5FLKA

Structure of haloalkane dehalogenase variant dhaa101
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
b'IGTGFPFDPHYVEVLGSRMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYRFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTPDVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHAA101
molecule tags Hydrolase
source organism Rhodococcus rhodochrous
publication title Evolutionary Analysis is a Powerful Complement to Energy Calculations Allowing Entropy-Driven Stabilization
rcsb
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5flkA00
4N5HX 4QA9A 4FHZA 1UZAA 5A6VA 4UPDA 1W75A 2HA7A 5FRDA 2JF0A 2RI6A 2WG1A 5CMLA 4AZ3A 1QFMA 2V97A 1ZGCA 2ROQA 4FTWA 4BRSA 2XI4A 1MAHA 1TRHA 3WIBA 4DMFA 1GT6A 1UKCA 4J0CA 1JKMA 4Y2QA 2NW6A 5AH0A 4C01A 4CFSA 2WHPB 3SK0A 2AJBA 4BZWA 4J0DA 4DYHA 2ONCA 1VE6A 5FPPA 4EY7A 2HA4A 5JAUA 5LP1A 5J3JA 5IVKA 3BF8A 5LIPA 2G4LA 3VISA 3WJ1A 1EDDA 3KWJA 4BCCA 4DMKA 5AI9A 4D9JA 3IURA 3RM3A 4DGQA 4JH0A 2LIPA 4Y2PA 1ZD5A 2WQZA 1ZI8A 5K3AA 1HPLA 2JGJA 2EEPA 4FFVA 2PSJA 1FFBA 5AM4A 3OURA 3HEAA 4AO7A 2GZRA 1CPYA 2WIFA 1WM1A 4KE9A 2WUGA 2WG0A 1DX4A 4B9AA 4F5ZA 4P08A 1H2WA 5JALA 2XMCA 3FLBA 3WYDA 1CUFA 4QEKA 4E46A 4HTAA 2VAXA 2J4CA 1XZMA 3I2GA 1TKRA 4HZGA 2WJ6A 4B81A 4BC1A 4PV7A 2O7VA 1LPPA 3O9MA 4KE6A 1K6EA 5T4HA 5CT4A 5FPQA 4UFPA 2WHPA 3P2MA 4Y9SA 3H0CA 2XUQA 2OCLA 1Z68A 4PF1A 5T4EA 3WKDA 1W6RA 3PE6A 2PPLA 3WKCA 3IB3A 5DTJA 3PF9A 3ESBA 1DTEA 1BE0A 7YASA 1ZD3A 1XZHA 2ZJFA 4M0FA 3C87A 2JGKA 2OAEA 2V9ZA 4V2IA 3GELA 2V98A 4GEGA 4MYDA 3CXUA 3FYUC 5JAOA 1ISPA 2HU7A 3STXA 1DT5A 5JAPA 5DNUA 1AKNA 2BGRA 3AIKA 3R3YA 3VVLA 3JYHA 3QH4A 1B6GA 5CH5A 2GBCA 4E11A 1LNSA 5KREA 3HLKA 5A7HA 4HAIA 1GGVA 2HU8A 2FX5A 2XE4A 3H2KA 3QPCA 4LXGA 1WB5A 3LCRA 1CUDA 2EDAA 3IUQA 4H7DA 3AZQA 5F4ZA 2CMFA 1C7IA 4FNMA 3HI4A 5ALWA 5EIAA 5HFNA 1R50A 3RKSA 1EVQA 1WPXA 1LLFA 3C5WP 2Z8XA 3I1IA 1K8QA 2JEYA 4RPCA 1EVEA 5DLPA 2ZSHA 5AI5A 1CUAA 4I3FA 1Y37A 4Z49A 1LPNA 2K2QB 3STYA 5FLKA 2C5GA 1BS9A 4H7KA 2DQZA 3F8SA 2VF2A 1YAJA 2BCEA 3EQ7A 3GA7A 4BE4A 4HXFB 3FCYA 2I3DA 4IH1A 3VJKA 1QIGA 4KAJA 3N2ZB 1CQWA 4I4CA 1KU0A 4IH9A 1LPBB 4W63A 1GPLA 1XRPA 4X6YA 4DNFA 3H04A 4GXNA 5JD4A 4Y2UA 5EI5A 2ACEA 5ALLA 3EBLA 5EHQA 1MAAA 1TAHA 3RK4A 3AILA 1VJ5A 1JJBA 4AX4A 1ETHA 4HXGA 5HF5A 2Z5GA 3HYSA 5LKRA 1ZICA 4PSDA 5A7GA 4MJ3A 1QO7A 2WUDA 4XVCA 4U2GA 2PU7A 1H2YA 5KWIA 1IUNA 2CB9A 1UK8A 2QKYA 3A70A 4DLNA 1CUXA 4UHFA 3ZLUA 2QOEA 2XMDA 1MO2A 5AKXA 2QTBA 1QIDA 1VA5A 2WIKA 2IITA 3GFFA 2DCMA 4AO8A 1ZIYA 1ORVA 4XX1A 3WWEA 3GZJA 5D3ZA 3TEJA 5AJHA 1TCBA 4LXIA 4W1SA 1P0MA 4KRXA 2ZYIA 4UHCA 2XUDA 5A71A 1K5PA 3IA2A 3WK4A 1WPRA 5JZ9A 5I9IA 1AUOA 4ARBA 2HRQA 1A8QA 1EDBA 5JASA 3WJ2A 4UBMA 4X95A 3HRHA 5IVDA 2QS9A 1MJ5A 1ZD4A 2D0DA 3LS2A 5DYTA 1P0PA 3PICA 2QUBA 2JGEA 3BDIA 4FKBA 1CRLA 1QIHA 4IHAA 5ALMA 4EY6A 1AZWA 1D07A 4AMYA 1MX9A 4LKOA 3O4JA 5AKJA 4L72A 3T52A 1FSSA 4CCWA 3FNBA 3VJLA 5ALOA 2IX9A 4Y2RA 1UKAA 5D3KA 4Q3KA 3EQ9A 2VAVA 1XZGA 4E15A 4N8EA 1ZI9A 1R9NA 1IZ7A 5IKXA 1E5TA 2QUAA 3DKRA 3LIIA 3ANTA 4WDRA 1H22A 3CN7A 3B3QA 4ROTA 1CUZA 3WWOA 2WG2A 1XFDA 5AKZA 1CUUA 2YASA 4LIPD 3I2KA 5DNWA 1JT2A 3MGAA 1O6FA 3KD2A 5JARA 2CJPA 1OXMA 3B12A 4B82A 1DU4A 3HSSA 3SX4A 1MX5A 3PFBA 5T4FA 2XLCA 3JW8A 1R9MA 4GI1A 4BTVA 1XRLA 5ALIA 4BYMA 5AICA 5JADA 2DHCA 3AIOA 3D0KA 2XMGA 2WIJA 5HZGA 1W52X 1BROA 4QWWA 1M33A 1CUVA 5ALGA 2HA2A 4WFIA 1N8SA 1U4NA 1GPNA 3R0VA 3FYUA 3L1IA 4KE8A 5ALQA 1E3QA 3OTQA 2FJPA 1VLQA 1ACLA 1XROA 2IIVA 4BB0A 1SCKA 1QIFA 3WL7A 3VKFA 4JNCA 5LZ5A 3O4GA 2WFLA 2HDWA 1WHSA 5CTAA 2VTVA 1XLWA 1QFSA 4BP9A 1VZ3A 4UHDA 4AO6A 4ZREA 2XQFA 3WL6A 4QLAA 3O9VA 3NUZA 4EHBA 3V48A 4C6HA 4FLEA 1X2BA 4LYEA 4OU5A 2PVSA 1QOZA 2ECFA 1QLWA 2R11A 5A62A 2WFZA 1DWPA 3G8YA 1J1IA 2YYSA 1IMJA 2Y2UA 1T4MA 4LHEA 5CT6A 1R1DA 1P0IA 2ZYRA 4H7IA 1XZFA 5C81A 5LZ4A 4KRYA 3R40A 5CH3A 2HRRA 5AIBA 3IULA 1LPAB 3C45A 4FBLA 5CW2A 5FV4A 1W1IA 4G9GA 3VXKA 5LKAA 3IUNA 1HKHA 2OQIA 3ED1A 5CXXA 4BVKA 3F96A 4K5QA 3K6KA 1E8NA 1XLUA 3FYTA 4XWGA 5LZ8A 2WFMA 2YXPX 4TGLA 3DKKA 2WJ3A 3VVMA 3L1HA 5AHXA 2B61A 1F8UA 3UUEA 1R3DA 1GKKA 3BWXA 1USWA 1UXOA 3Q8WA 3A6ZA 3ANSA 2CZQA 1EH5A 3WZLA 1WB4A 1XQYA 4J0JA 3D4LA 2GZSA 5AK6A 3DQZA 4C87A 1XZBA 4EZIA 1BN7A 4HS9A 1BU8A 2Z8ZA 1J07A 4YASA 4C4XA 2QZPA 2X5XA 3BIXA 1CVLA 3WZMA 4AQDA 5HQ3B 1A8UA 3ICVA 4X90A 1Q0RA 1YS2X 4G8CA 1LBSA 4G8BA 3WK8A 2PUJA 4O08A 2DSNA 4FLFA 3BF7A 4BRZA 2ZJ7A 3ESDA 3MUNA 1G42A 4CG2A 1G5FA 1PJAA 1EB8A 2PL5A 4QDXA 1IVYA 1UOOA 4ZV7A 2ACKA 3WLAA 2VJCA 3ZPXA 2QXTA 4BDTA 3K2IA 4H7JA 5LZ7A 1EK1A 2BUAA 1RP1A 5ESRA 2C58A 3M3DA 1BCSA 1Y7IA 3O4IA 4H0CA 4X3CA 1E8MA 5EIHA 4BAGA 4W1PA 3VDXA 4OB8A 4FFWA 4X97A 5AK5A 2C0PA 2QVBA 3AZOA 3FLAA 2HHAA 3A2LA 3IBTA 1ACJA 1CUGA 4Q3OA 5CT8A 5JZSA 4CG3A 5LZ2A 2WSLA 3FVRA 5ALNA 5K3DA 1WHTA 3V1KA 4UBJA 3F97A 1ORWA 4UFNA 5AKYA 4FMPA 3C70A 5JATA 1UT6A 3QPDA 1OILA 5HF6A 2DHDA 3BXPA 1JMYA 2ZYHA 2ZYSA 1MNQA 4KYVA 4DIUA 2GYWA 4G5XA 1LZLA 4YK7A 2X8BA 4AXBA 5FP0A 4MEAA 5EHZA 2XQGA 1XRRA 4AN0A 1F0NA 3GUUA 3I2FA 3WL8A 1JI3A 1BN6A 4EB0A 4BAUA 2JGLA 2PKYX 4BCBA 3WA6A 1E66A 1N5RA 4WY5A 4E14A 1U2EA 3CN9A 2BKLA 4WJLA 1Y7HA 5JAHA 2RONA 3ZLTA 1SCIA 1LPMA 4L0CA 4G4GA 1FFEA 3TGLA 1VA4A 5ALYA 5KWJA 2OAGA 4Q82A 4EBBA 4WY8A 1WCYA 4ETWA 2JGFA 3CCBA 5ALFA 3C6XA 4G9EA 5ALRA 3WL5A 1O6GA 3E0XA 4B84A 1CUHA 4UBOA 3KDAA 4Y2YA 4EUSA 2XUPA 3BJMA 3D2AA 4GECA 5LYYA 5KBYA 4N8SA 4KJXA 4WFJA 1XZEA 4RE6A 2PBLA 1CUIA 4RNCA 5JANA 1UOQA 2H7YA 2O2GA 1THGA 1L7RA 4FBMA 4XJVA 1J06A 4Y2SA 2BJHA 4X93A 1Q83A 3G0CA 2QXUA 1X2EA 4UBKA 3IDAA 4UBIA 5AM1A 4KACA 3PF8A 5EHNA 2XUOA 1IUPA 4PNZA 1CUBA 5AM0A 2QJWA 3OM8A 3LIPA 3QITA 2OCIA 5AM2A 4FOLA 2QM0A 4C88A 3A2NA 4BCDA 4CCYA 2XMRA 1QTIA 4AN1A 3DOHA 1ZOIA 5C8ZA 2JGIA 4EA6A 1YS1X 4PSCA 2XMQA 4GLBA 2RAUA 3BDVA 4NS4A 4MXDA 1QO9A 1VKHA 5AI4A 3K9BA 5ISMA 1LPOA 3N0TA 3G0DA 4X00A 4TPKA 5DJ5A 4IQ4A 1TCCA 2XQJA 3M83A 4M0MA 1XKTA 1UFOA 2J4FA 4A16A 5ALHA 5FXMA 5C7YA 1AQLA 2DHEA 4FNGA 2VJAA 3HACA 3QMWA 3DD5A 4BP8A 4G4JA 3D3NA 1G4HA 3FCXA 3IIIA 4J0IA 1Q0ZA 2DR0A 3C6ZA 4CIBA 5CURA 4NVRA 5HCUA 5K3CA 1LZKA 5DNVA 2OG1A 3ZV7A 1IUOA 1FFAA 1RWQA 3EQ8A 2GYUA 3C43A 2PUHA 3WWDA 3FWHA 1DQZA 3ICWA 3R41A 4U2EA 3SC2A 1DWQA 1EXWA 2WU4A 3G9ZA 3CCCA 2OGSA 2H7XA 4OB7A 4QE3A 3DEAA 3E4DA 2AJDA 1MPXA 1UK6A 2I03A 4QWMA 3W9UA 2C7BA 5AKGA 4JUIA 3R3XA 3H2IA 4RE5A 4WCVA 3WK5A 1E89A 2GYVA 3R3WA 5D6OA 4GBGA 4X94A 1TIBA 1VZ2A 2O2IA 1HL7A 1SC9A 3AINA 2HIHA 2RIPA 1AMNA 3DNMA 3DYVA 3H18A 2CBGA 4EY4A 3HABA 1XZAA 2OCGA 4MQLA 4CG1A 5FDFA 4Y2VA 4OSEA 4DNQA 3AJAA 5DWDA 1XZCA 2XMZA 5ALTA 2R8BA 3G02A 1UK9A 2GBGA 5ALZA 3IVMA 1EI9A 4H7HA 2QRUA 1QIMA 3AZPA 4KAFA 3G7NA 3I6YA 3QVMA 2HL6A 1AC5A 2XUKA 3ZLVA 2E3JA 2YH2A 4DNOA 3L1JA 2X76A 3PFCA 1C7JA 5JD6A 4CI9A 4BZZA 5LZ9A 4K6HA 1YB7A 4QLOA 1AURA 5JIBA 4OU4A 3OPMA 2ZSIA 4K2AA 3O4HA 1MN6A 3WI7A 1NX9A 3I6MA 4CCYB 3PUIA 1NU6A 4NZZA 2ZJ6A 4HXEB 4U2CA 3C6YA 5SYNA 1H2XA 1XZJA 3D59A 3JWEA 3KWFA 5BV7A 1QGED 3WWPA 3KOOA 4B0OA 3UUFA 4Y2XA 3G9TA 1N5MA 4H7FA 3EIOA 3S8YA 3WIOA 5JD5A 5JYCA 2HA0A 4Q34A 1H2ZA 5LLSA 2PX6A 3C6BA 1UOPA 3STWA 1R88A 2XB6A 4H7EA 4Q1VA 4HVTA 1U65A 2XT0A 1UKBA 2H1IA 5IVHA 1YA4A 3M82A 2B9VA 4PW0A 3X3HA 4JYPA 3EF3A 2DQYA 2XUIA 1A88A 1RYYA 1IZ8A 2OXEA 2Z3ZA 4LYDA 2OLEA 5YASA 5K3FB 4MWSA 3MUOA 2AJ8A 3QMMA 1YR2A 4Q05A 3WKBA 5CH8A 5D7BA 1XZIA 4UBNA 2Y6VA 1HDEA 2WKWA 2JEZA 3QBJA 2O7RA 2XUAA 1KEZA 4EY5A 4X71A 2JGMA 4X91A 5SYMA 2RGUA 1EA5A 3C8DA 3H17A 4GW3A 5AKEA 3WA7A 5HF8A 2WJ4A 2G5TA 3FSGD 5C8VA 2VATA 5ALUA 1GPKA 3KXPA 1FFDA 2PU5A 3F67A 2C5FA 1BRTA 1XQXA 4AMZA 3STTA 2ZVDA 3GBSA 3QPAA 5BOVA 4INZA 4BATA 3QMVA 2CKMA 5ALSA 4P9NA 3V1MA 3H2GA 4F21A 2PSFA 3R3UA 4P92A 1EX9A 4QDOA 1A7UA 4DSAA 5E2IA 4TVKA 1DX6A 1XZLA 1YA8A 2G5PA 3ESAA 1EK2A 1THTA 2VT7A 4W1QA 2XUJA 3GROA 5AKHA 4QNNA 2HA6A 5E4TA 1LGYA 3PUHA 1MNAA 4OCZA 3MVEA 3QZUA 5C8XA 2VJBA 2AJCA 4BDSA 3FVTA 3SWWA 3WK7A 2G63A 1N1MA 5IVIA 2WTMA 5AOCA 2H7CA 3AFIA 5FUMA 3IUJA 1DT3A 5AM3A 1QIEA 3RARA 4YX9A 5K3BA 3HC7A 2OGZA 3DCNA 4K6GA 4OYYA 5DYWA 2WHRA 3DL7A 4IH4A 4QZVA 1XQWA 5AKLA 3W05A 5I8PA 5CT5A 3DS8A 1ZI6A 3D7RA 3RLIA 1BEZA 4P93A 3V1LA 1XRNA 2BUCA 1TCAA 1SFRA 4GHWA 1FFCA 2XLBA 3H1AA 1YCDA 4BVLA 3W2TA 2C4HA 3FAKA 3V9AA 1JU4A 1DWOA 1P0QA 1CUCA 3S2ZA 3WKEA 1GQSA 1W76A 5CRIA 2D5LA 2VSQA 3WWCA 1Q84A 1ZJ5A 4M0EA 1PFQA 2I3ZA 3WKAA 4BAZA 1DINA 3I2IA 3KSRA 2WTNA 4Y2TA 4HRXA 1ODSA 2QT9A 4U2FA 3DOIA 4N5IX 1EINA 1CR6A 5CBKA 3OOSA 4DTCA 3D2BA 2C0QA 3DDUA 1XZKA 5A2GA 2FJ0A 4YPVA 1F0PA 5ALJA 1FJ2A 1TQHA 4X85A 4G4IA 2HADA 5AO9A 4J03A 3ESCA 4OYLA 4A23A 5IH7A 1XQVA 4B83A 4BC0A 4WDQA 4FWBA 4MYSA 3T4UA 3VJMA 4BVJA 3NGMA 4PSUA 1E8DA 4H77A 4B7ZA 2ORYA 2XDWA 5ALDA 3D5EA 4DMCA 5K5EA 3E1GA 1BEEA 5BWCA 3TRDA 2OCKA 3R3ZA 4G8DA 2JBWA 4KAAA 4C89A 2VQ6A 2WILA 4H18A 2VT6A 1GQRA 2JIDA 5AKIA 1GKLA 3I2HA 3I2JA 5ALXA 2HFJA 1AGYA 4X92A 4X7BA 1ODCA 1NU8A 2B4KA 5ALPA 1A8SA 1QIIA 4J0HA 4XIIA 1EB9A 1QONA 3I1YA 5FKJA 4NMWA 2WHQA 3DLTA 1YSCA 1YAHA 4JYMA 2J3QA 4B0PA 1SCQA 1YB6A 5BWBA 1EHYA 4ZRDA 2WUEA 2P8SA 2WM2A 4WFKA 3WYNA 1MU0A 3ZI7A 3FBWA 4BTLA 4W1RA 5HKBA 1VOTA 1J2EA 4F60A 1CUEA 4QDTA 5E4JA 3QM1A 5HF9A 3O95A 5CT9A 3BIWA 2DFPA 5HQ3A 3UMJA 4ZI5A 4U2BA 2HA5A 4B85A 1VXRA 5EGNA 4UHBA 1SOMA 5A7FA 5CXUA 4PO3X 5I7UA 4PQEA 3D2CA 4X6UA 4JEIA 3NWOA 2FUKA 2V96A 1QIKA 4ZXFA 3FLEA 3C8HA 5AOAA 1R4ZA 2GBIA 3M81A 1ZD2P 4UHHA 3G0BA 2AJLI 2RHWA 5HFAA 1UWCA 1LBTA 2WU3A 4FLMA 1JJFA 4RGYA 2HM7A 3STVA 1HBJA 4Y7DA 3A2MA 4KE7A 4OUKX 1CIJA 1JU3A 3ILSA 4B9EA 3H1BA 1ZGBA 1QZ3A 4ZWNA 4QDUA 1OCEA 1TK3A 1CQZA 3ZWQA 4ARAA 1CV2A 3V1NA 1CUYA 3G9UA 5K3EA 3W06A 2B20A 2QMQA 2Q0XA 2CEKA 2AXEA 4EY8A 4DMHA 2BGNA 5AIAA 5JZBA 2OGTA 3YASA 4H35A 6YASA 4S0XA 5EIEA 2OQVA 3DJYA 3FSGA 1ODTC 1K63A 1MX1A 4OPMA 3R3VA 4L3WA 1BCRA 4IO0A 3STUA 4MQMA 2PM8A 4L9AA 3QYJA 4W9RA 4FDMA 4J0KA 4K6KA 4OB6A 5AM5A 1UK7A 2UZ0A 1QJ4A 4QDZA 1HQDA 4J3JA 3G0IA 2WIDA 2XUHA 3FYUB 1XRMA 1CUJA 4Y2JA 1PV1A 1ZIXA 5ALEA 1GXSA 2J3DA 3U0VA 4DSZA 1CUSA 5AK4A 3HJUA 3BJRA 3OC0A 4UUQA 1C4XA 1CEXA 1JFRA 3HZOA 1B41A 2RHTA 3HXKA 3LP5A 5T4BA 1DQYA 1CFJA 5K3FA 5DYYA 2VA9A 4UFOA 4Q3LA 2I78A 5AI6A 1YASA 2WFLB 4B80A 4AZ0A 1XKLA 1XLVA 3H2HA 4DM7A 2QJRA 1KU6A 3H2JA 4X6XA 4KEAA 4AB1A 4GWLA 3I28A 5H3HA 5ALKA 1JJIA 1CUWA 3F98A 1MT3A 2BAGA 2H9YA 5HK8A 4LXHA 4U2DA 5FOQA 3WK6A 3BE8A 1QE3A 4KR0A 3WQHA 2XUGA 1EDEA 1T2NA 3IUMA 2QR5A 1G66A 3AUKA 3G0GA 1L7AA 2O2HA 5ALVA 2PSDA 1JMKC 2XMBA 3U1TA 3E3AA 3B5EA 1K4YA 1X70A 1XRQA 1GZ7A 5HK9A 2OPHA 4J0GA 2EDCA 1S8OA 2GBFA 2BUBA 2Z3WA 4MWTA 3WMRA 4C4YA 2XQIA 4F0JA 1W4LA 1AX9A 4GDMA 4J7AA 1LPSA 2CUTA 3I6ZA 1ZJ4A 4A5SA 5AKKA 3F9CA 1VXOA 1CLEA 1QIJA 1VE7A 3O0DA 3W9BA 2WLSA 2HU5A 4ZGBA 1U8EA 4ZV9A 2XUFA 2PSEA 3DYIA 5AOBA 1WOMA 2BFNA 3PI6A 3DL4A 2ES4A 4CIAA 3WK9A 5EHXA 2WIGA 3AIMA 2Y6UA 1L7QA 4N8DA 2HFKA 4UBLA 1XZDA 2VEOA 1HLGA 4BBZA 2Y1KA 5HKAA 1F6WA 3Q0TA 4B6GA 3BL8A 5AP9A 5AK3A 5EFZA 5AI8A 2PSHA 5AI0A 4OD0A 4UHEA 3G9XA 1I6WA 2HA3A 4ITVA 1MTZA 2WUFA 3FOBA 3NOXA 2W22A 2XQKA 5DTIA 4BE9A 3PDCA 2XMSA 3H19A 5E4YA 3OG9A 3TJMA 4DNPA 4G1FA 4MEBA 4HRYA 2Y2VA 1QTRA 4C4ZA 3LLCA 1H23A 4I19A 2VJDA 3C5VA 1WB6A 2W6CX 3W04A
chains in the Genus database with same CATH superfamily
3C3XA 3OUTA 4TWJA 5I9NA 4TQAA 1AA6A 1WRBA 1VPTA 2IS6A 5DGHA 3CBGA 5JVDA 3G9QA 5LQSA 1V6AA 3PIDA 3CNNA 1B8NA 2WKQA 4UPDA 2GK4A 2HA7A 3NM6B 3VI3B 1OH7A 2QX9A 3RDPA 5JAMA 5FRDA 2WM3A 2HLPA 4IOKA 3OUZA 1E64A 3V42A 2IXDA 4I1YA 2JFNA 3ZV3A 1NR1A 3B2NA 1JHRA 1HT0A 2HSDA 2OXIA 4AZ3A 3ZCSA 1EBFA 3G59A 4EF6A 3VMFA 3AF2A 2Z0MA 3Q2KA 2GT1A 3B6EA 3O2SB 4GF5A 4P0TA 1A5BB 1EHCA 3FYCA 3L79A 4KQIA 3AHGA 4P3OA 1WHTB 3BH6A 3WLFA 1M34E 5DWQA 4DMFA 4PEVA 1H93A 4ZYZA 1HFKA 5JW6A 1TT5A 1RIIA 3B5IA 4BO9A 4PGFA 2OUKA 4IHJF 1U2ZA 1D2RA 4LCBA 4RA9B 3IRUA 4D96A 3JD2A 4ER6A 4L57A 1F14A 1T2AA 5REQB 3RGWS 5BNZA 2YS7A 3B3GA 3O31A 4Y2QA 4HNAA 3LYHA 5AH0A 1U3GA 2Q3LA 2YJ4A 1G3IA 4R3NA 4U7JA 2ZE8A 4KPFC 4HWOA 4DLSA 1M2GA 4DV3B 4MUFA 3ZHQA 1ZJZA 3SK0A 2AJBA 4GKKB 1LBEA 3LKDA 5KYKA 1CYEA 5J4KA 5I9TA 1NQAO 2OA0A 4RKFA 2GCOA 1FDWA 1K68A 1MUUA 2J30A 2PQMA 4EY7A 1P3DA 2NX2A 4YJ3F 2HA4A 2GO7A 3JXEA 3LHFA 4I9HA 5LIPA 3GA0A 3TR0A 2OL4A 3MOSA 5DBIA 2C03A 2NXWA 1JG2A 2VJOA 1Z5VA 2Y4NA 4IWYA 4LY3A 1QYVA 2ZYGA 2ZI4A 4Y0NA 2VK1A 3AUFA 3MEQA 4ZOCA 1GKIA 3VISA 3UK2A 3ZVLA 3KYIB 4KQEA 1ZFNA 4RNDB 3RANA 4CIXA 1VTKA 1BMQA 5B7GA 1SXQA 3KKMA 3TR6A 2ZRIA 3KQWA 1HLPA 3EXG2 1SVOA 2JFYA 3DDNA 3AHIA 4CHGA 4ZI3A 3IURA 5B2EA 2EW8A 3KB6A 3MQ2A 3CGGA 3NALA 3QU7A 1O87A 5IRCD 3WGTA 1CE8B 1Z6QA 2MSWA 3B9QA 1S7GA 2LIPA 1OZ0A 1NW3A 4KR2A 1UC4B 4ECAA 1CIVA 2WVHA 4KC0A 3RT9A 1ZI8A 5K3AA 1H6DA 2PXHA 4NEQA 4WNCA 3UJ8A 4CV1A 4F38A 2PJDA 4A6DA 3NVKI 1YACA 4PHHA 5EUQB 3CURA 1E18A 2VZ8A 2W2LD 3K0FA 3FW1A 3I0NA 3RROA 3WGHA 4AD8A 2OBXA 3COWA 1MB9A 3LK6A 4FFVA 4GPZA 4X8MA 1OLOA 5K6RA 3PUVA 5GVRA 5I4KA 1V37A 4OQPA 1JB9A 1HT3A 4CIYA 1JKFA 2DLDA 3JQ8B 1FFBA 1GLNA 1QF9A 3R9IA 3NTVA 4TL7A 4M2LA 1OZHA 5IC4A 5L3ZA 2AFHA 3A1FA 2JH3A 2BEJA 3ROZA 1N3IA 2WG0A 1DX4A 3H5IA 4B9AA 3PRHA 1OF1A 1N6KA 2FF5A 4C03A 1EK5A 1CD5A 5LFAA 3QY0A 1FU7A 5TT0A 4HL6A 3SHVA 2IDMA 2Q6LA 1PHPA 2CFCA 3OZWA 1U5CA 1CUFA 2Q5QA 4QEKA 5C1IA 1RYMA 3BPSA 3HB9A 2J4CA 1GIAA 2HTEA 2I2WA 1R0BA 1GL3A 1XZMA 4IXDA 1WSWA 3EZXA 3KJZA 3NC1C 2Z1NA 4HZGA 1XDBA 4LJ9A 2X40A 3S2UA 4ZGGA 3I1FA 2QG9A 5AOVA 5KDLA 4NENA 3AP2A 1BD4A 2WJ6A 5ECGC 3FHOA 1C1YA 2Y92A 1I36A 1N1GA 3ENZA 2EFJA 2WPDA 1T6ZA 2HRBA 3BXGA 3H87A 3L7CA 3MSCA 3SC3A 3TDMA 2DKNA 1FVFA 4YQYA 4GZMA 3WNBA 2QM7A 3PCRB 1WV1A 2UUPA 5E6RA 5BO5A 2DUWA 3MCZA 3ORQA 5HEKA 1ZVJA 4G41A 1GR1A 4MICA 3ED5A 3JZFA 1DC6A 4R3WA 1JEYB 2ZQYA 1RMYA 1GPWB 3ZE6A 4TMYA 5FPQA 1EZ4A 4AZSA 4YUXA 4Y9SA 1T9KA 2R86A 2ODAA 2XUQA 1QRUA 2GD2A 1KAHA 2QM3A 4RGVA 2H3HA 1NG9A 1ESEA 3B52X 4P2BA 1Z68A 4HDCA 4IJMA 5C7LO 2HF2A 1F5SA 1W6RA 2R79A 3PE6A 2PPLA 2RC6A 3A3NA 3QKIA 4GMFA 4LGVA 3WKCA 4N3GA 4UM8B 1T2FA 1QG2A 3MOIA 3EEFA 4QBFA 3SC4A 1M2OB 3W0LB 1OKKA 4IXWA 1IZ0A 1OWNA 2AMJA 4BCDA 3QU9A 4Z0NA 4J1QA 5C7OO 5DK4A 1ZA2A 3ENKA 4E51A 3O8QA 3OJWA 2ZJFA 5EJ9A 3IIJA 1SUFA 1QORA 1FK8A 4CQMD 1FDIA 5B4VA 4Z9BA 3JQCA 5FOSA 1B73A 1D4AA 3GELA 2AFIB 4XLZA 3TUIC 4B4UA 4XCXA 2GESA 1KJJA 3ESXA 3LX4A 4WEOA 1P3JA 1AO0A 4GEGA 1I3LA 1KRHA 3FYUC 3CR8A 3KOUA 3NZEA 3O93A 4MH0R 5DULA 4WINA 4AUMA 1B4DA 3AKZA 2FQ1A 4LWQA 5BY2A 1L5HB 3BGOS 5DNUA 4YGXB 1J2RA 2BGRA 3AIKA 3VNBA 2RBGA 5LXTB 4C7KA 3B2QA 1UPXA 2AI2A 3JYHA 5GONA 3QH4A 2CL0X 4RZUA 5IUNC 3GJRA 3GRPA 1AA9A 2HMVA 1BTOA 2FUG6 3FKSA 4Q93A 1SA0B 4BMPB 4XI9A 1U8YA 5K1ZA 2QTLA 1LNSA 3AOEC 3O94A 5KREA 3CVWA 5J43A 2QX6A 3N6XA 5A7HA 4BV3A 3NKLA 4HAIA 3OF3A 3KZXA 4DLUA 2FX5A 1PD1A 2J67A 2O2XA 3D5QA 4ZIRB 3QPCA 4LXGA 1FLVA 5L7WA 1FDOA 1T36B 5U9CA 1JG1A 3GUHA 4U5XA 5BNFA 1UCFA 3OQHA 4MWCA 1Q19A 5EZYB 4DC1A 3E5MA 1XEWX 3CUEF 3P2JA 1CUDA 2FLKA 4DXDA 2EDAA 5BSFA 2RB4A 4X8OA 1E2JA 4FK8A 1FTYA 2HCBA 1ADJA 4OHUA 4RD2A 1X9IA 1Y1LA 4ZZ2A 4AUEA 3AZQA 4IXTA 5HOQA 4C0JA 3EZ2A 1ZUNB 3C3DA 2P5YA 1XQ6A 2VPQA 1C7IA 3TGWA 3EVZA 4IIXA 4IZ6A 5GZ1A 4BNIA 1YQQA 2ZWOA 1XYGA 1YZHA 5J4YA 4PWYA 4MQ5A 4GP9A 2FVXA 2J3KA 5ALWA 5EIAA 1X13A 4B45A 1R50A 4RLQA 3RKSA 4O0LA 4FWTA 1GRRA 2QY9A 1OXVA 1M8KA 2ZKLA 5T8KA 2BWJA 5J2UA 1FSPA 2AE1A 3OZCA 2OVBA 4L8FA 1E7WA 2Z8XA 1KOJA 3C5WP 4LHXA 1JHVA 3PQFA 1AZSC 4U8HA 3I1IA 4B32A 4K40A 1CQIB 4CLRA 2AKYA 2JEYA 3ZBPA 2GVZC 4HB4A 1IJEA 3P27A 3TNDA 1D09A 2R5NA 3ML1A 2R3SA 3OT4A 2CHFA 3KR0A 4M9ZA 4MV5A 1Y37A 3M6AA 4A03A 4DJAA 2C4UA 5HP4A 3LHSA 5LL6P 3ZHSA 1LPNA 3EMKA 1ZOLA 1XXLA 2PMEA 1Z18A 1UBCA 2D1QA 4KQMA 1N5IA 1YJ8A 2I6XA 4DZTA 4MDEA 5FLKA 6PFKA 1BS9A 4KBGA 2BY4A 2IIPA 1VE3A 4C3OB 4MUIA 3ZV5A 3NIDB 2ZCJA 3B70A 5MHTA 2H59A 2WYWA 4XTRA 2NPFA 2I54A 3GA7A 3DWIA 2TECE 2VUIB 4HXFB 3ZI4A 3OEHD 4G0WA 2DCUA 4TQ9A 5KYYA 1U98A 1PG2A 3V5NA 1A9SA 5IKEA 3PXUA 4WESB 4BRWA 2A0XA 3M6XA 2XKJE 4IH1A 4DY4A 3OZSA 1NUSA 4C20A 2OFWA 2G07A 4DNXA 1KU0A 3T9FA 1R6AA 4QTYA 3UAXA 1LPBB 2RKBA 5JTUA 2Z2IA 5HVNA 2HCRA 5AW8A 4DNFA 1LI7A 4LXUA 4BNKA 5IDWA 2MSKA 2YIJA 2PR2A 2R8ZA 1Z4PX 2FGKA 4I55A 5AW0A 5H4GA 2Q21A 1NMYA 4RM2A 3FPHA 4PTLA 3B7WA 1X1RA 2WU0A 3EGWA 3EXHA 2C83A 1OXBB 5JHHB 2P41A 1LNQA 4QAJA 1Q12A 1J0CA 3MELA 4HV4A 2FZ4A 1RJWA 1Z6GA 2NM0A 3ACCA 3GFOA 3LX5A 5LLDA 2PS1A 2P1ZA 4ARUA 5KTTA 4MX8A 3FNHA 5EHQA 1MAAA 5FWYB 4PLHA 4L15A 3BKWA 1GY8A 3DHEA 3CW2A 3DHVA 3NOVA 3OP4A 3OZVA 4DUGD 1TQ8A 2EOAA 1KMHB 4RTNA 4F5WA 3EGXA 4BMDA 4YV2A 2F8SA 1PNQA 1MOSA 4JMLA 1Z3CA 2XZOA 3QWAA 1JJBA 4AX4A 3O4RA 5HGXA 1ETHA 2PS9A 4MVJM 1D1PA 1M2NA 5LKRA 1GADO 1VJ0A 2JJ1A 3PUZA 4NDNE 2NVUB 5AESA 2HRZA 3FOFC 1IUNA 2QD1A 4ALIA 1C7EA 1GG2A 1HZJA 1UK8A 3LRTA 4WK2B 3LWDA 1NN0A 3S81A 4F3RA 1PW7A 3A70A 1U3FA 1CT9A 2GN4A 2RJ3A 4XR9A 4DIEA 4RPGA 5JO9A 1KHHA 2QOEA 2TYSB 2NT4A 2XMDA 2AC7A 3GJ3A 3EDYA 4FU0A 3IVRA 4W82A 5AKXA 1NYLA 5IM5A 8LDHA 2IITA 2DXIA 2A1TS 5DGDA 3DF7A 4BMXA 5L51A 4YJGA 4AO8A 3RSCA 1U9JA 3GLFA 1ORVA 3HKBA 2EHDA 3B6IA 4HXYA 2QRVB 4B2LA 1R0SA 1BXKA 2M98A 3ANXA 5AXDA 3T95A 4W5WA 5JZVA 2YW9A 2Q1UA 2W90A 3Q7EA 1V25A 2FG6C 4JMPA 3BIFA 5AJHA 3ZY2A 1OI4A 1VL5A 3KT3A 1E3EA 1X19A 2FN3A 4I2VA 4OXNA 4AY3A 1AMOA 2KLBA 3U3JA 1XK6A 2QB5A 2ZYIA 5DT9A 1NPYA 2WM9B 2Q5OA 2H1WA 1T6BY 5A71A 5T8KC 4K9PA 2ERCA 4D9FA 1Y8AA 2F2TA 3F5SA 4N4AA 3IA2A 1KI1A 3DDCA 3DT9A 3PZBA 1SQ5A 3HJTA 5I9IA 3K4PA 4D8TA 2QVGA 3DBRA 2JFOA 3OSUA 1XCGB 4DV5B 2WJHA 1H4VB 1A8QA 2DM6A 2OTCA 1RWVA 4GC9A 1BMFA 4PLPA 1T9BA 4RF5A 2D5IA 4P83A 1ULTA 4GSYA 1GT91 1GV0A 3GIWA 3W8EA 3WP1B 3ZDXB 1XX6A 2VNJA 3AL3A 1ZJ6A 3FFXA 1YRWA 3HRHA 4LHVA 2PRZA 3SDBA 3THXB 2AZXA 1TOAA 1G8FA 1XD9A 3NVAA 5D1HA 3SNKA 4YI5A 3TFQA 2WD9A 3I9OA 5DRTA 5K3OA 1DBWA 2YVAA 1ISJA 1Y82A 3L18A 3PHCA 5DYTA 5IJ0B 3S3TA 1ADYA 1ZMTA 5G4KB 1FDSA 1SBYA 1P0PA 3AR9A 3K0FB 4R0VA 1K5GA 5DSZA 3BDIA 3VH1A 2BJVA 4LWPA 1OGYA 1UIRA 3EGVA 3W2HA 3KPWA 2Q41A 3U9LA 1A97A 1RXEA 4EY6A 1PR0A 4V1CA 1AZWA 3FMPB 4P82A 1EAYA 1DIGA 2A5GA 3E5HA 1DJLA 2WWXA 5GAJA 6AT1A 1MX9A 1Q5PA 1UBMS 1TQ4A 3ND5A 4QIHA 4AG6A 4LKOA 3B6KA 3PFKA 2ZWVA 1L5QA 2QMYA 3T8YA 4LJRA 1NQXA 4ZEVA 4L72A 4LYFA 4QBTA 3T52A 2WYIA 3GUYA 4P4GA 4KXQA 3L1UA 2VJLA 5FFMA 2O8NA 1QH9A 1C3LA 1G8AA 1UKAA 3MGKA 2X2PA 5C3MA 4L8VA 1JHZA 5L45A 3SXJA 2FZKA 1RWNA 2ICAA 3H9UA 3SKYA 1DIAA 2R66A 1VE1A 2FSIA 2WTBA 3F4BA 3H8JA 2XRMA 5J2TB 4DA4A 1M2KA 1NVVQ 3G2LA 5EIBD 1VL2A 2CYCA 2QTVA 1N7IA 3TLYA 3H11B 3U44B 3HK2A 1Q0UA 2D7CA 5FHRA 4CR6A 2IHNA 1G6KA 4IJKA 1Z88A 1II9A 3JALA 5CFLA 5IKXA 2BMFA 2ISQA 2QUAA 3JRWA 4KLRA 4TQGA 2BW0A 2Q1SA 3IQZA 5SICE 3VZBA 1W36C 2DECA 3EGDB 2EGHA 4WDRA 3CN7A 3BRWD 3FTCA 3B3QA 3LCJA 4R8RA 3CGWA 2X5OA 2JK0A 4RW0A 1CUZA 4MRRA 2GKSA 5BPFA 1XFDA 1CUUA 2VHQA 3WE7A 1TYBE 2AD5A 4RY9A 4BBJA 2W70A 2BGIA 3KTAB 1SKBA 1A7JA 2XAUA 4MINA 1JT2A 2C9YA 4AAYA 2IE0A 3TIVA 7REQA 4JQZA 2EKQA 4Y30A 2QTGA 4JR1A 3P2IA 4HDNA 4MUHA 4DRXB 5JARA 3TLCA 2D13A 1OXMA 4YRZA 2WZQA 3GC6A 1H4QA 2ZAIA 9ATCA 3NOOA 3SZLA 3V4ZA 4L51A 4RABA 3H4TA 1H65A 2PCJA 3HEMA 1ZN7A 5FH9A 1KAGA 1M5TA 3OQJA 3QXSA 4X7MA 2CFIA 4YUAA 5L8VA 5LQUA 3ER8A 3BH0A 3T1YB 2PV0A 1NSTA 3L8EA 2X1HA 5G1PA 1PDWA 2H1OA 4MS4A 1O2DA 1M1UA 1R9MA 3FWZA 5A5EA 3R6DA 4K28A 2NU7B 5D1NA 3NFRA 3R74A 5IDQA 5ALIA 3T3EA 5AICA 2ATEA 1JGTA 1BWPA 2YNMC 3JQRA 4UDNA 1U8ZA 2ZR7A 5K8UA 3AIOA 5BN3A 3QEKA 3G2KA 1IRXA 3NBXX 2GLXA 4KL8S 2QTVB 2WIJA 1E9EA 3B9RA 2E5WA 2PL9A 3COVA 3DTTA 3IBYA 4YAUA 1BROA 4HBGA 4ER5A 1JYEA 3ZWKA 2DB3A 2P2SA 1P1FA 1ZDMA 1EJ2A 3H5LA 3U3RA 5KJCA 2J6IA 1YB5A 1TAQA 1S6YA 4HI0E 1U4NA 2CXSA 2LP4Y 2ZIXB 1FX0A 3AMVA 5T41A 4C4RA 3MERA 5H16A 3WLNA 1JEOA 3H2ZA 4HNUA 4OHWA 3KQHA 1WUTA 4KQFA 1F20A 1VIAA 1W35A 3ZW9A 4R4JA 1ACLA 4EX6A 2X1VA 4AJKA 4UTRA 3ZU2A 4FDVA 1Q15A 3Q5DA 1CJVC 5COBA 5FI0B 4JNCA 4QYSA 2GUWA 4K9KA 4TWZA 3LQQA 3MRVA 4UEQA 3O4GA 4UXJA 3UMYA 3LOUA 5ITWA 4C7OB 2I80A 4CU5A 3MIIA 4NIMA 3PQ7A 4RYLA 1ORHA 2FW9A 1JTVA 2V0GA 3FFTA 2YQ5A 4DLLA 3BFKA 4FFRA 5BN5A 3IUEA 1HR0B 4RO0A 1PR5A 3QX8A 3TW6A 1WCV1 2REOA 2XZDA 2ORVA 3ZEIA 4GPAA 5TPWB 2WB2A 3PHGA 1EVIA 4O2BB 4MV3A 3KWLA 1J7JA 3W7BA 2C7OA 3R23A 2RH4A 2FPXA 4HWGA 3RK1A 3EB9A 4B8WA 2GJKA 4DVJA 4IGEA 1XDUA 3SQLA 1ZK2A 3VOTA 5DOVA 2P3OA 5B4UA 4DCSA 1M1NB 1PFVA 3E27A 3A4TA 3OIYA 4K86A 4OU5A 2PVSA 4RD6A 4XCQA 3CY6A 4JJ7A 1JXMA 3OEWA 3HJGA 2R11A 4LYYA 4D8XA 2QTMA 3GLQA 2WFZA 3JQAB 2H2WA 3V4PB 1IMJA 5IAGA 2WZBA 3M6UA 4ZFNA 4ZOLA 5HBRA 3WL3A 5EMKA 4JUDX 4MW1A 1T4MA 2ZAMA 1N1EA 1E2FA 2GSWA 1US8B 2NZVG 4X6LA 5AJYA 3KP1A 2H2DA 2ZBUA 3DTVB 2X41A 1DOAA 4ZO6A 4RLSA 1VP3A 2QORA 3LT5A 4C2BA 3K70D 2F8TA 2XYQA 1AQJA 4DRXA 2J9GA 2JAUA 4DQDA 2W0SA 2WWRA 2XCIA 1V47A 4TMKA 2I4LA 1NLFA 3NEYA 1SIUA 2BFEA 1OFHA 1RWKA 2FWBA 4RBNA 4EJSC 2Z30A 2A84A 1X15A 3EUFA 4HRAA 5ER6A 4C07A 3QBVA 3QVXA 1MV8A 4EL0A 4GZ5A 3G1TA 5K8JB 2SICE 1HDXA 2GPNA 5TQ0B 2J9FB 2BSAA 1TLFA 4LY6A 3SZGA 5DI3A 4EYKA 3DMPA 2B1JA 3BMXA 3C45A 3DEJA 3OE1A 1H6BA 4Q4JA 1E1QD 4F2WA 1B8UA 1Z4OA 4F9GA 1W34A 1G8HA 1RVDA 2PMWB 1LA2A 3LNCA 1SQGA 1W1IA 4G9GA 4XYEA 1YI0A 1R0YA 4IVQA 1ILWA 2JI4A 2R65A 4UVDA 5LKAA 5LOVF 2C7VA 3ORHA 3O82A 4HQNA 1HKHA 2OQIA 1MO6A 5AWFC 2BHTA 2P9TA 3VC2A 2AMVA 3ED1A 2ZIEA 4C43A 3TIXB 2FAXA 2G36A 2AR0A 1YFLA 2HBZA 2BMAA 2I7XA 4M0DA 3DAOA 2JD1A 3K6KA 4RHEA 2OFFA 3FAZA 1UKVY 1XLUA 1G20B 3KM0A 3LY8A 4XWGA 3KQSA 2BHLA 2I2BA 5TPZD 4TTSA 4JI6B 1OYOA 2HXYA 2I7DA 1UBRS 1SU6A 1TA0A 2YXPX 2YZMA 3V2IA 3VVMA 4PYKA 3I3SR 1LDNA 1OKKD 5CEEA 4FYKA 1PSZA 2GZAA 3HYNA 1F8UA 2NQ8A 3VR6H 4YYZA 2MSDB 1TFUA 1E2DA 2C0CA 3S4YA 3TZQA 3T1VA 2QL6A 4I5GA 3N8GA 1E9VA 3BWXA 3E2IA 3LTEA 4MARA 5EGSA 2RGNA 2XX3A 4YIHA 2JLCA 5LQMA 4P84A 4JBGA 2YJZA 4S1OA 1MQSA 3ZXSA 5HZGA 3EDCA 1EH5A 1KP3A 1WB4A 1XQYA 1TT5B 1C1XB 2R87A 3D7MA 1OQAA 3K30A 2I9KA 1IJFA 2AN4A 5AK6A 3JAMA 1U9IC 3VU0A 2FSHA 1G8SA 3QENA 2JBHA 4QOIA 3G85A 2PJZA 1Z0KA 2HX1A 1Q7CA 2X4IA 4XLTA 2G1PA 3F3YA 1WTAA 4R2MA 4NAUA 4YASA 4LF6B 3H9JA 4KODA 3PK0A 1UKEA 3CPJB 4TLCA 3EXFA 1M2JA 1NF2A 3LC1O 4C4XA 3D8BA 1JDTA 1NW5A 1EFRA 1W30A 1CVLA 3BIXA 1JAXA 3L7DA 3QA9A 5GP1A 3WMXA 4Q3DA 5KVSA 3ICVA 1ZH4A 4IYRA 4WIAA 4XYBA 5KHAA 4DG9A 3DXXA 3NAZA 5DX1A 5A4FS 2F43A 1QC5A 3DTYA 4ID9A 3DFZA 2HPAA 4IP0A 3DMNA 4I4LA 3AFGA 3WK8A 2J5BA 2Q9CA 3HR4A 3LSYA 3O1LA 4NFLA 2QENA 2PWZA 1KR2A 3TX6A 3PQ5A 1P4AA 2QW8A 6REQB 4DABA 2HPVA 3G2MA 5HRUA 5DNYB 2ZJ7A 3IALA 1FRFS 1ZXXA 4LBYA 1WVMA 3MUNA 4HDNB 4MWBA 5EXPA 1Z6ZA 3DZGA 3IEXA 4G07A 5LP6C 4GYWA 1CWUA 2JFQA 4QJIA 5LB4A 4L5JA 2VP5A 5BYAA 4QDXA 5KKNB 2ZWIA 2HIAA 3LVFO 1S2NA 4UNPA 4BX9A 4IIGA 3C5HA 2P7HA 3AOGA 5F77A 1UOOA 2W9XA 2ACKA 3L7NA 4WLNA 4BV9A 2O8EA 3P45A 5AD1A 1SOWA 1HE3A 3IEKA 4QOSA 4ZMRA 1CU1A 3TW8B 2QXTA 3L82B 1T5BA 4MUMA 2Q28A 3LSTA 1YJBA 2WW8A 4ER7A 4TSKA 1C1DA 2E4ZA 1E1MA 3QP9A 5LZ7A 1JQLB 4PAWA 3EODA 3M4ZA 4MUNA 2UVPA 3OAAD 2I7CA 5DHAA 2EG5A 5G2OA 1M5RA 1NZDA 4PLFA 1NVBA 4L0DA 5EAIA 3R3HA 1E8MA 2BRUA 4ZYLA 3DL2A 4FOOA 5B36A 2GZHA 1D2NA 2Y0CA 1J8VA 1OFIA 1TYCA 1J22A 1CETA 3Q12A 4MLZA 4W1PA 2H9AA 3KZ1E 4XB2A 2BVNA 1TW3A 3SR0A 4B87A 4NCAA 4PLWA 4O5AA 4XDZA 3DLPX 4MQBA 1YGYA 2JI9A 4TVBA 1FSGA 2E89A 3GN1A 1U2TA 1PTKA 3FLAA 2C97A 3NV7A 5ELLA 3E81A 4CLDA 3BL5A 1T10A 1ACJA 5I5EA 1AHHA 1CUGA 3M4JA 4RJKA 2X42A 3DV2A 3E15A 4L5BA 4CE6A 1Y9AA 2J45A 4GX2A 1VSTA 4W99A 4DREA 5ABPA 5LYJB 4IXMA 2ADOA 1U0LA 3U2QA 3KOWA 3FVRA 3FX2A 3PC8A 1OC2A 5H1YA 2EW1A 4BP3A 4MR8A 3DAYA 4BNHA 2XTNA 1PEDA 4CRWB 1E3WB 5DHPA 4G01B 4JLOA 1VBFA 4BHTA 2I55A 2J1LA 4N7RA 4XD2A 5DTQA 1R0KA 1XT6A 2V45A 4RHCA 5EZ6B 3CRMA 4DLKA 4UFNA 1WWKA 2H06A 2C2KA 2RC5A 4O1MA 4QRHA 1Q0PA 5TPWA 5LQDA 1NBEA 2P9GA 4KFUA 3E9MA 1OR8A 4FMPA 4UMVA 5CX1B 1E2LA 1SPXA 1D6MA 1F8GA 1MENA 3QPDA 1H1TA 2JS7A 2E4VA 2NZYA 2F9FA 1PSWA 1ZGZA 3KS9A 3BMNA 4ROSA 2XXAB 1OILA 5HF6A 4D82A 1R6UA 1T91A 1O1YA 5JXHA 3SC2B 4JJEA 1TW2A 4KG7A 1H8HD 1MNQA 4HFJA 1GQYA 2HWKA 2ZRJA 4F7WA 2WJVA 3GVCA 2GYWA 1MJGM 2NV2B 5IULC 4D74A 3DO6A 1X1BA 4GOOD 1LZLA 2AK2A 2DOKA 3TLGB 3LA8A 4RKQA 2NV6A 1Q21A 2XITA 3OCXA 2XQGA 1YJAA 3EUAA 1UMDA 1F0NA 3CRRA 3EZ6A 4Q4LA 1G2IA 4EG3A 2QRKA 1TUIA 3OZRA 4R6XA 2FPOA 4A0QA 4X66B 3H4VA 3ZYZA 4RTOA 5CEFA 2I6UA 1IY0A 1VQ1A 2FSVA 3WNQA 2G71A 2R4UA 1ZPDA 1JR2A 4YMUA 4YFYA 3S40A 3ZDZB 2PKYX 3HV0A 1GU1A 1MDBA 1IQ0A 2WAAA 3QVGB 4HQKA 3H2YA 4QUBA 1X6VA 3QVKA 3RQSA 3VPHA 3WHKA 4EVSA 5J47A 4RANA 2IUYA 3W5HA 1PCXA 1Z73A 1T1RA 2E85A 1XA3A 1G8JA 1RKXA 2QVCA 1NT2A 3ABSB 3O73A 5FPSA 1NSYA 4LZPA 5FUYA 2WD8A 5E2AA 1OVMA 4FR0A 3O8CA 3OE5A 4JU8A 3ZLTA 3VX3A 5DBGA 4UOZA 2YN4A 4ABYA 1YF3A 5FUXA 2PD4A 3LT1A 1H4SA 1TJ5A 2XUZA 3H1EA 1GN9A 4E6EA 1E0SA 1KI7A 3D7NA 4RHFA 3PEFA 5DGTA 2I9PA 1VA4A 3GLFB 3GVXA 4V3CA 1VJ1A 3RVQA 2ZJ5A 5ALYA 1QTNA 4YO7A 1NQWA 2NYRA 1TPYA 3LBAA 1M0SA 2YYAA 4WY8A 3QF4B 4BLVA 4F3NA 4R9SA 2DMRA 5C5DA 3LVBA 4HYTA 1DC5A 1Y89A 3I8XA 2JGFA 5SZKB 4ETWA 3UK7A 4UZEA 4RZHA 3VHXA 3UXYA 3B6MA 3ILYA 5F2OA 1UUFA 3HKDB 5KQMA 2CVOA 1UDBA 2WZCA 5ALRA 2C3MA 2OZVA 1QLJA 1QP8A 2YWFA 1NV9A 5KVCA 4KMOA 4QT0A 1W5FA 1OX4B 3Q9LA 4A5OA 5BR1A 1QE5A 2I6GA 2AFIE 2GEBA 1XTPA 3NBKA 3KDAA 2I99A 1H0HA 1KK1A 3EY9A 2QMUA 1CS4C 3JATA 2VSFA 3AJRA 5TARA 3S28A 2PZ8A 3MLAA 2IJGX 1F9EA 3BJMA 3P2YA 2XF2A 5JSHA 3FVVA 2JLUA 5EPOA 1Y42X 4CM9A 4HS4A 4HWKA 3H8VA 5KZMB 3FKJA 3MUEA 5LYYA 3NX4A 2FCRA 1KQPA 3RODA 3TE6A 1SEVA 4KJXA 5FT9A 4D79A 1KTIA 4WFJA 3MTIA 3GGCA 1XZEA 2I5PO 1GO2A 5JCJA 4C1BA 1D2AA 4R54A 2Z8YM 4W4TA 1KEEA 1TU0A 2I8LA 2EJWA 2WJGA 3IQWA 1R0CA 4BKRA 2BM8A 3UJNA 4Q6BA 2OBFA 4Y6PA 1N92A 3RFTA 3N39C 1CCWA 1AGPA 2AUNA 1KYIA 4HBZA 4R1SA 2B8EA 1KO4A 1TKAA 1K3TA 3BQNB 4TLAA 2H4HA 4NPHA 2DWOA 1ZITA 2RHDA 1RWPA 2O2GA 3I72A 3DVLA 3K31A 2QJOA 1H2EA 3MT9A 4E03A 5BR7A 1KOLA 4B47A 3B1ZA 1B74A 2W6OA 5GONF 3ZNNA 4L8LA 1DPFA 4QM7A 3U9SA 1PL0A 1J06A 3QF7A 1NAIA 5F52A 3QX7A 2R47A 3IP7A 4X93A 3EMBA 1YKSA 2SKEA 3IP8A 4O2BA 1Q83A 4O4JB 1Z0DA 2QIOA 1X2EA 2B2CA 4HRVA 4UBKA 4HDMA 3WLSA 1BW9B 4YROA 3CUTA 5D84A 5HJ5A 5KTYA 5BOSB 1P45A 3WGYA 2J0SA 2ZS9A 2QD3A 3GD5A 5K09A 4GM1A 2B3TA 1M2VB 5EHNA 2WPNA 3PBKA 5D5HA 1JPNA 1CZOA 1JILA 2F62A 1QHHA 4IJQA 5EMNA 4D9NA 2HF8A 1N2HA 3CVOA 4M36A 3KYCB 4M7WA 1JHXA 2YBEA 3TN7A 2YWRA 5BSHA 3OZEA 3WDLA 3OM8A 1SQ0A 4GS5A 3KD3A 3LIPA 4XGQA 3GNLA 2B9EA 2P27A 3JQ6A 3PFFA 3QITA 4FOLA 1MMFB 3EAGA 3CLHA 3KHUA 3ROXA 3TKAA 1XCOA 4AS2A 2XNSA 3BJZA 4NBLA 4P3PA 5IYZF 4KVGA 3HPQA 4F9FA 2NWQA 2G0NA 3P9NA 1E6WA 4O59O 5CP8A 5DP1A 3DL0A 5GGYA 1GYRA 2OB1A 3RTDA 5BUSA 1J00A 4C4AA 4OF4A 1MCZA 1XMSA 4KO2S 2ZBRA 3OT1A 1MGOA 3U7JA 1NMSA 3K0CA 1PW5A 1P4GA 5LP6B 3FCAA 2X2EA 3NATA 4JIGA 3UGKA 2SBTA 3U7EB 1ISSA 5J2TF 1VKHA 4HMOA 1FMCA 1ZU4A 1Z06A 1LPOA 3N0TA 4TX1A 2E6UX 4X00A 1M1XB 4MJLA 2A5JA 4TPKA 3EXEA 1GFSA 4RS3A 3NYWA 1TCCA 1Y3CE 4U5QA 5DJ5A 1V6SA 4IQ8A 2COEA 2AHOA 5KNCA 1K5HA 2F59A 1ZM7A 1ZUHA 2WBLC 1W96A 4HWPA 5I6DA 2X14A 3WGVA 5DK6A 2J4FA 2Q4RA 4N7BA 3TQHA 2P2ZA 1JKJA 4RPKA 1AQLA 2H1CA 4LTDA 3N5CA 5C7YA 4FNGA 4TN1A 3CO0S 5TVGA 5CFQA 1EUZA 3HACA 2XEDA 2A88A 2H1VA 3NIGB 1AQIA 5U1PA 1V48A 2P3LA 3T54A 2QRZA 1WDWB 1PS9A 3HHEA 3F73A 4DJ5X 3U56A 1TKBA 3K5PA 1N75A 2BYTA 2QSYA 3A1EA 3D3NA 2P6NA 1G4HA 4RDHA 1ZSNA 5CAEA 3S27A 4B79A 4C76A 4IEIA 4OGFA 3KB2A 3M6FA 4UXHA 2ZAYA 1QQBA 3SM9A 3P9SA 2FMHA 2HYDA 4ZQIA 4NVRA 2QY6A 4UZSA 3VPCA 3UMBA 3ZDAA 4PIPA 5H83A 4CIVA 1Y3DE 3CZCA 4IHKA 4WJZA 1AHPA 1U7PA 1JDBB 3NDBB 5K3CA 4EYOA 1HNXB 3FHLA 4L5CA 1YCGA 4A2PA 2W7TA 3TQOA 5A3QA 4Y7CA 5B3LA 2WF8A 5AJXA 1C9YA 1CDDA 4B6FA 2GN8A 1WCIB 3MQ4A 1LSSA 1FFAA 5HS4A 3AK4A 4NV1A 1KS9A 1RRVA 3K9NA 1E2EA 1USUA 2GR9A 3C43A 2Z09A 4FEEA 3V7WA 2PNJA 5I3CA 2PUHA 4OK3A 5JAIA 3ICWA 2IU0A 4P31A 4MHOA 4WD3A 4MPTA 1AKEA 1AUPA 1XWWA 4IGKA 3EVDA 1IZYA 3N5KA 4FMBB 1YDHA 3EZLA 1DAMA 1F3OA 2HKIA 2BGWA 3FPAA 3IKMB 3CCCA 4ENTA 2QT1A 4ZQGA 3GCGA 4PBTA 5EHGA 3A25A 3KJQA 2ZRGA 3TZHA 4JVOA 2JDID 2BH2A 1MPXA 5ERXA 4CL2A 1MJHA 5CCEA 3N53A 2ETVA 3V34A 1NUHA 4ND6A 1NRWA 2AFIA 1F8FA 1QHHB 4PZPA 2Y1EA 3ZE7A 4C3ZA 4LMBA 4KMRA 1UBEA 3MW8A 2BFDB 3F6CA 5TEWA 1XUOA 2C7BA 3PR1A 1QU2A 4OY3A 1YZGA 2RH8A 2XODA 3IAXA 1RWMA 3H0KA 3QHQA 2RK4A 1GOTA 3GLSA 2YVKA 4DQVA 2IS1A 2A5DA 1G55A 2PZKA 3O83A 3BHJA 4LJ8A 4NK4A 2GYVA 4BNMA 1SIOA 1U2DA 4MKXA 4E1BA 1ARZA 3CYFA 1TJNA 1A8HA 1FYVA 3KCQA 4X94A 1C30B 2F8LA 1TIBA 2PXAA 3P26A 2CT8A 1TVKB 2D0OB 4YR7A 2HIHA 2RIPA 1P4JA 2MSLA 3DHYA 3DOUA 3VNSA 1RPTA 2C2YA 1J09A 1IFXA 2WVAA 3O1HB 5JMPA 4F93B 1JR3A 2XGSA 1SB8A 3EQ2A 1XZAA 3QBDA 4MQLA 2O06A 4IJ5A 5I8WA 3WQQA 2FZLA 5CB8A 2HWWA 1NY5A 3GEDA 4JJ6A 5CNIA 5JS8A 3BCUA 3FH0A 4KUGA 2CLCX 4Q9JA 4DNQA 4NE7A 1T8WA 1XZCA 4B31A 4FNAA 1YQGA 3JD1A 1YBVA 4F5EA 3HCOA 5CX1A 1UK9A 1RYBA 3GRAA 3IVMA 5ALZA 3S7ZA 5K8CA 1JEQB 3RU3A 5FUQA 4V03A 1ID1A 2VRCA 3LC7O 3UHPA 4F5YA 2QZJA 1E7MA 3A6HA 3RS3A 3EF1A 1FNBA 3WGGA 1JXOA 1Y8RA 4E30A 4PLVA 2CE7A 1O94C 3LUKA 2H3EA 1ULSA 1RFGE 1ZN2A 1I9GA 2P69A 1IXSB 1HYGA 3GU3A 3AHJA 4OP2A 1GSIA 2C96A 1YD7A 4TSFA 2ODPA 5L40A 2V0NA 3GFVA 1J49A 1AC5A 2A6PA 2XYRA 4CLEA 1BFUA 3D4NA 5E0KB 1RCTE 2QGZA 4U7PB 1J20A 3P9XA 4FC6A 3GG9A 4CKEA 5B12A 3ETJA 4FSHA 1AK9A 4DLRA 1FTWA 1E6CA 3TZKA 4LDPA 3OZGA 4LOLA 2RHGB 1YKFA 2X76A 3JQ7B 1TJYA 4JR0A 2REQB 4YPFA 4R8KA 4BOYA 1SM4A 3P9CA 4CI9A 3TAXA 4CFZA 4R1LA 3N0VA 4EABA 2A0FA 4HJRA 1GPUA 2OLJA 4Q1BA 4DSOA 4RF2A 2X15A 4EHFA 4L2IA 2OORC 4R9VA 3ZQ6A 2VPPA 3E3LA 1U7OA 4BQEA 5BV2P 3UT6A 1J97A 2ZSIA 3MXTA 2DQ4A 4K2AA 4PNHA 4P3YA 4Z86A 5IM4A 4RQTA 4AM8A 1GR0A 1AF4A 5LP6A 4YRQA 4N41A 3KLOA 4DM4A 1RLTA 1Q17A 1L4YA 1TFRA 4NICA 4CCYB 4NYJQ 3G5LA 2D0IA 4V24A 4WZBA 5KNDA 4B3GA 2QAIA 2VRWA 4BPRA 5DU2A 2ZJ6A 2YX1A 3MWYW 3F3SA 4PY2A 5SYNA 1UJCA 1XZJA 3D59A 1PUXA 3ZOZA 1V8BA 3KWFA 4HNQA 4R8LA 4B3XA 4LHWA 4TTAA 1KY4A 5JTTA 1Y4DE 1YDEA 2IYRA 4RX1A 2W71A 3A1DA 3UUFA 3FTDA 4W5NA 521PA 1MQ8B 1K9SA 4RSGA 3ZEAA 1FA9A 4H7FA 3IS3A 4MW2A 3UHJA 1CJMA 1QK3A 3PTZA 3TECE 2OV8A 3S8YA 1U7TA 1MGPA 5JD5A 4ER0A 4L95C 4OOFA 2CLSA 2JBAA 1TCUA 1H2ZA 2IUSA 1KZ9A 3FHCB 2Q8PA 2WRZA 2ONYA 3KR9A 4NC9A 3TRHA 2WJPA 1M6VA 1WPQA 3C6BA 3OZ7A 4REOA 2WU1A 4PRLA 4RETA 3ZLJA 1JA1A 2XSZD 4YCBA 3U7IA 3PFHA 4MPJA 4A2CA 2XT0A 5DEIA 1DFHA 1Y6RA 2V65A 3AT1A 3ASUA 2X5NA 3N2IA 3NEAA 5IVHA 2IP2A 1B6SA 4JYPA 2C2BA 3ZBUA 4TYMA 2JHCA 2ZUWA 1IMOA 1COZA 1XTBA 5EP1A 5F5LA 4DV0B 1UDXA 3ELWA 5JPDA 3MD9A 1QGDA 3AR7A 1C50A 3JZMA 3T5MA 1SVKA 3VUEA 2OXEA 2Z3ZA 1P2DA 4YDQA 1SJ9A 1NW6A 4M89A 5I4CA 1SG6A 1GQ2A 3W8RA 1HFJA 2FW1A 3OTIA 4MWSA 5K3FB 4DEYA 1P31A 2AJ8A 3JWJA 4J7UA 2IQ5A 3I4CA 3TXXA 1EFUA 1KYZA 3KYDB 4ER3A 3EVEA 3RAEC 2P6PA 4WJKB 4J90A 3F8TA 4Q05A 2GN1A 2O5VA 4CDMA 1FNCA 4BFLA 2HR1A 2PS3A 5M04A 4R2HA 5DOZA 2WKWA 2UVPB 2YXBA 5K20A 4BVBA 2AG6A 1JDPA 2F1HA 2IHBA 3GD7A 3G2IA 2KS6A 1QWOA 3PEEA 4A2QA 4C2AA 5JAZA 3GPBA 1MJFA 5I48A 1LJ8A 3SQMA 4EG0A 3EMDA 1DEAA 4MKFA 3T5AA 3QNMA 2VJNA 4O2LA 4YONB 1KIFA 4YRPA 2BOVA 1EA5A 1L8XA 3AUSA 1EGMB 2I3AA 4GMGA 1JALA 3DB2A 1XA0A 3P9RA 3QY9A 1P6QA 1Q0SA 2I0FA 3CW9A 5BNTA 3JZDA 2XDQB 1G291 2GD6A 5THXA 5AKEA 1O03A 1KORA 1U90A 4Q3BA 4RF3A 2HNAA 2VDMB 3TRJA 2HSZA 4PE5B 1OLSA 4RHUA 2C78A 4NJOA 2O0JA 4XGKA 5ALUA 2XDYA 3KXPA 1FFDA 1M2VA 2CEAA 4WOJA 3F67A 3M34A 1ZH6A 2DH5A 1A5SB 2R8PA 1BRTA 3AKCA 3O92A 3DV0B 1KXJA 4QBGB 4QM6A 5HZMA 3QPAA 5KTSA 4CTKA 1UT5A 1UAAA 4I50A 3ROMA 1Y3BE 2NYVA 1D1TA 3L6DA 5C2JB 3I76A 4BATA 4CT5A 1YL6A 4BO5A 2V7XA 2JJMA 1NFFA 3L7AA 4HDSA 3T5GA 4D3FA 5KOIA 3THXA 3HNRA 1T9GS 4S2EA 3D3WB 3TTSA 4V0KA 4I99A 4LYJA 1P7WA 4GOND 3D6AA 3Q3VA 3ICOA 4ITUA 3CX8A 4G5GA 5JXWA 2QROA 1CJSA 1A7UA 1VLVA 5DBOA 1KQNA 3BGVA 3DE0X 4BFCA 3A8TA 3O8OA 1TM3E 3KFVA 4BO2A 1TEXA 2J8ZA 2Y3IA 3BK7A 5CHEA 3P9ZA 2OQ2A 2Z9BA 2FZ5A 3VC3A 3FPLA 1DX6A 1ZL2A 2LVBA 4N9QA 3VTKA 3H0EA 4BMNA 1QP0A 5C46F 3A7DA 1BH2A 1YA8A 2NZUG 1Z8FA 3H7AA 5FEMA 4AZ0B 5KYNA 3V8BA 3NQ41 3OPNA 3ESAA 5AR1A 4EHLA 1SU7A 2VT7A 1K06A 2ZP1A 4E33A 4YWHA 2GA9A 1DELA 4RZ2A 3CNLA 1RAAA 1N7GA 1TZBA 2F64A 3IO5A 4PX3A 4PNEA 3PUHA 2VSNA 3DEFA 1Z6TA 3A6KA 1JFSA 1XEXB 2VTKA 5F78A 1XDDA 3ADCA 1XD8A 4FDLA 2IDJA 4HDMB 5LCXA 5C8XA 1SHLA 1M6VB 3F3MA 4P5EA 3OM1A 2AJCA 1DLJA 3FDIA 2IU3A 4JI5B 3RASA 4OQFA 1N6HA 1P91A 1Z5UA 4QUDA 4F2DA 2CSUA 2H54A 3DMGA 3HUEA 1LRKA 1N1MA 2VK8A 4ZTBA 3A4IA 1J33A 1IPHA 4I7EA 1M1YA 2WWHA 3JX9A 3TD6A 5AOCA 4NBSA 2EU8A 3G82C 5BR8B 4PR3A 1FQWA 2H7CA 2H8KA 3HMKA 3AIIA 3AYXB 4H1VA 5FUMA 3TWOA 2LRHA 2TSYB 3KLNA 5F64A 1DT3A 3L07A 1DZIA 3NI2A 3WHIA 5JSZA 4N03A 5AM3A 1QR6A 1J0XO 1XQ1A 4ZU3A 2AEFA 5BWOA 1QIEA 3LECA 3RARA 4PFKA 2C42A 4FZRA 1KMQA 2PAAA 3WIUA 5FBLB 1JNXX 5E8RA 4JXKA 4BWYA 3BHIA 1JYFA 1U0NA 2P6MA 5HM8A 5JPCA 1RC8A 3ES9A 3KUDA 1UP6A 3NHBA 4LDNA 4S1TA 5TQ2B 4ARSA 1I3KA 2AXQA 3OPQA 1XQWA 3SOPA 3WRXA 1QDEA 1ABFA 4ALKA 4JKOA 2VBCA 5IW8A 2IQIA 4GVXA 3BGIA 4FD3A 3JYQA 4HAYA 4J75A 1E1LA 1O7JA 2OQRA 2OY0A 4PZEA 3KQVA 4GKVA 1K7XB 5K6AA 1O89A 4MRNA 5HMMA 5CLGA 3WGNA 4QUAA 3RVOA 4G23A 3NGLA 4BNDB 4MLPA 4TMZA 4DDVA 1YIDA 1U0FA 1N8KA 4LGCA 3DZFA 3DMYA 4HAWA 4RHTA 1U2PA 4IMRA 1IN4A 1OI7A 5D01A 3V9AA 3L1VA 4HDKA 1RSZA 3B5JA 3O8QB 4XFJA 3MMSA 1DWOA 4LN1A 5IH3A 1T6XA 4J3NA 4YCLA 1UBSB 5JWRA 3CLTD 4DHEA 4OMUA 5KDOA 3ADDA 3IPAA 2PRJA 4YLEA 2PL3A 1RHJA 4FDUA 3WKEA 2Q6KA 2D5LA 2YFKA 3JQ8A 3CQ9A 1XNHA 1PFQA 1W85B 4ZZ3A 1NZFA 1Z8NA 2DC1A 2DFTA 2E4AA 5B2ZA 5IARA 3VSBA 3EUWA 4ND1A 4LJ6A 5JJBA 4BQOA 1T4BA 3I05A 3WKAA 1JB1A 4BAZA 4KXUA 4G24A 3GNQA 1I24A 1U6IA 5G1NA 3X1ZA 3ZV4A 3I2IA 3KSRA 1EFKA 4Y2TA 4BKUA 4HRXA 3T3NA 2LXNA 2HHCA 2QT9A 5C4IA 1QHSA 3ANNA 2IUUA 1U94A 3P4YA 3R9XB 5KUTA 1R0RE 1OH5A 2Y8EA 3OIFA 2M1ZA 1UJNA 3F2VA 3QOWA 1D5CA 1VMDA 4Z99A 4HTFB 3ZCQA 2Q7OE 1CVRA 1U8CB 1W88B 3SF8A 2YHIA 3H9QA 4E2FA 4OHOA 4TZKA 3TOCA 2AB0A 2NO1A 3HEBA 4B3FX 1LDGA 3BORA 2ZFUA 4NR0A 4XR4A 2Q07A 5J2UB 2GN0A 4MMZB 3GLIB 1VCMA 3IT3A 4KO4S 2C0QA 2JIOA 4O4HA 3F6SA 3KJFA 4I5EA 8ABPA 4AYTA 3DOCA 1CP2A 3REQB 2FJ0A 5CXQA 1QDUA 3K35A 2Q5JA 4RH3A 2YHBA 4EKYA 1IU9A 2AN1A 1VLMA 1FJ2A 2V59A 2RI1A 2ZETA 3FCEA 4RFVA 4UMEA 4YJDA 5IABA 5FI1B 4YJ3A 3H1PA 2ERYA 3E9QA 4J16A 3FIJA 4GQIA 2O2EA 1GU7A 3DAHA 1JN0A 3KKZA 4QQ8A 1C8BA 1TGVA 4WY2A 2DBRA 3FCOA 3RSOA 3ULKA 3FRJA 4DLYA 1E1CB 5IH7A 1XQVA 3BB1A 2Q5EA 4NSNA 3BH7A 1YZ3A 1GNRA 3GCWA 5AJZA 3DDHA 4BC0A 4CCSA 5B57C 5JOQA 3EPKA 3K0SA 4TZ0A 4B44A 4FWBA 4MYSA 4S0ZA 2D1SA 5B30A 3LBIA 3T4UA 1U3CA 4NMLA 3VJMA 4WBXC 1IZ9A 4M1KA 2XVXA 4E5NA 3UGJA 2CNDA 3AL0C 4ZCMA 5AK0A 1I6LA 4Q37A 1XHEA 2R0QC 2NO6A 3NYIA 3B82A 3KB8A 1MB2A 3C8ZA 1RT9A 1SHKA 3OT5A 3BSFA 4KDEA 3GZ4A 4OHKA 3LZDA 3O74A 2ZE7A 3PPVA 5HGJA 3T7DA 3ZVMA 1KEWA 4QVGA 3BD7A 4IJWA 3GPCA 4WERA 4UUOA 5TMBA 1ZVMA 1O5TA 3DTNA 3MWDB 2JK1A 2YXEA 1KI6B 1O0SA 2X7JA 2ZT7A 3CS3A 2HQOA 3KTFA 3TRDA 1QO0A 3QVWA 4EG5A 1XNGA 2UXDB 1LLDA 4WN9B 3F6YA 4KAAA 1I7NA 4C89A 3RAFC 1TTPB 4AROA 4Q3NA 1ZEMA 4PZ9A 2W2KA 5LUBA 3AHFA 2VT6A 3FJOA 1U7HA 2OSBA 1D0IA 4MV4A 4ODIA 5IEBA 3U31A 2JGNA 4HMQA 5AKIA 4ASUD 4B8ZA 2YXLA 1P74A 3ELDA 2X1LA 3JQFA 4MW6A 1P73A 3K1AB 5EZYF 5D7NA 2YS6A 1NLMA 3P2KA 4MGYR 2F1RA 4X92A 1PX2A 4X7BA 2O6LA 3RC7A 1JLRA 4IRUB 2UV8A 1VIDA 3ROKA 2OKGA 1GSHA 1S5PA 3JTMA 4P4UA 4QXOA 5F5NA 3A11A 4F91B 5KTOA 2B37A 5E6SA 1S4MA 1JS1X 3DZIA 1L9XA 5JG7A 4WACA 4XM1A 4AX8A 5ENDA 3HGTA 5HQJA 4ZGWA 4Y2HA 4XIIA 4KR9A 4HPXB 1T5TA 2EQ5A 1EB9A 1GRCA 4K3VA 3TOVA 1P4HA 1ZN9A 2EQAA 4AJ2A 2D59A 1T1GA 1GJRA 3DLTA 1EFDN 3UANA 3QBEA 1BEUB 5H82A 4AKIA 2WSBA 1A9XB 1I2ZA 1YSCA 5B1IA 2OK7A 4ND4A 4DIFA 1J70A 3I42A 1V9SA 1EVLA 5FL7D 2PUFA 4ZT6A 2WP8J 1W59A 4TYNA 2AD1A 1L5SA 2P9YA 1UDRA 3H6KA 4LZJA 3FIUA 4YS6A 2Q8QA 1PR9A 4TOIA 1SCQA 3ZLBA 4NQZA 2JFHA 2G6BA 4BMVA 3X1YA 4ZRDA 4BXOB 3BDAA 4WUTA 2GF0A 2Y0PA 5SY6A 1PSDA 4QYIB 3ZI7A 3FBWA 2G0AA 1Q0HA 2XY4A 4RSHA 5TT1A 3KQKA 3COJA 2F3PA 4JI0B 1HEIA 2Z1DA 4OUDA 3RS9A 4NZNA 3E1KA 2I2CA 4ETMA 4C0BA 1ZNYA 2B21A 2ZCUA 3VR5D 1QFYA 4OM7A 1ST3A 2AOXA 3TZ6A 4FB4A 4ZTZB 3I8OA 3TCKA 2YN0A 3ZK9A 2BT4A 1JMVA 1WXWA 3KOMA 3KYJB 4F60A 2E87A 1AGRA 1KF0A 1M1YE 3R2JA 4HFNA 4KPUB 4X1IA 3QM1A 1V3QE 1A95A 2GJ9A 3DT6A 4AY4A 5JYEA 2AOUA 2UYHA 2OYRA 5JS1A 1KY3A 5CT9A 3K70B 1NUQA 1DP4A 3BIWA 1BFKA 1ZH0A 2BCJQ 3K96A 1IVNA 2VPTA 2WEKA 3UMJA 4JFAA 1B42A 4CQLA 1WB9A 2FHPA 1N6IA 2GFQA 2FSSA 1RPAA 2NLOA 1HGXA 4B85A 2BMWA 1RZRD 1G3UA 1M3SA 3O5AA 5EGNA 3RIGA 3SZ3A 4EPRA 1J0EA 3CPHA 5H68A 3LKBA 4MRMA 3UN1A 2P75A 1WD7A 4A73A 2PEYA 1K98A 3LDAA 3FYHA 3L4SO 4MV8A 5CXUA 3MTJA 5KEIA 1DQSA 2PRSA 3PHLA 4PO3X 1Z5ZA 3JCZA 5I7UA 3D2CA 4X6UA 4EHKA 4D99A 2A9FA 3GRVA 4A27A 2FW8A 3VC1A 1E2GA 1JUDA 1P8JA 2GEDA 3MHPA 5HIIA 2FOIA 2AX4A 3GZTB 2VAMA 3CZ4A 4M88A 4MCAA 3T7IA 3VSDA 4RAQA 5BRJA 2TS1A 4YCNA 2BCGY 3JRNA 2RG1A 4MS1B 1HZZC 4L78A 3Q8XB 4C14A 4MVXA 2OV1A 1TJ3A 3C8HA 3A14A 2PO5A 4TROA 1NTOA 2VRBA 4Y98A 1T2DA 1Y3FE 1E7RA 3HJFA 3M81A 1BE8A 3TS1A 2C9MA 3LUDA 5GOZA 1LFAA 3TDKA 2O8FB 2NNWB 1NNUA 3WS7A 1E4EA 4QU0A 3G0BA 4F1WA 2RHWA 2LCIA 1HZZA 3HBLA 3NHFA 4OG2A 4QHYA 2IBMA 2O2JA 1XVLA 4F85A 1W25A 4K6CA 1ZRNA 5DHSA 1Q1AA 1LBTA 2WU3A 4H9GA 4KI0A 2C2XA 2WYHA 3BE4A 1JJFA 1KMHA 4M1SA 4OFWA 4CUKA 3UCXA 5CM9C 1HORA 4L50A 4C2UA 4OLAA 3WX0A 3OFSA 2OHHA 3NH6A 2VPWA 4XVUA 4X84A 3H8WA 3C4JA 1QGUB 2KBEA 3TFWA 5KQGA 1XMXA 2CN1A 1ITZA 2OM6A 2BTQA 3ILSA 4KGXA 4ZOLB 2JD2A 3G8CA 3RVJA 1PJRA 4H4EA 3VNAA 3ZVNA 2JJQA 3NANA 4MVJI 1BRMA 1FMLA 4PHTA 2MTBA 1XAJA 4XSVA 4M4SA 3R0QA 2OP0A 4KQ1A 3ZHXA 4EZEA 4RTQA 7ADHA 1CNMA 1CQZA 4EW6A 3CH4B 1BQ4A 4HUJA 5DM2A 3B20A 4LQCA 5IM4F 2FPPB 3COYA 2C3OA 2IZ0A 2VTBB 4D6YA 1A9TA 4YB8A 4Q4DA 4BMSA 2YBDA 4F97A 3G9UA 4PPYA 2DTXA 4NH4A 4AU1A 1GKUB 2B20A 2R48A 2QQ5A 2ZUBA 2CEKA 3O75A 3QEJA 2GMWA 1Q1NA 2QEQA 3EZYA 3HKBB 2C4KA 1CR1A 2BGNA 4DMHA 4TKVA 2YZ7A 3L7LA 4YLYA 5JZBA 3I4LA 3S2IA 2G82A 3PJEA 2P9JA 3KV1A 5HDBB 3QUQA 4NPCA 1XJ5A 1NRXA 1L7BA 2IFTA 5A4AA 3BUSA 4ZHQA 1J2YA 1DKNA 1GFZA 4HLUC 2HT1A 4R05A 1IWPB 1WCIA 3ZHRA 4KDRA 3NEPX 1HE4A 3UWKA 4L3WA 4N39A 2GCPA 2PT6A 3EW7A 4IO0A 1YHYA 4I8XA 5K0GA 1RYZA 4C29A 1N8TA 4LRUA 2AMFA 1WIWA 4M38A 3WY9A 3GLKA 2HT6A 1BKDR 2HMAA 1N7JA 2CCGA 4AW9A 5KMGA 3LUFA 1ESNA 2KW5A 4NTZA 4QGGA 4L3OA 5HZHA 3HDQA 2LDBA 9LDBA 5DM70 2DULA 2EZ9A 4RJ2A 3EEOA 2RAVA 5BQOA 4J49A 1CHNA 3LBHA 2DLCX 3ME5A 2QPLA 2WR8A 4YVFA 4CNBA 1Z5GA 1BG6A 2JKZA 1HY3A 1GXSA 2CV2A 2J3DA 3L49A 2QPTA 5HIMA 1OASA 1TJ4A 1RABA 3K0AB 4C04A 3HJUA 1QJCA 4CWAA 3VMMA 4E0BA 3N74A 5K0CA 3OQIA 2NV0A 3KUCA 3LDHA 3DOEA 5JJKA 3PENA 3M89A 1ZGJA 4D81A 5CB4B 4GUAA 1NN5A 1VBNA 2A94A 3V33A 4YJHB 1KE1A 3QE9Y 1OW3B 4LE2A 5A5FA 5M34A 4RH0A 1GUBA 1ND6A 2DHRA 1NVGA 3SYLA 5J4LA 2OCDA 2XNDD 3HXKA 5C32A 3KJIA 4IHJB 4BLWA 1Z2EA 1DXHA 3VR3D 2XBMA 2AUTA 3LK7A 4W5HA 3A1TA 5DYYA 4CL3A 4GGOA 4QFMA 3SHFA 5GIPE 2XZTA 2RKOA 1O54A 3DWGA 4UFOA 4K9OA 3RYHA 2I78A 4DFDA 3U1VA 4CBVA 5AI6A 2UUAB 2XNCA 5EMHA 5D00A 3MK31 4JBLA 2R6AA 3KLMX 3UJ3X 5KKAA 3CUUA 5KOHB 5EERA 1ZM4A 1ZX1A 1MZVA 1UMKA 4DM7A 3TGPA 2JLXA 1KU6A 3OWXA 2HJHA 2ODBA 2P1DA 4Z53A 3NPMA 4BRUA 2HH9A 2MSCB 4R3UC 3A1UA 1CUWA 1YQDA 4EB3A 2ZRHA 1BKYA 5EXEA 1A77A 5AUQA 1MT3A 1H94A 1KMMA 3QA3E 1L1FA 3OPYA 5CDHA 4CGZA 4LXHA 1CB7A 2WUVA 4PHCA 1QAMA 1FFXB 1ZD8A 4U2DA 5JXGA 5ESWA 4N12A 5A5DA 4KXFB 4I46A 1FU4A 1Q77A 4P4TA 3T7TA 1O95D 2W2TA 4CKXA 2C59A 3EPLA 3VZSA 1M1YB 2VXBA 4XIYA 3C3EA 3CX7A 4YRFA 1K4KA 2HMSA 4ME6A 1FJHA 1CLUA 1N2CA 3B6ZA 2IRWA 4WCFB 1KO5A 3WQHA 2EW2A 2ZJ3A 1TUBB 4D4HA 1EDEA 2BGUA 4ZVPA 1KP9A 3C15C 3KXIA 2B94A 1YBFA 4YWJA 2QR5A 5A62A 1G66A 3AJEA 3OJEA 3OF5A 5D3MA 1MC1A 3U80A 2ON6A 2M2IA 1ZL0A 3DEZA 1A7KA 3IDFA 1L7AA 4RKRA 3VR5H 2O2HA 3A1VA 1E99A 4IV8A 3E9CA 2W8ZA 2HQRA 1ZBDA 3GLUA 3IUBA 2YV4A 4F11A 1JHOA 1Z45A 3UFXB 1K4YA 1X70A 1H8ED 4WBNA 1BMDA 3Q2IA 1KDZA 3U49A 4LUCA 3TUJC 2QTRA 3VR2D 3IVXA 3EA5A 2EDCA 3MGCA 3EFOA 3LJKA 2BTEA 3G17A 3WMRA 1Y6ZA 1QPBA 2PVPA 1H2AS 2XQIA 3F7OA 3L8DA 5EFOA 4C4YA 4WNAB 9ABPA 4D45A 4K3UA 4BVFA 4O4HB 1AX9A 1JLLA 1LF0A 2ISSD 3WIDA 5TQ2A 4FFBA 1U0SY 2Z98A 2ZPAA 2O3SA 2GCIA 1R6VA 1VCHA 1EMDA 2ZWMA 4IHQA 4KNWA 3BE5A 4UAGA 3DB1A 5CFRA 3FTEA 3ETDA 2HLDD 1P3Y1 2YFYA 4HDOB 1LWOA 1W0KA 3F9CA 1PNVA 5TX7A 4JELA 1N3YA 3AY6A 3PQ8A 5GM2A 1VXOA 2GTIA 1TIPA 4LNUB 2B92A 4NATA 3HRIA 4IVNA 4RM3A 5CK4A 4YJHA 3ZGNA 1AB5A 5BWLA 4GR9A 2KJQA 5L3SB 3SJAA 2WLSA 4ZVOA 3FM9A 1QRAA 2HU5A 3C1TA 4S1VA 1H2FA 4XWOA 1U8EA 2A4MA 1I4LD 2XUFA 3DYIA 3LLSA 3QU4A 1UH5A 1WOMA 5AOBA 4HGNA 4PGMA 1WNFA 1WVIA 3HB0A 1H1LB 4FFPA 5DB4A 4M9CA 3DL4A 2R1TB 5LA6A 4BKPA 2ES4A 2ZK7A 5EINA 3HP7A 3LNTA 1XJCA 4XGIA 3QKTA 3LA6A 4FC7A 4D80A 4NI5A 3F0TA 5EQFA 2O1XA 3OJ0A 2Q49A 1VB5A 3M4YA 1OX5A 4JDUA 2IYWA 2LZ0A 3JYLA 2QL5A 4G65A 2D4AA 4ZHQF 4NZOA 2Q5HA 3M7IA 3E8SA 4ZOQI 1JEQA 2DY1A 1HT1E 1PLKA 4G1UC 1YK0A 2V3CC 3JPWA 1BQ3A 4O2AB 3EFOB 3EGCA 4IIYA 3TOZA 2BKEA 1NBOA 2X9NA 4EMUA 2H17A 1H2HA 3PEWA 1HLGA 4TWAA 3WLJA 2QPAA 3MTGA 4ACBA 3PWSA 4KO1S 3Q0TA 4K9NA 3VHLB 4B3JA 3K2BA 1MB4A 4ZHQB 4LF7B 2OEPA 3MWKA 1KETA 2H6EA 2N46A 3MWEA 3NDJA 2RB5A 5AK3A 4KIFA 2P30A 3N87A 4KPUA 4X1IB 3TD9A 1MEJA 4MZDA 4Q19A 6REQA 1BU5A 5G02A 5T3UA 2ZUTA 2ZIVB 4NU5A 5AI0A 1FPMA 4CEJA 4K88A 3SBXA 1B1CA 3G9XA 4O02B 2PUAA 2YDYA 1MOPA 3LP6A 1I1NA 4ARCA 2VK2A 4FGLA 1DOZA 2WMOB 3Q3HA 4BNFA 1DX9A 1GM5A 4LFBB 4FHGA 1NP3A 1FVHA 2A30A 4WCFC 1WLSA