5FLKA

Structure of haloalkane dehalogenase variant dhaa101
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
IGTGFPFDPHYVEVLGSRMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYRFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTPDVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHAA101
publication title Evolutionary Analysis is a Powerful Complement to Energy Calculations Allowing Entropy-Driven Stabilization
rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5flkA00
3SWWA 2JIDA 2VJDA 4FLEA 3BF8A 4J03A 4LIPD 1M33A 4I4CA 1QIDA 4IHAA 4BVJA 1VXOA 4KE7A 4INZA 4RGYA 3FYUA 3I2KA 1XZMA 3AZOA 2VAXA 5ALQA 1AGYA 1R1DA 1ZJ4A 4Y9SA 2XUGA 3C5WP 1XZBA 2I3DA 4E46A 3A70A 3FSGA 5FKJA 3EQ7A 3NOXA 4X3CA 2OQIA 4EY5A 1BEZA 4EUSA 5AOBA 4AZ3A 5ISMA 1GXSA 1QOZA 3ANSA 3WWOA 3DKKA 2YH2A 1ZI8A 1JJIA 3ZPXA 4BC0A 4B84A 5K3FA 3WK7A 4QWMA 5ALHA 5AKJA 2O2IA 5FV4A 1A8SA 5YASA 4MEBA 1ZJ5A 1Q84A 4E14A 4X71A 2XMZA 2XUKA 3FVRA 1GZ7A 3IURA 4GEGA 1QIFA 4J0GA 3AILA 2YXPX 4Y2YA 2J4CA 1N8SA 3C6BA 4OYYA 1QONA 4UFNA 2ZVDA 4MQLA 2GYVA 4QDTA 1Z68A 4U2GA 4Q3KA 5IVHA 3H18A 3FSGD 1WB5A 1F0NA 3PE6A 5ESRA 2GBCA 3WZLA 3BIXA 3C45A 3FNBA 2DCMA 4BAUA 3H1AA 1EI9A 4EY8A 1EB8A 1TCBA 3A2LA 3KD2A 4P92A 2XDWA 3PF8A 1ZD3A 1ACJA 2ZSIA 3QYJA 4H7FA 1EXWA 3IB3A 3C43A 5AM1A 1MNAA 4UBKA 1DX4A 1VLQA 1GQRA 3DYIA 2B61A 1BCSA 4A5SA 3G7NA 3C70A 1VXRA 4G9EA 3M81A 3PI6A 4J3JA 1WCYA 3VDXA 1QLWA 2W22A 5EGNA 5ALEA 1R50A 4B9AA 3WK8A 3I2HA 3E0XA 2W6CX 4DMCA 1DT5A 2OGTA 5CT6A 3RKSA 4X6XA 2QJWA 4CG2A 3OTQA 1ODCA 1UXOA 1CUHA 1VA4A 4CG1A 3O95A 4H7HA 5FPPA 3W04A 4ZXFA 1CUZA 2XQKA 1OILA 3FLEA 1CUXA 1UK6A 1CLEA 4DNPA 4HXGA 4C4XA 5AOCA 1ACLA 2WJ4A 1W1IA 1CUFA 3HYSA 2WFLB 3P2MA 3EQ9A 3F9CA 1VOTA 1YA4A 2WUFA 1ZD4A 4OB7A 3W06A 2DR0A 4DMKA 3IBTA 4KR0A 4E15A 5EIEA 1T4MA 3STYA 4QDXA 3CXUA 3W9UA 4Y2TA 3KXPA 3QPCA 1QO9A 4CI9A 3GROA 1ZGBA 4BATA 2QT9A 4WDRA 3S2ZA 3I28A 4J0HA 3MUNA 3ANTA 2O2GA 4UBIA 1UOQA 2FJPA 1SC9A 1LBTA 4B0OA 2BKLA 5ALLA 4BZWA 2WIDA 4MEAA 5AKHA 3DDUA 3ZLTA 5JYCA 1WPRA 3WKBA 3PUHA 5IVKA 1O6FA 1U4NA 3WA6A 1AUOA 1KU6A 5A7HA 1OCEA 2XMBA 3C5VA 2VJAA 1MN6A 5ALRA 5SYMA 3BDIA 2OQVA 2XQJA 2G5PA 2GBIA 2WHPB 3H2JA 2WKWA 5IH7A 2P8SA 1JT2A 4WCVA 5ALFA 4C88A 2ACKA 3F96A 3OM8A 4OB8A 2WU3A 4LXHA 1XZDA 4U2CA 2X5XA 4K2AA 4DGQA 4KRYA 1FSSA 4GXNA 5FDFA 1FFDA 3WQHA 2VQ6A 4BVLA 5D3KA 3WKDA 4L0CA 4EBBA 1HKHA 2HHAA 5I8PA 4B85A 1TK3A 1YR2A 1QIGA 3G0BA 4JYMA 5LZ8A 1J06A 2WM2A 1JJFA 3ICWA 4LYDA 2WUDA 1D07A 2ZJFA 1CUUA 1WM1A 3WWDA 4JUIA 3T52A 4BRZA 1J07A 1RYYA 3QM1A 2GYUA 2PKYX 1WHTA 4QDZA 4FBMA 1QGED 5LZ9A 5HK9A 3WL5A 3O9VA 4OB6A 2NW6A 3BDVA 3KWFA 4G9GA 2J3DA 3V1LA 5H3HA 3A2MA 4EA6A 3F98A 3WZMA 1AZWA 2HU5A 2HA4A 3U1TA 5JALA 1CQWA 1HPLA 4JYPA 3R3UA 4HVTA 1JMKC 1G42A 4KJXA 3N2ZB 1K5PA 3VXKA 1J2EA 2WUGA 5HQ3B 2C5GA 2VAVA 1CUCA 1G5FA 3BL8A 1L7QA 4XX1A 1GPNA 3D4LA 3O4JA 4Y2PA 4BCBA 1ORWA 1WB4A 1CVLA 1K6EA 3STVA 4DSZA 4P08A 2XUIA 1E66A 4HAIA 2XQIA 2H9YA 4Y2SA 2XUHA 1CV2A 4AQDA 4JH0A 1N1MA 3CCBA 3R0VA 4OU4A 1UT6A 3UMJA 5JASA 4IH4A 1ZD2P 4BDTA 1OXMA 2VJBA 1E5TA 2JEZA 1HQDA 2G5TA 1LPNA 2QZPA 1TQHA 5FRDA 1SCKA 4UHHA 4Y2RA 5CH5A 3H19A 4X97A 1W76A 1UFOA 2QTBA 1VJ5A 2V97A 4FLFA 4Z49A 2PPLA 1CUYA 4RNCA 5LZ5A 2PSDA 1W6RA 4CG3A 1ZI6A 3ESBA 3F97A 1XKLA 1FFCA 4Q34A 4HZGA 1AKNA 2PVSA 1GPKA 5ALOA 5JD6A 4W1PA 3GUUA 1CQZA 4EZIA 1CUDA 3D2AA 1NX9A 2Q0XA 4QEKA 4IQ4A 2YYSA 4LKOA 2B9VA 4BCDA 2BJHA 3TJMA 5EHZA 3FCXA 3G0CA 4H7IA 5IVIA 1CUEA 1TIBA 4BB0A 4CFSA 1AMNA 2ES4A 5AK6A 3WK6A 1XRLA 1CUGA 4K6KA 2WG1A 3G9TA 2WFMA 3IUJA 5BV7A 3FYUC 1R3DA 3O4HA 1EK1A 4N8EA 4OD0A 2DQYA 2WIFA 4UHDA 4AO8A 2OPHA 5HZGA 1XZHA 3IUNA 1QIIA 2EDCA 4HXEB 4H77A 3ED1A 3VJMA 5T4BA 4HRXA 5AJHA 1CUIA 4RPCA 5AKLA 3L1IA 1IMJA 5DJ5A 3IA2A 1VKHA 4QZVA 1EINA 4CCYB 4H18A 2XI4A 3LIPA 3HSSA 2WUEA 4GI1A 3R3VA 1JMYA 2ZSHA 2ZYRA 3E4DA 3K2IA 3WK4A 3EBLA 1A8QA 1QTIA 4FDMA 2GZSA 4XJVA 4PW0A 1E89A 3AJAA 3K6KA 4PNZA 3AZPA 1SFRA 2ZYHA 1E3QA 1DQYA 1P0QA 2Y2UA 3LS2A 3DYVA 5D3ZA 5A62A 1XZKA 4FBLA 1B6GA 2VA9A 4IH9A 3I2GA 5ALMA 4C4YA 2HRRA 3RARA 2XMRA 2OCGA 3R41A 2Z8XA 1VE7A 5AM0A 4M0FA 1H2ZA 1QFSA 1Y7IA 3EF3A 4AO7A 4GDMA 5JZSA 3V1MA 1CUVA 2PM8A 4X92A 3UUEA 2DQZA 3BJMA 3WL8A 3BXPA 1CUJA 2DSNA 5AHXA 3ZLUA 5JARA 3I1IA 5ALDA 2RHTA 2JGJA 3AIKA 5ALWA 2DHCA 2JGFA 2PUJA 3HACA 1HLGA 3DS8A 3M82A 4NS4A 2VTVA 1UKBA 1DU4A 1U8EA 2XLCA 3H2IA 5LP1A 3WK9A 3X3HA 3IIIA 5AKGA 2BAGA 5I7UA 5A6VA 3WK5A 1YASA 4FFWA 4LHEA 5EHQA 3TRDA 1YSCA 4GHWA 2HA6A 2PU7A 2WG2A 4DM7A 4JEIA 4BC1A 2V9ZA 3A6ZA 4EY7A 4BCCA 4E11A 1BROA 4X94A 2BGRA 2WJ3A 2WG0A 3PDCA 4RE6A 4BBZA 3D7RA 4AX4A 3I1YA 3DL4A 1Y7HA 2EEPA 3WKAA 3AIMA 4J7AA 2XUJA 2XUAA 3PUIA 2XQGA 1CUBA 1XRQA 2WJ6A 5E4JA 4HTAA 1DX6A 1XROA 4FOLA 3VVMA 3MVEA 3D59A 1EDDA 4YPVA 3DCNA 3DJYA 4YK7A 1AQLA 1YAJA 3OOSA 1EDBA 4QNNA 1VZ2A 2HA2A 3EQ8A 2DHDA 3BE8A 3W05A 1LLFA 5CH3A 2QRUA 4XWGA 5C8XA 5K3AA 1RWQA 5DNVA 5DNWA 3VJLA 1W4LA 1XLUA 3B3QA 4QDOA 2HA5A 5JADA 4GWLA 1XRNA 3YASA 3H2KA 5KBYA 2GBFA 5LZ2A 5DWDA 2R8BA 1VZ3A 2OCIA 3RM3A 4ZREA 4EY4A 5JZBA 1F6WA 4WY5A 3VISA 2GBGA 1EVQA 3IUMA 3WYDA 5AKEA 3ILSA 2JEYA 3D5EA 4PF1A 4C01A 2Y2VA 1Q0RA 1AURA 4OPMA 5ALXA 2CZQA 1UK8A 2OLEA 5I9IA 1W52X 3I2FA 2GYWA 4PSUA 2JGLA 2XUDA 2I03A 2JGIA 3D2BA 5CXUA 5ALZA 4BP9A 3G0IA 1EVEA 4D9JA 2HM7A 3RLIA 2XUPA 2HL6A 1ZIYA 3WL6A 1XZFA 4UBNA 3M3DA 3QMWA 5AKIA 1P0MA 2HU7A 3I2IA 4MWTA 1XLVA 3G02A 2IITA 4QWWA 4MQMA 5K3FB 1BEEA 4H7EA 1XZEA 2XMSA 2FUKA 4ZV7A 3FAKA 4YASA 3KDAA 4AMZA 1S8OA 3DEAA 1E8NA 3FWHA 2V98A 1ZICA 4OCZA 1LZKA 1YB6A 5DNUA 4RE5A 2AJDA 4ZV9A 1CFJA 2HDWA 3ZWQA 1YCDA 1YS1X 1XQVA 5EIAA 4BZZA 4BVKA 4W1QA 1UK7A 3WLAA 2QVBA 3DL7A 4G5XA 1MAHA 2Z3WA 3PF9A 1CPYA 2X76A 4BYMA 4A23A 5J3JA 5HFNA 1IZ8A 3QVMA 4NMWA 2WQZA 1E8DA 4H7JA 3WWEA 1QIKA 1BE0A 1SOMA 4X6UA 3ESCA 3LP5A 2C0PA 3JW8A 3OURA 2Z3ZA 1CRLA 1GQSA 2RAUA 3NGMA 1T2NA 2Y6VA 3DKRA 3AUKA 5AICA 1LPBB 1R9MA 1K4YA 1XFDA 4CIBA 3W9BA 2QXUA 3M83A 2RHWA 2PSHA 3G0GA 1DWQA 2CBGA 3H0CA 3WL7A 5JIBA 2QUAA 4F5ZA 3HRHA 4KAFA 5AM3A 5JAOA 5AO9A 4DYHA 2C58A 3ZI7A 3QH4A 1N5RA 4X7BA 1A8UA 3R3ZA 4F21A 4H35A 5JZ9A 5JAPA 4UFOA 4KE8A 5ALVA 5AI9A 4KE6A 1P0PA 4N5HX 3T4UA 2VSQA 3C6YA 4UUQA 1QIEA 4EY6A 3BF7A 1X2BA 1USWA 2XMCA 4PQEA 2PL5A 3C87A 2AJLI 4AN0A 1H23A 5CMLA 4B83A 3GA7A 2XB6A 3TGLA 3R40A 3WIOA 1NU8A 1XQWA 3H1BA 1MAAA 3STXA 2WSLA 1QJ4A 3VKFA 5JATA 4DTCA 4ARAA 2HFJA 3DD5A 4U2DA 2OCKA 5ALNA 1XZIA 3OPMA 2O7VA 5CURA 1DWOA 2WFZA 1KEZA 5ALSA 1DWPA 2YASA 1QIMA 4UHFA 4NVRA 3H2HA 4DMHA 3G0DA 4WFIA 3HJUA 4FFVA 3V48A 1JU4A 3GFFA 1UKAA 1ZD5A 1DTEA 4X85A 5A7GA 2QXTA 1U2EA 3WJ2A 4B81A 4Y2QA 2Y6UA 5HKAA 4N8SA 2ZJ7A 3SK0A 3HXKA 1MX9A 1JJBA 4CIAA 3DOIA 3DOHA 4HS9A 5ALPA 5AM2A 4DNFA 3QPAA 4JNCA 4NZZA 2VJCA 2C7BA 2WTMA 4BDSA 3TEJA 5AK3A 1B41A 1EA5A 2XMDA 1ODSA 1R4ZA 2WTNA 2VEOA 5HFAA 1C4XA 2QOEA 4M0EA 2C5FA 3BWXA 1F0PA 1QO7A 4WDQA 3N0TA 3IDAA 2QMQA 1LPMA 1LZLA 4Q1VA 2B4KA 2XMGA 1X2EA 5HKBA 4B80A 4OYLA 4J0KA 1MX1A 5LZ7A 1EK2A 3L1HA 5FP0A 3WKCA 4GLBA 4UHEA 1MJ5A 4H7KA 1H2YA 5CRIA 3I2JA 5CT4A 5CBKA 5BWBA 4HRYA 2VATA 4Q3LA 5CT9A 2CUTA 3GBSA 3KSRA 3Q0TA 3LCRA 4UHCA 5C7YA 4UHBA 4J0CA 2ACEA 4Y2VA 2PBLA 1HBJA 2XT0A 3PICA 5F4ZA 2HA7A 2QM0A 2UZ0A 4V2IA 1THTA 4OU5A 4Y2XA 1LPSA 2LIPA 3PFBA 4L9AA 1A7UA 1CUSA 1W75A 2FX5A 5FLKA 4FNGA 2QKYA 3HEAA 5AI4A 3WIBA 4TPKA 3WI7A 5JD5A 2HRQA 4F0JA 4K5QA 4LXGA 3V1KA 4BAGA 4UFPA 4G4JA 3R3WA 3NUZA 1H2WA 1XLWA 5HCUA 5JANA 2WIKA 3O4GA 4X95A 4O08A 3HC7A 2ZYSA 1BS9A 4K6HA 2D5LA 5EHXA 4ZI5A 4U2EA 1WPXA 1NU6A 5HF8A 3W2TA 5AOAA 1EH5A 4AMYA 3RK4A 5IKXA 4S0XA 4C89A 4EHBA 4I3FA 4QLOA 4U2FA 2BUCA 1TKRA 5T4FA 1X70A 3C6XA 1K63A 4X00A 4KAJA 3IVMA 4B9EA 4DSAA 1DT3A 1CR6A 2OAEA 1BCRA 2HU8A 1JU3A 4KEAA 5ALKA 3R3YA 5CW2A 5AIAA 2QJRA 3QMMA 1ORVA 3FBWA 2RGUA 4GBGA 3DNMA 2ECFA 4PV7A 4BAZA 4YX9A 2J3QA 3IULA 1QZ3A 1BRTA 3PFCA 1QIHA 1Q0ZA 2WFLA 5A2GA 2OXEA 3ZV7A 4W63A 1MT3A 1UK9A 2OG1A 4MJ3A 1H22A 2C0QA 1GT6A 1C7IA 1U65A 1CEXA 3I6MA 1UZAA 3MGAA 2WHQA 2GZRA 1LBSA 5HK8A 1XZCA 1XZGA 1XRPA 4QLAA 2ONCA 3GZJA 4Y2JA 4H0CA 4AZ0A 5JAHA 2CMFA 1XZLA 5ALUA 3WMRA 5E4YA 4U2BA 2I3ZA 1DINA 4MWSA 5E4TA 4FHZA 2QS9A 5LKAA 2PUHA 4DLNA 5E2IA 3O4IA 4LYEA 5AKYA 5KWJA 4X90A 3SX4A 3UUFA 3C8DA 1I6WA 1LPAB 4IO0A 4DIUA 1AX9A 1XRRA 5HF6A 4ROTA 4TVKA 2WILA 5K3DA 4W9RA 1ODTC 4QDUA 2WHPA 2H7CA 1JFRA 4OUKX 4ITVA 1LPOA 5AI6A 3VJKA 4AN1A 4BE9A 3LIIA 1FFBA 3AINA 2VF2A 1SCQA 3KWJA 3WA7A 4ZGBA 5CH8A 1BN7A 2JGEA 1IVYA 2Z5GA 1FFEA 1UOOA 5K3CA 5CXXA 4DNOA 3O0DA 1EDEA 1G4HA 2PU5A 2R11A 2G4LA 5T4EA 1MPXA 2VT7A 2RIPA 5DTJA 1YA8A 4OSEA 1VA5A 1CIJA 1WB6A 2OAGA 4FTWA 2PX6A 1THGA 1PJAA 4C87A 2H7XA 2HADA 4F60A 1EX9A 3STUA 5DYYA 4A16A 2PSJA 2WIJA 2JF0A 2HFKA 4IH1A 5EIHA 3ZLVA 4B0PA 2Z8ZA 1JKMA 1E8MA 1KU0A 5EHNA 3SC2A 1R9NA 2IX9A 4G8DA 1DQZA 5LIPA 3CCCA 4Y7DA 3FYUB 1WHSA 5BWCA 1GPLA 4G8CA 1GGVA 4KAAA 3WYNA 2HA0A 5FXMA 4ZWNA 4N8DA 3ESDA 1YB7A 3ESAA 1C7JA 5DYTA 4DNQA 3WKEA 3MUOA 5CT5A 5JD4A 1F8UA 2EDAA 4PSCA 5HQ3A 2AJBA 4Y2UA 2FJ0A 4MYSA 2H7YA 4AO6A 3L1JA 3HI4A 4DMFA 5FPQA 1WOMA 3D0KA 2ZJ6A 4WFKA 1PFQA 7YASA 1L7RA 4N5IX 3E1GA 1GKKA 3DQZA 1TCCA 4W1RA 3WWPA 4CCWA 2C4HA 3G9XA 4B6GA 3B5EA 5SYNA 2D0DA 5AKKA 3QBJA 1MX5A 5C8ZA 1UKCA 5DLPA 3FLAA 1QFMA 5JAUA 3K9BA 1R88A 4EB0A 4K6GA 5AI5A 5DYWA 2AJ8A 1AC5A 1XQYA 4PSDA 1LGYA 1MNQA 3ICVA 5AK4A 2BCEA 4BP8A 4FWBA 2WLSA 1A88A 4B82A 4L3WA 4XVCA 1MO2A 3V1NA 4L72A 5AM5A 3FOBA 4KACA 3V9AA 1QTRA 1L7AA 4GW3A 1BN6A 3HLKA 2AJCA 4J0IA 3JWEA 4KYVA 3IUQA 4BRSA 5C81A 4MYDA 4AB1A 4J0JA 5AKZA 5AI8A 5AIBA 4Q05A 2JGKA 2G63A 3STWA 1JI3A 5K3EA 1EHYA 5AP9A 2OCLA 3F8SA 5HF9A 1K8QA 1PV1A 2XE4A 1EB9A 4PO3X 4FKBA 1ZI9A 1GKLA 2CKMA 3B12A 1FJ2A 4FNMA 5ALYA 1ZGCA 1UOPA 1TCAA 3WWCA 3CN9A 4QA9A 2VT6A 1ZOIA 2ROQA 4WJLA 5ALIA 5IVDA 4WFJA 3C6ZA 3LLCA 4UBJA 3STTA 4KE9A 4LXIA 3QITA 2XUFA 2QR5A 2V96A 4QE3A 4J0DA 1IUNA 2AXEA 3A2NA 4Q82A 2K2QB 1ETHA 2J4FA 1H2XA 4ETWA 4XIIA 1QE3A 4X91A 5KWIA 3WJ1A 2XUOA 2X8BA 5K5EA 4UBOA 1Y37A 2CB9A 2XLBA 1XRMA 5EI5A 1MTZA 3S8YA 3D2CA 4CCYA 5LZ4A 1IUOA 4WY8A 3DLTA 2JBWA 3C8HA 3FYTA 3E3AA 1ISPA 4G4GA 4KRXA 5AKXA 1IUPA 6YASA 4MXDA 3D3NA 2Y1KA 5CTAA 1YAHA 5A7FA 2QUBA 3H2GA 3BIWA 5A71A 5KREA 4P9NA 5D7BA 4GECA 4BTLA 1XZAA 4UPDA 1LPPA 1QIJA 2DFPA 1UWCA 5LYYA 4ZRDA 4FLMA 3BJRA 4X6YA 5BOVA 2BUBA 3JYHA 2HIHA 3NWOA 2BUAA 2BGNA 1MU0A 3VVLA 3FLBA 4BE4A 3Q8WA 2DHEA 2CJPA 1RP1A 3QPDA 1ZIXA 1TRHA 2BFNA 5ALJA 4G1FA 3FVTA 2E3JA 5LKRA 1TAHA 4X93A 5AK5A 2O2HA 1LNSA 5LLSA 3OC0A 4ARBA 3H17A 3HZOA 5HF5A 3EIOA 1VE6A 2IIVA 2OGSA 3AFIA 1HL7A 2XQFA 2H1IA 2RI6A 5T4HA 3G9ZA 2RONA 4FMPA 3FCYA 2OGZA 1FFAA 2PSFA 3CN7A 3GELA 4B7ZA 1CUWA 5AI0A 2ORYA 3F67A 4HXFB 2HA3A 3G9UA 3KOOA 1HDEA 5AH0A 5FOQA 5K3BA 1J1IA 1YS2X 5D6OA 4AXBA 1O6GA 4BTVA 1XZJA 4UBMA 5EFZA 2CEKA 1N5MA 3HABA 5ALTA 4M0MA 2O7RA 2WHRA 4G4IA 4H7DA 2ZYIA 2WU4A 1XKTA 2PSEA 4P93A 5DTIA 2B20A 4UBLA 3O9MA 5CT8A 5C8VA 5FUMA 1XQXA 4C4ZA 3H04A 1G66A 1SCIA 3R3XA 3QZUA 5AM4A 3QMVA 5ALGA 2WIGA 2JGMA 3I6ZA 4I19A 4TGLA 2XUQA 4C6HA 4W1SA 3AIOA 1CUAA 3G8YA 3AZQA 4G8BA 3I6YA 4Q3OA 3OG9A 1BU8A 2XMQA 3U0VA 1IZ7A 1P0IA 1Q83A 2I78A
chains in the Genus database with same CATH superfamily
1UCFA 4WVLA 4ZPXA 3SWWA 2HWWA 2JIDA 2GZ1A 3QY0A 2GJ4A 4ZCSA 4AKTA 2ZJYA 3BF8A 4A0HA 4OXKA 3W2FA 4J03A 1RQLA 2VHTA 4KWTA 2EERA 2A58A 1CY6A 2X22A 2B83A 4RGBA 2C0CA 3UJNA 1AO3A 2QL6A 2IHKA 3R6GA 4L2IA 5NULA 3TE6A 1PG5A 1G17A 1COWA 2H7VA 3QRWA 1G16A 2F8SA 4AJ2A 3ASZA 4RPGA 3NHZA 1GL3A 2PZ8A 4RGYA 2FP4B 4XIYA 1W44A 4E1VA 1PJLA 1AQNA 3I2KA 4BMXA 1UT8A 1SA0A 2GM3A 3U4QB 2IS1A 1G98A 1OXUA 5B55A 1SBQA 2J1LA 1BDBA 4I0WB 2J7PA 1K86A 1QYCA 1S1CA 3MCAA 4HN2A 3AVWA 2XUGA 4QYWA 3RFVA 1NX6A 1QGYA 3C5WP 3GD7A 1XZBA 4OATA 2I3DA 4E46A 5IYZB 1B16A 3MTEA 4YMTA 2VPIA 3ANMA 1O8CA 2IOQA 5FKJA 5T5QA 2GVDC 3EQ7A 2PGXA 4X3CA 2OQIA 2YHIA 1VJ1A 1LLQA 1Y6ZA 2PZEA 5INTA 5KSZA 1KEEA 4EUSA 5KINB 4AMUA 3ZHVA 4D26A 5IZCA 2XZLA 1RJGA 1FXSA 3C4QA 3OOJA 3KU4A 4YRTA 5ISMA 4RZIA 2HSWA 1PR0A 1QLHA 1QOZA 1RLOA 4UC0A 4YI3A 2YZ7A 2QN6A 2YH2A 1ZI8A 3AJEA 3M3HA 1FVFA 1ABFA 3GF4A 4NCNA 2QTHA 3R8CA 4DEYA 3T3GA 1VQ1A 2G07A 4GF5A 5EXTA 2J4DA 2GNAA 5TSDA 4TYMA 1QHFA 1WQ3A 3GC6A 3AP2A 1AK2A 2UYQA 4LZOA 3P2YA 2E6UX 3AX6A 4DRZA 4E5VA 3B3FA 4YCLA 4WX2B 4UM9D 1QBKC 4L8FA 4X71A 1HOXA 2O2JA 2XMZA 2BFBB 4WN3A 4RF4A 4F72A 3VPSA 1GZ7A 3IURA 1ZCJA 3TW0A 3F0TA 3NTQA 1HYGA 1COWD 4K8OA 5HSGA 3GO4A 4B4DA 5B57C 3IOYA 3AILA 2J5RA 2YXPX 4JB0A 4V38A 3AUAA 1BHJA 1P91A 5FPSA 5KYXA 1UXIA 4W8HA 4UFNA 1C9DB 4BX8A 4MNTA 2J7PD 3ZBPA 3THWA 4HWPA 3H11A 4KXNA 2OORA 5NLLA 1L5HB 4M6WB 1M1YE 4RMIA 1UBFA 3TNFA 3TBHA 4XLZA 4JI4B 3RT9A 4IJQA 4U2GA 1I3LA 4QYMA 1M73E 1WUHS 4WQMA 2CMDA 1X1SA 3T0FA 1GVNB 1F0NA 4NE7A 3UQZA 2WYUA 4BGUA 3SYLA 3PE6A 4I2NA 4I5FA 5ESRA 1KFBB 2GBCA 3IGFA 2OFOA 4TV8F 4KLAA 4EX7A 4OUDB 4N18A 1L7PA 5J43A 1SKMA 4U39A 2CL6X 4LNUA 1U1DA 2DCMA 1X15A 2VQSA 5CHYA 4PRLA 4X5OA 2YRXA 3DT8A 3OQMA 3ZWYA 4HAXA 3MWGA 4LSMA 3SE7A 2ENWA 1AK9A 4Q7KA 4BE7B 1D4FA 4Z7JA 1TL7C 1YL6A 3OESA 4V0RA 1QB8A 2JH9A 3IERA 4LE1A 4BFXA 5HZMA 5TNXA 4EFNA 1PZXA 1ZD3A 4AF7A 4FGUA 4H7FA 5HM8A 1RKQA 4XQ0A 3Q8XB 1T29A 5DB4A 1E1KA 3VKUA 4RK0A 5DYIA 2EJVA 3C43A 3OF2A 1SC1A 4C05A 1HNXB 1MNAA 4UBKA 3VOTA 1AM4D 1VLQA 3F9RA 3ZUGA 1L5NA 2QT0A 2VCEA 3LBNA 1WY7A 2BFFB 2F8LA 2I3GA 2ATEA 3G7NA 3QE3A 2C88A 1CY8A 1VXRA 4RSRA 1ZU4A 1UANA 3QUBA 4CL0A 3BG5A 3AL2A 1BVHA 1PL7A 10MHA 1TJ4A 1QCYA 2Q4RA 3HVKA 3I04M 3KT3A 3PL1A 4LN1A 1M34A 4BEWA 4IIJF 2E85A 4JQCA 5IN4A 1MH1A 3GFPA 3PI6A 2W2NA 1WCYA 3K05A 3QFHA 4R8VA 4ZEMA 2XKJE 4TUYB 1HKUA 2WR8A 3IKLA 4NYJQ 3EA0A 4L16A 2P75A 3G5LA 3GRUA 3OCUA 4GX0A 4B3MB 4HPWA 5I45A 3CF4A 3ZXXA 2XYGA 4FD3A 3PUJA 3DM9B 4EA8A 5GJBA 4YMGA 4CEJB 4R2LA 4NFYA 4QUDA 3BVPA 3WK8A 4J91A 5KYWA 3KDSE 3E0XA 3MWEA 5JSFA 4RJ2A 2JHCA 1BX3A 4BV8A 4UOQA 2H59A 3E7DA 4PZZA 4MCJA 5L3ZA 3WYEA 4KAXA 4B3XA 4CW7A 1DT5A 3TTUA 2OGTA 5CT6A 5DCWA 1N0IA 4EUFA 4D97A 4Y0AA 3U7FB 4X44A 3UGJA 4X63A 2NUAB 4XQEA 1E32A 2PXCA 1BCRB 3JASB 1Q19A 3O6VA 4QOIA 2CT8A 2IPOA 1IB0A 2P5YA 4UMEA 3GGDA 1S1MA 2V7TA 4I81A 4CMJA 3UMGA 5IG2A 3O95A 3PX7A 3MT9A 4QJ3A 2O2CA 3CQ9A 3W04A 3FTCA 4BX3A 4POOA 1E4EB 3UF0A 1E3WA 1VJRA 1EWYA 1AKTA 1KI2A 5FO0A 2GHQA 2O6HA 1KTVA 4BOYA 5C18A 1RAIA 3IHTA 3QKWA 2DQSA 2VHYA 2V1UA 1CLEA 4FOSA 3RC9A 4C4XA 2QUZA 4M1YA 2YXLA 4PGMA 3ZCPA 4RTRA 1N2BA 3RANA 3LQFA 3UHOA 4ALKA 1RQNA 1W1IA 4NU8X 1ZGHA 1NJSA 3DD1A 3HYSA 1OXXK 5DWVA 2MSNA 3P2MA 5EQFA 4CLOB 2IV7A 3EQ9A 1AXEA 1PVDA 3F9CA 3GRPA 3F73A 2QNBA 1JSXA 2VWPA 3EHEA 4ZVLA 4IEIA 3MN1A 1KI3A 1QG4A 4RV9A 2OQ2A 4L4ZA 4CMIA 3OIUA 1QM5A 1NVEA 3L06A 3MGBA 4LY6A 5JTTA 2O7SA 2QP4A 1LV7A 2NX2A 2ORIA 2VNHA 4ILEA 3D8NA 3AEKA 1Q1EA 3JYNA 4UE2A 2WUFA 4I3HA 3SJAA 1Y1RA 3UUWA 3W06A 2O3UA 3EYAA 4XX0A 1D3AA 1WXFA 2DR0A 4ZU6X 3C1TA 2A0YA 2QYHA 3N2GB 3MMZA 1YR6A 2ZRKA 2ZWMA 1DJNA 3I5AA 4ZVSA 4LJSA 4Y2TA 4DR6B 1XMVA 4BO0A 1FIUA 4M1MA 4F6RB 1F9AA 4P53A 3BTVA 3F3MA 4LMBA 5BV2P 1Z3CA 1RQPA 2JGAA 3MJTA 5A4IS 2YZGA 2V6IA 3IFSA 1KY4A 3OPYA 1NVKA 3JRWA 2ALJA 2F6RA 1ZGBA 3HXTA 5AVWA 1I13A 1LLCA 1YF3A 2D06A 2QT9A 3K94A 3LV8A 2GN1A 1QFXA 4P4GA 1YE8A 2Q6TA 3LOQA 4AZ0B 3BT7A 1Z0UA 4UBIA 2IV3A 3IIMA 3MMNA 1ZIDA 5JBIA 1A9ZA 1KR5A 3K6SB 1UOQA 2BF7A 3KR1A 3KYDB 2PKEA 2WQ7A 1JBQA 1JIUA 1ANKA 1MP0A 4GO1A 3C3BA 3R6WA 1R64A 1RT9A 3USZA 1V5WA 1Z74A 2WKSA 4BZWA 4D4IA 5L3SB 3HL0A 3RF6A 3MINA 3PRJA 3T7CA 3ZLTA 3FDIA 4HCJA 3WYFA 3WKBA 4DCPA 2JJ1A 3OQOA 4G85A 4BGVA 3T9DA 3OT1A 3E1SA 1U4OA 2VDLB 3ICOA 1TC2A 5IT0A 1M8PA 3LCVB 3HKCA 1O6FA 4ZCRA 2PGLA 4CLRA 3BJEA 3AHDA 3ZOKA 1M2JA 1KTIA 4CEHB 1NMEA 3QENA 5G53C 2TYSB 4RZQA 5F2NA 4JCOA 1J8MF 2G8LA 4DR7B 3BGDA 3HO8A 4CM3A 1JTEA 4YH1A 2VJAA 1MO4A 1NRIA 1MN6A 2C4VA 3OQIB 5FFNA 3BDIA 3HNOA 1YJBA 3P4UA 4P38A 2CD9A 1SOUA 3ELWA 3IVRA 2GCNA 3ANYB 4G0VA 1JHDA 2GBIA 4RHCA 5B6JA 1UBMS 4AP6A 2IH2A 1EDOA 5ENVA 2V3VA 4TL6A 4DDUA 1J9ZA 2IDMA 4CLXA 3IBFA 4YT2A 1K1EA 2GK3A 2NXNA 3MSXA 1I10A 1PYOA 1YUBA 3EUAA 2G72A 4RL4A 3ZZ0A 3UW1A 4AG3A 3OIDA 1AUPA 3G2OA 2O0JA 2W2OA 1C4WA 4ED9A 1GUZA 1JR6A 1G4UR 5CIWA 1SHJA 3P0IA 3FVQA 2Q5OA 3UH0A 2Z1NA 3F5FA 2YWFA 4LXHA 4OB8A 3EPLA 1JWAB 2VLBA 3HO1A 3BJZA 1V96A 1WDLA 4Q24A 3LCJA 1B3BA 4YYEA 4DUPA 5BWNA 2X5XA 1U2GA 1UC9A 1ND5A 2EIXA 1IM5A 1WMAA 2JJ1D 2YIVX 3U3KA 3EFHA 5CFRA 1YTUA 4GXNA 1KI7A 2CB0A 4B3RB 1FB5A 3MFQA 4HGRA 3ZKWB 3QA9A 1ABBA 2FMIA 2FPIB 2KLBA 4LQ4A 2VQ6A 3HDYA 2HYIC 3H16A 3GI1A 3GT0A 4OHBA 3R3JA 4KR7A 1JDJA 1JGTA 3TJRA 1PJSA 3ND9A 3ROTA 4E4TA 2XCLA 4G24A 3DDHA 4N3BA 2EQ5A 2VTKA 4S05A 2OFPA 2O8BA 3EFBA 1CF9A 3E9NA 1RWNA 3ZWPA 1TOAA 2CLCX 2XX3A 1H3NA 1QWSA 4LUCA 2CLHB 2YFQA 2YQZA 3KQSA 3L7AA 2YBDA 2VCHA 1QIGA 2MCFA 3RFFA 2BM0A 1U6IA 3RC3A 2IUUA 2J9ZB 3HLTA 3L5KA 2OCXA 4LYDA 5EMLA 1BS2A 2ZJFA 3HJTA 3BH0A 2VC2B 3F6CA 3RSOA 2ANBA 2ZRDA 4D9MA 1G8HA 5LP6F 1LBEA 3L7YA 3G5TA 1P2VA 3GV0A 4LISA 2R68A 2VZ8A 3NHYA 3PIDA 4MWZA 4CR8A 5I7VA 4CF6A 4PSAA 1BW9A 3PGVA 4GE0A 4BPRA 3PZBA 2LVBA 2R1TA 2YJ5A 5HK9A 2G25A 4DS3A 4M1TA 1W0CA 1NR1A 1JHZA 2DWQA 3O9VA 2NW6A 5KU7A 1TTQB 3WZ2A 5LMNB 2J3DA 4WL0A 1C81A 4RGQA 5HJ2A 5CDFE 4P7FA 4Q0MA 5H3HA 4CE6A 5C1IA 5TY0A 1W34A 1T0JB 2EYUA 5EXSA 2BGLA 4I2VA 2A5JA 2NUBA 4KPEC 3DE6X 4GMGA 4MK4A 3I0ZA 3K72B 5EYPB 4UDXX 3U9TA 1AZWA 5HKKA 5KJFA 3UH1A 1SVKA 5GM1A 2I4LA 3M6VA 3O8DA 4XM1A 1UEJA 3U1TA 2V9CA 4UE3S 2R1UA 1FP4A 1POXA 1HE8B 1FRZA 1CQWA 1JG3A 2ZI7A 2J5QA 3H1GA 4N47A 4HVTA 3NTRA 3V2HA 3PD1A 4URXR 1L7NA 3FX2A 3I9V1 8MHTA 2JH8A 4AY3A 3E81A 3UOAB 1Y8RB 1GNLA 1C9JA 2ZUBA 3IALA 2C95A 4GNKA 1KJYA 2BSAA 4DLRA 4EYGA 5JW6A 4YMUA 1K5HA 1JHOA 1NLUA 1NNSA 2J6IA 3FWNA 2YZNA 2EBWA 2G9UA 1QP7A 1K5PA 1A5AB 4JL5A 1KOGA 1YVEI 4C76A 3PYLA 4PZYA 2RHHA 5H81A 1W7AA 3KLBA 3AETA 5EP3A 2QTMA 5LU9A 1EGMB 3TVDA 2W2QA 4LKRA 1K08A 3IMFA 4ZAGA 1NFFA 1UMBB 1RW4A 1UFQA 3HO6A 1U2TA 3O4JA 4Y2PA 4BCBA 1ORWA 1U9JA 5CVUA 1N6NA 1CVLA 1F8XA 3R0QA 4M9CA 4OXNA 4MMYB 1QYIA 4UCFA 3EW9A 2EFHB 4LE2A 3THOA 4E2ZA 1W5BA 1DO8A 1G0OA 1J8FA 3LXMA 4ER7A 1E66A 4XIGS 5ARCA 3FTEA 5B7PA 2XQIA 1NQWA 4AWBA 1I7PA 3VSEA 1NVAA 2XNDA 3RVOA 3DLCA 5B3KA 5HKKD 2B2XA 5GMOA 3HUFA 1AK1A 2GKGA 4LHXA 4AICA 3OEED 3F6YA 1V43A 3W6PA 1IXSB 2PLWA 3UMMA 2J9FB 2RE8A 1TYDE 2DJIA 2HOQA 2MMCA 4C4TA 5JASA 3G8DA 1PI3A 2DLNA 1S3SA 2Q6IA 3NAZA 1E0AA 2J3HA 3SEQA 1OXMA 1F6DA 2VJBA 1E5TA 3O84A 4C4PA 4RHXA 3RVRA 4NOJA 4BFWA 3ZNNA 1JDVA 2OAQ1 2B0JA 4B3HA 2G5TA 3HJHA 4XXHA 3FTDA 4R0VA 4AF8A 3FZEA 4RTQA 2QRVB 3SS7X 2OC4A 2G5CA 3ZE9A 3WFIA 2Y99A 1VI2A 4X97A 2ZIVB 1NC3A 2F90A 5ES4B 3DPSA 2C82A 1MC1A 2QTBA 4G0NA 5F98A 2R8XA 1T9DA 1GU7A 2ZRPA 4M88A 4DT1A 4Z49A 2XECA 1V7QA 1PGOA 2RGAA 3D3WA 3NHFA 3Q7QA 5K8JB 5IAOA 4YCAA 3E70C 2PUTA 4KMMA 3TGPA 4TKUA 3B3AA 2W70A 1MRZA 1IQRA 3H99A 3OUUA 1LV8A 3BB1A 5J2TF 3UHJA 4OLFA 2JJQA 2D1SA 5AW9A 3TBFA 3V33A 1RWKA 2IDKA 1S9HA 3U5ZB 1PWYE 4L6AA 4Q4JB 3F97A 5T67A 1NW3A 1XKLA 3NHSA 3R8XA 3OQNA 3VU8A 5CEJA 3I4CA 2XNDD 3WMEA 1AKNA 1WXIA 2FK8A 4L95C 2EP7A 5U9CA 1RRKA 2A1TS 2R3SA 3H8SA 4GX2A 5JD6A 5FOWA 4M1ZA 5TQ0B 4BHTA 4X8MA 3NWEA 3T54A 3QUTA 4GPAA 2ZTUA 3ORHA 4LG1A 4CEIB 2QN1A 1O9HA 4MVJA 2PK3A 2QX6A 3D2AA 4D98A 4O2BB 2KJQA 3LDFA 1UC8A 3RJ9A 2C2GA 3W8DA 2ADOA 2YYSA 3JQBC 4LKOA 3ZGYA 1U2QA 2B9VA 2FPKA 2ZJBA 3PENA 2W7TA 1RAGA 4BCDA 4DR1B 3FYHA 4UNSA 1AS0A 2GB4A 3U39A 5J4KA 3FUVA 1AB6A 3FCXA 4LXQA 3G0CA 4HDSB 2JFNA 3IR6A 4EK9A 2QY9A 4TL7A 5IVIA 1CUEA 2OOSA 4IVQA 4IYRA 1TIBA 2EX0A 5T3UA 4BZQA 1D8AA 1UZUA 1WF6A 5BMOA 4QATA 1FUUA 5BSHA 5K0BA 2PR7A 3RC2A 3BQ9A 2BN4A 2WZDA 4K05A 4C0AC 4CFSA 1AUQA 3WXBA 1S0UA 3U7IA 4KR6A 1TKBA 2AD1A 3VMMA 4P2BA 2QPOA 3AJ8A 3EZ9A 4DXDA 1WQ4A 4ZI2A 4OHRA 4CJXA 1N9GB 1CUGA 2H5JA 3WBKA 4KFTA 4JR1A 2CJYA 2H2DA 2FGKA 4L50A 2C7RA 1VYTA 3U31A 3FYUC 3RVMA 1R3DA 1V37A 4PINA 4XPIB 3U3OA 4YDRA 1TEVA 2FLVA 2O5RA 4WNAB 5ENZA 1NJ5A 3O82A 4AO8A 1JEYA 4CG0A 2Q1SA 5E7JA 3N1UA 4AY5A 3BMOB 5IM5A 2ZT7A 4AJPA 1D1PA 3ED1A 4KPYA 4MVJD 3VJMA 1JDBB 2Y77A 2HK7A 4GP7A 1XQ9A 3NOOA 2R4TA 3A27A 3L0BA 5CX4A 1IPHA 2Y1FA 5EUMA 2G9ZA 2VQ3A 5AKLA 3LPMA 4FYVA 1ESDA 1VL0A 3NT2A 4A0RA 1U04A 3L92A 3RASA 4DJEC 1VKHA 4ESHA 1XMPA 1JT9A 1O3YA 2AEJA 3U44B 5EESA 2D4AA 1XPRA 5CYOA 1EINA 1E5DA 2XGSA 4OUDA 2QNIA 1JR3E 3LIPA 1KJQA 1LRKA 1R2QA 2X7XA 3I42A 3KKEA 2XB9A 3R3VA 2GWHA 4KI7A 1CU1A 1M7HA 2JLBA 5LWHA 4X1KA 1DO0A 2H2AA 1N5OX 2AW3A 2ZWOA 3KYBA 4YUVA 3T06B 4BFTA 4GMHA 1Q3KA 3MUFA 4B80A 1TJYA 3DL2A 1T5DX 1QTIA 2FN7A 2H85A 4GR5A 4HQ6A 5CPBA 3UJBA 2DTDA 2M98A 2YVLA 4B44A 2XOXA 4TSRA 2GTIA 4FX2A 1Q1QA 4MIOA 5CLGA 1JR2A 1YS7A 2XVYA 4PW0A 1J70A 2L17A 3OLCX 3N05A 3I4FA 1H2RS 2HZ7A 3K6KA 1I4TD 4MS1A 1O0CA 1SFRA 4KUGA 1KP3A 3IC5A 1KYQA 1RXUA 3A10A 5CVDA 3ZU3A 4OSPA 1TFUA 4IGEA 4RTNA 2REQB 5KTRA 1V4NA 4U7JA 1FXWA 1KXZA 3DYVA 2ZU6A 1QQ6A 3DE3X 2GCOA 3NTXA 4J4HA 4W82A 4M86A 1XZKA 5GONB 3AF6A 3M4JA 2PZGA 1U1FA 4PZLA 4MQFB 4F1WA 2IOHA 1OGYA 3DOUA 4TUYA 2XMRA 2PYDA 3HA3A 1V4VA 2P8JA 2WAOA 2DT5A 1VE7A 3GZNA 4M0FA 4DXAA 2J67A 3L4BC 1NUQA 5BQFA 2UZIR 1K6JA 2ERXA 2YV1A 2JIMA 2VHXA 2BMEA 3FPFA 3FR7A 3BZWA 4GDMA 2BT4A 4UMFA 3VPGA 2GJ9A 4DQKA 1G21B 2GM5A 1E2IA 4BMCA 3UUEA 2WSMA 4C4SA 2Z08A 5JV5A 3ZVNA 4IIYA 4V02A 3BXPA 4QGAA 3GFTA 4Y1EA 4IRXA 1PFWA 4CMBA 2DSNA 4Z6KA 2J08A 1N9KA 1VHQA 3JASA 3ZLUA 3VTFA 2PVPA 3SEZA 4Q1AA 2I2AA 2YIDA 2YY6A 1Q21A 1R6BX 3I1IA 4KDEA 2FDCA 3LOPA 1LNZA 3IOEA 1QGDA 3TYXA 1UZLA 3WHPA 3HJAA 4O4IB 3IKTA 5E8JA 2X3FA 3CTMA 3MS2A 3OWOA 4XYGA 1ZYUA 4B73A 2GASA 3QHAA 2H1WA 2OPBA 3OZSA 3MELA 3O74A 3B9PA 1JKFA 4ZAXA 4YREA 4WCFC 1LF5A 1VKOA 5FNZA 4EUEA 4YY3B 4O4JA 2GEUA 5JCOA 3RG2A 1VBFA 4F8YA 4RAOA 5F7XA 2PLNA 2WC1A 5FPYA 1GRCA 2K4MA 3KPYA 1QOQB 5L7YA 4CM5A 1R5OA 2GSWA 2VSYA 1F4LA 3JVDA 4IX1A 1N2CA 2GARA 3KWLA 1GYRA 3CW8X 3PQ5A 1QX3A 2IU6A 4KVGA 4MV0A 1J0CA 4C9BA 1NM5C 5GOTA 2Z58A 1N33B 1CQJB 1ZMXA 3HLYA 1P31A 1ULHA 16PKA 3D6MA 4U7TB 4CKBB 3GRYA 1GAWA 1R9JA 3AXSA 3BH6A 4D8WA 2NV2B 2CHQA 1L4LA 3BJIC 5A05A 3IEVA 3DLPX 5H82A 4N5DA 1QDLB 3TI9A 4FFWA 4JBWA 4EPXA 1XALA 1I2ZA 3KKMA 5ARBA 3EQZA 5IABA 1OC4A 5LMZA 5EHQA 1L5ZA 5HRUA 2HBQA 2W6JA 3KT6A 2H5EA 3VPCA 2GSDA 4UJ3A 4C78A 1E1DA 1U0HC 2PU7A 3IOMA 4BUZA 5ENDA 3FBTA 4DM7A 2BWJA 2PJDA 5IKPA 5HZKA 1XJCA 5IF9A 2E4YA 1U8AA 2V4UA 1Z6XA 3DMRA 3NBZC 3JSAA 1A71A 1TD1A 4MV1A 2X77A 5E6RB 4E11A 5HIKA 2PUBA 3K6SA 3BRSA 4FGZA 4ER6A 1W2GA 4ZQBA 3T35A 4X1OA 5FTKA 2MSWA 2WG0A 3CSSA 3H5RA 3DWGA 3MFYA 3PDCA 4MQEA 4ZO9A 3W5AA 1EBBA 1PKEA 2CNBA 3F4BA 4TMYA 5I7WA 1PUXA 2BRUA 1NYRA 3S2YA 3SVTA 3ZZMA 3T3MB 2V7BA 2Y0DA 4LHWA 2EZ4A 3I1YA 1K2WA 3Q0IA 1NVBA 1WXEA 2JLWA 1OWMA 3DDZX 3EBPA 8ADHA 1NUSA 3AIMA 3D7LA 3RVBA 1JJAA 3VKHA 3N0RA 2GA9A 2AR9A 2YIJA 4D9EA 4XYEA 4G25A 4LRYA 3P0RA 5CHEA 2VP3A 2WI8A 3I37X 4P36A 5EMHA 3TQQA 1ZESA 3OC6A 4YMIA 2A92A 1X8XA 1U0LA 3RC7A 1II8B 3IS3A 3SQNA 1XRQA 2AR0A 1GPUA 2B1QA 3BL5A 4RS4A 5E4JA 1K4MA 2YICA 4HTAA 3WGGA 1LI7A 2W90A 1J8VA 1O57A 1VJGA 2W6JD 3TRIA 4DMMA 4TLMB 3VVMA 5CB8A 2ZR0A 5KTKA 2Z6QA 1OX6A 4QDJA 3HB5X 3MVEA 3RCBA 1SVSA 2QRPA 3TZEA 3UMVA 4GE3A 4GYYA 1YAJA 2OECA 1QH9A 2Q8QA 1YZGA 3L7KA 1EDBA 3OOSA 4G26A 4KQEA 3U7JA 4D2IA 5KQGA 2AOUA 1NKTA 2HA2A 4PCAA 3PRYA 1QHYA 4NEQA 1XTVA 4MS3B 2OB1A 1S2OA 2J0EA 4V0QA 3KZMA 3R9KA 5C4IA 3KJHA 1ENYA 2F62A 3HFSA 3WGOA 3SKXA 4DIDA 4R0NA 3EG5A 4J6EA 3N2YA 3NTUA 1U28A 3A1EA 4Q01A 3QLVA 2O14A 4H0FA 5BN3A 3LA6A 4CGZA 3GPDG 3NXKA 4N0MA 2P27A 3AB8A 3MZ0A 2OHHA 3PHLA 3RWOA 3PWKA 2RBEA 4FYPA 5I7HA 3M7IA 1JG2A 1Y1TA 1Q3HA 3JQAB 2E6KA 1XLUA 2FQWA 1K06A 3KO8A 4OM7A 4WPGA 3B3QA 1T2VA 2HMVA 1CQIA 4BNJA 1DPGA 5B2FA 5K8TA 4QDOA 1ESMA 5KQRA 1G2PA 3WS7A 1UPAA 1NVDA 2FPXA 2HA5A 4WSOA 1RHQA 5DSTA 5A3RA 3LYLA 2C2OA 4CMEA 1ORIA 1MB3A 2BGIA 2BKVA 4M7WA 5KZMB 2NVOA 2P4HX 2GBFA 2CDCA 2YQ5A 5EP4A 4BWYA 3LXUX 4X0EA 4I99A 5DWDA 1WSWA 1GILA 3ZIAA 4CIYA 1DJPA 2DUNA 1JPVA 5KWSA 3UJDA 3R7NA 2OCIA 1OI4A 3CF0A 3RM3A 1E64A 2MINA 4OBEA 3IDFA 1W0JA 1N3BA 1Q3TA 1KFJB 3VZCA 3FKSA 1U1EA 3WYDA 4DF3A 2YV3A 5E6UA 3PWZA 3EJWA 1SXJC 2P41A 3ILSA 5IJ0B 5BR8B 1L8AA 3E23A 2H0RA 2JW5A 2ZYAA 3FUUA 3TIIA 2PRZA 4G89A 2MU1A 5JNUA 2JK0A 2LIVA 1N2OA 3LVBA 4HADA 2X8LA 2G1JA 3I5MA 2VJLA 2WM3A 2H2FA 3HA5A 3IQIX 4JLDA 4OPMA 5JAQA 5CJJA 2C8VA 3QU5A 1J49A 2PO7A 3LA8A 4NZMA 2DWCA 3UV7A 4J7CA 4F04A 3AWIA 5I9IA 2FX2A 2HWUA 1BHSA 1WVGA 1G5IA 1W52X 2VRWA 4JP3A 2WAXA 4JUDX 2HR1A 1JYFA 1Y8AA 2VDUE 5D6NA 5CPFA 2OV1A 2O19A 3B7PA 4KL8S 2YZKA 3FAZA 3MIZA 3RYFA 3PNMA 3JYOA 2VNIA 2I03A 5FUQA 5JQWA 2B21A 2ID8A 4JN6B 1IU9A 3D2BA 1LVHA 3V5NA 2DKFA 5B58C 4NQZA 5ALZA 4CIWA 4BX2A 4D96A 2WYHA 4LV5B 1G19A 2G28A 2DUMA 3H1TA 4YP0A 3S99A 3ZNQA 2D2FA 5F51A 1GOTA 4D9JA 1OAAA 5EIBD 4FM9A 1KAMA 1D2MA 4NMMA 3KEFA 2YHAA 5KMGB 4DABA 2YWHA 4AZ3B 1Z5NA 4UBNA 1S89A 5AKIA 2HTFA 5CXQA 1GXSB 3DFMA 3SZOA 1UUFA 4RO0A 1OTYA 1PZHA 1E2DA 1KS9A 1YVPA 4PSVA 1G59A 1QPBA 1A95A 1RIIA 4R7TA 2FPUA 4HX5A 4JC4A 1NYLA 1DBPA 3LYAA 1W0JD 3I1FA 4H7EA 1N0VC 1H5UA 2WFAA 1AO0A 3FKSD 1VG8A 4F97A 1P7WA 1OYYA 4UMVA 3FDXA 3EASA 4YT8A 4P7GA 5IJ9B 1NF2A 3R5HA 3IKVA 1CY4A 1E2KA 2LCIA 2AGVA 3QP9A 2XMSA 4JR0A 4RA9B 1G8FA 4XD2A 2JI9A 4R98A 4ZXPA 4ZKDA 1ZH8A 1J2UA 1UMBA 4JWTA 4DMLA 3PP8A 5C4MA 1Q6YA 3VC7A 4OLJA 1MIOB 4S12A 5CVTA 5CAEA 3K7EA 1J0XO 1E8NA 3FWHA 1U0JA 3BXOA 3HP4A 4DLAA 2FVXA 5I9NA 1OB5A 1Y1KE 3DDWA 4XZ3A 3S2SA 2I55A 2POQX 2AT1A 1D9ZA 2PE5A 4Q9DA 4TQGA 1NI4A 3FYDA 5EPOA 4C29A 5I3ZA 2JLAA 2ASEA 5ARDA 1TQ8A 1X1QA 1JSZA 5CLHA 1YCDA 4CR7A 4E7OA 4ZO4A 3RTAA 2RGXA 1H2BA 2XZDA 3I73A 2YFKA 2BKEA 4KIFA 1NE7A 2IW1A 3P96A 4QNRA 3SZ3A 4BFYA 2XBLA 5EJEA 3A06A 3IQHX 3TKYA 4XFKA 3WY9A 4RJJA 3WLAA 1EJ2A 3LWDA 3DL7A 3EAGA 2XEDA 1QV7A 4G5XA 5LBUA 4DC1A 3P5SA 1MAHA 5ALKA 3DVSX 1GPAA 3JRNA 1WOYA 1JDSA 2DFKB 2X76A 3DZBA 4BYMA 1AMUA 4NK5A 1OFGA 4B4UA 3KNZA 2CXOA 1F20A 2HB6A 3LPCA 2WQZA 3SFVA 3EPPA 3FFTA 3ENWA 3UCFA 3SHOA 1E6MA 1KO8A 2QRVA 4I1YA 1L5MA 3ZTYA 1L5LA 2P5SA 5F76A 2C0PA 5E0KB 2PYZA 1JNYA 1NUAA 2Z3ZA 1JL3A 3OT4A 3PBKA 2W6QA 4FI3F 4ND5A 4LHYA 1SM4A 5CB4B 4QBIA 3E5MA 3IQGX 4U02A 1B15A 2RAUA 4V1CB 1KSHA 4ZO8A 3U3JA 5LNK6 3MHPA 4U7GA 2KHZA 1ZS9A 1T2NA 4FYKA 1UJCA 3P9ZA 4EYSA 5AICA 2ZRGA 2HUPA 2XAUA 1BCSB 3BD8A 2EFEB 1LPBB 5B1DA 1KE1A 4EM6A 2BDUA 1HT0A 2E1RA 4R84A 4YUZA 5M5BA 1CZKA 2RHBA 2NNWB 1R6XA 2QXUA 2P0YA 3QBTA 5BXQC 1DELA 3G0GA 3H0CA 3EGVA 3VNAA 2QUAA 2XJ4A 5JAMA 2EX4A 3O83A 4QDKA 5AO9A 5IMBA 1NNI1 3VU1A 4B33A 3IA7A 1RM3A 2JCSA 3H9JA 3REGA 3OJ0A 2CHEA 4Q4AB 5L3VA 3ZI7A 4R6WA 1XMIA 2JDIA 5FWYB 2DPGA 3EGXB 5KNLA 3QXCA 3HUTA 3U4CA 5L4NA 1N5RA 3D6NB 2VH5R 4BBAA 2F43A 2PX5A 3IPLA 2QZZA 2WHYA 1WG8A 4FE4A 2QX9A 4X7BA 3R3ZA 5EJ4A 1YK1A 2FUCA 4EG3A 1T0BA 1MBZA 3ONDA 2AOVA 3CVVA 1OB2A 2BI4A 1JA0A 3R4CA 4H3KB 2ID4A 1TX4B 4O4HF 2OLKA 5AI9A 4LW8A 2I87A 5BORA 4TZ6A 3E3OA 2X7JA 4CHTA 3IO3A 1O6CA 1SCDA 1YC5A 4WESB 2LCFA 4JLMA 2UKDA 2PMBA 5HDBB 3U0BA 4IXNA 1Q1NA 5EIWA 4LQCA 3GOQA 5BNTA 1IZ9A 1SBNE 5H5JA 3ZE7A 2ATIA 1USWA 3I8XA 4PQEA 3SKVA 3ZJYA 5C9ZA 3GNQA 1Y3FE 3NH6A 4TWAA 4DV0B 2I3AA 3C98A 4R3UC 1JEAA 2H4XA 2VHUA 1H23A 1RI4A 1S2IA 2ZBQA 4B83A 2APJA 2ECQA 3KALA 2GPJA 2CL5A 5JISA 5TGZA 1CJBA 2IPAB 3N7UA 4JD5A 5KNDH 4H3SA 4M0LA 3DXFA 3R40A 3EXEA 2LD4A 4D9IA 2HK8A 3QU2A 2GLXA 3NT5A 4LS3A 2VSNA 4XPIA 3ZH2A 1XZ8A 1XQWA 4ZALA 2AX3A 3X2SA 3HCAA 3KELA 2GBLA 3PDUA 2JDID 2WSLA 3MT8A 3LHIA 3FDZB 1A7KA 3OQJA 4MUXA 1KOJA 4EJFA 4YUWA 4WK2B 2ODTX 1XU7A 4O63O 4TMVA 3AI2A 3IUEA 4V0KA 3NUQA 2PKXA 2Q5HA 4C1NA 3EXFA 3HB7A 1M2NA 4BFVA 3EAQA 2NV0A 2OCKA 4IRUB 2C42A 3EY4A 1UBSB 2Q5LA 1XZIA 1U02A 3V7UA 4F3YA 2O7VA 3LMKA 5CURA 1AJEA 1DWOA 2B0CA 2J87A 2IYLD 4NCHA 5EJ8A 5K0SA 1M72A 3T34A 1J20A 3UG7A 4TV9F 2ZB8A 2QTWB 1GNPA 3U44A 1W5SA 2QTRA 3K16A 5GZ1A 4M7RA 2PEYA 5JNSA 1KL7A 4DIBA 1TNDA 1QHNA 2H8KA 5BR7A 5BV1A 4DV2B 2V7GA 2JZCA 1QDEA 1ZA1A 2Q3BA 4C22A 3UA3A 4NVRA 4J2TA 1EGAA 3CGWA 4NATA 2D54A 3WGMA 2O1SA 1JG7A 4HH4A 1P6XA 4KWHA 3MEQA 4Y6LA 1S02A 4TL8A 5TQJA 3G0DA 4AYWA 4EUHA 4MQUA 1IM2A 3EFOB 4FFVA 5FJJA 1QK5A 3L79A 5CW1A 2VTDA 3SM3A 1NT2A 4WEOA 2ZQZA 4Y6QA 1JU4A 1TYBE 5IJXA 4G56A 4DJFC 1B2RA 3GFFA 1K92A 2PQ2A 3HP7A 4O4LF 3MCVA 5LYJF 3N2IA 3FPCA 2XSZA 2IZOA 2R2AA 4LK2A 5IDVA 1AZSC 1TVEA 1YFZA 2GZ3A 4IJKA 4RVFA 2PWYA 1SVLA 4GLJA 1GADO 4FFLA 4YP5A 2W2PA 2ZAGA 3LX5A 3OZWA 4R68A 3RYTC 4IZHA 4DAOA 721PA 5HKAA 5HTOA 3O8QB 2GN4A 3B1FA 1WMSA 5J40A 3BTOA 4Q03A 3NOQA 3KAQA 5FNVA 1JJBA 1P75A 4Y30A 2AKYA 4V3CA 5IH3A 4F2WA 4ER0A 3COJA 4JP1A 1K0UA 2BOVA 1MO5A 1V16A 4EATA 3B53X 4BBJA 4DNFA 3QPAA 3B6KA 1HDYA 1DCMA 4Q47A 2C7BA 1OWPA 4UAGA 3TJZA 3W77A 4BDSA 2UYHA 4YCBA 1ORTA 1XUOA 3IVGA 1EA5A 5FFMA 4M53A 1U0GA 2XMDA 4EW2A 2O54A 1L5VA 1BGXT 1QOPB 2WTNA 1R0WA 3KB6A 3NEAA 2O3TA 1QTQA 3FJOA 3KKQA 2NO7A 2VK8A 2GF2A 1NRWA 1I14A 2FF7A 3P2OA 4BZPA 1C4XA 4MAMA 1SXJB 4KO3S 4MUFA 3AGPA 4YJGA 1SD2A 3BBPA 2XODA 5BW8A 4EL0A 2C5FA 2G1KA 1F0PA 1GG2A 2ILTA 4LTDA 3GHHA 3HK2A 3N0TA 2QMQA 1U3TA 1FYWA 2ZR9A 3CRRA 4IF6A 4RY9A 3BWDD 1GR1A 1KJ9A 2XSZD 5JVDB 1WO8A 1S8FA 2XMGA 1XD8A 3VU9A 4QHSA 3Q72A 4L74A 5CLJA 4OYLA 5J5CA 4FZJA 1ELOA 2G70A 4MJ7A 5T41A 2GPTA 4IIVA 2NXEA 1BMFA 4GKAA 2WF9A 3L1HA 3TZ6A 4KSYA 2PFSA 4E12A 4D0SA 4J94A 4H7PA 1LVGA 1YUNA 1C3LA 4UHEA 4V0LA 1SMKA 2QIPA 3P4YA 4DIFA 1YIDA 2ODEA 2WT8A 3QTLA 4XE5A 1H2YA 1XCLA 3I2JA 5CRIA 3EIUA 5J4HA 1T13A 2TMYA 2VKTA 3FVWA 2R7AA 4Q3LA 3CLRD 4CKBA 5KQMA 2IYXA 4PNEA 3GBSA 2OBNA 4C3VA 2FPMA 2YCLA 2HK6A 4KODA 3VOAA 4I9FA 3PPWA 4DEVA 3KEQA 3DNFA 3OO1A 4FQ8A 4QICA 4A10A 1QP8A 2EJCA 2Y1OA 3OEHA 4K03A 5JXGA 4J0CA 5IAKA 3P2EA 4IS3A 4R71A 1KORA 2FW6A 3SQXA 1S96A 4CKWA 3RS7A 4ZODA 2VNSA 1HBJA 3D6TB 4FSHA 3LUJA 1NQTA 4M55A 1L7DA 1RYEA 1XCJA 2FFJA 2XT0A 4JELA 2XIQA 4M98A 4YO8A 3VM6A 4LFAB 3PICA 1QYWA 4EGJA 2DEUA 1ENZA 4OP2A 3E35A 3C5CA 1P9WA 4YT5A 5AW8A 2UZ0A 4J16A 3S8EA 4PE5B 4ZVUA 1ECLA 3DP7A 3OKCA 2W2KB 2HHHB 5BY2A 3UGKA 2ZETA 4Q3DA 5KPDA 1Z5WA 5TT1A 4HMQA 1R4MB 2X6RA 1LPSA 2XJ9A 4RKYA 3LLMA 2H18A 5LA6A 5AW5A 5MDHA 4Q4CA 4HAUA 2J0QA 1SCNE 4FN4A 3BRCA 1SQGA 5LUAA 1GGHA 1ZN8A 1W75A 2FX5A 2JL1A 1DKOA 3CLTC 3HBAA 4IHJA 5FLKA 3F6SA 2XWSA 1A4UA 3TPZA 4WZBE 3HEAA 5AI4A 3TQSA 3WIBA 4TPKA 3TAXA 1VPEA 3I52A 5JD5A 3CWZA 4DLSA 1QG0A 1IWOA 4F0JA 1TA4A 3T5GA 3V1KA 3U19A 2R8YA 1IHPA 1ZJWA 3K9LA 4X1YB 4IJUA 3UK6A 5BNWA 4PZAA 5I8WA 4QGGA 2HMUA 4Q9NA 1OH7A 2EBHX 1Q7RA 1OX5A 2B8TA 2V6BA 1C14A 3TR0A 4BUCA 4YROA 2Y1CA 2RHCA 4QQNA 3R9XB 2XUZA 4S04A 3B9QA 4YLEA 3TCNA 3ZW8A 5FQOA 4B87A 1XLWA 3LX8A 2XNHA 2P2SA 3PGXA 5EJ2A 4PBSA 5HCUA 4BEJA 3OEHD 3CMMA 1QR2A 3RYIB 4D41A 3FE2A 4QBFA 1T9GR 4O08A 1M5UA 2JGDB 3AEUA 3HC7A 3OHPA 4MGYR 4MW5A 4NE9A 5DX8A 3W6NA 1GPBA 1P73A 3VPFA 3DBIA 3PT5A 4IV8A 1BS9A 4MCHA 4K6HA 1NG9A 3WRVA 1E5QA 3G8BA 3HN6A 4C43A 4U9IS 1LQTA 3GLGB 3VUFA 2D5LA 2YDYA 4TWZA 3Q3JB 3KOYA 4EVSA 4ZI5A 4U2EA 1N78A 4MQ4A 4AJ4A 1M6NA 4ZMRA 1L7BA 1DQSA 1G18A 3CSDA 2YHSA 4NCIA 3SSOA 5DM70 3T3DA 4LXYA 4DEXA 1EDZA 1C3VA 1XELA 2G3YA 2P9TA 4KXMA 2OBYA 1J9EA 2PNFA 4GH5A 5SY6A 4NYJR 3PB3A 1K2VN 1RE0A 2G36A 3U3DA 3JQQA 3SLKA 5ILOA 2BEJA 5IKXA 3DE5X 3KVOA 4C89A 4CYMA 1F3LA 1JFFA 2JAXA 2JCYA 5FORA 1GQFA 1I32A 1MJHA 4QYIB 3EWAA 4QLOA 3ZBQA 1Z39A 1MABA 4ID3A 5T4FA 3V97A 1MX3A 2O8DB 2VBFA 3A4TA 4Q4DA 1AQ6A 2F4NA 3C3YA 3VR3A 13PKA 2QL7A 1R7RA 1F3OA 1ZSNA 3JQAA 1KVQA 4I36A 4PXSA 1BYIA 3U5TA 2FG7C 4NDZA 1KNXA 3AVQA 2VDMB 3L0PA 5IKEA 3PG5A 4HQNA 1C1XA 5CFQA 4DADA 2ZM6B 2ZU0C 4V0NA 5IRCD 2GXQA 2J6HA 5CIYA 1RHKA 3CUUA 5DM0A 2OAP1 1SELA 4LWQA 3E22A 4NZNA 3TW4A 4I5GA 3RVLA 3QPVA 1JU3A 4UE6A 1WVMA 2JIBA 1JYSA 3JTMA 1KZGB 3O4VA 4KEAA 2QX7A 2QUKA 1XNGA 1SZJG 3PFFA 1XTBA 4MB0A 1V71A 4N01A 2Y66A 2HWKA 1VTKA 2QX4A 5LQKA 3FBWA 3B1XA 3KZNA 3D6VA 3DNMA 2ECFA 3M6FA 4PV7A 1L6RA 1VMIA 4JFRA 5DO9A 1A04A 3V4FA 4BAZA 3L1UA 4CT5A 3QLUA 5K8IA 4ABTA 1BKSB 3C7TA 1GCUA 3L6BA 3O8OA 2WJPA 3JRXA 1TC1A 3HYNA 3OZFA 2HF2A 1UEXC 4CKEA 1D4AA 1Y6QA 2VPYA 3DHEA 4JGIA 1YR7A 3KV1A 1QHIA 2ZYTX 4ZCQA 2WFLA 3ZHZA 5A2GA 2FPRA 4J2OA 3EUEA 1HE1C 4PLGA 5AXAA 4BFLA 4W63A 1PD1A 1MT3A 3IDQA 3BGOS 4FCCA 3LP8A 1US8B 2B69A 4FC7A 1J0AA 1KAOA 4K9DA 4MJ3A 1VLJA 5FV7A 3M9WA 1C2TA 4DCVA 3TZLA 4O2AB 3IPCA 5L3QB 2C92A 4GQAA 2YNMC 3I01A 2C0QA 3LTEA 1GT6A 3OLVA 3TEFA 2WPDA 2VUUA 4JIMA 2FB9A 2LWIA 4LYYA 3RS9A 1I7LA 4DWVA 4UHJA 1V3TA 3JQAD 2RK6A 2HQSA 2PBRA 4BNFA 4JVLA 2Q8NA 3CG4A 3O90A 2EZTA 3TZCA 5F3WB 1C9KA 1N7JA 2G17A 4C3OB 4BKMA 3PD7A 1NHGA 1ZD8A 2BSQA 4QLAA 3BL6A 2W4IA 4QXRA 4P80A 4EGAA 3QYPA 1F2VA 4IOMA 2LDXA 3GZTB 2O1XA 2F7SA 2V0GA 3GQBA 1FBNA 5D85A 2AC7A 3MXOA 3ZWCA 1DO2A 2PAAA 1ADBA 1Y63A 1B3RA 1S3IA 1TCUA 1VFNA 2O4UX 2PJZA 1MW9X 2ZIWB 3AKYA 4RAQA 3DUFA 1NW4A 3AFNA 3DAGA 3IP7A 3MM4A 3PU6A 5EIFA 1F9EA 1XEWY 3H6KA 1R6DA 4KSBA 1OWOA 3CFYA 3K73O 4HUQB 1U7XA 2WAMA 5FLEX 4HH3C 4DSTA 2O8CA 4AS3A 2NUTA 1T6YA 5JLJA 5E4TA 3HMKA 3NV7A 5CVJA 1UJ6A 1UBGA 2W2XA 3NKLA 5E2IA 2AMFA 3DXYA 4IL5A 3O4IA 5SYAA 4CFYA 5LOVF 1H66A 1RPTA 4Q93A 2AOTB 4TS3A 1B2LA 3JAWB 2C5EA 4JKIA 1NNEA 4QUJA 2JHAA 4OEHA 4GP6A 3QEMB 1G8YA 2YMMA 5IDXA 2IRWA 5BVHB 1JVBA 3UMRA 1W88B 2XAAA 4BKUA 1FLVA 2DPMA 2WPDD 1J7JA 1RYZA 4JLWA 2OWEA 4XUGB 5JI2E 1I6WA 1WDKA 1Y4SA 3SEAA 4Z4IA 3LCMA 3CZRA 1DIRA 4IO0A 3KVNA 4G01B 2SKDA 5T8KA 4NJOA 4HL6A 3THSA 2QA5A 1A5BB 3M70A 7ABPA 1LSOA 1NT4A 2ZI3A 4GIBA 1IHXA 4RULA 1X8KA 5B7QA 4P3YA 4TVKA 1IHDA 4TTPA 2WILA 3TH5A 4KHPB 4Z4QA 3T1VA 1T1EA 3X43A 1T3LA 1WJGA 4GUAA 4CIVA 1ODTC 2PZMA 3FHTA 1VKZA 2QJOA 2H7CA 4AN1A 5AI6A 3ZDYB 3P9SA 5I3CA 1F14A 4BE9A 1IY0A 1L4MA 1JKXA 2YN4A 4N65A 5BMVB 4O3MA 1T3TA 1YWGO 2JJYA 2PFGA 2QM7A 2VYFA 3Q3IA 4P54A 4H31A 1BEUB 1YDEA 5DT9A 5FOVA 4UEKA 2GZDA 4EHLA 1OTXA 2VO1A 3HHPA 3ON5A 3WGYA 5LNK1 1D2NA 1P6QA 3LRPA 2Q0HA 3T1HB 4DZZA 2PLFA 2ODNA 4QPNA 1FNCA 1TT5B 2Z5GA 1R0ZA 1Q77A 3JZIA 4MP6A 1CIPA 1RLMA 4PZUA 5CXXA 3IJ5A 1DAPA 4G09A 4NZOA 4DNOA 3GCDA 2GM4A 4V1CA 1EM8A 2R11A 2VT3A 1EP3B 4BTEA 3T95A 4F38A 3BMNA 2OV3A 4M83A 1Q95A 5T4EA 1OQAA 2VCYA 3EF0A 1LDEA 1MPXA 1NC1A 1NF9A 3FB1A 3MAAC 1DAGA 1LBIA 4HRAA 5IW8A 2VT7A 5ICSA 4M9RA 1NW6A 4DM4A 3IILA 4BLPA 1N2JA 2H07A 1GKUB 2G77B 1JWLA 1YU9A 1EK6A 1VA5A 2P2DA 2P62A 3ZLBA 2FQXA 4DIKA 4FZRA 2OAGA 3CRW1 4FTWA 1MA0A 2JZOA 3GUHA 3E7PA 1THGA 1XYYA 1IJFA 4KXYA 4U7PB 3SBDA 4MUNA 2X4GA 2WWHA 2W8BA 1ZA2A 3AEQB 4Y9UA 2H7XA 4WOCA 5T6MA 4R3NA 4XM0A 3AY3A 4LMRA 1R8YA 3QVGB 1SQ5A 2W2VA 4ISCA 4IUYA 3QG5A 3HDQA 4KQ6A 1YZLA 2NN3C 4YP6A 4DY6A 1GJRA 3HKDB 5A4DA 2OBMA 2QN9A 2FWPA 4LWZA 3SSMA 2AH5A 1QRSA 3STUA 4A16A 3L3BA 4MKXA 5G4KB 5IC6A 1VHJA 2O2EA 1H94A 3QLEA 4KXLA 1SKAA 5K6TA 1U0EA 4ASUA 2JB9A 1GSIA 1UIRA 5DXAA 4JMLA 4CQJA 1KQGA 4RLQA 1KU0A 1MO6A 4PWYA 4JLKA 1MD9A 5E3JA 1T9HA 1LK7A 4K81B 4C2UA 3CH4B 3Q9UA 4B17A 4E1AA 3CF2A 3VTAA 2O8EA 3TW6A 4EGFA 4FWTA 1IN7A 1CZUA 1G20E 4QIHA 3UKDA 2WWXA 3EDRA 5K01A 4BL5A 5CD9A 1BVYF 2FPPB 4GM1A 1Y8CA 2HNKA 2VL7A 1B0ZA 1LDMA 4U00A 4QHTA 2PJRA 1YNSA 3N53A 4X41A 3L82B 3TNJA 4U5QA 1ZSVA 4AWAA 2VDVE 3RJZA 3CRNA 4TXLA 4MUMA 1G2QA 1GPLA 2HHLA 2Z9DA 1N4AA 4DYVA 4BJ5A 1YQDA 4TMTA 2FDRA 2FKAA 2JCGA 1RACA 1DXOA 5I9BA 4P86A 3V8MA 1V95A 3F3KA 4YCMA 2G7ZA 4G5OA 4FFDA 1H1LA 3TFWA 1H9CA 3GR6A 3PQ4A 5DIZA 3MPOA 1ZUNB 1JNXX 3CINA 3IODA 3CONA 4N8DA 2AI1A 1VG0B 2DY0A 4AF6A 1I94B 4UASA 4MB2A 2FZGA 2ZRBA 4UUBA 4RTLA 1E3TA 3QMPA 4P4SA 1SQ6A 3EXAA 5DYTA 4QBHA 3T6KA 3AFGA 5REQB 1JZQA 4UEQA 1CYDA 1A72A 3WKEA 2VJYA 5CT5A 2OENG 1DWUA 1F8UA 5JQGB 1M0EA 1D7OA 1M66A 2NIPA 4ASUD 4DV3B 5HQ3A 5ERXA 2R1VA 5IWAB 2AJBA 2E1PA 2FJ0A 3LFTA 2H7YA 4HSGA 4YRBA 3EGOA 3CSUA 1PGJA 4HWSA 1L8OA 2Q2QA 2QMUA 2EX1A 3EGIA 3L8DA 3AU8A 4KHZA 2NZ2A 1UBHS 2ZJ6A 4A6DA 1M5TA 1XRSB 3RYHB 3FWKA 1LB1B 1LS1A 3VHXA 3G23A 4L3OA 1V9SA 3ES9A 4BLRA 7YASA 1S8NA 4R5HA 2YJ4A 1WD5A 3E1GA 1V25A 2BFMA 3DQZA 1S2LA 3OU6A 4FDAA 3U09A 1TCCA 1O89A 1J90A 1GPJA 1SXIA 2DULA 3EVAA 3U1BA 1SXPA 2GS9A 4EHAA 5DNYB 4EMTA 2NMVA 1QE5A 5BW5A 4CCWA 3EFOA 2ZQYA 5JH7B 1WULS 4MVJF 4Y67A 3SJZA 2ZANA 1A2BA 1BKDR 3GEDA 3NBXX 4DCSA 1UKCA 1GFZA 1JKJA 5DLPA 1K68A 2NO1A 2X19A 5EQJB 3KLNA 2RHRA 3KKLA 1YKSA 2GPSA 3H2ZA 3P9RA 5IYZF 3Q10A 1Q74A 3D1JA 3BRWA 2PLRA 4RK7A 3H7AA 3EDYA 2FFRA 1LY1A 4PSDA 1AF7A 3H2SA 4D8XA 3VAAA 2BD0A 1AKYA 2HBYA 3ICVA 3EN0A 1HOTA 2YIMA 2B4RO 4S2UA 1REQB 521PA 3LVFO 3CA8A 3QW2A 2YOFA 1ISJA 2G09A 2Z4TA 1X13A 3ZV6A 3BB3A 1U2PA 3DTVA 3ONVA 4NRDA 5ITZA 5B1SA 1HWYA 1CEYA 4LBWA 3OH8A 2R65A 3NPAA 4OQ4A 3VHLB 1A88A 4B82A 1K0FA 1QFYA 1KO7A 2C4WA 2DX7A 2E48A 3KP1A 4XVCA 3GLFB 3V1NA 3NBYC 3HV2A 3WGLA 4L72A 2CUZA 1P2DA 3PFHA 4S1OA 4Z1MA 5HX7A 3MBIA 4C7OA 4DLUA 4LF4B 4MW2A 3W1EA 1N6IA 2P9ZA 1QTRA 2BSXA 4JLSA 3OZGA 4M22A 4WEQA 4B3CA 1X7WA 5DNEA 3RBAA 1AHPA 1LH0A 1BN6A 1VMDA 2R1ZA 5TJHA 4DCCA 2JI7A 3G1UA 4KLZA 4Q7MB 3U1VA 4PYNA 3GJ6A 2YZMA 1UADA 3DV9A 1I51A 3JWEA 4H9GA 4RABA 1GRRA 5JCZA 1WP4A 4BRSA 5DLEA 1GAJA 2X40A 4PHTA 2V9PA 1HI9A 2XITA 1VDMA 1JR4A 4JEUA 1Y4ZA 1JJVA 1PT5A 5AI8A 4Z4FA 3K30A 5JY6A 3A0RB 2E18A 3S70A 1HYBA 2FNAA 3EZ6A 2XKAA 1UBNA 1B76A 4B6FA 4FE7A 5KUTA 4QSMA 2FSVC 3BRWD 4RM3A 1EHYA 4L78A 3T5BA 4TMXA 2RJ3A 5JTUA 5DHFA 5KC9A 2ZYVX 1RRMA 1UKVY 1N2IA 4P3PA 3ZQUA 5WRFA 5A2QA 4ZT3A 3T0IA 4MV3A 1E2FA 4PO3X 4CQLB 1V7ZA 2CLEB 1B43A 3JSXA 3DBOB 4A8JC 5F5NA 3B12A 4R0MA 1VHLA 1FJ2A 3Q11A 4FNMA 4X1IB 4WBNA 3S81A 4EPWA 3DTVD 3QKUA 3V1TC 5D51S 3WWCA 3CN9A 3KC2A 1SUWA 4LMPA 3OLYA 4QA9A 5I5GA 3U61B 5DFAA 3EC2A 1UM9B 1JB1A 2VT6A 4W8GA 4D3FA 4Z1MD 5H0IA 4ZZ0A 4MHTA 3DHYA 2ROQA 3B85A 1IDN1 4LYHA 1USGA 4YV2A 3PDIB 1YO6A 3TIFA 4U8GA 1KZ9A 1XXHE 4ZT7A 5C7IO 1E59A 4IFEA 1N0HA 3QITA 4U7DA 1EHIA 1C9MA 1BDJA 1XNJA 2C7VA 3D1LA 4G0XA 2NM0A 2R5NA 2WTAA 3U80A 4DSNA 1G9XA 4LC9A 4QARA 5AVKA 4WOPA 5JJKA 1T15A 2B99A 4CTJA 3HYRA 4J0DA 1A76A 1MAVA 3L0SA 2R4UA 3E61A 5B3JC 1JQJC 4H3HB 4TLCA 4WKGA 2VDRB 2AYXA 4RPHA 1AGPA 3DFFA 4B76A 4C7XA 4ETWA 4XIIA 2W2KA 5CDUA 1MB4A 8GPBA 4TUYF 4KXWA 3W0LB 1QE3A 4X91A 5LDHA 5GINE 3SYTA 1VJDA 1DOHA 2VHZA 1DBWA 1UAYA 3N8KA 2VKQA 3O8BA 4HGZA 2OMEA 3QELB 3CLUC 2G5GX 4M7PA 3WJ1A 1P5JA 1ZK3A 3K96A 4BQRA 2I99A 1L5QA 4GI5A 4W5JA 5DGXA 3GLIB 4LBVA 2WKRA 1TIPA 1Y37A 4BFZA 1NBME 5DN9A 3OLXA 4RFSA 5IJAA 4L4UA 5B7NA 3FPKA 4MRSA 4PTLA 1VPDA 3ZHTA 2E4VA 1HE3A 3LRXA 3CRVA 3CEPB 4OXIA 3S8YA 3KTAB 1B00A 3VI4B 3EJ6A 3QOWA 1SOAA 1VM6A 3BIFA 3OZXA 3RJMA 5KOJB 5LZ4A 2X42A 1L4UA 5DP2A 1ZM9A 4L5AA 1EFPB 2IP1A 4OA8A 5DRTA 1OH8A 3O8NA 1K7XB 3AVUA 2IDZA 5TVKA 3CUYA 1TM4E 1X7XA 3MGGA 5E9QA 3SS8A 3FYTA 1C0EA 2O50A 3D0OA 3E3AA 1NY5A 1U9IA 3F7TA 4R40A 3ENVA 3HU5A 2YDXA 4G4GA 4GPBA 1HMPA 2CXHA 3DC2A 4ENRA 3I4LA 1ECPA 2FG5A 1XVLA 1E7WA 1KQPA 2JGDA 2IXFA 4N12A 4IIDA 1EVIA 1ML3A 4ZOLA 3SC3A 2H5LA 1IE3A 3DVQX 1YAHA 2BGUA 1WXDA 2FEKA 2J5XA 3AR8A 5EE3A 1SCUA 2QUBA 3ND6A 4B4WA 5BYKA 4EG6A 3WR5A 4NKRA 1OXSC 1ATIA 1R16A 2R6GA 1ECCA 2VUHB 3KKZA 3CYFA 3QYFA 4GGMX 4O0LA 5HXAA 2YWEA 5K09A 3R44A 3R0JA 2Q99A 4LZNA 2FPGB 4NHEA 5HQJA 2JFWA 2J33A 3CISA 3DH0A 4K6FA 5IBPA 3TO5A 1DBSA 1NULA 1SHZA 3X2FA 1A9XA 1GD1O 3NYQA 4IDOA 1W2HA 2PKQO 4ZD6A 3ZS9A 4TXNA 3NTVA 4RJKA 4YP1A 3D31A 1UWCA 4TS9A 4F91B 1KI9A 1CD5A 1FU8A 3BJRA 3UY4A 5LQAA 3N0WA 3LKVA 1VHWA 1JIIA 2F17A 2CFCA 2YOHA 3QVVA 3PS9A 2FA9A 4MWGA 5E6SB 1GAQA 4FFBB 4FT2A 2HH9A 1Z62A 3KQWA 3T0GA 3T99A 1EMDA 2IIQA 4HC4A 3SQOA 4D43A 2BUAA 3Q6MA 2BGNA 2XTMA 4ZYXA 3DCYA 3O4FA 1CHNA 2VUTA 4IQFA 5AK0A 3VVLA 5ESDA 3K3PA 1K89A 1RADA 1YCHA 3IQDB 2MYUA 3WLPA 4A9AA 4R2WA 2XE8A 1GCOA 1MAWA 4PYOA 3UT0A 3VKVA 4EDFA 1Y8QA 1FRNA 3DBRB 1YVRA 1U9CA 1Z13A 2ADFA 2NQTA 5HFJA 1RYDA 4DBLC 3Q41A 1V3UA 1RP1A 1ZIPA 2C2HA 3QPDA 3HRKA 4G1MB 4OMCA 3DC7A 3CF4G 4QQ8A 5LP6C 4DQUA 5BSGA 1M2VB 1MT0A 2BTQB 4NP6A 5ALJA 4E33A 3DZFA 2G9RA 1XTTA 1OC2A 2IXTA 3NCTA 2Q7OE 3RSSA 4BO4A 4EJSB 2HT1A 2BCJQ 2AZ4A 1RU3A 1XA0A 1E3IA 2O2HA 4L6CA 3HDJA 3IP6A 5TARA 3OC0A 4NYIQ 4RTPA 2E4WA 2DFDA 1UODA 4HLNA 3PGKA 2EL7A 5E2BA 1RKVA 3DVAB 3GLHE 3H17A 4HTFB 5JC8A 1RLJA 3KQMA 1ZN9A 2F55A 5KSOA 1TA0A 2IJGX 3EEFA 1CS0A 5FOUA 3T7AA 1UKEA 2P1ZA 1US8A 1VE6A 1Q16A 2Q3FA 4NDAA 1V9CA 4NF2A 4HFMA 4MWOA 5JSQA 2GEBA 3O75A 5JEEA 4IEEA 1MCZA 1EFHA 2AG8A 2CJFA 1NJGA 4MW6A 4RD0A 3S68A 4HDMA 2OGSA 5JSKA 1I9GA 1TW3A 1WMDA 4AECA 1PK8A 2I29A 2B6NA 2H1IA 2SECE 2SCUA 3PC8C 4RKQA 2RI6A 4BQPA 3ISVA 4LPSA 3UWOA 2NNLD 4BLSA 3G9ZA 4BV9A 2BYTA 1FJHA 1PS9A 2C9ZA 2RONA 2Y1WA 4HP8A 9ABPA 1YXMA 4GPEA 1M6WA 4OGLA 3BHIA 1SC4A 3CIFA 3UJ7A 2J32A 2OGZA 4AJ9A 1FFAA 3GELA 3A36A 3H75A 3LTNC 4QUIA 2VR1A 1R6UA 4XR9A 2PGAA 1ICEA 2VH1A 1GSAA 2A94A 1O97C 1FTYA 1BU5A 2Q3HA 1I4OA 2H65A 2HMWA 5FWAA 4ENVA 3KOOA 2AI3A 2QY6A 1A9RA 1KVSA 4R2XA 2O23A 3AF5A 2F9LA 1DJQA 1JZTA 4Z8XA 2RGCA 5FOQA 1J42A 2QQFA 4ZT6A 1PUIA 5EL0A 3VPHA 1NUTA 1CG6A 3NETA 2JVIA 1QAMA 4AXBA 1VI6A 4KX3A 1CS4C 1FJXA 5TQVA 4IJ6A 4QULA 5TV2A 1ZC3A 3WL3A 3K9CA 5CUQA 3ZS8A 5BSEA 1LBQA 3IQFA 3UAVA 3HMQA 2RGWA 5MN6A 3GJ0A 1PEYA 1RC1A 1SZDA 2Q6KA 1PR9A 4J6FA 3PHGA 3ZHXA 3VYVA 5CDGA 3ICEA 2CEKA 5SZJA 5F1PA 2B6HA 2QORA 2ACVA 3K0CA 4Y0VA 1FQJA 5GV8A 4LGMA 5KSYA 1ZEMA 3G1TA 3QVXA 4G4IA 4GSLA 4H7DA 4NR0A 3GP3A 1HA3A 3OE4A 3UJPA 1WZUA 3TPCA 5LQCA 9ATCA 4BGDA 3DQQA 4RYDA 4X84A 3B9RA 3NALA 2WU4A 4AC9A 1XKTA 2XT6A <