5FLKA

Structure of haloalkane dehalogenase variant dhaa101
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
IGTGFPFDPHYVEVLGSRMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYRFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTPDVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary Analysis is a Powerful Complement to Energy Calculations Allowing Entropy-Driven Stabilization
rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords DHAA101
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5flkA00
1IZ7A 4EY5A 1LLFA 1J07A 4CI9A 5K3BA 3O95A 4O08A 5DWDA 1X2BA 1A88A 1Q0ZA 4RE5A 4XVCA 5FDFA 3IUQA 5FRDA 4UBLA 2AJ8A 4AO8A 3R0VA 2OCKA 4PV7A 1R9NA 3DL4A 3AFIA 2WFLB 1XZCA 1ZD2P 3AZPA 1EDEA 1CUVA 1JMYA 5LLSA 3C70A 3LCRA 2OLEA 3VJMA 4UHFA 2JEZA 3HC7A 4G9GA 3CN7A 1XLWA 5CT6A 1LPMA 1C7JA 3GFFA 4BCDA 2VT7A 5AICA 4KYVA 2R11A 2NW6A 1BN6A 2WKWA 5AKGA 1KU0A 2QM0A 4L72A 1XRQA 1YAHA 5CH5A 1YA8A 5AM2A 1K63A 3R3ZA 4B80A 3EQ9A 1QIJA 3VDXA 1GPNA 4KAFA 4F5ZA 1I6WA 4HVTA 4PSCA 1OXMA 2OCLA 2FJ0A 4WY8A 2IX9A 2C7BA 2AXEA 4G8CA 2HRRA 5CT9A 4Y2VA 1CQWA 1VA4A 4HRXA 3MGAA 4EHBA 2WHPB 5DJ5A 4NVRA 2VSQA 3RARA 5K3DA 5ALHA 4Y9SA 3H19A 2XUKA 4LIPD 3P2MA 3D7RA 2QVBA 2C0PA 5T4BA 5JALA 5JD4A 4QE3A 1MT3A 1XZAA 3H1AA 3O9VA 4X6XA 1PJAA 5JYCA 1MAHA 1ZI9A 2PPLA 1HLGA 2I03A 3WYNA 4QNNA 2XUOA 1SCQA 4BRSA 3FAKA 4J0CA 4BRZA 3I6ZA 3E3AA 2Z3WA 1HQDA 1ORVA 3H1BA 3BIWA 5ALMA 3OTQA 4UUQA 3C8HA 1UK8A 3C5WP 3NUZA 5AKIA 3IB3A 2RIPA 5CXXA 2ZJFA 1XRLA 3QMWA 1YS2X 1QIMA 5CXUA 4GBGA 5JIBA 1MO2A 3VKFA 5HQ3A 2HU5A 2VAXA 4M0EA 2OPHA 5AKHA 4DNFA 4KAJA 1CUWA 1BCSA 3QH4A 4OYYA 3RK4A 5D3KA 1OCEA 3MVEA 1YS1X 3SC2A 4QA9A 1JFRA 2PU7A 4HS9A 3WL5A 1BRTA 1DX4A 2YXPX 2DSNA 1Y7HA 1R88A 1CEXA 1UXOA 4ZWNA 2RHWA 1WB6A 3PICA 5AM3A 4B6GA 2ZSIA 1AZWA 5CW2A 1LZKA 2BUBA 5A71A 2RI6A 1LBSA 1JJFA 5AKKA 1W6RA 4WFKA 5ESRA 4HAIA 4DM7A 3RKSA 1QTRA 1GT6A 1C4XA 1MNQA 3W06A 1QO7A 4UHHA 2G5TA 3ESDA 1HPLA 3QITA 4FNMA 3BXPA 2FX5A 5HKBA 5I8PA 5JADA 2QUAA 1S8OA 1XQWA 1ZIYA 1ZD5A 3WKAA 5ALZA 3OM8A 3HI4A 2JBWA 4E15A 2BAGA 1DX6A 2C5FA 3QBJA 4UHCA 4TVKA 3IBTA 4B7ZA 3HZOA 5T4EA 4GLBA 5FV4A 1IVYA 2Y6VA 4S0XA 3RLIA 4X7BA 2OAEA 1XQVA 4CFSA 3D2AA 3I6YA 2WJ6A 1Z68A 1IUPA 4W9RA 3VVLA 4BDTA 2ZYRA 3H2GA 4K5QA 1XZGA 3KWJA 5ALWA 5HFNA 5EIAA 3FNBA 3LLCA 1VLQA 4BAUA 2CUTA 1J06A 2BKLA 2PU5A 1MNAA 3KD2A 3DYVA 3I2KA 3ESBA 1H2ZA 2XE4A 1ZGCA 3O4HA 1P0MA 3F98A 5AOBA 4BVKA 3G9XA 3QM1A 4AZ0A 3WJ1A 3WL6A 4EA6A 1SCKA 2XUHA 5CH8A 3DDUA 3FSGA 5DTIA 2XT0A 1A8UA 3WMRA 2B61A 3H17A 1J2EA 4PNZA 2ZYSA 1N5MA 3AZOA 3FYUA 2K2QB 2QT9A 1XZMA 1ZOIA 4KRYA 5HF6A 4H18A 1DWPA 4DLNA 1GPKA 3WKEA 3G0BA 3NGMA 3FVRA 1AMNA 4G4JA 4J0GA 5ALIA 2ES4A 5JD6A 2WQZA 1T4MA 4G1FA 2XMSA 4GWLA 1IMJA 4QLAA 4NMWA 1UOQA 4QWWA 1AGYA 4B9AA 4K6HA 2B20A 4UFOA 2OCIA 4OU4A 2O7VA 4KE9A 4G4IA 4F60A 5F4ZA 3UUEA 2QUBA 2XUQA 2JGIA 4AO7A 2V98A 5IVKA 2GYUA 4AN0A 5E4JA 5AO9A 1K6EA 2HA2A 2Y2VA 5HF9A 4U2FA 1VE6A 3WA7A 2WILA 3MUOA 4EUSA 3KXPA 3C6ZA 2X76A 3FOBA 3O9MA 3O4GA 5K3CA 2J3QA 3FLAA 3AIKA 1UKBA 3WK5A 3PE6A 4CG2A 3K2IA 3PI6A 4OD0A 2HU7A 2VJBA 3I2HA 2XUDA 2IITA 1LPSA 3DOHA 4B83A 4C89A 1HKHA 3PUIA 3V9AA 4TGLA 4LYDA 1W4LA 4JNCA 2HIHA 1EK1A 1WHSA 1EXWA 4MEBA 1UOOA 4GDMA 1A8QA 3G7NA 1YCDA 1ZJ4A 4FLMA 4HRYA 4U2CA 2WUDA 2XLBA 4K2AA 5E2IA 1SOMA 1HDEA 1MPXA 1IUOA 4YK7A 1QLWA 3I2JA 5ALQA 3WWOA 5AKEA 2X8BA 3I2FA 2WHRA 2PSDA 5SYNA 5AI9A 4KRXA 1VZ2A 3CCCA 4U2BA 4C01A 1VZ3A 1D07A 2Z8ZA 4LXHA 4I3FA 2R8BA 1QONA 1FSSA 4AMYA 5EHQA 5T4FA 3LS2A 5ALXA 2VATA 4RPCA 5AI8A 2RGUA 5CTAA 3SWWA 4JYMA 2G63A 4K6GA 3C87A 5ALGA 2ZJ6A 3DNMA 2XUJA 1WOMA 2J4CA 4UPDA 4G4GA 1F0PA 1QE3A 5YASA 2YASA 2BGRA 1EB8A 4Y2TA 2HM7A 3U0VA 4DSZA 3WK8A 2CEKA 2BGNA 4RGYA 4UFNA 5AKXA 4INZA 2HADA 1QTIA 2WU3A 4BATA 2J3DA 3K6KA 1X70A 2QXTA 1QGED 1XRMA 4IHAA 4UHEA 5D3ZA 2WUGA 4I19A 4LHEA 3R3WA 1E89A 5AOCA 2VEOA 3FSGD 1ZJ5A 4P93A 2H7YA 4XIIA 5ALDA 5I7UA 1BCRA 4DNQA 4GEGA 1QIEA 2V96A 3BDIA 1NU8A 2WIFA 4DTCA 4OCZA 1LPNA 3EF3A 1DQYA 4CCYB 3T4UA 4UBJA 3C45A 3F67A 4J0IA 1W75A 4XX1A 2GYWA 2VQ6A 4X3CA 2CBGA 3IUMA 3WKBA 1FFAA 3HYSA 4UFPA 1H2XA 2O2HA 4HTAA 3OOSA 1EX9A 3WL7A 2O7RA 4QDXA 5DTJA 5A6VA 1LPBB 4OYLA 4H7KA 2XMQA 1K5PA 1OILA 4HXGA 3WZMA 2WUEA 3JW8A 2PX6A 2WIGA 4OSEA 3QMVA 4B85A 5DNWA 2WG1A 4BCCA 3KWFA 3W05A 1O6FA 4E11A 4Q3LA 1H23A 1L7RA 5AM5A 2WUFA 4H7HA 4KE8A 5ALNA 5HQ3B 5A2GA 4FMPA 4TPKA 3S8YA 4OB6A 3EQ7A 2VTVA 3A2LA 4LKOA 1GGVA 3DS8A 4X97A 1MJ5A 1BU8A 4IH4A 3V1NA 5AHXA 4EY7A 3VVMA 1C7IA 4FBMA 2XUAA 2OQVA 1LGYA 4H77A 5JZSA 1ZIXA 3D2BA 3AIOA 1UK7A 4BDSA 1ZGBA 4FOLA 3G0GA 1XZDA 2P8SA 3FCYA 2YH2A 3QVMA 3BF7A 3V1KA 1AUOA 5AKZA 4MQMA 1CRLA 4XWGA 1UT6A 4W1SA 3F9CA 1JI3A 5AK6A 2ZVDA 2RHTA 4BP8A 1E3QA 5LP1A 4YX9A 3FYUC 2XUFA 1WB4A 1UWCA 4DIUA 5JANA 2PUJA 2VJAA 4W63A 4Y2PA 3WKDA 2E3JA 1MN6A 4LXGA 3H2HA 4G9EA 5FXMA 2WIDA 3SX4A 4ARBA 1R4ZA 1CUJA 1DINA 1BS9A 5AM4A 2G4LA 4QZVA 4HXFB 1YB6A 2FJPA 3WK9A 4LYEA 4N8SA 5DNUA 1LZLA 2C58A 2CB9A 5ALPA 3ICVA 2YYSA 3PDCA 2Y2UA 1W52X 2GBGA 4DSAA 1O6GA 2EDAA 5BV7A 5AK5A 2XQGA 3QYJA 3Q8WA 3A6ZA 4C4YA 1DTEA 4J7AA 1Q0RA 2RAUA 4FFVA 5IVHA 4EY6A 4CIBA 2Z8XA 2XLCA 3WK4A 1EDBA 1W1IA 4HXEB 5IVDA 2BCEA 3OG9A 1VXOA 1G4HA 3K9BA 3AIMA 4PSDA 4H7DA 4PW0A 2WJ3A 1N8SA 4KE7A 3IDAA 4UBKA 5ALTA 3TEJA 1UOPA 3FWHA 4KACA 1MU0A 4BVLA 5JARA 2DQZA 3PF9A 3NWOA 3EBLA 4FNGA 1YB7A 2HA0A 1Q83A 1N5RA 2HRQA 2PVSA 1B6GA 4Q34A 4C6HA 1YAJA 5AI4A 1CUAA 2QR5A 4B81A 5HK9A 1YA4A 2B4KA 2CKMA 4FBLA 3TRDA 3G8YA 4BAGA 5AH0A 3C43A 1GPLA 2VJCA 2WIJA 1AC5A 3B5EA 4WFIA 2JGFA 5SYMA 4Q3OA 3STUA 3O4IA 4WJLA 1Y37A 3KDAA 5C8XA 1R3DA 1AKNA 1MTZA 4BYMA 4MWSA 5CMLA 2UZ0A 4H7JA 3WK6A 3STTA 3O4JA 2GZSA 1R9MA 4CIAA 4MEAA 1SC9A 1JU4A 4K6KA 5A7FA 3WWDA 1ORWA 3GA7A 3G9TA 1QIFA 1VXRA 2GBCA 1DT3A 3OC0A 4Y2RA 3FLBA 4AO6A 2J4FA 4Y2XA 1L7QA 1WB5A 4B82A 5K3FA 5KBYA 4FHZA 4ZI5A 1SCIA 4QDZA 1JJIA 2QOEA 3UUFA 3KSRA 4J0DA 2VJDA 2ZJ7A 3R3XA 3WWPA 4EB0A 1GZ7A 2PKYX 4WCVA 5AP9A 3D3NA 2ACKA 1XKTA 3V48A 1RP1A 1XZIA 3G9ZA 5JAOA 4BZZA 3DQZA 1QFSA 4H7EA 4WY5A 2BJHA 2WG2A 2XUIA 4Y2QA 1GQRA 1CUUA 4ZREA 1G42A 4Y2YA 1VA5A 1CUEA 1EH5A 2ACEA 1XZJA 4ITVA 5IKXA 5E4YA 3ZLUA 2WJ4A 5BWBA 1KU6A 2VF2A 2HA6A 1RWQA 3LIIA 4BE4A 4BCBA 3ED1A 1TRHA 2WU4A 4JH0A 5JAHA 4FTWA 1PFQA 4P92A 4PSUA 5FOQA 1Y7IA 1FJ2A 2PSJA 1E5TA 4PQEA 4DMFA 2ZSHA 3DYIA 2XQJA 4N8DA 5AOAA 2JGEA 2OGTA 1VE7A 5K3AA 4F0JA 3AZQA 4H7IA 4KEAA 3TJMA 5CT8A 3PFCA 1PV1A 2BFNA 2JGJA 2XB6A 5LIPA 1CLEA 5HK8A 1BROA 3DCNA 1XZBA 1CPYA 3WQHA 1JT2A 3LIPA 4JEIA 1G5FA 4X95A 4ROTA 2OAGA 1CVLA 1QO9A 5KWIA 5AIAA 1TCBA 3M83A 1VKHA 4U2GA 2LIPA 4H0CA 4Q1VA 3L1HA 2H9YA 5AM1A 1YSCA 1QIKA 4J0KA 3FBWA 4FLFA 4UBIA 1ODTC 5ALVA 2HFJA 1R50A 3A70A 3VISA 1U65A 4EY4A 1CUGA 2XMRA 2AJBA 5EIHA 1YASA 2XQFA 4QDUA 3G02A 4BC1A 3R40A 2XMCA 4BTVA 2XMGA 3FLEA 1HBJA 3FYTA 5A7HA 1ACJA 3STXA 4B0PA 2QRUA 4GECA 1E8DA 3BIXA 3WYDA 1CUHA 3IULA 2D0DA 1EI9A 5D7BA 5I9IA 1BE0A 3Q0TA 5IVIA 4BVJA 5EI5A 2JIDA 1JJBA 3F8SA 5AKYA 1FFBA 1DWQA 3D5EA 3RM3A 3DD5A 5H3HA 3WZLA 3ILSA 4B84A 4JYPA 4L3WA 2GZRA 1THGA 4UBOA 4J03A 4AB1A 3H2KA 5ISMA 3ANTA 3ZV7A 3KOOA 3CCBA 4AQDA 4BC0A 4CCYA 4A16A 1XZFA 2BUCA 3WIOA 4MYSA 2WM2A 4NZZA 1DU4A 1ACLA 2O2IA 4D9JA 4KE6A 2OGZA 4OB8A 2W22A 5FUMA 3H18A 1P0QA 4NS4A 2H7CA 3NOXA 1VJ5A 3O0DA 4BAZA 1M33A 4DGQA 4WDQA 5LZ4A 1AQLA 2XUGA 4ARAA 4B9EA 2C0QA 4Y2JA 4AMZA 2OG1A 1X2EA 4ETWA 1XLUA 3E4DA 5DLPA 4P9NA 3I1IA 1CUCA 2OCGA 1KEZA 3STVA 2I78A 3V1LA 3M3DA 4KR0A 4Q05A 3H04A 3W2TA 7YASA 3IVMA 2AJCA 2X5XA 1XKLA 2G5PA 2HL6A 3HSSA 4U2EA 3GUUA 1FFEA 1TK3A 3DL7A 4QDTA 5FPPA 2QS9A 4XJVA 2QTBA 5LZ8A 1W76A 1HL7A 1P0IA 4CG3A 3JWEA 2H1IA 5DYTA 5EIEA 5LZ5A 2HDWA 3C6BA 5HF5A 1H22A 1H2WA 3VJKA 1TIBA 5JATA 4Q82A 1MX9A 3H2IA 2WTNA 4X85A 4B0OA 4Y2UA 5EFZA 5EGNA 3DKRA 1QFMA 4A23A 4KJXA 4L9AA 3PF8A 4EZIA 1UKCA 1EA5A 1USWA 2CJPA 1EHYA 3BL8A 1AX9A 1UFOA 1WHTA 2DHCA 2DHEA 3EIOA 5AK3A 5AI6A 4CCWA 5ALJA 3D2CA 5ALKA 2WFMA 2W6CX 3ANSA 5JZBA 3I1YA 1K4YA 3STWA 2I3ZA 2WIKA 4X71A 4L0CA 5KWJA 4U2DA 3BDVA 3F96A 3HABA 4ZXFA 4C4ZA 3D0KA 5C7YA 1CFJA 3HJUA 5AKLA 2DCMA 2WLSA 5EHZA 3WIBA 1ZI6A 4X91A 1XRNA 1UK9A 3IUNA 1GKKA 1B41A 3L1IA 4LXIA 2EDCA 2RONA 3GELA 4C4XA 1U8EA 2QKYA 2XMBA 3D59A 3ICWA 1CUYA 5FLKA 2ROQA 1UKAA 5DNVA 3QPDA 3VJLA 4QDOA 1LPPA 1E8MA 4MJ3A 4GW3A 3ZLVA 1XFDA 4N5IX 2WG0A 2ORYA 4OUKX 5BWCA 1XRPA 4BTLA 1ZI8A 3I2GA 1QIIA 2XQIA 1DT5A 5E4TA 4OPMA 1F8UA 5JD5A 2B9VA 1XRRA 3S2ZA 5ALRA 2ONCA 2WHQA 4P08A 3WK7A 3IIIA 2V9ZA 4AXBA 4J0JA 1WPRA 1XLVA 6YASA 3C6YA 3G0IA 4OU5A 5FKJA 5KREA 3DJYA 5HZGA 3AINA 3G9UA 3QPCA 1SFRA 1F0NA 2GYVA 4CG1A 1U2EA 3EQ8A 4QWMA 2XDWA 3OPMA 3C5VA 1EDDA 3U1TA 4DMHA 1R1DA 5C81A 4G8BA 1DWOA 3HLKA 2WTMA 2QJWA 4MWTA 3WLAA 1ISPA 2C5GA 5AI0A 1BEEA 3DOIA 4PO3X 2V97A 2WHPA 1Q84A 2GBIA 3UMJA 4FFWA 4FWBA 1LPAB 1CUXA 3I28A 4E46A 3B12A 1ODCA 4WDRA 4X94A 5LYYA 1CUFA 3QZUA 4IO0A 3G0CA 2HU8A 5JZ9A 3F97A 3BJMA 4KAAA 4FDMA 1E8NA 5K3FB 5LKAA 4X90A 1RYYA 1CUZA 1K8QA 2PM8A 2OGSA 1ETHA 4UBNA 5ALOA 2JGLA 2AJDA 5FP0A 1J1IA 2HA3A 1CUIA 2XMDA 4W1PA 4FKBA 4HZGA 4N8EA 1ODSA 3TGLA 1ZICA 4PF1A 4QEKA 4X6UA 1TQHA 4MXDA 3STYA 4IQ4A 3A2NA 5C8ZA 2O2GA 3WI7A 5LZ7A 3DKKA 1TAHA 4C88A 4X6YA 4WFJA 1IUNA 4GHWA 3LP5A 1CIJA 4V2IA 5CURA 1H2YA 1EINA 3BF8A 4RNCA 3W9BA 1GKLA 5T4HA 2CMFA 4IH1A 2DHDA 3V1MA 3GBSA 1E66A 4UBMA 5A7GA 5ALFA 4ZV9A 4W1QA 1N1MA 4UHDA 4ZV7A 3MUNA 1A8SA 2ECFA 3H2JA 2H7XA 3IA2A 5D6OA 1UZAA 1IZ8A 2OQIA 4G8DA 3JYHA 4BZWA 3R3YA 2HA7A 1XQXA 3DEAA 3PUHA 1XZEA 3WJ2A 2CZQA 3A2MA 5DYYA 5JAUA 1T2NA 5HCUA 3YASA 1GXSA 1LPOA 3BWXA 4GI1A 3N0TA 4OB7A 1TKRA 3W9UA 1AURA 4BBZA 5FPQA 3I2IA 4J3JA 4DYHA 5A62A 4DNOA 4X93A 4J0HA 3C6XA 5IH7A 3T52A 2JGMA 2HA5A 1MX5A 2AJLI 1ZD3A 2JEYA 3AILA 2VT6A 2JGKA 3E1GA 1FFCA 5CH3A 1XZHA 2XUPA 2QZPA 3WWEA 2PBLA 1QIDA 2DQYA 5LZ9A 2PSFA 1EVQA 5HKAA 3I6MA 1XZLA 3ESAA 3R3UA 5K3EA 2Y1KA 3QMMA 4H7FA 2QXUA 4Z49A 2VAVA 3WKCA 3HEAA 1GQSA 1P0PA 3DLTA 1WCYA 4N5HX 1XROA 4YPVA 5LKRA 5AIBA 2WFLA 2PL5A 5ALSA 4ZRDA 4FLEA 4RE6A 5CT4A 5AJHA 3ZI7A 5CBKA 1CUBA 4Y2SA 2PSEA 1CV2A 2PSHA 4JUIA 4BP9A 1A7UA 4M0MA 4AX4A 4AN1A 5LZ2A 4Q3KA 1XQYA 4EBBA 3BE8A 3L1JA 3FCXA 2HA4A 5ALUA 4F21A 5CT5A 1EK2A 5AI5A 1LNSA 2EEPA 1TCCA 2DR0A 5AK4A 3CXUA 3FVTA 4BB0A 5C8VA 4E14A 2VA9A 4MYDA 3M82A 5HF8A 1CUDA 1YR2A 1WPXA 1QJ4A 3BJRA 3FYUB 3N2ZB 4BE9A 3GZJA 5EHNA 2XI4A 3G0DA 5CRIA 5BOVA 2FUKA 1BN7A 1XZKA 4ZGBA 5EHXA 5ALYA 1NU6A 1NX9A 1TCAA 5AM0A 4X00A 4C87A 5JASA 3ZPXA 1QZ3A 3E0XA 4QLOA 4DMCA 2ZYIA 1WM1A 3C8DA 2D5LA 2PUHA 3OURA 1JMKC 2BUAA 2WSLA 2Z3ZA 2QJRA 2WFZA 3CN9A 4YASA 4I4CA 1JU3A 1CR6A 1THTA 2QMQA 5J3JA 1BEZA 4DMKA 1MX1A 3H0CA 2ZYHA 5ALLA 1DQZA 1CQZA 1VOTA 4W1RA 1FFDA 5DYWA 3WA6A 4IH9A 4DNPA 4G5XA 4EY8A 2XMZA 3SK0A 3D4LA 4Y7DA 2I3DA 3R41A 2XQKA 1QOZA 4H35A 1UK6A 2DFPA 3W04A 3X3HA 5K5EA 3AJAA 3ESCA 4AZ3A 3VXKA 3IURA 4X92A 3R3VA 3HRHA 3AUKA 1EVEA 1JKMA 4MQLA 3WL8A 3ZWQA 2JF0A 2Q0XA 5HFAA 1QIGA 1QIHA 1L7AA 3WWCA 5ALEA 2HHAA 3HACA 2C4HA 3B3QA 2GBFA 4UHBA 3QPAA 2HFKA 3HXKA 5JAPA 1U4NA 1G66A 3IUJA 1F6WA 4M0FA 4A5SA 3GROA 3PFBA 4GXNA 3M81A 2OXEA 2Y6UA 2IIVA 3ZLTA 1ZD4A 1MAAA 1CUSA 1EB9A 5AKJA 1LBTA 2Z5GA
chains in the Genus database with same CATH superfamily
2A9KA 5KYYB 1X87A 1W44A 1LLFA 1C3OA 1QK5A 3KQKA 4CI9A 3QF4B 3CH7A 2ENWA 3U40A 1Z0KA 4OREX 3E3NA 2FPGB 4M9ZA 4KK4A 4FN4A 3FZQA 1X2BA 3A1FA 1NUTA 3JD1A 2UYGA 4JVNA 3VM6A 2P40A 3JALB 2Q27A 3ENQA 3T5PA 1UJ2A 3EQ2A 3LW8A 4L3VA 1Q0LA 3NHZA 4ASUD 3OD5A 1TMOA 4PLPA 3VI4B 3HPRA 1I4LD 4DAEA 4PPGA 3R0VA 4NZMA 4CM8B 2XBLA 2ZXUA 3ZBPA 2GK3A 2Z3VA 4CEIA 1P1KA 4PV7A 2AN1A 4ZT4A 1OB5A 5AJUA 4US0R 4ALIA 2IGBA 1E3TA 5KJEA 1R5BA 4EH1A 1IN6A 3ZWMA 1XZCA 3GH3A 4AY4A 1ZSVA 4YS6A 2QWXA 3WBBA 4OQPA 2Q6VA 4A82A 3ZIDA 3JZFA 4ZEVA 1FS4A 1RYHA 3LA8A 1CF4A 1UODA 3U80A 4R9UC 3VJMA 3QKTA 3VU0A 4DLBA 2C5SA 3LBNA 2YXBA 3QNWA 3FPLA 4II7A 1EG7A 2PE5A 2ZJ4A 1HDOA 3CN7A 3RBZA 2J3JA 4YAEA 1SXJE 2E85A 3CEPB 2A59A 3GJRA 4KZKA 5CT6A 3VZSA 3PUXA 1JWAB 5K0GA 3IOCA 2QTRA 1YVUA 4RFSA 1CQPA 5A9SA 3ND6A 5C1DA 3ZR4B 4KYUA 3M4YA 3C1TA 3AO0B 2Q1YA 3IEKA 3BOSA 3V8RA 2F8TA 3MCTA 1EESA 2NUAB 2QSZA 2JLZA 2VDRB 3SXPA 1NNUA 3WLQA 5IXJA 3N70A 1TFRA 5KTTA 1RYBA 4HAXA 4K6OA 1KU0A 1C9KA 2R62A 1E2LA 4II3A 3THYA 1XRQA 2OCAA 1JPUA 1QE5A 2C42A 2YFHA 2ZUBA 3BSWA 3GIWA 3GLSA 3KUXA 2ISCA 1YA8A 4XJXA 1UWVA 1NW7A 2HT6A 1O2DA 2WJWA 4IGIA 4KLAA 1Q16A 4X1KA 2BGUA 2W5UA 3EQ9A 4E22A 4RHUA 4ND1A 2ZUDA 2FI1A 1OTYA 5LFAA 1N75A 1Q1AA 3GNQA 4BFTA 4JSYA 1I6WA 3FUUA 4Z3KA 3M4JA 1UXGA 1V43A 3L6OO 4PSCA 2OVFA 2JBAA 2FJ0A 1UFRA 3TVDA 4WY8A 1FU8A 2UZIR 5LQUA 1NVWQ 1IPHA 1VG9B 3BZUA 4FEEA 3TTUA 3UAWA 1WETA 3S2SA 2HRRA 1F2TB 3NU1A 4X64B 2ZRCA 1P45A 2QMUA 3HRIA 3L40A 3SNKA 5BMOA 5LQMA 2WE7A 3TRKA 1SEPA 3D4PA 1P7CA 3PC7A 5AWFC 3W78A 4FE7A 5KTKA 5LP6A 1G2QA 2LCQA 1N6IA 3M49A 3AP3A 4QYWA 3C3KA 5DJ5A 1M5RA 1PZFA 2CVFA 2WJAA 4UMFA 3THRA 1NBIA 2FUG1 1SKYE 2QIOA 5BURA 4V3CA 1IN5A 1UWLA 3IOYA 1BMQA 1B42A 1IM8A 1KIFA 2H54A 3FUWA 4TMYA 5C1IA 2WD9A 5A0VA 2Q5HA 4DC1A 3HYTA 2DTEA 1RKBA 4Y9SA 3UIEA 1HT0A 4EX6A 3PR2B 1MO4A 3RUEA 1EK6A 2NTYC 3TH5A 1RAHA 2ETXA 2X5JO 4IDGA 1DWUA 2BL4A 3GGSA 3NIWA 1ZIDA 4E6EA 5JALA 4R84A 4KX5A 1XQ6A 4TTSA 1EK0A 4M60A 1XZAA 3DCIA 3DVSX 5EYPB 4JNKA 1QM5A 1BJRE 3LHIA 4PVDA 1B4DA 2QD3A 3ZOZA 2BEJA 2H7VA 4LI0A 2VYNA 1SM4A 4IIVA 3MJTA 3HXOA 2WT9A 5MGNA 5DI3B 2I03A 3FNQA 4IIFA 3BAZA 1PQWA 3WYNA 2L69A 2XUOA 4M9CA 1DG9A 4RZQA 4B31A 1J5EB 3ABRB 1TYAE 2AOWA 4XB2A 2QRNA 5B3KA 3HY3A 4JA0A 5BW4A 3V7UA 4ZDKA 4B7AA 3UCEA 3OPXA 1E0JA 1UBKS 3CRRA 4JJ8A 4BRSA 1JHZA 3HL0A 5GPBA 2QN6A 1AM4D 2NPOA 1R7RA 2ZYDA 4A03A 3GLIE 1KZ4A 4YC7A 1HQDA 3WNBA 4RVFA 3H1BA 3A9WA 3BIWA 5NLLA 5KQGA 1MABA 1N0UA 1JA9A 2UV8A 4RTSA 1LTQA 3K09A 4HUQA 4AJOA 1S3SA 1K4MA 3DO6A 4GWGA 3GP3A 2V9CA 3DULA 3U2QA 4BB9A 1VCMA 4FX5A 1RPAA 3C5WP 3OZIA 1TQ4A 3EEFA 3ZK8A 2V5UA 4BPBA 4QGGA 4FYPA 2CJXA 1NNSA 3PVCA 4LBZA 1R3UA 3RVMA 2BMVA 3ZCTA 3PCXA 2P2NA 1FJXA 1RZUA 3FMVA 3OJEA 4HH3C 4JB2A 4O4JF 1HTTA 3PFHA 3NBUA 4FI3F 1MMFB 1FVHA 4H1WA 3DZDA 2XZLA 1R0LA 3DZCA 3QMWA 2RGNC 4CL2A 3J7TA 1QIMA 5FTMA 2VDWB 4KDFA 3K2BA 4IIJB 5CXUA 4RSRA 3QXGA 4PGMA 1NP7A 1S5PA 4Y6RA 2VF8A 1XWIA 2ID8A 4N5MA 3RVKA 2Q7XA 2HBYA 2W2KA 3G2PA 2CMKA 3I8OA 1ST3A 3UV7A 3WGNA 1KI8A 4P31A 3V46A 1CUWA 3LUAA 3NTVA 5C8YF 4OYYA 2IHVA 4A1FA 1GN8A 1LK5A 3PC4A 5D3KA 3U62A 2FFAA 2XZTA 3P0IA 2ZBFA 1SB8A 4ENRA 2YR0A 3L79A 1G9SA 1I32A 2PSSA 3L9WA 4B4WA 2GPAA 1V9CA 4I08A 3FHLA 2BT4A 1UPCA 4QA9A 1JFRA 2PU7A 1UR5A 3L02A 2I7CA 4GI2A 2LCIA 2X14A 1D9XA 5LA6F 4RHXA 1IXSB 1TM7E 1DX4A 1KJ8A 2DSNA 1FA9A 3VZCA 1R88A 2X5NA 3NHLA 1KOFA 4ROSA 1FX0A 2VSOA 3U3RA 1EXVA 4BEBA 2IY8A 1XF9A 5KPDA 3EVDA 4BUCA 1D2EA 3PICA 5CJPA 3WIEA 4U7GA 4F3TA 3COWA 2YWRA 3HGMA 3LD9A 4H60A 3VC2A 5EZYB 2ZSIA 4ICIA 1OLOA 3BHIA 1Z0IA 2HIMA 1LZKA 1TQ6A 4P4TA 4QASA 1S8FA 2ZJYA 3VV2A 1JJFA 5AKKA 3OT5A 5DM4A 2C99A 5GVRA 3VU3A 3JZDA 1DUVG 3EVNA 4LQCA 1FSFA 4P8RA 4GVXA 3TTSA 4TKLA 5EG5A 4UOQA 3BMOB 3OC6A 3OSUA 5AVXA 3C5CA 2JJYA 1PR4A 3NHBA 4YGYA 4OSOA 2GFHA 4URYR 4AMUA 2G5TA 3QLTA 3ESDA 1M2FA 4RMNA 4TWJA 4P33A 3NIBA 2ZSAA 3O7MA 3PPVA 5CFPA 4W5NA 3S2GA 4ZEMA 1GL6A 1LNQA 2AOTA 2VUSA 3CUVA 2FX5A 1KPIA 2J0UA 2W2VA 3DZ8A 4DIDA 3ZTWA 3N76A 3FGZA 4FOOA 1BOOA 3QMPA 4ZI7F 1DOHA 4J16A 3N07A 5B3LA 3RQIA 4KPEC 5EXDA 4GX0A 5D7NA 2XB4A 1I4OA 3MJRA 3CG4A 2VZ8A 3ZVLA 5I7EA 3IMFA 1I1NA 3I6QA 1OXVA 2HK9A 2VJQA 4ISCA 3HN6A 4B3MB 1NLFA 1L8AA 4FBGA 3ER9A 2FSGA 4BLRA 3EXHA 3EUFA 3QWBA 3QBJA 4UHCA 2XGOA 5A06A 1QQAA 3BA1A 2Q4DA 5GMOA 4LC1A 3V3TA 3LY9A 4GU5A 4IOJA 2QN1A 3ENKA 3R5HA 3GLGE 4BNVA 1NE7A 3HZOA 3QIVA 1WULS 1EFHA 2X0NA 3KPVA 1P1FA 1R8JA 1VYVA 3P9XA 2QN2A 3AJ9A 5IZCA 4ZQCB 2HNKA 4BFCA 1IVYA 1FMLA 1YJXA 2Y6VA 2A0UA 3THYB 3HVJA 2IPOA 1XV5A 3D2AA 2ZS7A 1R6TA 3M0EA 5F2OA 3TBKA 1VRVA 4KOEC 3UAGA 1RZRA 1Z68A 4XGRA 5DX1A 5JQGB 4OQYA 4GIBA 5IEJA 5KNBH 3TW8A 4O4LA 3G79A 1ECGA 3G5AA 3PJDA 4KR9A 3IXLA 1P9NA 1VB5A 1JSLA 2PXCA 1GFIA 3UAOA 3LOUA 2VJMA 3T1YB 3VR2D 4WHMA 2NLOA 1VSBA 5C31A 5G1OA 2AF4C 1BQEA 5HFNA 1DXQA 4TYMA 4CM5A 1D4AA 1XTRA 3EZLA 4G5RA 1B2LA 1DC3A 1H2FA 2ZAOA 1Z37A 4XPIB 3FMOB 5EIAA 5K3SA 4I55A 3O75A 3ZUGA 1YE8A 3A9CA 4GNKA 3ZWOA 1DKUA 1SGWA 2Y4NA 4D3SA 3PX2A 5IDQA 4R81A 1PZNA 2QPAA 1WE2A 2YXLA 3DFIA 1DRWA 1NUSA 4RKYA 4YJKA 1SVUA 1Z5PA 1G8MA 1W5AA 3VC7A 3IP1A 5KJ1A 2J0EA 5ICGA 2H52A 1URPA 4MQ4A 2DM6A 5JHHB 3SJZA 4UREA 3DYVA 3I2KA 3R77A 1G0OA 1XSEA 3ZWAA 2WM3A 3ESBA 1H2ZA 2RBEA 4X9XA 3VH1A 1ZGCA 1J7JA 2QTWB 3O4HA 3QSGA 1P0MA 3F98A 4IEFB 2Q3BA 5KS2A 3P9CA 2ZS8A 2GD1O 4IVPA 4O25A 1ELOA 3ZWBA 1W0CA 2VYND 1J1ZA 2FEPA 2OKGA 2FW9A 4GZLA 3ENZA 3M5WA 1WUTA 1TA9A 3VDNB 3F6CA 1Q7RA 3W7AA 3DEJA 4ARZB 5BT9A 2VUUA 3CO5A 1YOVA 1TCVA 1I33A 1SU4A 3WL6A 2WKRA 2P6PA 3CLKA 1KIMA 2EZUA 1E7SA 5E6SA 4E3ZA 4X45A 1T5OA 4Z54A 1QYCA 3BGSA 1MFPA 1E18A 3O3MB 1WDMA 2OO7A 1C30A 3H11A 4BIIA 2BZ0A 4TSRA 1V1MA 4YMGA 1H4VB 2PLFA 4ML3A 5ER9A 4XH9B 1J2EA 2JFPA 4LRXA 4ESOA 4AROA 1QHFA 4JAVC 4PNZA 8ADHA 1DV2A 1IONA 4F6LA 4GQBA 3ZJUA 3E6AA 1YZLA 3FKJA 4B8ZA 2R7AA 3B5JA 3KSZO 4BFUA 2QAJA 5HQTA 2YQ4A 4ZZ2A 3WNQA 1C14A 3CTMA 3HXLA 2XRYA 3O1HB 2VP6A 4EJSA 1KHHA 1XZMA 1Z73A 2FWIA 5AJYA 2IP4A 2JAUA 4C7KA 3VV3A 1G1MA 2NYUA 4OJQA 4LWQA 5HF6A 1IATA 4QJ4A 5FLEX 4MHOA 4EKIA 2GILA 3G17A 3QELB 3H99A 1GPKA 4AICA 3ZDBA 1N3YA 2IYNA 5LDHA 4J0FA 5E8RA 2O23A 1LX6A 2CUZA 1ZOLA 1K3UB 1WZNA 5CA1B 2PBRA 1B74A 1XDUA 1JQEA 2ZRGA 3HDVA 4N3BA 1AMNA 2J59A 4KIFA 4J1NA 4J0GA 2VHZA 3SYMA 1XTQA 2GVNA 2RK6A 3BMOA 2B7LA 3M5PA 5JD6A 2L17A 2WQZA 4URZR 5J4KA 3W5BA 2K7FA 2QORA 3R4CA 3ZCQA 2Z58A 2ZWAA 1QP4A 2OUKA 2Q2OA 3JVDA 3F74A 5IF3A 1W1WA 5MHTA 3N87A 1UOQA 1PT6A 3UGKA 4IFEA 3JY6A 4CEJB 1UFVA 3F5DA 4S1VA 1R00A 4UFOA 2PL3A 2OCIA 1QR2A 3S44A 1EX1A 1FDTA 3GZNB 1XAGA 1Z2CA 1G20B 3WBFA 2W4IA 2IV2X 1PN3A 4XGKA 2R8ZA 3EDMA 1NSFA 2FWMX 5CLIA 3ZHUA 4RXUA 4BOYA 4ECEA 1VPDA 4FFPA 1TMKA 1OI3A 3P0EA 4HN2A 4HEA6 4M1SA 3WGHA 5M7EA 4WN3A 1GL9B 4RW0A 5F64A 4DIFA 5AVTA 2J0VA 3AY6A 5JYEA 2EKZA 4MKFA 4IVQA 1TK9A 1NC1A 5L3RA 2A7QA 2V74B 4MVWA 3TZHA 3Q98A 5FPTA 5AO9A 2NT3A 1E9VA 4OHPA 3IJRA 3T41A 1R4MA 2NSDA 3B2NA 3L8MA 4KZPA 3TLZA 5L4SA 2RI0A 2ZYAA 3OQNA 2IBSA 1WZIA 2FUNB 2JCVA 2DY0A 1U1FA 1PFKA 1Y8QB 4U2FA 5HF9A 1T9DA 1Y7TA 2J5RA 3TNYA 4F9FA 3UYLA 4B40A 4MIYA 1RVDA 1PJ2A 3VPHA 1T3GA 1RWBA 1DC6A 2ZAIA 3KXPA 3LAWA 1NBAA 3EG5A 4XVQA 1ZMOA 2X76A 3FOBA 3R3JA 1GVHA 1ZNYA 1GTL1 4ZRMA 1V8ZA 5DKFA 2C04A 3O4GA 4JOSA 4CM1A 4DIKA 5CA0B 2JI6A 2X0DA 4KR6A 1K92A 2BLLA 1B43A 2FW7A 2P9GA 1AVTA 3GJ3A 4QGFA 1XD2B 3W1EA 2FXIA 2EL9A 3WK5A 2NO6A 3ZGYA 1JR4A 1PYOA 2H4YA 4RXTA 4UAJA 4CG2A 5K0BA 2JH8A 2H4JA 3JPWA 2OOSA 1K98A 1IBKB 1A9ZA 3T3MB 2VZLA 2QMYA 1YNOA 1Q50A 5H3CA 2ZB7A 2X3FA 1O6ZA 2G1JA 3CBGA 2XUDA 4CM9D 1H9AA 3FDFA 2HXSA 2YQ5A 3BWBA 1PNTA 3N8DA 3NH9A 4IP0A 5EJ8A 1T9CA 1YZVA 1YZUA 4OYRA 4W5WA 1FW6A 1TECE 3K2QA 3O26A 4K3UA 4NYJR 3UK7A 3TF5A 2X7HA 5I47A 2A6PA 2WM8A 1KAGA 1QZXA 5BPHA 4Z4QA 1FJGB 3ECAA 4KPUA 1S7CA 2HIHA 1G2PA 1WSAA 3BN3A 5DHPA 4ZMSA 5JR3A 4RD3A 1FTNA 1RCTE 2BEKA 2KQUA 1E69A 3DZBA 3ZY2A 1FXWF 3L07A 1DLIA 1NJ8A 1SBNE 3V8QA 5I7VA 2DP4E 1YCDA 4FLMA 4MO9A 3NHKA 5LA6B 3BGWA 3TL6A 4GR5A 1YRWA 3OX2A 3HCFA 4HPXB 1EFDN 1AA6A 3B5IA 4WT7A 3DJFA 1O87A 3MIZA 4BNTA 3RNLA 2PRKA 1MPXA 1IUOA 2WWXA 3OSZA 4NATA 1QLWA 5CIWA 3ZYZA 3C3MA 4FFSA 4QUGA 2QT0A 4HB0A 1XL1A 4GPAA 3PXDA 4EPWA 5A6SB 5JC8A 4JP3A 1X0VA 1W1UA 2VJMB 4QPPA 2FNAA 3H5TA 5B5SA 1FCJA 2WHRA 3A4VA 3NWEA 4ER7A 5C2JB 2PSDA 4ZOQI 3E9DA 1D2CA 4EX7A 1E1YA 1RYMA 4OUDB 1RQNA 2NYRA 5L45A 4BNNA 2X42A 4U2BA 4C01A 1Y1LA 1CY0A 1GTZA 1I4DD 1VZ3A 2C1XA 4OHVA 4IIJF 4P4SB 4DQVA 3KYCA 4BJ1A 1IWOA 2VYQA 3NOVA 2EYQA 4QGAA 3UATA 1AKVA 3BRSA 3FFBA 4HFMA 3RWMB 4QUAA 2R8BA 1OU4A 1UZUA 4O33A 1E7WA 1ZCAA 2EFYA 1QZTA 1T9ZA 1PQYA 5EHQA 1TPYA 4F1JA 3QPWA 3OF2A 3BH0A 1YGPA 1VMKA 4UXHA 5FL7A 3ZHYA 2JLYA 2DUMA 2FZWA 4LRYA 5BSUA 4K8RB 1EIZA 5EE0A 4YUYA 3AM4A 4ZCQA 5A9RA 1Z8NA 5HZMA 4B3CA 5IULC 2Y0BA 5CTAA 3SWWA 2PZBA 4S1NA 1ADJA 1Y98A 4LY0A 4RL6A 2GRAA 3N1UA 1RKXA 1XMJA 3C87A 4BLQA 2VA8A 3KB8A 2ZJ6A 4H1HA 1DJLA 1HEIA 3ER6A 2DUWA 1PFYA 3L1KA 4C3ZA 1X1SA 4FYYA 2QBYB 3MF4A 4KXQA 2J4CA 1JHMA 2XA9A 1KYQA 4QELA 2XVAA 4I2VA 1SBYA 2BFMA 3A6FA 5FCDA 2FMKA 3EDYA 4C29A 2AYXA 2QP4A 4JQCA 4AJLA 2X3YA 1CWUA 2BGRA 1J23A 3LC7O 3MFYA 1ESDA 4IQ0A 4LQLA 3DLHA 4HGNA 4I50A 4QPJC 4W9NC 5B7PA 1TT5B 1Y5NA 1IXRC 2HM7A 2PRSA 4MUYA 2NQTA 3FLMA 1A4XA 4RH1A 5H70A 1KY5A 2CEKA 7MHTA 1D3AA 2AFHB 5JS8A 4OKIA 4DILA 3JTMA 1NVFA 3U3OA 1ZN9A 2FUCA 2AG1A 4OI0A 5HIAA 1YC2A 2EFJA 1RRMA 2HCTA 9LDBA 4OXYA 4ZJUA 1DJMA 4M87A 4D3FA 3DAGA 1I5RA 3JD2A 5AKXA 1RNLA 1POXA 3RUCA 4MX8A 2HADA 4NJEB 3VH3A 2OSVA 3NYIA 1KYTA 2DBVO 4B4UA 4G84A 1E3IA 3K32A 5D51S 1M1XB 3EQZA 3EVEA 4Q01A 4DADA 2C3OA 4P5EA 3B78A 3RYFA 1TJNA 3UHOA 3A3KA 3PHLA 4J4TA 3AM3A 2O14A 1MJGA 2VNAA 1V8PA 4XSHA 3VR0A 2QXTA 1QGED 5BRAA 5FBWB 4NQRA 4Y6PA 3O84A 5D3ZA 4MKHA 1XEWY 3U44A 1G21A 3QKSB 4IILA 5UKDA 4DQDA 3IAS1 2I7TA 3MT8A 2WUGA 2X4GA 5LPNA 4D80A 4F45A 2WAAA 3EG9A 2VWHA 3M1AA 4I19A 1Z34A 2VBFA 2XF8A 4KNYA 5B57C 3MTAA 1JSRA 1KH2A 1V37A 2RH9B 3FNGA 2OV4A 2A1TS 4FW8A 4JUAA 4YRLA 2WHXA 3AB8A 4HQFA 1PJSA 2H7YA 4KLRA 4XIIA 3ZH9B 4QTYA 3AI2A 4ZOEA 5ALDA 4JZKA 1BMFD 1EJBA 1PFUA 4RVOA 1QGAA 3C3DA 1TYBE 2P9JA 4G3XA 2Z9BA 3GEGA 4G65A 4KXWA 3I52A 4UTOA 2O8BB 4TS9A 3KWMA 2CHGA 1LVHA 3PLRA 4E2FA 5B7NA 4GSKA 4JKIA 5K0JA 3U9TA 2PGOA 3GLFB 4C4PA 2WIFA 2ZE5A 4N3NA 3A31A 4DTCA 3AF3A 5LM3A 4FUQA 1S4QA 4TKMA 1XDBA 3K31A 4TL9A 1RMQA 1XX6A 2WJVA 1F4PA 1G7CA 1T8RA 2I2DA 3BK2A 4IXMA 4MVCA 2BHTA 5ETJA 3ZG6A 5A1JA 3FSRA 4UM8B 1W4RA 3BERA 2JAPA 2VDUE 4FDLA 4OLHA 4HTFB 1ZS9A 3L6BA 1M0EA 3FOWA 3DSRA 4GPZA 3R7WA 3VNAA 3WKBA 2C5LA 3GL9A 2HSDA 1GAXA 5FR1A 1R8XA 2FETA 1VLZA 1R6AA 3BFVA 3FPKA 5FUXA 3ESYA 4UFPA 8ABPA 1T4CB 4PNPA 3GHHA 2C5BA 3JX9A 2JCSA 2F7SA 1U5CA 1EX9A 2YZNA 3HFJA 4IBOA 4QECA 1PL8A 2QMZA 2O7RA 3SX2A 5DTJA 5A6VA 1PL0A 1LPBB 1QC5A 3CR3C 4JI6B 2QAGB 3T94A 3VHXB 2HR1A 2QRVB 4J3NA 4BB5A 3BL6A 2Q8NA 2CLIB 1NRJB 3B1KA 4WCFC 1E2PA 4JU8A 5CCDA 1UM9B 2ZBVA 4CKCB 4XVHA 3TN7A 4CM4B 1BXZA 1IBSA 2C29D 2IC5A 1GQFA 2F1KA 2WUEA 1E0SA 2Z9DA 4FVTA 2K87A 1N3IA 2X4DA 3ETNA 3TSZA 3ROQA 4CV2A 5LUAA 1STOA 3QMVA 3OU2A 1DKPA 1V16A 4JR2A 4BCCA 3ZZ1A 4B5KA 1UF9A 4D4IA 4B1FA 1VL5A 1O6FA 3AH8A 2C83A 1SEVA 2Q4OA 3X1KA 4CWAA 3AHCA 3O8RA 2KYRA 3UJ6A 1LDYA 1H23A 1Q1QA 2XE6A 1L1RA 2HHJA 3GD5A 3H42B 2WUFA 4OQNA 5LB4A 1KR5A 5IJ9B 4HQRA 1J99A 2H8GA 4H7HA 2GN0A 5ALNA 2DWQA 3CLHA 1CJBA 2NVOA 3FWYA 4WERA 3EXHC 5A2GA 2B8EA 3FPJA 4OP1A 4TPKA 1DKNA 1C1DB 1PS0A 2OE2A 4M3NA 4UARA 5BV8A 3PNPA 4MOWA 3P52A 1GRCA 4FFDA 4OOFA 5KWVA 3VR4A 2VDMB 1ODIA 4IH4A 4DW8A 2M98A 5JROA 3ZCUA 1CZLA 3IIMA 2C2HA 2C84A 5F7ZA 3ZU2A 1C1HA 2GERA 4HL6A 1VGQA 3C4JA 3VVMA 2JLXA 1FP4B 2H5JA 1XC7A 1Z9BA 5K8LA 4GM4A 4FBMA 4PG5A 4QAQA 4M1YA 2BN4A 4G56A 1LGYA 2J9FB 1ZGHA 4I5GA 5CM9C 2NM0A 1KBZA 1W6UA 4WBNB 3I9FA 4AKSA 1BNCA 3FRIA 1M5TA 4EY3A 4NMXB 1N8NA 2PMCA 4OHYA 1UK7A 4R9VA 1NBME 1Z47A 4Q3NA 2EATA 4MA4A 4YP9A 4PHCA 3RVSA 3N7TA 4CU2A 2VO1A 3JQFC 2WSIA 4BMDA 1KJ9A 2VRBA 2VHXA 3ITEA 4UKDA 1JG7A 2MSEB 4EGSA 4P81A 1E2NA 4ENTA 1WKCA 2IRWA 2UAGA 2J7KA 821PA 1I7DA 2P8SA 1IXYA 1KE2A 3QVMA 2Q28A 3AJDA 3BPSA 3WRXA 1AUOA 3NC4A 3VMFA 1QV7A 3CH6A 2EW1A 1WJGA 3CSUA 4MQMA 5EIWA 4BKMA 1KAQA 5KVVA 2V65A 4Y9DA 4EMSA 3ZD6A 4XWGA 3T0GA 1E6KA 1AOXA 4UM9D 3ITDA 3GGPA 1CZUA 1UT6A 3O92A 2G0AA 4EHAA 13PKA 2BMDA 4QX6A 4W1SA 3W2GA 4EQ6B 4DV6B 5AK6A 1I8TA 4ZEXA 4JODA 2F90A 3ZV3A 1WHTB 4XPZA 4DWOA 2F55A 3OEEA 1V8BA 2QT1A 3FYUC 3JS5A 4IIEA 3RAGA 3E9MA 3RDPA 1UWCA 1ZL0A 4UAVA 2XIQA 5EERA 1UJ5A 4MYHA 2VJAA 4IJ6A 5HNKA 4H1UA 1C7RA 4Y2PA 4DMLA 1X1DA 4I66A 1D1QA 2ODAA 5BY2A 1SKMA 2KWIA 1FBNA 2GDZA 4TV8B 5CW1A 3H2HA 5KTOA 1YI0A 2YOHA 1OASA 2RGDA 3GMSA 3PGMA 3U4IA 4QQNA 3JQDA 3E82A 1G18A 1QWOA 5LBIA 1LVUA 3INGA 2JIBA 3BAFA 3O38A 3Q9UA 1AUVA 1WDTA 3P71T 4N3GA 4QC2A 1IYZA 5AM4A 1RBQA 2G4LA 4MRSA 5FNVA 5JYDA 1YB6A 4Z4EA 5D5PA 3KJEA 1QCCA 3FNIA 4N8SA 4B2YA 3S27A 3D0QA 2BHRA 1DV1A 4UTXA 2F3PA 4YUVA 1CDDA 1JTVA 5E3IA 5TLSA 4B76A 3A6DA 5FOWA 6PFKA 2XIJA 4HWGA 1T35A 4Z0HO 5JJ5A 2GH1A 3NBAA 4BO1A 4F96A 2HCJB 5JZOA 3UEOA 2ZIXB 2ZJAA 3EFHA 1PT7A 3PDCA 5CX1A 3IR7A 3G5LA 4OQFA 1Z75A 3OCXA 2IDZA 5L3SA 4PU0A 2YRWA 2CHUA 2HH9A 3O9ZA 4U7FA 1WU8A 3HNOA 4G5YA 4D97A 5AHWA 2O8DA 1GR1A 2V7TA 1VBKA 2QY6A 2XQGA 3EXEB 3BWDD 4IICA 4V02A 5DIFA 2FW1A 1Q0TA 2HJHA 1XWFA 3BB1A 2V7QD 4EF5A 1RABA 3KAPA 2W2LA 4ETNA 3EBPA 1IBCA 2R6HA 2J5XA 2EG9A 3FYHA 2ZBGA 2XYRA 3RFFA 2FSVC 3IVCA 2ZFUA 1F2DA 2JK0A 3ND7A 4FFVA 1WVGA 2NYVA 3LUKA 3UTDA 1MOSA 1CIVA 2CL7X 4BQOA 3NEJA 2Z8XA 5FBKA 4QO8A 2JLVA 1DE0A 3FB4A 4J7UA 4AZTA 3C2QA 3N39C 1EFCA 3ANMA 2WYIA 4HXEB 4PLFA 2GB4A 2JIMA 4R9RA 5EAIA 3H5RA 4QRDA 3OKPA 2J5QA 4F1KA 2BCEA 4QSMA 3W4JA 2C3YA 4W7IA 5HIIA 1P9RA 3F8WA 4PSDA 4HLQB 1N9ZA 1V6SA 4WKGA 5E7JA 1AY0A 1H85A 1GZVA 1H3NA 1RC0A 1G8HA 1W49A 3OQHA 1Z5VA 3V4ZA 4UBKA 1VHTA 2C2ZA 3TEJA 5L51A 2NAPA 1WMFA 1KI1A 3T7CA 3VKUA 3SXUA 4LOKA 3WWZA 5FLXA 3CW8X 1NXSA 1UOPA 3RFVA 3AM1A 3DR3A 3GAFA 2P27A 2JA2A 4A0SA 3DDCA 3GJ4A 1XN4A 1EM8A 5ESWA 3MEQA 1WW3A 3HB0A 1U0OC 1OF1A 3CLTD 4GZ3A 3RJMA 2DQZA 4NX2A 5DTQA 1JIIA 1OA0A 3LUDA 3KLOA 4GE3A 4JLWA 4C0KA 4EZBA 5JPCA 3WO0A 2A8YA 3IKVA 3KQYA 3PF9A 3W34A 2NTNA 3VYSB 3F4LA 1ADFA 3JALA 5GGYA 4BO6A 1K7YA 2P3QA 1UBEA 1X7YB 5IT5A 4DS3A 3LC2O 1EHCA 3DCJA 3FBTA 3GG9A 1ISRA 3PP8A 4G4SP 1JYSA 5TS3A 5CIQA 3X1YA 5IS2A 2AUMA 1YBVA 1DC8A 2PVSA 3IRUA 1HE5A 2GJ9A 1JHAA 2EKDA 2NU8A 4C6HA 4XFDA 2GD0A 4L76A 1GOTA 5TB5A 4F5YA 1O1YA 1XMOB 3O8QB 3L8HA 2IVZA 4R7ZA 5I7WA 2XTNA 3KVNA 1X6VA 1JBQA 1N5DA 2DTDA 1R8SA 2WWHA 2JFGA 3GJQA 1BGWA 3RBAA 3TXYA 4MPDA 1LB1B 1ZOSA 1M6VB 3KTOA 2VBIA 4D42A 1L4MA 4QVKA 3E23A 3TQFA 5ES4B 2B6NA 4HSEA 4QBKA 1NHWA 2AZXA 2YNMD 2CHFA 1W5SA 4TOIA 3DE6X 4NZPA 1EQUA 2UXCB 2VJCA 1TU0A 4P3NA 1LDNA 3V8EA 5KYWA 2BM8A 1NVTA 1DXHA 2H3HA 5IJAA 3HBMA 3ESQA 3PLAE 5LXTB 3U3KA 3AOEA 4F4DA 3TBFA 5EMLA 3FE2A 4WFIA 3HZZA 5IKMA 5TF4A 4OXKA 3HHEA 1FLVA 5G0UA 4Q03A 1VGVA 4HBGA 3PHBE 2GGSA 3M1YA 2MSNA 3FY4A 1U6KA 2Z1MA 3IHLA 4GH5A 1L1EA 3UJDA 2VTEA 3E18A 3PBKA 4M8KA 3KDAA 2D06A 4URFA 3WQSB 1J7KA 4P2BA 3ZHSA 2HTEA 1R3DA 5C8XA 1MTZA 4DV3B 4JGGA 4IV5A 4Q4DA 2TYSB 4G1CA 3WISA 2UZ0A 4H7JA 5HG0A 4MW5A 1CZKA 1EE9A 3WK6A 3HKBB 3HP4A 4TVOA 1R9MA 4FYWA 3HEBA 4PR3A 3R0XA 1P4RA 2YMMA 3PV0A 5IJ0B 2DUNA 1PGQA 1SC9A 1T5DX 3BD7A 4UU7A 5B58C 4JVMA 1JU4A 3K8QA 4K6KA 4Q37A 5IJWA 5A7FA 4E94A 4MUFA 3OVMA 2SHKA 5HOQA 3F1LA 4XD2A 1ND6A 4JP1A 4AWXA 1UMBA 4A26A 2QD4A 1VXRA 2CYAA 4BRUA 3B1JA 3IKTA 5F3RA 2ZQZA 1P7WA 4MROA 1GIAA 2IPXA 4PINA 4Y2RA 3KEMA 4EL0A 2CYCA 3UA3A 1T9BA 1E9DA 4HR7A 3IPAA 4I6JA 1AIPA 2Q6KA 5AVJA 2D2IA 2H0AA 1BVUA 4Y2XA 4AN4A 4L50A 4EVSA 2J67A 4C43A 4LSWA 4B82A 2XNSA 6ADHA 5K3FA 5ICCA 3VPGA 4ZVPA 2CLLB 4QDZA 1E2UA 1TQ8A 3H9EO 5F35A 3CX7A 3IBSA 1JLMA 4R1UA 4BO2A 4TWAA 2ZKIA 3MWDA 3PENA 1D2MA 1RBYA 3ILHA 2ISQA 4FMDB 4XI9A 2FFBA 5KNBD 3JASA 4W7HA 2PKYX 4WCVA 4Z9FA 3TINA 1O95A 4GP6A 3D3NA 4M2LA 2EX1A 2EW8A 3FH0A 3OKAA 2EBUA 1CNEA 4MAMA 4DLVA 3KSAC 2D7DA 2TSYB 3G9ZA 3HI6A 5EE3A 2H08A 1CB7A 4WY5A 4HI0E 5EJ5A 1I0LA 2PT7A 4NBTA 2A5JA 3AX6A 4R1PA 4K9LA 3BJIC 3W5AA 2R9VA 3NKFA 5FUWA 5J23A 5J58A 1SBZA 1NNEA 1BFDA 1F8FA 4C0WA 2OBYA 4N6OA 5A5GA 2ACVA 2QAGC 1WP4A 5FUYA 2VPQA 3DDNA 1SA0A 3PXGA 1O0SA 1I7QB 4TWIA 1WHSB 2VR1A 4QREA 1VA5A 1VLVA 1J9ZA 4MLCA 3AHIA 4CM8A 3LKDA 2E7ZA 4UZEA 5CDHA 5IKXA 1F2VA 1Q92A 2PZKA 2Z2IA 4G1VA 4UD6A 5NULA 2WJ4A 4PC7A 3IE1A 4O3MA 3KSMA 3TCKA 1D09A 3VX3A 2VTDA 4Y9RA 3K35A 3ZZ0A 3HLYA 1KU6A 3I45A 4I4LA 1WMBA 4WECA 3U60B 3IV9A 2VF2A 2OWDA 5T64A 2HA6A 1EEXB 3TLGB 1RWQA 3LIIA 2AVDA 4N12A 2QGNA 2YRXA 3KTDA 4OAOA 1JHRA 4PTYA 4INPA 2GAJA 4RF2A 3M89A 4MPPA 5ERYA 3JQGB 1G7SA 4YTEA 2PS9A 1CERA 1R6UA 2WYWA 2Z5LA 3BWCA 4LOHA 3EPKA 4O2BA 4HB2A 4X6LA 3RUFA 2JJ8A 2DT8A 2B21A 3A10A 2EKQA 4XFKA 2VP3A 3NTRA 3UENA 3WB9A 3O2JA 4FTWA 3GW8A 3IDFA 4ZVRA 2YN2A 2ASVA 3GLIA 4KR7A 3MERA 3EDRA 1RWMA 2CCKA 3OPQA 3OWXA 5D00A 4JL8A 1NZJA 1JAXA 2A9JA 2MMGA 5ELXA 2UKDA 2CY0A 4NL4H 4FINA 4H59A 3CVJA 3FCAA 5LR6A 4GOXA 1EX6A 1UPUA 3M2PA 4P36A 3SHTA 2YZGA 3EOAI 1M6HA 4JDUA 3ZU4A 1L1QA 3G6WA 2E5WA 1XBTA 4LF7B 3L4JA 3GLRA 1AV7A 1WBJB 3GD7A 4AF6A 3AZQA 3VR6H 4R5MA 1SVIA 4KEAA 2YBDA 2BPOA 1WUJS 4HBZA 1U0GA 2JJ2A 2ECKA 4D82A 5BSVA 5F3WB 5LIPA 3AM5A 1GSIA 1CLEA 1TZKA 1NP3A 1TM4E 4EI2A 2FEMA 2Y1FA 1W36C 1KBOA 4C22A 2D1RA 2VK8A 3DZHA 1T24A 3T8YA 3BSSA 2JEOA 1C8LA 1R0CA 3U39A 1GN9A 1N5OX 2O2XA 1MABB 3K30A 1G5FA 3L6CA 5THQA 1POWA 1ATIA 1IHUA 3DONA 3OH8A 3X0DA 1FTGA 5DX0A 2ZRMA 4P84A 1L6RA 2Q6TA 1QO9A 3O82A 1ZVKA 5I8ZA 5KWIA 4A2CA 1GV1A 2WDZA 3M8KA 1TCBA 1X1AA 3AHFA 1D5WA 4J76A 3M83A 1PYDA 3MWGA 3UWMA 1M7GA 1Y1SA 4LWZA 1TOAA 3PJFA 4U2GA 3REGA 4OKNA 4CT5A 4YCNA 1E64A 5IBQA 1L9KA 2HZBA 1PL6A 1QH8A 2UYOA 1FUIA 4FR2A 2HOQA 2FN9A 2Q5FA 2PT6A 4TV9F 3S29A 4EFKA 1W36B 1QBKC 4HVAA 1QIKA 3RRYA 5FFMA 1A9SA 3KQVA 4ZMBA 3T38A 1TIPA 1DS6A 1LX7A 3FBWA 4FLFA 1ODTC 2OCDA 3TPZA 5HUHA 4FGUA 2X0IA 2N1BA 4TXMA 3WV4A 4ZU6X 2NT4A 4JMLA 3UK2A 4D5GA 3O8CA 1GQOA 1AKTA 3AKZA 4A6DA 1NV8A 1U65A 2WOOA 2BBTA 3SJAA 2BI4A 4AJHA 4V1CI 3CVYA 4D46A 2ECPA 3R7BA 1Z17A 5EIHA 1AGXA 1TKCA 2XQFA 1R2QA 3L43A 1NW4A 3OLZA 5IDWA 2A5DA 1Y1RA 2POQX 3P2EA 3R40A 4XSVA 2NP7A 4I4TA 5DEIA 4I14A 5I7HA 3PRJA 2GX6A 2AEFA 3C97A 1JH8A 1DG1G 4POOA 1LJUA 1JDSA 4AS3A 1XXHA 3RHSA 1V47A 1HBJA 3LPDA 4G01B 1BXRA 5HBGA 3UKDA 1ECCA 3STXA 1NATA 3MWDB 4W8OA 2CNKA 2QRUA 4HXYA 4QM7A 5GINE 3BIXA 2B4AA 1LK0A 3S5UA 3G5TA 2Z6VA 1XDGA 3UG6A 1GEEA 2WD7A 2GASA 1A96A 2VH2A 4M36A 1DIRA 3B8HA 1RPTA 1E1CA 1JG1A 4BO7A 2CV1A 4L9WA 4CF6A 2JAHA 2VHYA 5D7BA 5INTA 4M0KA 5F73A 4V03A 5CLJA 1M66A 2IYSA 4Z4IA 3VTKA 3I8SA 3P7MA 3K4HA 3SQXA 4YIHA 3Q0TA 2A2ZA 1WXHA 3BBPA 1X42A 3GRPA 4WLNA 1ZW6A 3A1DA 4H4CA 4BKPA 1X0XA 3L93A 1MGOA 2ABWA 3ABIA 5PNTA 1LCIA 2PLNA 3M6AA 1GP2A 1FFBA 1YRBA 3EW9A 4R8MA 3KOXA 1DWQA 3CYFA 4TTPA 5JS1A 4IDPA 1ZM4A 1P3Y1 2VDWA 4UM9B 1NR5A 4NDAA 1BG6A 4HNRA 5JCJD 1SCNE 2IOYA 4Y67A 1UMCB 3WG9A 3THXB 1OZ0A 3CKMA 2WF7A 3MCZA 2CD7A 5JH7F 1G6Q1 3WC4A 4PNEA 1GNTA 1VKJA 1X1RA 3SY8A 4AQDA 2O07A 3HKDB 2ZUTA 3TW4A 4JJFA 2JASA 5C4IA 3AFMA 3KZVA 4KUGA 4JGBA 3RC2A 3GFPA 4EWLA 5B1DA 1XZFA 5HCIA 3LX6A 1FTYA 1V5WA 3EF0A 4O2AB 3SKYA 3REQA 4L6IA 4AZWA 3I9V1 1W25A 1FJHA 1T13A 3IELA 2V7PA 5KNCH 1R5OA 1BGVA 1M0WA 3LZDA 2I80A 4P3PA 4EA9A 5KNCD 1MD9A 4XSGA 2CFCA 5LOVB 4K2HA 2C7PA 1K2VN 1JPJA 4X1IB 4ETMA 2ZATA 4QJ5A 5KC9A 4PXSA 1Z6TA 1MORA 3BK1A 1OLSA 4DLRA 3C24A 1A9XB 1G2OA 2Y66A 4AI6A 2EZ9A 2XDQB 5I9SA 1NP6A 3NOXA 4DBLE 4YMUA 1OD6A 4GMGA 5LUBA 3FWKA 3DO8A 4EF4A 1RJDA 3OLVA 3R0ZA 1UKVY 1M33A 1AKMA 4S2EA 2RHGB 3CSDA 1IDN1 5F5XA 1H1DA 1XYGA 4GM0A 3VI3B 4MHTA 2ZIGA 621PA 2AC2A 4CL0A 1C1XB 4GSLA 1Z33A 1AQUA 4TZTA 3MS7A 3FMFA 4YFVA 4FFRA 2QX4A 2C0QA 1A9RA 1R8YA 1AO3A 4IQGA 4MWEA 4YJ3F 4D74A 1CD5A 1CNMA 1YTLA 3FR8A 4HEA1 3SSOA 1CUCA 1TADA 5A0TA 1X19A 1RYNA 3AP2A 3GEBA 3SOPA 4BMVA 4RMIA 3M3DA 2X6RA 2VZEA 3H04A 4PGHA 2DUJA 3TE6A 1H3FA 2EGHA 3W2TA 1N2HA 3R3HA 4ESVA 4N03A 2CXSA 2R6DA 1JE0A 1NVVR 2FGKA 3PSAA 1RHUA 5M04A 2G76A 3G49A 4LY3A 4HDMB 3ZIUA 4U2EA 3ONNA 1FFEA 4WOCA 2P69A 3BTOA 1GYPA 5AJWA 1ZGJA 3B6ZA 4TT3A 5JZVA 5IABA 2ZSDA 3R76A 4I1OA 1A9TA 1XTVA 1T9KA 4EHNA 1P6XA 1JDUA 3SF8B 5ARBA 2NV2B 4ESEA 1QHHA 2IF2A 3EHDA 2PIDA 1NVKA 1P0IA 4ZZ3A 1N1GA 4AUEA 4ZQBA 4IGFA 1L5VA 1R18A 2CBZA 1TUBA 2OK7A 4WBNA 1QHNA 2HREA 1NW6A 4NZYA 1LBIA 4TKVA 2PH7A 1RKQA 4H6XA 4XWAA 1ZU4A 4Y6LA 3S7ZA 2AG5A 1VHWA 2HDWA 4FGLA 4XYGA 3TTVA 1WF3A 2PS0A 4ER3A 3DOCA 4TZ0A 5DGCA 3WRYC 2MR6A 3EAQA 1DC7A 3HB1A 3VKVA 3GP8A 3RFXA 3HUFA 1AHHA 5DX8A 3BQ9A 5HX7A 2H85A 4RJKA 3OP1A 3EVGA 2WY2D 3HM2A 3RHFA 1R64A 4YRQA 4TT3D 3H2IA 4RACA 4B0OA 3KNZA 3TLEA 1MVNA 4HAOA 4US2R 4MDFA 4ABYA 1ZMBA 2N75A 3CC8A 4G0PA 1QFMA 4A23A 2XWPA 4TLMB 1A8HA 2QJFA 4BNDA 2PL9A 4EZIA 2F00A 4KKXB 3T1QA 3VKGA 1EA5A 1A2BA 5BQFA 2CJPA 2DHRA 1EHYA 1AX9A 3D81A 2VP4A 4CE6A 1U80A 1EUDA 2VWPA 3QPVA 3GJ7A 3H5WA 4K8OA 2D0OB 3V8NA 5LSAA 4GP7A 2O5CA 1RXYA 4MHSA 4PXYA 3KVVA 1ZGGA 5ALKA 2VPTA 4B6JA 3RAEC 1HGXA 4PVCA 2VSNA 2VRWA 4WOPA 1H66A 4QXMA 2ZDHA 3JYPA 5EJAA 3IT0A 2IV7A 3SVLA 1OR8A 3LT1A 3VGPA 5GJVC 4JJAA 1TI7A 5B2EA 3K4QA 3PGLA 4X71A 1JEOA 1LU9A 4Y7CA 4EELA 5KWJA 4L4SA 4FN5A 2GN8A 4PC3A 5JMOA 3RADC 2R47A 1OFVA 2ZGVA 4ZXFA 3HU2A 1PF7E 2QRVA 4Y1RA 1YDFA 1ZL2A 1S8NA 5BQXA 3HJUA 5BSTA 4EYSA 3Q4GA 2K5UA 4FFOA 4FR0A 4QIHA 1COWD 4GF5A 2IUUA 1X3LA 2GLXA 1TVKB 2DCMA 4A15A 1QNLA 4MB2A 2WLSA 4Z86A 3KOYA 3M9WA 3RSOA 3EOBI 2A4KA 5EHZA 4Y6GB 5KI6A 4P53A 4D9CA 3FOEC 3WRWA 4X66B 1FFWA 1ES9A 3LBIA 3N75A 4L8FA 3UW1A 5MF6A 1RXWA 1M1NA 4ZU3A 2QRHA 2C8VA 4RK5A 2PUAA 4GC9A 2BGMA 3IFSA 4EVRA 1KPGA 3JD3A 4DM4A 5JO9A 2PH3A 4BXOA 2VLIA 4UXIA 4AJ4A 4OTZA 1IIRA 5BORA 4NBKA 4PHHA 4PNHA 2FQXA 1J8YF 2LIVA 2Y1OA 3DZFA 2I5PO 4HRVA 3GELA 1BE8A 3UT5B 5AXAA 2L2QA 5AW9A 3ZHCA 1NQXA 3TLJA 4DRXB 1Z4KA 1L7MA 1YIAA 2QNIA 2NVUB 2HMUA 2QJTA 4Q12A 4QNRA 3TPCA 2JZCA 2XMBA 4JD5A 3PWKA 4LMBA 4A5OA 4DQUA 1NW3A 3DAFA 4C08A 2AD5A 4PX2A 2E5LB 3ZTTA 1CUYA 1IM5A 3NHRA 3B1WA 5FTWA 5CA0A 1WW8A 1HWYA 3CUUA 3QPDA 1JUDA 4WNIA 1A9XA 1AK1A 1AUPA 3L18A 5T6BA 3WRYA 4ZAGA 5BSGA 4J16C 2VDQB 4JQYA 2J6BA 3DMPA 4NABA 1RQGA 3GGJA 4GW3A 1YONA 3ZLVA 2BKUA 3EXFB 4WNCA 9ATCA 2NNWB 3KKNA 5F2EA 3F6EX 1I1QB 1KXZA 1XRPA 4BTLA 1T0UA 2KBEA 5AVRA 2O48X 3W79A 1Q1BA 3C3CA 3GR6A 3DXFA 4B3IA 1JDTA 1GG8A 1ZEMA 3IKJA 4HOYA 4OPMA 4TRRA 5E4TA 1P4HA 3DW1X 3WHKA 4EGCB 4ZHQA 1II8A 1UQTA 3KTFA 1JSCA 4RHFA 1A50B 1TM2A 1JVNA 1SQFA 4ZVLA 2B9VA 2J3IA 1OLXA 2QZZA 2Z1NA 2J48A 4MVYA 3WX0A 3OZGA 4M99A 1W85B 4RSMA 2ONCA 2J87A 2ZVQX 3T5BA 2QTVB 3QEBZ 3GUCA 4QL3A 4HNVA 1LFAA 3PRHA 4I9GA 4REQB 1Z7GA 2D13A 3HH8A 2Q3CA 3K8OE 4YRDA 2Q2VA 2EARA 4EP1A 3GDWA 1QK4A 4J0JA 2BMEA 3UT6A 1LVGA 1WPRA 5C37A 1A7AA 3AY0A 3A8TA 5EPUA 2YDXA 4Z7NB 5AJXA 2FSSA 1BD4A 2I65A 4TLAA 1NN1A 2ZJ5A 1LBHA 4TM8A 721PA 3NM4A 3B48A 3I64A 5KREA 1WXWA 3KHTA 4K1XA 2PUWA 3WQQA 3I5YA 1AE1A 1U3FA 2V7GA 2I1VB 1HOXA 3HQ4O 3G9UA 4RUKA 4BQPA 1JE1A 1NT4A 5B1HA 4G86A 3M4NA 3OAAD 1XR3A 1EFVA 5HW0A 4Z53A 3WYFA 4BN4A 1GGEA 2PMDA 3IVRA 4EB6B 4UTNA 1MR3F 1YIDA 1QG6A 3AXSA 1D2HA 2C9OA 2ST1A 3MRXA 3FPSA 5A3VA 5KTMA 4OOEA 1WEKA 2R2GA 3CF2A 2QG9A 3C5VA 2ZJ1A 3LKVA 2NQ8A 3A11A 4WZAA 3SSMA 2GF2A 1SOUA 1YQDA 5DHTA 3ZDRA 4PYMA 1MUUA 2E89A 2LBPA 1L5NA 4EPYA 4PX9A 2A33A 3U1TA 1XXHE 3S2EA 3FA2A 4NCBA 3ITNA 1PBNA 2BEUA 4AECA 2X1MA 2B1JA 3QE9Y 3WLTA 3A05A 1VP9A 2JIRA 4G8BA 5FOUA 3AEQA 1DBIA 2JFZA 4ZEOA 2JGNA 3OCCA 3RS8A 4ENWA 3QEOA 4F3RA 4WXHA 5HUQA 3THWB 1CR4A 2ZTSA 3GNTA 5AI0A 4BNXA 2C2BA 3IR5A 4PO3X 3OUTA 4Q1CA 5KDLA 1T9GR 4CYMA 3C48A 3KOUA 2OBBA 4D8UA 3OY7A 4ZI2A 1IY8A 4QXOA 5IAOA 3EF1A 2ZI6A 3IS3A 1T3ZA 2UVPB 4NFHA 3L4SO 4JK3A 4BFVA 1N6RA 1Z8HA 4O2RA 1Z6AA 4P7JA 5BSWA 1EG2A 3TDKA 2OCPA 3L0PA 1Q7TA 3TQSA 4AQ7A 4W5OA 4EM6A 3GAMA 4C03A 1FS6A 4KG7A 4YLGA 5CEFA 4KQ9A 3IQGX 1NI3A 4FWBA 1RLOA 3GPBA 3DWEX 1A5TA 3FROA 2B1IA 2PH1A 2RGWA 1LPAB 3NETA 3U81A 1CUXA 4PAGA 5SY9A 4XWOA 1GUFA 3LPAA 4OM7A 3B70A 4RHTA 3DT6A 1AS2A 2LP4Y 5KOJA 1Z7BA 3EEIA 1ZESA 4WDRA 2WWYA 4PCVA 4X94A 2DERA 4O5AA 3MN1A 1ZNWA 3MGBA 2AEMA 3C6QA 3LH5A 1JHXA 1FRFS 4OBWA 3G0CA 5BSEA 2O8FA 3EHEA 1B8VA 2E48A 2WAYA 2IDJA 5JZ9A 4YR7A 3Q7IA 3V42A 4YQFA 4JLUA 1Q74A 3BRCA 3KETA 1A71A 1KY2A 1VRWA 1Z35A 2QGZA 5B30A 4KAAA 1DG3A 5TQVA 1E8NA 4U7WA 4ZU1X 3STHA 2HSZA 2P91A 5A2QA 2JHAA 2PS3A 3WGMA 5KTYA 2XNDD 3PXAA 4EDHA 1N9GA 1QH8B 1SVNA 4BNYA 5IU6A 3C5EA 4Z9AA 2IP2A 1RYYA 2ENUA 4IJMA 4R4JA 4AF7A 3Q7EA 2I7VA 1W4ZA 3CH5A 1DP4A 3A3OA 2LNDA 3FGOA 3OD1A 2FN3A 4L95C 2VTBB 4G0UA 1QQ6A 2HA3A 3OA2A 3CISA 4YUXA 4FKBA 3DL0A 3B3JA 2H2DA 3H83A 3FMIA 3LNTA 5G0SA 3NVKI 1F51E 3W8FA 3EXIB 1EM6A 1JQAA 2J5KA 1VIYA 5GZ6A 3STYA 4AJNA 1NPTO 1PR5A 1UQRA 2NO5A 1OQAA 4TUYA 5J2TA 1QU2A 3LY7A 3DMFA 3CKKA 1LV8A 1ACMA 1TQDA 4KDRA 4B09A 5F9FA 2O57A 1TAHA 3GHYA 3NV9A 3S7TA 1B6RA 3V4VB 2XA2A 2C9CA 2I34A 4WFJA 4KC0A 4Z9XA 4L8WB 3GCWA 4GHWA 5JH7B 3U4MA 4GOOD 1GD1O 2QJOA 1KEEA 1DAFA 3KBOA 2VH5R 5TJ9A 3NVDA 4K05A 3WTCA 1CIJA 4AG5A 3EIFA 3UJ9A 5IHPA 4A2QA 1J0BA 5CURA 3SXJA 4AMBA 1H2YA 4JJIA 3RJTA 1QAOA 2VCYA 2H59A 4CLHA 1FUUA 2PGDA 2SKEA 5T4HA 4QJIA 4IH1A 3UXEA 2BGKA 3SM3A 8OHMA 3R8CA 4EKGA 3UJ7A 1IH8A 4UDYX 2CNWD 4G25A 1ZH0A 1NVDA 4IOKA 4DXDA 3NBFA 1H9BA 2AOTB 4JWKA 3TTYA 2J0UB 1PU2A 4TN1A 3KALA 1GSOA 4IHQA 2WT4A 1G1AA 3MHPA 3PVSA 1KMIY 2FPIA 4ZV7A 3KSUA 2AZ4A 2I9PA 2ODWA 2VDOB 4Q9IA 3TL3A 2NXCA 3LV8A 1GPMA 3AR8A 3MUNA 3NOOA 2JVJA 3D6NB 2ECFA 3DNFA 3MS2A 5E1MA 1NY5A 5GY7A 4LN1A 1I51A 2G0TA 4IMIB 1ULSA 2H7XA 3E1KA 4BU1A 3BTUA 5L95A 1CB0A 1CRPA 3IA2A 4DARA 1IG0A 5D6OA 2NZJA 2DFKB 1YJQA 4Z3OA 2DBZA 2FHSA 1YZQA 2DECA 4JELA 1ZH8A 3LT5A 3NBYC 4I5EA 3UH1A 3JYHA 3QKIA 1GNLA 3NBMA 4KMOA 3KDPA 2IWRA 2JKZA 2GRUA 1Q0PA 2JKVA 2EFEB 5KYKA 1T8WA 1II8B 1CR2A 1XQXA 4MEJA 3FWNA 5CCXA 4YRIA 3HE3A 4FYMA 1MPTA 1H8HD 3E9EA 3GMTA 5B1IA 1P80A 1SZJG 3X2SA 1DCTA 3CJTA 3I0MA 1GXSA 3DTTA 3K5IA 1XA4A 3LX4A 4I6GA 1KO1A 4U7DA 1WY7A 3UMVA 4OB7A 4ZO4A 2XADA 4LJRA 3QTLA 4MGEA 5F23A 5I01A 2X7XA 1SCUA 4QEZA 1VP3A 1KMCA 2F8LA 3I2IA 5TT0A 4X7RA 1P60A 4J3JA 1TUEA 1A76A 2HSJA 4F97A 1JDPA 1S3IA 2ZIFA 1PFWA 3F3SA 4X93A 5DE3A 5TMEA 1ZJJA 2GPSA 4J0HA 3WLFA 3FR7A 1Z39A 4DHWA 3PG5A 1WD7A 4BZQA 2CNDA 4KO4S 4P98A 4ARIA 5IANA 4KCGA 2QNBA 3ESRA 3SLKA 2DPHA 1M54A 4XRGA 4D45A 3DE2X 3DXYA 5I4BA 4O6VA 3PQFA 3DMHA 3ITKA 3U09A 3F4KA 5K01A 5IMBA 3LWDA 2AJLI 4MKRA 4CFZA 4JA2A 1WZCA 5GZ3A 3MELA 2VT6A 4WACA 1FFCA 3ZE9A 4LF5B 1RAFA 2GARA 3AVYA 4WK6A 1XZHA 4UVHA 2EX0A 5EWLB 1G6HA 1UXJA 2HGSA 4YMTA 3WWEA 1P2GA 2I87A 5I9NA 3H8JA 2KSQA 1TC2A 3I9NA 3LGXA 5DISB 2JK1A 4YRPA 2XPCA 4EG3A 3UOWA 4YT2A 3R0JA 3FX2A 3EGEA 1EAYA 2W0SA 4OJMX 1ZK2A 2ZUUA 1TF2A 3GJZA 3MJDA 4XWTA 3VA7A 4UMEA 4BLPA 5HKAA 2D2EA 1ZK1A 1JIKA 1XZLA 2GEJA 3R3UA 7GPBA 1GU0A 3UPUA 2GN9A 4TS3A 4U6SA 4Z49A 4H7FA 2XT9A 4OGWA 1TF5A 2JDID 1CZRA 4LHWA 1M7HA 2COEA 3MFQA 3K6SB 4O02B 5L3VA 1V4VA 3HEAA 3QHQA 3TZKA 1FBTA 1QK3A 5COBA 4XJTA 3T4EA 1RXIA 1CJTC 2VT2A 3ZK7A 4XUGB 1V1RA 3G2MA 1XROA 1F14A 2Q5QA 4M7PA 3ETDA 1QGDA 4X60A 1FNBA 2JJMA 2NPFA 4DWJA 4A8HA 3FTPA 1D04A 5IDVA 2VPIA 5ICFA 1JFSA 1KI4A 1IBLB 5ALSA 4ZRDA 1HE4A 5FO0A 4Z1MD 5ER6A 1I4WA 1IRXA 2FLWA 3W1WA 3ZI7A 3P9KA 3IP8A 5BNIA 2MIIA 1CUBA 2B8TA 2YIVX 3B38A 5TS2A 1NVBA 1QS0B 4F9EA 5CBKA 2YZMA 4LFBB 421PA 3SFTA 3KM0A 2ESRA 1YE5A 4UCXA 2P5YA 1SZPA 1WBBA 3KJXA 1XVTA 3DWIA 3BHNA 2PJZA 3OTWA 4BP9A 1QGUA 3JQQA 3PK0A 4MRNA 5F33A 2MJLA 4OM8A 1KH1A 1NOIA 2XE8A 4JT9A 4PYKA 2JLBA 4EFLA 2R1TB 3BE8A 3RJ9A 2DR2A 5ALUA 4OLAA 3K0KA 1K1EA 3L8GA 1KE1A 1G5QA 5AI5A 4MSUA 3LJKA 4LDPA 2FRDC 2X15A 3WL4A 3LT2A 3C3XA 4CHTA 1I3LA 1NKSA 4LZJA 3Q5EA 2B82A 3FPAA 2AEJA 2C9ZA 1EZ4A 2YMQA 4MVJF 2JCBA 2QROA 4HYYA 4XGIA 3CHYA 5DTRA 4Q4AA 4YONB 4E14A 5C8VA 3ML1A 2IIBA 2R8PA 3BREA 3OU7A 1BWSA 3B8EA 4MYDA 3M82A 1JKFA 5JMPA 3V2HA 5KINB 2Y67A 3ANYB 5EJ2A 1EIWA 1OYVA 4NAVA 3TZCA 4AS2A 3DFKA 4KKVA 3UW3A 3OCYA 1JYFA 2YJNA 5BW6B 4BE9A 3Q6IA 1KDYA 3AT1A 1H8EA 3TG8A 2Q4TA 1J90A 1L3BA 3CZAA 2XCUA 1ZN2A 3LCJA 5CRIA 2FUKA 4KH1A 3V2IA 4BBAA 5K8JB 1NFRA 5CBPA 2O3SA 2IU6A 2NNLD 3P26A 5AM0A 1Q1ZA 3EXAA 2B1QA 2EWMA 1H42A 2OL4A 3A1VA 3Q2OA 3TM4A 1L5HA 3MSXA 4ZK2A 1W35A 2P5TB 4A91A 2PZ8A 3LSTA 3H8SA 1FFHA 3HJNA 4CZ2A 4D9GA 3JZMA 4IXTA 3H5OA 3RTEA 2BHSA 2ZYIA 4U0KA 1YD7A 1WM1A 2C2WA 2NU6B 3KJQA 4IDOA 2AXPA 5ARDA 2QD5A 3KQTA 4K9SA 2FR8A 3JQ6A 2RJNA 5CDTA 4UDOA 3LE8A 4UULA 1EVYA 2ZTMA 3UAZA 5DW0A 3T1HB 1FMTA 2BUAA 2XX3A 1II0A 3X1XA 1ZD9A 4ACAA 4IRXA 4Y18A 3CKLA 4FD2A 5CG2A 3LF2A 3A9TA 4PFQA 2QJRA 5E7MA 2WZCA 1E2GA 1RE0A 5JZMA 1QH0A 3H2SA 4XR4A 2Q5EA 5EL0A 1NQVA 1NQAO 2P7IA 2CL0X 1OAOA 5JOQA 3UBMA 1EM8B 2E49A 2W6MA 4YASA 1EFTA 2AWNA 1B1CA 4UJ3A 3WGTA 5KC8A 2A5YB 3U61B 2R751 3DBIA 2LZ0A 1PW7A 3B20A 4FU0A 3CGGA 4L3OA 4DCOA 2X0FA 2X8WA 2Z0MA 4IMRA 2FQQA 4XB6B 4Z6KA 2VYFA 3BIFA 4KVGA 3VTFA 4BNHA 1XHEA 3DBLB 2I4TA 3L0SA 1YRYE 2UVQA 2NACA 3AV3A 3FNRA 2P77A 4P22A 2Q9BA 3AJ8A 3SD7A 3SP1A 2PT9A 5B1SA 4TZKA 1LA2A 3GV0A 1FUYB 1DHTA 2O0LA 5CFOA 5CX4A 3S8EA 4Q9LA 1Y6QA 2REQB 2RG1A 4IH9A 3EEBA 3JYLA 2VPWA 4DNPA 2GA8A 4JFRA 1B0UA 3UB3A 2W48A 4MDYA 1O94A 4CLDA 4DUGD 1B8OA 2BFBA 2OYRA 3TPFA 4PYQA 1LXCA 3R41A 1OT5A 2IXDA 1JQ3A 1F5NA 1Q19A 5D2CA 5B4UA 5BXYA 3ZDZB 3W4IA 2XECA 3KIPA 2PGNA 3C7AA 3CNBA 4H35A 3RFUA 3D1LA 3WE7A 3WQBA 2XZOA 3N8GA 5ED4A 5GWXA 4NFYA 2R6CA 2J31A 2RCNA 3AJAA 4GC5A 1E3SA 3D8RA 3IURA 1Z56C 4X92A 1Z82A 2H1RA 4CMGA 1T4DA 3HRHA 1VRCA 5JRDS 3AUKA 2YYYA 1KAMA 2DLNA 2ZRQA 4PQGA 4BS9A 4RQBA 1JKMA 5TQ0B 3DR5A 4J1TA 3WL8A 2P1DA 1RAGA 2JF0A 3AVOA 4XAQA 5F7JA 3CNLA 1PJ3A 3R75A 1SIWA 5JY1A 1KJJA 3QX3A 1R4AA 5HFAA 2EBFX 1GZDA 2AOUB 2X58A 3DFFA 3RBVA 3VVCA 1YVDA 4E33A 1P6UA 2ZE7A 2FW8A 2WPDA 1AQNA 1PGPA 1VTKA 3C1UA 4B6QA 1KY4A 4UTRA 4LYHA 1A2QA 3OEHA 2F43A 3B3QA 1T15A 2ZRDA 3CEHA 1S89A 5TXGA 2GBFA 4OYHA 3WGKA 3SHOA 2G17A 3DXZA 3G2LA