA 1STMA 2VMCA 1FNYA 3UESA 1PNFA 1ZBA1 1R1A3 3PJQA 4CU7A 5F3GA 1DQ1A 3U4XA 1DYPA 3AX4A 3WDYA 3A4UA 2J1AA 2FDGA 2WRAA 3U07A 3PIGA 3V56A 3GZEA 1J3QA 2RG4A 2VZOA 4UWDA 4BMBA 2XUEA 4NIGA 5B4NA 2BEOA 4HKOA 3RI8A 3EYPA 3AK0A 4QMAA 4RHV1 1XC6A 2LALA 1MS5A 3MIGA 1V6IA 1YRZA 5C6CA 3WW4A 1WCQA 1PGW2 4BHPA 3KQ4B 3DECA 3I7DA 4KBZA 2HWE1 2Y6GA 5ERLA 2JDUA 4K8RB 2PHXA 1ZRFA 4Z1VA 4Q26A 2VJXA 1WD3A 1WMDA 3BOPA 3KGZA 2JIJA 5IHRA 2Y6KA 4AE2A 1ZBE3 2W08A 5FZDA 5HBAA 1GNHA 1DG6A 2HWE3 3RDIA 3I8TA 1FYUA 1AR93 1CX4A 2R063 1BK0A 1JOJA 2XL7A 4XHBA 4AEDC 4AHWA 3I2GA 1QXJA 4IV3B 4CXYA 4HN0A 2OUHA 3RG0A 1Z78A 2WQ8A 2JD9A 4EN8B 4F8AA 4IEZA 4NWVA 2Y6HA 3VHRA 1F15A 3VBHA 5F37A 5LW9A 4QXBA 2ZX2A 4P9YA 4B1LA 4B29A 4QHZA 1W2OA 5AFEA 4UBHA 5K0UC 5CFCA 4D0QA 2FHRA 3USSA 1OPMA 1POV1 2I45A 3R4SA 4LA2A 4CDQC 4BQ3A 2ZX4A 1YQ2A 4AGVA 4LULA 1AL21 1IPSA 1YFXA 3VBUA 1YFWA 1MS4A 1DYKA 1VBA1 4OUEA 1GZTA 4BQ4A 1Y3TA 1W0NA 4OI2A 2GAUA 1SDWA 2XG3A 1AR82 2Q8CA 3CBNA 2IZWA 1MEC3 2GP3A 1POV3 4UW6A 5F5QA 2GALA 2JKBA 3THTA 4COUA 3B3QE 4QPGC 3PUIA 5F2WA 2VUCA 2JB8A 3G7DA 3KT7A 4AFDA 2ZGOA 3WNOA 4LKSA 1YQCA 2VR4A 2ZHLA 2C26A 3ZO0B 3CZUA 2PAKA 2LS6A 3BPZA 2UY9A 3JXSA 4L8QA 4Y1ZA 5IVBA 2XBO2 2WQZC 1IKPA 3HNMA 4XFFA 2GDFA 2GMPA 2QQWA 4J1XA 4LLOA 3W59A 5KHIA 4LBQA 1UZZA 4H7LA 4IERA 5FYYA 4Q4W1 3LSEA 1CAUB 3WINE 2AENA 2P1BA 5EWSA 3LDKA 1RUNA 2Q1MA 2LTNA 5CFDC 3JBG2 3MUZ1 4FPJA 1FOD1 1QEXA 2RR11 4IV1A 4EN9B 4X6RB 4XTMA 2DYCA 4XF9A 2D40A 4GJYA 1RUF3 4NAMA 3SEPA 4XETA 1RUD2 2E33A 4DY3A 2DURA 1FV3A 3WEZA 3PUAA 3DXUA 5D21A 4CUCA 4DRRA 2ZGRA 4YGCA 3M8LA 3OYWA 1BKZA 1H9PA 2A70A 4QPWA 4BM8A 3QH6A 3VLBB 3VKOA 3ZXAC 4XILA 4MSVA 4YG3A 3MUY1 4YW6A 2HWC2 5DZGA 2GN7A 3D0SA 5LZ6A 3BIEA 3VDDC 4QQOA 4CDUC 3OBZA 1JS9A 2PAMA 4ATFA 2RJLA 4LR4A 1D4M2 1EUUA 1M4WA 3CU7A 2ZEXA 5FP9A 2VD7A 1GP5A 1BEV1 4L97A 3H1WA 1Y43B 1VBD1 4ATEA 2DVBA 1QDOA 4W4ZA 4YZ4A 5T54A 3SCFA 4OHVA 1KJLA 1OMIA 3LD8A 3H0OA 2YU2A 1J1LA 4QPIC 4QX8A 2D3PA 1JXNA 1US3A 5K8SA 1OHFA 1PVC1 2GC3A 1NUKA 5FXWA 4PHZA 3CJIA 5FKBA 1Q8OA 1ND3A 1V6KA 2PQSA 3FBMA 5DUUA 4F7ZA 3K48A 4E2GA 3HNBM 5FP7A 1DGWX 1ZVFA 3KS7A 2XJUA 3VL9A 2ZPXA 4LIVA 1WCDJ 1ZZ6A 3N36A 4CCMA 3HMYA 5BNPC 1ASJ3 3E5QA 1W8OA 1VE0A 4QU2A 5CU1A 4QM8A 1OH3A 3A0KA 1RXFA 4HPKB 4N53A 3WP5A 5L9RA 4FT8A 1YC61 1S0EA 4IW3A 1UMHA 2VO5A 2QJVA 1FI2A 1MS3A 3A7QA 2HWD2 2QTWB 1W8FA 3AYAA 5GKAC 3ETQA 5JOYA 4DO0A 3QH7A 4M3CF 4W6YA 3ZKUA 4NR1A 3S30A 1AR72 4LUMA 2OPKA 5A3MA 3RNSA 1NOVA 5DXDA 5C8WA 3ZFFA 4AWDA 2DUOA 3C8XA 3UKNA 2ETEA 2P17A 4R4XA 2NPIA 5EXOA 5FTTC 5B2GB 1QMJA 1QY4A 3EMRA 1W03A 4CYDA 1GOHA 4QWNA 4NPLA 3LZZA 1H6YA 3IIAA 4CPBD 2Z79A 3HIFA 3VDBA 4OI0A 1R093 1GKBA 1GZWB 1W6NB 3CJXA 3NJYA 3P5BA 1N3QA 4LITA 5CKMA 2W5FA 2YBPA 2E7TA 4PI0A 2GN3A 1GV9A 1SFYA 4QHBA 4S2GA 5AFBA 2Z5WA 2RDRA 4NRMA 4DS0A 1HRI1 2ZGLA 3ATGA 3GJAA 5K9YA 1RUI1 1YO8A 3DYMA 3MFAA 2RV9A 1BMV1 2WFF3 1PX3A 1O3TA 1HV0A 4H7MA 1XB9A 4A42A 2FDHA 2VUAA 1W8ZA 2CSGA 2D5HA 3F2ZA 4QD2A 1N1VA 4CU9A 1CN1A 5IVCA 5C9AB 3S0MA 3VDCA 2DCJA 1URXA 5HPOA 4RR3B 5FY8A 1RL3A 1SQ4A 4YZ1A 4CEYB 1XNDA 1NA1A 2YDEA 5LK5A 4LPLA 1KDKA 3KV9A 3VD9A 2XLAA 5C3RA 3AFKA 1REEA 1QQP3 4R9AA 2HWF2 4Q29A 1MS1A 5BNNB 2NP0A 4LOTA 3VKNA 1H4GA 2UYBA 1GU3A 3AP5A 5A1LA 2VTXJ 5IVYA 5FUNA 3WY6A 5GLUA 1UN1A 1Q5OA 2D6PA 1LOFA 4AEKA 4KU8A 1PVXA 2A6VA 3VBHC 1JYWA 4ZZ8A 5KR7A 5FY9A 1XPWA 5E88A 4RS5B 1TMF2 3ME2A 1NAEA 1UZVA 1W6PA 5CFCC 1WCKA 4ARXA 4XBQA 2V4AA 1UQXA 3UYJA 2R49A 3EQEA 1I1EA 3RFRA 4GALA 2YXSA 4XFIA 2UU8A 3JBG1 4MH0E 3VBUC 4YVSB 3ZPYA 5EIYB 4WVWA 4LJHA 4IEXA 4JZRA 3OY8A 1DGWA 5A7NA 4JRLA 5HCHA 3AKPA 2DBNA 1C5HA 4LUKA 4KBBA 4MV2A 1CAWA 4AVBA 3HOBA 3B01A 1UIKA 4EN0A 4WVMB 1CIYA 3FLPA 4QT6A 1V6MA 3NVCA 2B9VA 3NV3A 1JZ2A 4K21A 4IEVA 4BDVB 4IQPA 4FTEA 5A3NA 1AJKA 3GZAA 3E1F1 4HN1A 1IPJA 4BISA 5ABJB 1W28A 1PX4A 1WW4A 3HT2A 3T3YA 1LOCA 1TME1 2FZ1A 2XL9A 3E6DA 4UAPA 3VD7A 3ZMOA 3V0BB 2Y38A 1HXS2 3AMHA 3A23A 2ZXQA 3JU9A 2ZHNA 2VCMA 1OVSA 2D98A 4OI4A 3PL0A 1S55A 4X6QB 4KWJA 1WLTA 4J6GA 4JKMA 5F32A 3FJSA 3SCHA 4XJWA 4Z8BA 1BBT3 1Y4WA 3TB0A 4YG0A 4K9SA 2RJ2A 3FL7A 3WF4A 3FUQA 2R041 1SLIA 2RE9A 4IV1C 2A6XA 2ZGKA 2EXIA 3HQUA 4HBNA 2P3IA 2J22A 1REDA 2OZ6A 4Q0SA 2BBAA 3N7JA 2CDPA 4EZ4A 4M3CB 3DL3A 4IV3A 4MGYE 4C91A 3DEMA 4FPLA 5IK5A 3T1LA 2JDMA 4N9HA 5L9BA 4BLJA 4JC1A 1DHKB 3E6BA 4WV8A 4BU2A 3K77A 4A6OA 4GMP1 2WS93 4LMFA 4LT5A 4LNVA 3ILNA 2UYAA 3IDBB 3J26N 5I93A 2Y34A 2ZAHA 3LPFA 4CCNA 1R082 2HWD1 2B8MA 5CKNA 1ONAA 4XDPA 1APNA 4XW3A 5DZEA 2YV8A 5HCBA 2ZEYA 5LBBA 4PF1A 2FD8A 5C3QA 2ZZJA 3S5AA 4TWTA 2FZ2A 3H3LA 1HQLA 4GMP3 4P9XA 3OB8A 3Q8EA 3WNXA 1JZ4A 4M3CE 1X82A 1QXPA 1H4HA 2QQOA 5FOBB 1WCUA 4XUOA 4YW3A 3MIBA 1NZIA 5FMBA 4Y5TA 4TZDA 4W50A 3CJIC 4ISQA 1ND3C 2W92A 3WG1A 5FZ0A 1PK6B 1DU3D 1V00A 2BW8A 2W1QA 1QNYA 3G6JB 4KMQA 4QM9A 4Y1XA 5D8AA 3PTYA 1PZ8A 3WW2A 5JIUA 1SBFA 1NYWA 2E9QA 3MV11 3POGA 4ZPIA 3O1VA 1GLHA 1R64A 4ZHNA 3H42B 4AXOA 2W47A 4PIYA 2HKXA 4N53C 2WZPP 4QU1A 3OPZA 2VZTA 4L92A 4QQPA 3SKVA 3J8F3 1H1IA 5FZ1A 2JEMA 2PHUA 1O6UA 3Q8FA 4L9BA 1VB2A 2VMHA 2QQNA 3JCIA 1O8SA 5FO8B 2O0OA 1CAUA 3ZPOA 1UZWA 5FLHA 4B8EA 5AC91 3K3OA 2HEYF 1K12A 2XVGA 3ZFFC 1O5UA 1OKQA 2G9ZA 4NWWA 2HWF1 1UY3A 1XSRA 3HJRA 1LR5A 1W9FA 4CZSA 2AUYA 5FREA 3W20A 1UYXA 5J96B 1DFQA 4D69A 2QQPA 2W1UA 4K6BA 1OA4A 4UOJA 5AC93 3IN9A 3BGAA 4MGZE 2Q1ZB 3I2JA 3I54A 3C7EA 1OLME 4P9IA 2ZZQA 4V2VA 1CVNA 2XXZA 1OF3A 1AYN1 1SPPA 4D6QA 1ULPA 2OW4A 1Z7S2 4P02B 4FAGA 4D7SA 3J7LA 4XYXA 3W9AA 2JECA 3RPQA 3IDEA 4CP9B 4A4AA 1V9U2 4P9GA 1RMU1 1H2NA 5FZ6A 1RUC1 3WDUA 4O9GA 3ZVXA 1AR61 2R072 2VGDA 5EPAA 3UGFA 1RIRA 1VAMA 2GH8A 3B02A 5A6QA 1AYN3 1NXD1 4QAWA 5CKQA 4KI5M 1WZXA 3C2UA 1JHJA 4KQ7A 1NA1C 3N7MA 2VU9A 4AFAA 5FKCA 2B9UA 5FMDA 4QDQA 2XHKA 2BWCA 5JPNB 3TN91 1RMU3 4CTEA 1AR63 3E5UA 5L9VA 4FPCA 5JVVA 5A3PA 5FYBA 1VIWB 3DPRB 3JZVA 5FPBA 4A2UA 5FYMA 1ODNA 3OUHA 2WINB 3MIFA 3PVOA 1JYNA 3POIA 1LOFC 1SG3A 4K1YA 3TEWA 5FXXA 4FFGA 2JIGA 3H8OA 2NN8A 1J1TA 1XJAA 1Y9MA 3ETPA 2JG8C 2QUOA 4HPKA 1GOFA 4Q4V3 2RS31 4J25A 4YNIA 1U5XA 2V73A 3QOPA 3GZUC 1G7YA 4C1WA 1WBFA 5FZFA 2JG9B 1UNBA 3ENRA 3GBWA 4MXWA 1MZEA 5HI0A 2EIBA 2ARCA 3CZJA 4EV0A 5C8CB 2ILMA 1UU6A 2G9FA 2P5BA 1WMFA 2RS33 2VL4A 2OVUA 2P6HA 3MHZA 4XZPA 5FY5A 3ZFEA 4ASMB 5JSRA 3BTXA 2R30A 1AYM3 3PDQA 4UFKA 5ANQA 1JOPA 2K0GA 1KRIA 1CIWA 1BXHA 1H0BA 3SMHA 1LU1A 4AEJA 3VD5A 2R32A 4R9BA 4LHKA 1GZWA 2R6QA 1PZ7A 1QF3A 3FHQA 3R4UA 2ZCWA 2XJTA 1YUDA 3FFQA 3P3PA 3THDA 4Q4Y3 2RM21 1ZYBA 4A7YA 3TEYA 3HNYM 1R1A2 2WO1A 4IEYA 2NM1A 1VMJA 2YGMA 2ZX1A 2ZEZA 5A3LA 1C1FA 3MPBA 1CR7A 2HYKA 3B7MA 1DZRA 1YQ8A 2W94A 3K46A 1ODMA 4AFMA 1H9WA 4BQ5A 4JAAA 3INAA 5DUWA 1CESA 5T55A 5C9AA 4YVWA 3AYDA 4YGEA 4NIAA 3K2OA 5DDJ3 2DBIA 4RR3A 3N9PA 1FAYA 2ET1A 4PLNA 5BYNA 1QH6A 1A34A 3WP6A 4XUQA 5FYVA 2KR2A 4KWKA 5JMCA 5FXVA 4QX0A 2YZ4A 2BVBA 4DIQA 1ZA7A 1V0AA 2CAVA 1WLCA 2YPDA 2ZTNA 3T30A 3DUIA 3WV6A 1XNAA 5JAXA 2RMU1 3VD4A 1UCXA 4MGTA 2BOJA 4IV3C 3OGRA 1FMD3 1GQPA 4HLTA 3PU8A 2R0FA 4ZU7A 1OD5A 4FCAA 4IEPA 5JXGA 3SEEA 5I0DA 1LESA 2EXJA 3CF6E 5FYCA 1QJU1 2VVFA 4CCDA 3RJRA 5IFPA 2OXBA 2D6MA 2HWE2 3BCWA 1C4RA 4GZ9A 4YGBA 4ZY9A 1AR92 2RMU3 2RHPA 1LENA 4WVVA 5GM0A 4FSJA 4OULA 4XMIA 4I2OA 2LUWA 5CB7A 4AAXA 2VCAA 2YROA 3ZXKA 3ZYRA 3LDBA 5EYYA 1IPKA 5H9RA 3ZIWA 1LHUA 4LKDA 4Q4X1 3BYWA 2PLV3 5L7OB 1J59A 3OBTA 1LECA 3NSTA 4FPHA 1GZ9A 2NZ9A 4COWA 1YFYA 2EAAA 3N9QA 4YG6A 1OFNA 2CGNA 2ZMNA 4MGSA 4RQPB 3VBOB 1S0FA 4OQ8A 5A7WA 3RRDA 4WVMA 5C4WA 2CWSA 2F4PA 2WN2A 3H8UA 4AR2A 2DF7A 2FMDA 3MICA 4HETA 3T2QA 2WQ4A 3RZJA 1GR3A 5A7PA 1RUE3 3FBYA 4NVPA 4BXSV 1RB8G 1Z7S1 1MEC2 1ULDA 2P4EA 3CL1A 5J7MA 3ZYJB 1LHNA 4B4PA 3ACLA 2PHWA 2NMOA 5I0RA 1DIWA 1VAVA 1AL22 4BLIA 2WWJA 2MEV3 1LNSA 5ACA3 3O14A 1ZX5A 5K4LA 5KXCA 3V0BA 2VBPA 5GZGA 4Z2AA 3VZMA 1SBEA 5IW0A 4ZXEA 1AZDA 1C8M3 1X36A 3JD71 5BUVA 1QJY3 4AQTA 2JKXA 1YI7A 4FVVA 3GCXA 3SXWA 1KGYA 3TOJA 1UY0A 3FFZA 1NQDA 1TE1B 5LBFA 1HX6A 1KD7A 1O59A 1W8UA 2C5DA 4Y33A 5FY7A 5LBEA 4XIKA 5F5AA 3SH5A 1C5IA 1DLCA 5T5OA 2FDJA 1D2SA 3VDDA 1CZVA 3JD73 4M3CA 1CAXB 4MG2A 3IB3A 5FJKA 2WZR1 3H50A 1UKGA 1VAKA 3UGGA 2OA2A 3FLRA 5T50A 3ZR5A 4QX5A 2VXRA 1RUF2 3KSCA 4Q0VA 4Q4W2 3VBSA 3ZIXA 1ENXA 1VP6A 2XJPA 5CA6A 3GM8A 1NKGA 2K2SA 1UIJA 1IQDC 3N7KA 4XE9A 3H3ZA 1WW5A 3I49A 5DG1A 1SCSA 1FOD2 3M70A 5CNAA 3TBDA 2EXKA 5C3OA 2V5YA 1YJLA 5CBLA 1NCRB 1OVPA 1W9WA 2VBDA 1OH4A 1VJ2A 4IGOA 1CD3G 3R6SA 2Q4SA 3ZDSA 1PGSA 2K46A 2GP5A 4R9DA 3C7OA 1CQ9A 1N1TA 5FQ0B 5JOZA 4S2FA 3WHUA 1LCLA 5E8AA 2W46A 4LO5B 1J84A 4KWLA 1PK6A 1S0DA 3KHBA 4TXWA 2OUJA 2X8KA 2HBTA 2CAUA 2KXLA 4YARA 1R1A1 3NQHA 3WG3A 2LM3A 5BXXA 4AG4A 1U5YA 3N7LA 5F39A 4W8JA 2WSVA 4OHXA 1PIV1 3POEA 5FPXA 2IFWA 3QCWA 5IFTA 1VBD2 3BI3A 2BBVA 5FPZA 3VBFB 1N47A 1U0AA 3LKJA 1IS3A 3HQRA 3E6CC 4H55A 2YPJA 4EWAA 2QZ2A 1MZ5A 1FPN1 5KBFA 5KC6A 2V4VA 1PVC2 3UK9A 1Q56A 3K4DA 5DUXA 1ZZ7A 1G9CA 1PIV3 1G9FA 2R0HA 3ACFA 2YY1A 4UFLA 2WJSA 4R8HA 3ZFEC 1UZYA 2VMIA 1JW6A 3NW4A 1RVF3 4DZGA 4I30A 3OPTA 2XPJA 4M4PA 4UW5A 1FPN3 5JLVA 3MFCA 1ACCA 5J3UA 3JB4C 1NLSA 1FNZA 3AJYA 1MR5A 3AC0A 5FMOL 2ARBA 4AW7A 1A8DA 1K5JA 1GNYA 2WNVB 2WZ8A 2XVKA 3S7EA 2YGLA 4IE7A 1CAVB 4JGYA 4MUVA 1ZBE1 1XBFA 4XOGA 2R1BA 5HXVA 2NQYA 1UXXX 4AHXA 1AR91 4BIOA 1F5JA 2R061 2YG0A 4JX0A 4A7ZA 4N9IA 1HB2A 2ZBJA 3DKWA 5FY0A 2VW2A 4MGIE 5GLZA 4XQ4A 4OQ9A 1OLQA 1Y7BA 4CCJA 4YVWC 1PZ9A 5C9AC 4J1WA 3D4KA 3POJA 2WZEA 4RR3C 3U11A 2BWAA 2B39A 4HK8A 1N1SA 2WFF2 4RFRB 2XHNA 4JHTA 4QKBA 3RMYA 3WNLA 3UNPA 5J37A 4EWEA 3MW4A 3GZTB 3RI9A 2FMYA 3DPRA 4XDQA 5LASA 4TLFA 5FWJA 1HRI2 3S6PA 3Q8AA 1RUI2 1W90A 2RS11 4A3XA 1W39A 1LGNA 2QDNA 1BMV2 2OZJA 4IEUA 4M0NA 1MEC1 1PMIA 2Y6LA 1LAJA 1SEFA 3POYA 2CGPA 1DGRA 5H9SA 1QQP2 4PDWB 3BUCA 4BPZA 5BNOB 5IVJA 2OPWA 4XFHA 2DVGA 4CPBA 5JMOA 5C70A 3Q8CA 2P3KA 4N43B 1GZCA 2RS13 4E2SA 1E57A 1SLCA 1VBC3 3N9LA 4O65A 1MVQA 1W8TA 3WOGA 3THPA 1VMHA 2JG9A 2XJVA 2ZGUA 3FX3A 2VUJA 2VUDA 1B35B 1W05A 4COVA 1JTZX 2HH9A 4YFZA 4FPFA 3WNMA 4YPJA 1SBDA 2RJKA 3WF3A 5I0SA 5CADA 1ZA4A 5KXBA 2G1MA 3ILRA 3TNQA 2CV6A 1JUHA 3NWKA 1H30A 4FXKB 4O9EA 3ACIA 2O1QA 3LGRA 4GKYA 4BQ1A 5C4WC 2PTMA 4A44A 3LWCA 2DVDA 3FMGA 4QQHA 1DZTA 4EROA 4YSFA 4AOCA 2YB7A 1Y9GA 1RUF1 1WD4A 5IWFA 3USUB 3HPNA 2I07B 2B42B 1DQ5A 5JIAA 3RWNA 1H2MA 1W9YA 4AFCA 4DUXA 3V0AB 5EYXA 1I9RA 4FXGB 1U12A 1PM7A 2AEZA 5HCAA 3B9IA 1PO21 2CL2A 3B9CA 1I3HA 1WWYA 2Y0OA 3SNMA 1NLQA 1ZZCA 5E6HA 3U37A 3ZOIA 1S0BA 3UT0A 3ITQA 3WP4A 2A6ZA 3FN9A 1GMMA 3ZN6B 5A3OA 1TVGA 2VW0A 1HB3A 3ZN4A 1VBE3 4H2AA 5FJHA 2D6LX 2GNDA 3EB7A 4Y20B 1PO23 2J7MA 1LEMA 4R9CA 5D1IA 4AI1A 4LTAA 4E4SA 3A0NA 1GBGA 3WR0A 2XKOA 2WAAA 4YGDA 2QVSB 1BBT2 3H7JA 2P6CA 3WQ7A 4BMEA 5BV6A 1TME2 4UFIA 4FOQA 4Q8KA 1CPMA 1GWKA 1W6OA 2JICA 3VL8A 4RA0A 4Q2FA 5M0TA 3T2OA 4TSVA 4ZXKA 3VBSC 4AI0A 1HRV1 1K5MB 2DFCA 2YC0A 2E63A 1NCQB 3OBRA 2J1SA 3LA2A 5FYSA 1VLNA 4O61A 3E5XA 5IYYA 4DINB 4NIIA 1RTVA 2ZACA 1G86A 2R042 2ZOEB 1ASJ1 4HONA 4YM0A 5JI7A 1WMXA 3MV01 1JYXA 2ZMLA 2EIEA 1IKQA 3SH4A 1LULA 3MZHA 1GNZA 1HRV3 4GKXA 2AREA 3M1HA 4XQWA 3UJQA 1FATA 1IS5A 3WF1A 4G9SB 5JCTA 1XXNA 4DQAA 1LHOA 5JPMB 4LE3A 4RQPA 2GSYA 5JXJA 3VBOA 3OGJA 5APAA 1V70A 2VMFA 1PK6C 2J1TA 3AP4A 3MIDA 5A70A 3EO6A 1SLAA 2OQ6A 1KXGA 2RS51 2VZRA 1DZQA 2HWB3 2VZSA 2XJQA 4SBVA 4XJAA 2Y6JA 3HQXA 1W04A 3KCCA 3LE0A 1NE4A 3RS6A 1WBLA 3ZN5A 4GA9A 2NMNA 1YCIA 1JYIA 2VOTA 3RZKA 3APBA 5DUVA 3ON7A 4CP0A 5KC5A 2Q0AA 1R091 3AVRA 3NV4A 5JZGB 1A6CA 1RUG3 2RS53 4Y24A 1MS8A 3BN6A 3VHOA 3O0WA 3SKJE 4UYBA 5T52A 2ORZA 3THCA 1VPHA 2WFF1 4GD4A 1JI6A 1PM4A 3SISA 4KGGA 3WW3A 4XF0A 3WCSA 4I0BA 5A32A 2GNBA 1XSQA 1HN0A 3X29B 4CDWB 5D2AA 3TWIA 2WLPA 1UPIA 2IXCA 1G9AA 1OLRA 3HR9A 4DOUA 5E1RA 5EV7A 1LTEA 1OQDA 4XBLA 1CAXA 1H8TB 1UL9A 2DDUA 1IGOA 2JB4A 4JGYC 4AVTA 1QQP1 2OKXA 2EVXA 1JMUB 1UOJA 3UKVA 5G05L 5F8PA 3T08A 3BODA 5EHDA 2BV4A 4D7TA 2JDPA 3ACGA 3WUCA 2QQJA 4UF0B 1YIFA 4XJUA 4ZONA 4CE8A 5AC92 3LF7A 3AVSA 3C7FA 5H9QA 2ZMKA 1LRHA 1UOGA 3RYKA 3POWA 5FZCA 5FZ4A 3V64A 2BQPA 4P9JA 4HMZA 2ES3A 5FZKA 4CEWA 2BTVC 1NCRA 3VZOA 4MZUA 2UWCA 3BVCA 5F2SA 1COV1 1CX1A 3AYEA 4BJ0A 5FQ0A 1NZCA 2V09A 1HQWA 2BGCA 2ZHKA 3AKRA 3KV4A 3LEGA 3DPRC 2JG8A 3ZXDA 1AYN2 1X33A 4FFIA 1UF2C 1SHWB 3WF2A 3IPVB 2WNUA 5LEJA 3O1UA 3ZKYA 2BUKA 4LEJA 2Y0IA 5FR3A 4NMIA 3RZGA 3NNJA 4FI9A 1COV3 2GMMA 3LAGA 1S0CA 1VRBA 2XB6C 1RMU2 2Q1FA 3K3NA 1RUC2 4DEQA 1AR62 4YW4A 5C5TA 4XAEA 1GP6A 2QQKA 3BTAA 3ZYIB 5GJ6A 3NNFA 3NNLA 1AX0A 3NV2A 3S5QA 5KHKA 4B1MA 2B5HA 4NPRA 1JZ5A 2VM9A 4K8FA 4RGAA 4PF5A 3TN92 4FPGA 2WT2A 2JG9C 2D44A 4UXAA 1BCXA 3KVAA 1NLRA 2P37A 2Y26A 5J09A 3HAGA 3I59B 1N3PA 3ACHA 4COZA 3PIJA 4MO3M 1BBT1 1XE0A 2VG9A 2X53S 4QGMA 1EV11 2XBO3 5IK4A 3T1MA 3T0AA 3SH3A 1YQ5A 3ECQA 3H3UA 2RS32 5DAQA 5FYUA 3AKTA 4IE0A 4NHYA 2I2SA 5SV5A 2XWBB 3T4VA 2WAOA 2ID4A 1A3KA 4FBFA 2XUMA 4HSLA 2FCTA 3B69A 5FXZA 4XF3A 1EV13 3MW3A 3WX5A 3BOWA 5IAVA 5C7GA 5JSOA 3WDVA 5FYIA 4IE6A 4BXFA 4AQSA 3RJ2X 1VR3A 2WS91 4Q4Y2 1RUD3 2VZ1A 4IEWA 1NQJA 1W8WA 4LBLA 2YU1A 4QGLA 1YQ6A 2VY0A 3O1RA 4Q0QA 4B7EA 2BERA 2JXAA 3CEWA 1W2AX 4A6SA 4S2HA 2OX0A 2HWC3 2EICA 2IXIA 1OSGA 4OVEA 4QXHA 2RM22 3GDBA 4XFGA 5DN2A 1VRH3 4CXWA 1K45A 1SDDB 4FPYA 5IATA 4LBKA 1DQ6A 2GC2A 2ZX0A 3LFIA 1KJRA 3ZYPA 1D4M3 1PNGA 3ZX7A 4BCUA 1NG0A 3ASIA 1S0IA 2P3JA 4M01A 3LFMA 3HWJA 4BK5A 2LRPA 2J1UA 1F35A 2VTFA 1SLBA 1W6MB 2JD4A 3NNMA 4PDWA 3FE5A 2VXJA 1HIXA 2AEYA 2H6CA 3PUSA 3QACA 4IGPA 1O91A 1SMVA 5LA2A 4WVZA 2DCTA 2WO7A 3VV1A 5FZOB 1FMD2 1HB4A 2VCBA 4GWIA 5A1AA 2VOKA 5CYYA 2VECA 1ZREA 1DCSA 4AI8A 2Z42A 3AMPA 1AJOA 3J8F1 4QGNA 3M3IA 2RMU2 4P5YA 2ERFA 2PHLA 4QPIB 5DPNA 4ZZ5A 4Z92B 2J1EA 1OQ1A 3PURA 4AI9A 4RYDA 1JZ6A 3U1XA 5LWBA 1AXYA 3ELNA 4RQPC 5ISLA 3VBOC 1BJQA 1QJU2 3RYRA 2X29A 3B5LB 2XKPA 1D0HA 3LSDA 3NL1A 4YW5A 2EIGA 3L2YA 2VZVA 2ZGQA 4ZU4A 1AR73 4MLOA 3USUA 3CDZB 4WZFA 2H0VA 1S2EA 2YHJA 2GNMA 3I4IA 4Q4X2 3ZDVA 1Q8VA 1GANA 3OG2A 2NYYA 4IETA 2AZ5A 1D7PM 1JH5A 4P00B 4MYEA 4N7IA 4V1PA 4DXSA 2YFUA 2WA3A 3BB6A 1W2TA 5FK7A 3IAPA 2VULA 2PHRA 3U4SA 1D4VB 1DQ4A 4AVCA 1GWMA 3GBFA 2MEV2 3M3EA 1LJ7A 1VB4A 2O8QA 1I6XA 1LGBA 2XR4A 3OJBA 3DV8A 4LO6B 1AX1A 4YZ2A 2VMGA 3RZHA 3OGGA 1RXGA 3PMEA 4PQQA 3ZXFA 2DUPA 3I3QA 3MPPG 3L9JT 5EJ1B 1RITA 4JV4A 2PYTA 3LDRA 2A3YA 5L73A 1JYVA 3EXUA 3GHNA 1K42A 1HKDA 3AMMA 2BFUL 1K5MA 4IXLA 1NCQA 3T4HB 2UY8A 1CGPA 2DU0A 3JD72 3LEIA 3AZZA 4QQLA 4ZU5A 5A6ZA 5IK7A 2ENRA 2FQPA 5J98B 1UKRA 4E8CA 3B93A 2BOIA 1SLTA 4Q4V1 2XH6A 2RDNA 3T09A 1AL0G 4CEWC 5FAXA 4HKLA 1NCRC 4F83A 3LEKA 2IVJA 4Y5Z0 2QZ3A 4DY5A 5C33A 2JWPA 2UWAA 5FY4A 1C8NA 1HJGA 3SCGA 1E5HA 4DNYA 1OURA 2WZR2 2TEPA 4FO9A 4URAA 2TBVA 4X8NA 1PGL2 5FMOS 1TMF3 1X50A 4EQVA 1UMZA 2XQXA 1IG0A 1OBNA 2DCYA 2WNUC 4JDMA 3FHIB 4WM8B 3HD8B 5FO7B 2IXKA 5G04L 1G9DA 1TNFA 1IG3A 3N4MA 1AYM1 3WXPA 5JXHA 1J83A 5KHGA 5LA0A 3AJZA 3VBHB 1QJX1 4JKKA 5KHJA 5F7UA 4EN6B 2OS2A 2W52A 2V72A 4AF9A 1IS4A 3O0XA 5BNQA 2FDIA 3VBFC 3WCRA 4XUPA 4Q4Y1 3AMQA 4XJZA 4CCLA 3MLKA 4FTSA 4L11A 1POV0 2KA3A 4AK3A 2ZX3A 4XMAA 4CCEA 1YI9A 1QJX3 1AVBA 4LKFA 4UFHA 1O4ZA 1EY2A 3DN7A 3MIEA 3POBA 4P5HA 1W6NA 2XLFA 4S2DA 4XAAA 4JTNA 3ZSEA 2CU5A 5BNNA 1OXCA 4CDWA 5CVRA 3WVJA 5J1XA 1OUXA 4NRQA 2EA7A 5DDJ1 1J3PA 1YIPA 3I2DA 3JUUA 5F3EA 2KD7A 4OZOA 1WLWA 1CPNA 1HXS3 1PIV2 1MZFA 2C6SA 3FHAA 1TZOA 3OUJA 5FLIA 2BNOA 3VB9A 4ZS3A 4IESA 1LHVA 1TEIA 2JDZA 1F8VA 1O4TA 1RVF2 4BIFA 5A7OA 5FYZA 3RZMA 5LA1A 3AM2A 1DQ2A 1FPN2 2VZPA 4YZ5A 5A1FA 1NY71 4CEYA 3W5MA 1FMD1 1KFUL 4UF0A 2XONA 3Q9OA 3N3HA 1JZ3A 1QOSA 2HBUA 1OA2A 1U5ZA 2VQTA 4LBQB 1GYKA 1ZM1A 1MVEA 2PXJA 1DGLA 3D8CA 2O8OA 3MLLA 1EP0A 4JDNA 1AF9A 3K51A 4I02A 5IVEA 1GSLA 1FV2A 1UPSA 3ZFGB 5LY2A 1PO11 4OYUA 4JQTA 4ES9A 3HBZA 4KH9A 1GFF2 3O12A 1WGPA 4PIXA 1ZBE2 2PLV1 2VOWA 2Z4FA 2W1WA 4I3GA 4RS5A 2VVDA 4DPNA 2GC1A 3BIWE 3IPVA 2R062 1DQ0A 1F31A 5FPLA 3UJOA 3JB8A 3UV9A 4Q27A 4BE3A 1PO13 3PTRB 1KFXL 3L2HA 3OEAA 4PDWC 2ZKNA 1ULEA 1DYOA 4XUNA 3ZSKA 2KM2A 1LEDA 1V6LA 4N7UA 5BNOC 2BYVE 2ET7A 2WT1A 3GXUA 2UURA 4YVSA 3OTFA 1J58A 1L7QA 2XJSA 4N43C 5JR2A 1RUE1 4I09A 1K3IA 2WUHA 2XWJB 4EN7B 5FFOC 5FP3A 3T2PA 3QLQA 1QH7A 2P3YA 3LOIA 2MEV1 3ZXGA 1REFA 3AYCA 5ACA1 2JDYA 1F4HA 2RS12 3OGVA 1C8M1 3M2MA 3BALA 3CJIB 2PFWA 2JDHA 1ND3B 3SLIA 5ABJA 4AL9A 3I97A 2XGXA 5FOJB 1QJY1 2N7GA 4KWUA 2W95A 5E89A 2D5FA 4XFCA 1UW8A 2CDOA 2NLRA 1JZ8A 1OPOA 4AZZA 3RGBA 1DP0A 1NT0A 4XEZA 5A80A 2WFPA 3KGLA 4CCOA 1RUJ1 1OQEA 4P9WA 1MQTB 2WNOA 2ZGPA 3AZWA 2AR6A 4RFT0 4XXPA 1RHI3 2VW1A 3WNKA 3PU3A 5J48A 1OA3A 4HK9A 4I01A 3WG2A 4FP2A 4JRAA 3AKSA 2VQAA 3TRSB 4JQRA 4MOAA 3IDAA 4XIOA 4Y26A 4K40A 2WWUA 1RINA 2WYSA 2DCZA 1L7LA 4MADA 1RUJ3 5JDBA 3F95A 3FZ3A 3ZFFB 2D97A 5I8SA 3AP9A 1X8EA 2BGPA 1PGL1 1UMIA 1N3OA 4META 4KU7A 3WQBA 4DRVA 3VN4A 2CGOA 1MS9A 2BJSA 3W58A 4IEOA 3AZXA 4HVRA 5FIXA 2A73B 5F3IA 4YW1A 1WA6X 2A1XA 2R073 4DEVA 5FPUA 1PO22 1UYYA 4E27A 1W6MA 4NOTA 4ONUA 1B09A 2ORXA 4XJ8A 1H1AA 2Z2SB 1HV1A 2DFBA 3IDCB 1O4YA 1K5MC 3RZZA 1JODA 1NCQC 3ZLIA 3DGTA 1YYNA 2A75A 1XNKA 2CTVA 3LA3A 1WW7A 5FYHA 3H8XA 1HW5A 5JSPA 2W9XA 3GGLA 4LO8A 3KQRA 3LA7A 2ADDA 2D3RA 4K20A 1W3XA 2DU1A 2W2IA 2ZHMA 3A22A 4AVVA 4URTA 3PUHA 4OHZA 3O1TA 1SACA 3GBGA 3J9SA 1OD3A 1NXMA 4GH4B 1I5ZA 4KL1A 4BQXA 4CSWA 1OKOA 3KV5A 3O1SA 2FDFA 4NIDA 4Y22B 3VZJA 2P34A 3E97A 2E7QA 3NAPB 4MXVA 4PBOA 1W99A 1H2KA 3MGUA 4NE9A 5A7QA 1HRV2 1V6OA 1OLMA 1QU0A 1RVF1 2CNAA 1JN2P 3TEXA 1ALYA 5FDBA 1ST8A 1W6QB 2DWRA 2X05A 2AYHA 1ASJ2 2Y8KA 4DMIA 3N9OA 3OOXA 2F4LA 4GWMA 1W6PB 2VH9A 4NHMA 2QKDA 3ZYFA 5LB6A 5JZGC 2GMEA 1ND2B 3OD0A 1IZ3A 4TYSA 3LPGA 3WNPA 1EAH3 3R4DB 1T6BX 4LA3A 2VVEA 2A3XA 3MYXA 4YRDA 4XACA 2Z69A 3PJYA 1JYTA 5FK8A 2PHTA 4QHOA 3VBRB 3ZXJA 5BPXA 4A3ZA 1GWLA 1ZZ8A 4BH9A 2DCKA 5FZAA 2R16A 5AVPA 2RS52 5BNNC 1O3SA 1Q8QA 4CDWC 1CAWB 5LATA 4QB6A 1GP4A 4BQYA 3A21A 5GZDA 3SHRA 2W0XA 1H8VA 3GCWA 3W21A 2A3WA 1RYYA 4XCBA 2OYZA 4CP9A 2YUEA 5HV4A 1RUH3 1VALA 1H8TC 1V6NA 2AC1A 2B7YA 4CRQA 4ARYA 1R092 1RJ8A 1F4AA 4I3PA 2GZWA 3BU7A 1T6GC 3KVBA 2EIDA 3R0RA 1XRUA 2PELA 4HXCA 1HQNA 4DUWA 4KNCA 1ZBA3 1N1YA 5EP9A 3CO2A 4CEYC 3WUDA 1ZRCA 3VHPA 4NIHA 4NHKA 1D2QA 3VKMA 2RDQA 3DF0A 1AUYA 2D93A 3HVDA 3KCXA 3IBMA 4GULA 5FRAA 3V65A 1DDLA 3QD6A 1W0PA 2ZKLA 1UX6A 1UZ0A 4R4ZA 2QQIA 2PAEA 5EJ3A 4FFHA 4RHV3 1G8WA 3JQWA 3U10A 4LHSA 1VBC1 3GJBA 4OI1A 1XE7A 1LOGA 1OOPB 1O5LA 1JOBA 2ATFA 4TLGA 4D6SA 3IMNA 3ZXEA 4RS5C 4AFBA 1EUTA 1OUSA 1CJPA 1UU4A 5FPVA 5BY5A 4WM8A 5I0UA 2PN5A 2ZGTA 3N9MA 5EZWA 5FP4A 3BTYA 4TN7A 4XVHA 4DXTA 1QHDA 4WM7B 1ZRIA 2QQUA 2IXLA 4OCTA 4PLMA 4XF4A 1FXZA 3ORJA 4GB31 1XQNA 2XVLA 1KITA 2DTYA 4GMP0 4YVSC 2L9LA 5C8CA 1W9SA 5FZ7A 2FCUA 2Y60A 4RGGA 5SV8A 3EJKA 2WA4A 5FV3A 1UO9A 1C1LA 4YW7A 1Z0HA 3GNEA 1COV2 4YFWA 2YBKA 5DQ0A 1XOYA 4LHLA 3VD3A 1G6NA 4GB33 5K7PA 2VNRA 1WKYA 2VC9A 4E8DA 2EALA 3M3CA 3OUIA 3HN3A 3I3EA 1ENSA 1BYHA 2GU9A 2HEWF 3IKWA 4GAZA 3U14A 4P14A 3M4FA 4Y1VA 1UOFA 5F5IA 4C0HA 1ULFA 2Q5TA 2WL1A 5ABJC 3KHCA 3D5OA 2JDNA 1QXRA 3KT4A 1AL23 2ZA9A 3Q8BA 5JOXA 1VBE1 2R1DA 3ILFA 4ZKTB 1VBA3 1S4CA 2FCVA 5D8AB 1DLLA 3T2TA 5LRRA 4OUSA 1RJ7A 3C7HA 5CAZA 5FZMA 5EJZB 3LQCA 3WHTA 1EPWA 5KHHA 3RZLA 1GICA 3H8RA 4DUVA 4MGKE 1A8MA 3J7HA 5GZEA 3U78A 2AGSA 4F3JA 1T2XA 2XDVA 2X09A 3AZYA 3OSDA 2C4XA 5LBCA 5C71A 1JYCA 1UY1A 3ZYHA 4MGQA 3UETA 4YW2A 1VMFA 1EV12 3MF6A 4JGZB 3PHMA 3ZFGA 1ZZBA 3J7NA 1YFUA 4E4ZA 5A33B 5I91A 2VE1A 3OF1A 3VKFC 1IOAA 2X5IB 2GC0A 4FPEA 4U2AA 5JXIA 1QOTA 2QQVA 4Q1RA 4Q4W3 4V2WA 4Z07A 3UKTA 5CEHA 4ORFA 4GIQA 4PBPA 1DF0A 2D43A 1UX7A 3IAQA 4XQDA 1GQGA 4YZ3A 1JU4A 1W0OA 3I3BA 1FOD3 2I74A 4OZXA 3J7MA 1QKQA 3WW1A 1FX5A 2RR13 5I8YA 5CZKA 2MNGA 5GALA 1SPPB 5GZCA 2G19A 2WS92 3UGHA 5L7OA 1VRH2 1BK1A 2HWB1 3AXDA 5L19A 2AACA 3PVBB 4CDXB 5A3WA 1VBB1 3SC7X 3OPWA 4HFSA 4QKFA 1XYPA 4IL7A 4NUBA 3NJXA 4MHRA 4XDOA 3WDTA 1RUG1 1MACA 5C5UA 3KF3A 2WC2A 2WKKA 2XJRA 4B4QA 5A7SA 4HSJA 3AKQA 1BEV3 1VBB3 2BPA2 1XNCA 1VBD3 4P08A 3KB5A 2VAUA 3AXEA 3NO8A 1S1AA 4LKEA 4X8PA 1HDKA 4YLZA 2ZABA 3IMMA 4JVAA 4NAOA 4D7YA 2BFUS 2C0ZA 3H1MA 5FZIA 4B4RA 1PVC3 2DV9A 2ARXA 4UW4A 4Y3OA 4JKLA 4L0PA 1PMHX 1XE8A 5LCWL 1KS5A 1O3RA 4AEMA 1GQHA 1MQTA 1Q8SA 1W2UA 1V6JA 5LY1A 3BPSA 4CXXA 4Q8LA 5FZHA 3H1YA 1DBNA 4YM3A 1PGW1 3NJZA 1UAIA 3J8F2 4MVTA 2ZGMA 2UWBA 2HJIA 3S57A 4LXLA 5CIRA 4MXWB 3PMSA 5IJRA 4B7KA 4DXZA 2LROA 1E5IA 2D6OX 2VZUA 1SCRA 3ZFEB 3EBRA 4A41A 4HVQA 3O0VA 3CLPA 5FO9B 1ULGA 3HN1A 4XZUG 2WLQA 1KQRA 2IC1A 4OHYA 2EAKA 4BQ2A 4QX3A 5IUQA 4EE2A 3IT8A 5T5PA 4N8MA 4HVOA 4D8MA 4AI3A 2PMWB 1CJDA 5FBZA 3RYPA 2Q8DA 2W68A 5FZGA 2DTWA 4FPOB 4I0AA 1M06G 2ARAA 5FZLA 2E26A 2G4IA 1XNBA 4LIUA 4BYYA 3T0BA 4E9KA 3KT1A 1AX2A 3WDWA 5JUVA 5LEKA 1OFSA 3K75B 3MO4A 1W8NA 3KLSA 4INDA 4WBBA 4YVWB 4UFMA 4AVSA 5IVVA 1HRI3 3O7OA 1SLLA 3WT3A 3ZXLA 1RUI3 4YM2A 2QQLA 4AEDB 1AR81 3D3AA 3DKQA 1W8HA 2RVAA 2B45X 4LBQD 2IVIB 4LBMA 1LKNA 4GH4A 4Y5SA 5EFUA 4K3UA 2WBKA 4AVAA 4RD7A 1GUIA 4Y22A 1E5SA 1LOEA 1UWWA 3NAPA 3PLQA 5GZFA 3WNNA 1L3JA 3TEZA 4CVUA 5K0UB 1KEXA 4WM8C 5FZ3A 3VBFA 1AR83 4R52A 2PQQA 4FQZA 3ES4A 2ZJCA 4CDQB 4XC9A 4XURA 1MS0A 3NKGA 4UI9L 1W6QA 3M3OA 4WZCA 4YWAA 3VHNA 1YHFA 3ZSLA 2XBO1 5FZBA 1UXZA 2GNTA 2AH2A 4CUBA 2VNVA 3MBWA 4PQ9A 4Q1PA 4Q4V2 3ZSJA 5C8CC 1O3QA 1AXKA 5FZEA 3AL5A 1ND2A 5T5JA 4UT5A 4ET7A 5FY1A 2BU9A 3LEMA 1TNRA 3BU0A 5L36A 4B3NA 2JE9A 3O1PA 3KF5A 4QPGB 2JX9A 2Q8EA 4DFSA 1YWKA 2VQUA 4FOWA 5FP8A 4OUMA 3VBRA 4Y4RA 2Q8OA 3CKHA 2WNVA 3PNAA 3ALQA 4XHXA 1CAVA 2ZGSA 5FZ9A 5A3UA 4OHWA 1RUD1 1AYM2 3ABZA 3B00A 4Y1UA 5A7WB 4HZFA 1QJX2 2TUNA 3JBG3 5C4WB 1SZBA 4W65A 1HJFA 3IWZA 1BHGA 4PJYA 3HT1A 2XQRA 2HWC1 4CU6A 1I5PA 2J1VA 3LIGA 4ISRA 1VRH1 1QWRA 5FZ8A 3OBAA 4NPMA 4FPKA 5GLWA 1D4M1 5CFDB 1Q8PA 3DYOA 4LO7A 2OIIA 4QDRA 4UFJA 3CIHA 3LCPA 3RWKX 4XUTA 1UY2A 5GLVA 1O8PA 3ZSMA 4W6XA 4NN0A 4RGKA 4AGRA 4E4DX 4Y4YA 2A71A 3VGIA 5DDJ2 1LB2A 1TME3 4LK6A 4OLLA 1E5RA 3PVNA 4HKWA 3ZFGC 4XFAA 2C9KA 1HN1A 3ES1A 4W6WA 1OOPA 5IK8A 3DYPA 1TQ5A 3IIIA 3WLUA 2GH2A 1BVP1 5BNOA 5FWEA 3VDDB 2C1FA 2A5ZA 2JE7A 4CDUB 1EYBA 5DABA 2LW8A 5FLJA 1NY72 4N43A 2R043 3SITA 4ZS2A 3I2OA 4WM7A 2E51A 3NRUA 2E31A 2EXHA 1C3HA 5H9PA 3VUOA 2BNNA 3ST7A 2BZDA 1ZRDA 3VBSB 2QDRA 5L7OC 2FBEA 1BZWA 2OT7A 1G9BA 1B35A 5CG9A 4JTOA 3P6BA 2VTXA 1YXWA 3HEIA 1NE6A 1AR71 4QKNA 4C0BA 1PO12 1WA4A 3NMBA 3RMXA 3D6EA 5DAWA 3K4ZA 4LORA 3RQ0A 4DXRA 1S2BA 3NJVA 2YC2A 4LBNA 2PLV2 1W3VA 4C1XA 4CCCA 3DCQA 5DMYA 4AQ2A 3FWEA 5C3SA 2HWD3 1X9PA 2DVAA 3CNAA 1CONA 2CY6A 3RVHA 4D3WA 5EQUA 1SFPA 1WCSA 3H7YA 3VDAA 5BNPB 4FTBA 3D82A 4A7KA 4C90A 4Q5OA 3V0AA 5JWPA 4U36A 2WWSA 5IVFA 1FT9A 4EYUA 4LK7A 2O14A 1JZ7A 1XYOA 2WSUA 1OF4A 4GWJA 2QQMA 1RUE2 1UY4A 2PA7A 5JR7B 3WG4A 3ZN6A 3UL2A 4DB5A 4OMDA 3PVEA 1MQTC 1QOOA 2XMLA 1DGRN 4XJ9A 4G3YC 4AHZA 4HANA 4Y20A 1UYPA 5ACA2 2YYOA 4A45A 3VZNA 1CZTA 1CZSA 2QE3A 1PHMA 3J4UH 4FOYA 3VZLA 2PHFA 2Y64A 1C8M2 4PCRA 4PI2A 1U5IA 4H14A 2IFRA 3KM5A 5GLTA 4JGZA 1QJY2 4ASLA 5A33A 1RHI2 2H6BA 1LU2A 1QJEA 2E7AA 4HG6B 3RSJA 5IAXA 2X5IA 2BVVA 4IEQA 3T0DA 5ANNA 2YMZA 2ZS6B 5CISA 4CA9A 1R1ZA 2QFEA 3WQ1A 3AB0A 1RUJ2 5DG2A 5A6YA 2R7EB 1TG7A 1RGSA 4QX2A 4JGYB 4EWDA 4FP3A 2HWF3 5KXDA 4M4RA 4UBGA 3MI8A 3O1MA 2WT0A 4Q0PA 4ASKA 1TMF1 2HEVF 2IXJA 5CG8A 1LODA 3C7GA 4BZ4A 2SLIA 2J42A 4YYOA 2VOVA 2D6NA 2VMEA 2XLGA 3GHMA 4NROA 1OC1A 5HXMA 4IDZA 3HBKA 4CDXA 2VNGA 4LBJA 4FAHA 2TNFA 4BB3A 2WABA 4L2NA 1Y9QA 1QJFA 4EZHA 2VQ0A 4XTPA 3SQOA 2W3JA 4BWOA 2FDKA 1RUC3 3P3NA 4GH4C 1UYZA 5F1RA 2HYXA 4AAPA 1S2KA 3OGSA 2WYFA 1WUVA 3NAPC 2VBBA 2VPVA 4PT6A 5HCFA 1ZRRA 3VZKA 3FLTA 5CFCB 2BNMA 2BRTA 1H1MA 1Q43A 1UD1A 3LOBA 3WSOA 5JZGA 3ROUA 2X10A 4OMCA 3TN93 4PLOA 2ZGNA 3IM0A 1OT5A 4SLIA 3LB9A 3MF9A 4HT1T 5DZFA 4D6RA 3VBUB 2BGOA 4CP1A 4GWNA 1HXS1 1F2NA 2E53A 4FOVA 3MEPA 5FUPA 3POFA 1X9TA 3K4AA 1BVVA 1ND2C 1QDCA 4JHZA 5J36A 3ZM8A 1C57A 4COYA 3KCYA 4IE4A 4ES8A 5A6XA 2CYFA 3WD5A 2BP6A 4QB1A 4Y1YA 2A7AA 3GALA 3VBRC 2WN3A 1W2NA 3FUOA 3S7IA 1H8TA 1YEWA 2CWMA 2WNVC 3BTZA 4KGQA 1IHMA 4QPYA 5FUIA 4AYUA 2VNOA 4AQ6A 1IS6A 1JBCA 4GJZA 1EAH2 1ZZ9A 3NV1A 1H2LA 1HLCA 1AXZA 3EHKA 4BOWA 4GQ7A 2ZEWA 5FPAA 4L99A 4MX3A 1X8MA 2A6WA 2WDBA 4Z2WA 4TTGA 2WNEA 3C3VA 2P2KA 5A3TA 3KZ4C 3GYDA 1US2A 1RC6A 4QKDA 4AI2A 2QCSB 1R081 1HB1A 1LHWA 2IXHA 3H9AA 2F17A 4CU8A 1XYNA 3BKZA 3KV6A 1RUH2 2WR9A 1MZ6A 4IV1B 4XF1A 1P8JA 2RM23 2WIIB 5KWRA 5F3CA 4E4HA 2DUQA 3I3DA 3D0JA 1ZBA2 1R083 3URFA 4KG0A 4AEDA 3LIHA 2D7FA 4PIZA 2VZ3A 4RSUA 3WDXA 1YJKA 3OYWB 2IUWA 3N35A 4HOOA 4YM1A 3VKLA 4JDOA 1OOPC 2ZAAA 4G4FA 1WW6A 3P1IA 4XXAA 2E6VA 2MHFA 3W5NA 1ENQA 3U0ZA 1QNWA 4EJRA 2PHDA 4LHNA 3U75A 1JU3A 1XU1A 1WMEA 1ZNPA 2WO2A 5K0UA 5JI9A 2Q30A 4OFGA 1O7FA 1YLLA 3WP3A 4RHV2 3GF6A 2JDAA 4M0HA 4QDSA 4CDQA 1QGLA 4WM7C 4NHLA 1W6OB 4NHXA 3OCPA 4QX7A 5HV0A 2DVFA 3KD4A 3I2HA 4D94A 3I3MA 1B35C 4FFFA 3CHXA 4XFBA 5LRSA 1X7NA 4BK4A 3PUQA 3MDPA 1L7RA 1ENRA 2J1RA 5T3NA 3I59A 1SFNA 5DAXA 1GOGA 1VBC2 2W1SA 2OQ7A 4LBOA 3KMHA 2CHHA 3B94A 4QPGA 5C3PA 1D0GA 1QJU3 2VCCA 4UW3A 1RHI1 5FMCA 2VOXA 5TSWA 3I2IA 4QB2A 2HLEA 1XNTA 2K9ZA 2SBAA 2WO3A 3O1OA 3ZMNA 3R05A 3I2FA 4GXLA 3KWVA 4H3WA 2JE8A 4N90A 1S0GA 4N53B 4Q4X3 2H0BA 2IWGB 4GB32 2YC4A 5D8AC 5I8TA 2MPFA 1NX9A 3AP7A 1XU2A 4IUGA 1JHNA 1LGCA 4RL7A 2Y33A 4CUAA 3TNPB 5E16A 4BA6A 5F5CA 2B46X 4QQ2A 5F6KA 3JQXA 3ZR6A 1F5FA 1PMJX 1V9U1 2Y6FA 1UOBA 1CWPA 2C9AA 1W06A 4IE5A 5CFDA 2R071 1VBA2 4QXKA 4XPVA 4MHUA 1WLDA 4BQWA 2A6YA 1ULOA 4FQ4A 4LE4A 1AHSA 4RN5A 3ZYBA 1Z7S3 2VMDA 4AGGA 3CQOA 4IGQA 3MIHA 5LK7B 3AL6A 1V9U3 4JGZC 1KDMA 1VBE2 1W9TA 1YNAA 3FC0A 3MLJA 4M00A 5FYTA 5A32B 2V5DA 2VZQA 2X5IC 3N9NA 4XCAA 1ULCA 2W91A 3ZYGA 3AMNA 4Z82A 5KXEA 2G9GA 4CDUA 5DAPA 2RDSA 2B4KA 2W87A 5FZOA 3O5SA 4Q0UA 4K1ZA 3OD4A 5B4XA 2E32A 4LO4B 2QNKA 1QIQA 2C24A 1KS4A 1F9KA 4QX1A 4CCKA 2JENA 2ADEA 2EF6A 4NO4A 2JJ6A 1NA1B 2D6KA 4KG8A 1EPZA 4HL0A 2BDRA 4QPIA 4I0WB 2WZR3 1C28A 4QXCA 1A78A 3MW2A 3M7AA 2RR12 3AP6A 5F6LB 2YFZA 4CDXC 5IT6A 4CEWB 2W39A 1LOBA 3WQ0A 2YBSA 4E2QA 3NKTA 1H6XA 5T5LA 4XBNA 2XOMA 3DXTA 1RUOA 1EAH1 4XABA 4JCKA 4CP2A 1Q3EA 2D3SA 5BNPA 1UU5A 1BLZA 1S0JA 4NJ4A 2QBXA 4NRPA 5FCCA 5FBJA 1IQAA 1POQA 2JG8B 1OI6A 1QJZA 4P9LA 5JOWA 1BQPA 2JDKA 3IZOA 3WZ1A 4C8DA 2WNUB 2F6BA 3M3QA 3WF0A 3I2KA 3QBQA 2HWB2 3OEBA
chains in the Genus database with same CATH topology
3TAYA 4K7JA 5F9TA 4LLFA 3AFGA 5AVAA 3AZVA 1BEV2 1VBB2 1JUIA 1RUH1 4ITCA 1LOAA 3OY8B 1J3RA 3TYJA 5I0TA 4AHYA 1RUG2 3POSA 1FNYA 1PNFA 1ZBA1 1R1A3 3PJQA 1DQ1A 3U4XA 1DYPA 3AX4A 3WDYA 3A4UA 3U07A 3V56A 1J3QA 4BMBA 2BEOA 4HKOA 3RI8A 3AK0A 4QMAA 4RHV1 2LALA 1MS5A 3MIGA 1V6IA 1YRZA 5C6CA 3WW4A 1PGW2 4BHPA 3I7DA 2HWE1 2PHXA 1ZRFA 4Z1VA 4Q26A 1WD3A 1WMDA 3BOPA 3KGZA 4AE2A 1ZBE3 2W08A 5HBAA 1GNHA 1DG6A 2HWE3 3RDIA 3I8TA 1FYUA 1AR93 1CX4A 2R063 1JOJA 2XL7A 4XHBA 4AEDC 4AHWA 4IV3B 1QXJA 4HN0A 2OUHA 3RG0A 1Z78A 4F8AA 4EN8B 4IEZA 4NWVA 3VHRA 3VBHA 2ZX2A 4P9YA 4B29A 5AFEA 4UBHA 5K0UC 5CFCA 2FHRA 3USSA 1OPMA 1POV1 2I45A 3R4SA 4LA2A 4CDQC 2ZX4A 4AGVA 4LULA 1AL21 1YFXA 3VBUA 1YFWA 1MS4A 1DYKA 1VBA1 1Y3TA 4OI2A 2GAUA 1SDWA 2XG3A 1AR82 2IZWA 1MEC3 1POV3 4UW6A 5F5QA 2GALA 2JKBA 3THTA 4COUA 3B3QE 4QPGC 3G7DA 3KT7A 4AFDA 2ZGOA 2ZHLA 3ZO0B 2PAKA 3BPZA 2UY9A 4L8QA 4Y1ZA 2XBO2 2WQZC 1IKPA 4XFFA 2GDFA 2GMPA 4J1XA 4LLOA 3W59A 5KHIA 4LBQA 1UZZA 4H7LA 4IERA 4Q4W1 3LSEA 1CAUB 3WINE 2AENA 5EWSA 1RUNA 2Q1MA 2LTNA 5CFDC 3JBG2 4FPJA 1FOD1 2RR11 4IV1A 4EN9B 4X6RB 4XTMA 2DYCA 4XF9A 2D40A 1RUF3 4XETA 1RUD2 4DY3A 2DURA 1FV3A 4DRRA 2ZGRA 4YGCA 3M8LA 3OYWA 1BKZA 1H9PA 2A70A 4BM8A 3QH6A 3VLBB 3VKOA 3ZXAC 4XILA 4MSVA 4YG3A 2HWC2 5DZGA 2GN7A 3D0SA 3VDDC 4QQOA 4CDUC 2PAMA 4ATFA 2RJLA 4LR4A 1D4M2 1M4WA 3CU7A 1BEV1 4L97A 3H1WA 1Y43B 1VBD1 4ATEA 2DVBA 1QDOA 4YZ4A 5T54A 3SCFA 4OHVA 1KJLA 1OMIA 3H0OA 1J1LA 4QPIC 2D3PA 1JXNA 5K8SA 1OHFA 1PVC1 2GC3A 3CJIA 1Q8OA 1ND3A 1V6KA 5DUUA 3FBMA 4F7ZA 3K48A 4E2GA 1DGWX 1ZVFA 3KS7A 2XJUA 3VL9A 2ZPXA 1WCDJ 1ZZ6A 3N36A 3HMYA 5BNPC 1ASJ3 3E5QA 4QU2A 5CU1A 4QM8A 4HPKB 3A0KA 4N53A 3WP5A 4FT8A 1S0EA 2QJVA 1FI2A 1MS3A 2HWD2 3AYAA 5GKAC 5JOYA 3ETQA 3QH7A 4M3CF 4W6YA 4NR1A 3S30A 1AR72 4LUMA 2OPKA 5A3MA 3RNSA 1NOVA 5DXDA 5C8WA 3ZFFA 4AWDA 2DUOA 3UKNA 2ETEA 2P17A 4R4XA 2NPIA 5EXOA 5FTTC 5B2GB 1QMJA 1QY4A 4CYDA 3LZZA 3IIAA 2Z79A 3HIFA 4OI0A 1R093 1GKBA 1GZWB 1W6NB 3CJXA 1N3QA 2E7TA 5BNNB 2GN3A 1GV9A 1SFYA 4QHBA 4S2GA 5AFBA 2Z5WA 4DS0A 1HRI1 2ZGLA 3ATGA 5K9YA 1RUI1 1YO8A 3MFAA 1BMV1 2WFF3 1O3TA 1HV0A 4H7MA 2VUAA 2D5HA 4QD2A 1N1VA 1CN1A 3S0MA 5C9AB 2DCJA 1URXA 4RR3B 1RL3A 1SQ4A 4YZ1A 4CEYB 1XNDA 1NA1A 2YDEA 5LK5A 1KDKA 2XLAA 3AFKA 1REEA 1QQP3 4R9AA 2HWF2 4Q29A 1MS1A 2NP0A 3VKNA 1H4GA 2UYBA 3AP5A 3WY6A 5GLUA 1UN1A 1Q5OA 2D6PA 1LOFA 4AEKA 4KU8A 1PVXA 2A6VA 3VBHC 5E88A 4RS5B 1TMF2 3ME2A 1W6PA 5CFCC 1WCKA 4XBQA 2R49A 3EQEA 1I1EA 4GALA 2YXSA 4XFIA 2UU8A 3JBG1 4MH0E 3VBUC 4YVSB 3ZPYA 4WVWA 4IEXA 3OY8A 1DGWA 4JRLA 3AKPA 4MV2A 1C5HA 4LUKA 4KBBA 4AVBA 1CAWA 3B01A 1UIKA 4EN0A 4WVMB 3FLPA 4QT6A 1V6MA 3NVCA 3NV3A 4K21A 4IEVA 4IQPA 4FTEA 1AJKA 3GZAA 4HN1A 1IPJA 5ABJB 1WW4A 3HT2A 1LOCA 1TME1 2FZ1A 2XL9A 3E6DA 3ZMOA 3V0BB 2Y38A 1HXS2 3AMHA 3JU9A 2ZHNA 4OI4A 2D98A 1S55A 4X6QB 4KWJA 1WLTA 4J6GA 3FJSA 3SCHA 4XJWA 4Z8BA 1BBT3 3TB0A 4YG0A 4K9SA 3FUQA 2R041 1SLIA 2RE9A 4IV1C 2A6XA 2ZGKA 2EXIA 4HBNA 2P3IA 1REDA 2OZ6A 4Q0SA 3N7JA 4M3CB 3DL3A 4IV3A 4MGYE 4C91A 4FPLA 3T1LA 4N9HA 4BLJA 4JC1A 1DHKB 3E6BA 4WV8A 4GMP1 2WS93 4LT5A 4LNVA 3ILNA 2UYAA 3IDBB 3J26N 5I93A 2ZAHA 1R082 2HWD1 2B8MA 1ONAA 4XW3A 1APNA 5DZEA 2YV8A 5HCBA 2ZZJA 4TWTA 2FZ2A 4P9XA 1HQLA 4GMP3 3WNXA 4M3CE 1X82A 1QXPA 1H4HA 5FOBB 4YW3A 4TZDA 3CJIC 4ISQA 1ND3C 3WG1A 1PK6B 1DU3D 1V00A 2BW8A 3G6JB 1QNYA 4Y1XA 4QM9A 5JIUA 5D8AA 3PTYA 1PZ8A 3WW2A 1SBFA 1NYWA 2E9QA 1GLHA 4AXOA 4PIYA 2HKXA 4N53C 2WZPP 3OPZA 4L92A 4QQPA 3J8F3 1H1IA 2JEMA 2PHUA 4L9BA 1VB2A 2VMHA 3JCIA 5FO8B 2O0OA 1CAUA 5FLHA 4B8EA 5AC91 2HEYF 2XVGA 3ZFFC 1O5UA 1OKQA 4NWWA 2HWF1 1LR5A 4CZSA 5J96B 2AUYA 5FREA 1DFQA 4D69A 2QQPA 4K6BA 1OA4A 5AC93 3IN9A 4MGZE 2Q1ZB 3I54A 4P9IA 2ZZQA 1CVNA 1AYN1 2OW4A 1Z7S2 4FAGA 4D7SA 3W9AA 4XYXA 2JECA 3RPQA 3IDEA 1V9U2 4P9GA 1RMU1 1H2NA 3WDUA 1RUC1 3ZVXA 4O9GA 1AR61 2R072 2VGDA 1RIRA 1VAMA 2GH8A 3B02A 1AYN3 1NXD1 3C2UA 4KQ7A 1NA1C 3N7MA 2VU9A 4AFAA 2B9UA 2XHKA 2BWCA 5JPNB 3TN91 1RMU3 4CTEA 1AR63 3E5UA 4FPCA 5JVVA 1VIWB 3DPRB 3JZVA 4A2UA 2WINB 3MIFA 3PVOA 1LOFC 4K1YA 2NN8A 1J1TA 2JG8C 2QUOA 4HPKA 4Q4V3 2RS31 4YNIA 1U5XA 2V73A 3QOPA 3GZUC 1G7YA 4C1WA 1WBFA 2JG9B 3ENRA 3GBWA 4MXWA 1MZEA 5HI0A 4EV0A 5C8CB 2ILMA 1UU6A 2G9FA 2RS33 1WMFA 5I8YA 2OVUA 4XZPA 4ASMB 5JSRA 3ZFEA 2R30A 1AYM3 2K0GA 1KRIA 1CIWA 1BXHA 1H0BA 3SMHA 1LU1A 4AEJA 2R32A 4R9BA 4LHKA 1GZWA 2R6QA 1PZ7A 1QF3A 3R4UA 2ZCWA 2XJTA 1YUDA 3FFQA 3P3PA 4Q4Y3 2RM21 1ZYBA 4A7YA 1R1A2 4IEYA 2NM1A 2YGMA 2ZX1A 5A3LA 1C1FA 3MPBA 1CR7A 2HYKA 3B7MA 1DZRA 4AFMA 1H9WA 4JAAA 3INAA 5DUWA 1CESA 5T55A 5C9AA 4YVWA 3AYDA 4YGEA 5DDJ3 4RR3A 1FAYA 2ET1A 4PLNA 5BYNA 1QH6A 3WP6A 4KWKA 5JMCA 2YZ4A 2BVBA 2ZTNA 2CAVA 1WLCA 3DUIA 3WV6A 5JAXA 2RMU1 1UCXA 4IV3C 1FMD3 4HLTA 2R0FA 4ZU7A 1OD5A 4FCAA 4IEPA 1LESA 2EXJA 3CF6E 1QJU1 2VVFA 3RJRA 2D6MA 2HWE2 3BCWA 1C4RA 4YGBA 1AR92 2RMU3 2RHPA 1LENA 4WVVA 5GM0A 4FSJA 4OULA 4XMIA 4I2OA 2LUWA 5CB7A 2YROA 3ZXKA 3ZYRA 5EYYA 1IPKA 5H9RA 3ZIWA 1LHUA 4Q4X1 2PLV3 5L7OB 1J59A 3OBTA 1LECA 3NSTA 4FPHA 1GZ9A 2NZ9A 4COWA 1YFYA 2EAAA 4YG6A 1OFNA 2CGNA 2ZMNA 4RQPB 3VBOB 1S0FA 3RRDA 4WVMA 5C4WA 2CWSA 2F4PA 3H8UA 2DF7A 2FMDA 3MICA 4HETA 2WQ4A 1GR3A 1RB8G 1RUE3 3FBYA 4NVPA 1Z7S1 1MEC2 1ULDA 3CL1A 5J7MA 3ZYJB 1LHNA 4B4PA 3ACLA 2PHWA 2NMOA 5I0RA 1DIWA 1VAVA 1AL22 4BLIA 2MEV3 3V0BA 5ACA3 3O14A 1ZX5A 5KXCA 5GZGA 3VZMA 1SBEA 1AZDA 1C8M3 1X36A 3JD71 5BUVA 1QJY3 4AQTA 1YI7A 4FVVA 3SXWA 3TOJA 3FFZA 1NQDA 1TE1B 1HX6A 1KD7A 2C5DA 4XIKA 3SH5A 1C5IA 5T5OA 3VDDA 1D2SA 3JD73 4M3CA 1CAXB 2WZR1 3H50A 1UKGA 1VAKA 2OA2A 3FLRA 5T50A 4QX5A 2VXRA 1RUF2 3KSCA 4Q0VA 4Q4W2 3VBSA 3ZIXA 1ENXA 1VP6A 2XJPA 5CA6A 2K2SA 1UIJA 3N7KA 4XE9A 3H3ZA 1WW5A 5DG1A 1SCSA 1FOD2 3M70A 5CNAA 3TBDA 2EXKA 2V5YA 1YJLA 5CBLA 1NCRB 1VJ2A 3R6SA 1CD3G 3ZDSA 2Q4SA 1PGSA 4R9DA 1CQ9A 1N1TA 5FQ0B 5JOZA 4S2FA 3WHUA 1LCLA 5E8AA 4LO5B 4KWLA 1PK6A 1S0DA 2OUJA 2X8KA 2CAUA 2KXLA 4YARA 1R1A1 3WG3A 4AG4A 2LM3A 5BXXA 1U5YA 3N7LA 2WSVA 4OHXA 1PIV1 2BBVA 5FPXA 2IFWA 3QCWA 1VBD2 5FPZA 3VBFB 1N47A 1U0AA 3LKJA 1IS3A 3E6CC 4H55A 2YPJA 4EWAA 2QZ2A 1MZ5A 1FPN1 5KBFA 5KC6A 1PVC2 3UK9A 1Q56A 5DUXA 1ZZ7A 1G9CA 1PIV3 1G9FA 2R0HA 2YY1A 2WJSA 4R8HA 3ZFEC 1UZYA 2VMIA 1JW6A 3NW4A 1RVF3 4DZGA 4I30A 2XPJA 4UW5A 1FPN3 5JLVA 3MFCA 5J3UA 3JB4C 1NLSA 1FNZA 3AJYA 1MR5A 5FMOL 4AW7A 2ARBA 1A8DA 2WNVB 3S7EA 2XVKA 2YGLA 4JGYA 1CAVB 4MUVA 1ZBE1 4XOGA 2R1BA 5HXVA 2NQYA 4AHXA 1AR91 4BIOA 1F5JA 2R061 4A7ZA 4N9IA 2ZBJA 3DKWA 2VW2A 4MGIE 5GLZA 4XQ4A 1OLQA 1Y7BA 5C9AC 4YVWC 1PZ9A 4J1WA 3D4KA 4RR3C 3U11A 2BWAA 2B39A 4HK8A 1N1SA 2WFF2 3RMYA 5J37A 4EWEA 3MW4A 3GZTB 3RI9A 2FMYA 3DPRA 4XDQA 4TLFA 1HRI2 3S6PA 1RUI2 4A3XA 2RS11 1BMV2 1W39A 1LGNA 2QDNA 2OZJA 4IEUA 4M0NA 1MEC1 1PMIA 1SEFA 3POYA 2CGPA 1DGRA 5H9SA 1QQP2 4PDWB 4BPZA 5BNOB 4XFHA 2DVGA 2P3KA 4N43B 1GZCA 2RS13 4E2SA 1E57A 1SLCA 1VBC3 1MVQA 3WOGA 3THPA 2JG9A 2XJVA 2ZGUA 3FX3A 2VUJA 1B35B 4COVA 1JTZX 4YFZA 4FPFA 1SBDA 2RJKA 5I0SA 5CADA 1ZA4A 5KXBA 3ILRA 3TNQA 2CV6A 1JUHA 3NWKA 1H30A 4FXKB 4O9EA 2O1QA 3LGRA 4GKYA 4BQ1A 5C4WC 2PTMA 3LWCA 2DVDA 3FMGA 4QQHA 1DZTA 4EROA 4YSFA 3USUB 1RUF1 1WD4A 2I07B 2B42B 1DQ5A 5JIAA 3RWNA 1H2MA 4AFCA 3V0AB 5EYXA 1I9RA 4FXGB 1U12A 1PM7A 5HCAA 3B9IA 1PO21 2CL2A 3B9CA 1I3HA 2Y0OA 3SNMA 1ZZCA 1S0BA 3WP4A 2A6ZA 3ZN6B 2VW0A 3ZN4A 1VBE3 2D6LX 2GNDA 4Y20B 1PO23 1LEMA 4R9CA 5D1IA 4AI1A 4LTAA 4E4SA 3A0NA 1GBGA 3WR0A 2XKOA 4YGDA 2QVSB 1BBT2 3H7JA 3WQ7A 4BMEA 5BV6A 1TME2 4FOQA 4Q8KA 1CPMA 1W6OA 2JICA 3VL8A 4RA0A 4Q2FA 4TSVA 4ZXKA 3VBSC 4AI0A 1HRV1 1K5MB 2DFCA 2YC0A 2E63A 1NCQB 3OBRA 3LA2A 1VLNA 3E5XA 4DINB 1RTVA 2ZACA 1G86A 2R042 2ZOEB 1ASJ1 4YM0A 5JI7A 2ZMLA 3SH4A 1IKQA 3MZHA 1LULA 1GNZA 1HRV3 4GKXA 2AREA 3M1HA 4XQWA 3UJQA 1FATA 1IS5A 4G9SB 5JCTA 1XXNA 4DQAA 1LHOA 5JPMB 4LE3A 4RQPA 2GSYA 3VBOA 3OGJA 1V70A 1PK6C 3AP4A 3MIDA 3EO6A 2RS51 1SLAA 1KXGA 2XJQA 1DZQA 2HWB3 4SBVA 4XJAA 3HQXA 3KCCA 1NE4A 3RS6A 1WBLA 3ZN5A 4GA9A 2NMNA 1YCIA 1JYIA 3APBA 5DUVA 4CP0A 5KC5A 2Q0AA 1R091 3NV4A 5JZGB 1A6CA 1RUG3 2RS53 4Y24A 1MS8A 3VHOA 3O0WA 5T52A 2WFF1 3SISA 4KGGA 3WW3A 4XF0A 3WCSA 4I0BA 5A32A 2GNBA 3X29B 4CDWB 3TWIA 2WLPA 1UPIA 2IXCA 1G9AA 1OLRA 3HR9A 4DOUA 5E1RA 5EV7A 1LTEA 1OQDA 4XBLA 1CAXA 1H8TB 1UL9A 1IGOA 4JGYC 4AVTA 1QQP1 2EVXA 3UKVA 3BODA 4D7TA 3WUCA 1YIFA 4XJUA 5AC92 5H9QA 2ZMKA 1LRHA 3RYKA 3V64A 3POWA 2BQPA 4P9JA 4HMZA 2ES3A 4CEWA 2BTVC 1NCRA 3VZOA 4MZUA 2UWCA 1COV1 3AYEA 5FQ0A 1NZCA 2V09A 1HQWA 2BGCA 2ZHKA 3AKRA 3DPRC 2JG8A 3ZXDA 1AYN2 1X33A 1UF2C 3IPVB 2WNUA 5LEJA 2BUKA 4LEJA 2Y0IA 1COV3 2GMMA 3LAGA 1S0CA 2XB6C 1RMU2 1RUC2 1AR62 4YW4A 3BTAA 3ZYIB 5GJ6A 5KHKA 1AX0A 3NV2A 2B5HA 4NPRA 4K8FA 4RGAA 4PF5A 3TN92 4FPGA 2WT2A 2JG9C 2D44A 4UXAA 1BCXA 1NLRA 2P37A 2Y26A 5J09A 3HAGA 3I59B 1N3PA 4COZA 1BBT1 2VG9A 2X53S 4QGMA 1EV11 2XBO3 5IK4A 3T1MA 3SH3A 3ECQA 3H3UA 2RS32 3AKTA 2I2SA 5SV5A 2XWBB 1A3KA 4FBFA 2XUMA 4HSLA 3B69A 4XF3A 1EV13 3MW3A 3WX5A 3BOWA 5JSOA 3WDVA 4AQSA 3RJ2X 1VR3A 2WS91 4Q4Y2 1RUD3 4IEWA 1NQJA 4LBLA 4QGLA 2VY0A 4Q0QA 4B7EA 2JXAA 3CEWA 4S2HA 2HWC3 2IXIA 1OSGA 4OVEA 2RM22 4XFGA 1VRH3 4FPYA 4LBKA 1DQ6A 2GC2A 2ZX0A 3ZYPA 1KJRA 3ZX7A 1D4M3 1PNGA 4BCUA 1NG0A 3ASIA 1S0IA 2P3JA 4M01A 3HWJA 1SLBA 1W6MB 2JD4A 4PDWA 3FE5A 1HIXA 2H6CA 3QACA 1O91A 1SMVA 4WVZA 2DCTA 3VV1A 1FMD2 2VOKA 2VECA 1ZREA 4AI8A 2Z42A 3AMPA 1AJOA 3J8F1 4QGNA 3M3IA 2RMU2 2ERFA 2PHLA 4QPIB 4Z92B 1OQ1A 1AXYA 3ELNA 4RQPC 3VBOC 1BJQA 1QJU2 3RYRA 2X29A 3B5LB 2XKPA 1D0HA 3LSDA 3NL1A 4YW5A 2EIGA 3L2YA 2ZGQA 4ZU4A 1AR73 4MLOA 3USUA 4WZFA 2H0VA 2YHJA 2GNMA 3I4IA 4Q4X2 1Q8VA 1GANA 2NYYA 4IETA 2AZ5A 1JH5A 4MYEA 4N7IA 4V1PA 2WA3A 3BB6A 2VULA 2PHRA 1D4VB 1DQ4A 4AVCA 3GBFA 2MEV2 3M3EA 1LJ7A 1VB4A 2O8QA 1I6XA 1LGBA 3OJBA 3DV8A 4LO6B 1AX1A 4YZ2A 2VMGA 3OGGA 3PMEA 3ZXFA 2DUPA 3MPPG 3L9JT 1RITA 4JV4A 2PYTA 2A3YA 5L73A 3EXUA 3GHNA 1HKDA 3AMMA 2BFUL 1K5MA 4IXLA 1NCQA 2UY8A 1CGPA 2DU0A 3JD72 4QQLA 3AZZA 4ZU5A 5IK7A 2ENRA 2FQPA 5J98B 1UKRA 3B93A 1SLTA 4Q4V1 2XH6A 1AL0G 4CEWC 5FAXA 4HKLA 1NCRC 4F83A 5C33A 4Y5Z0 4DY5A 2QZ3A 2UWAA 1C8NA 3SCGA 4DNYA 2WZR2 2TEPA 4FO9A 2TBVA 4X8NA 1PGL2 5FMOS 1TMF3 1X50A 1UMZA 2DCYA 2WNUC 4JDMA 3FHIB 4WM8B