5FLMH

Structure of transcribing mammalian rna polymerase ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
148
structure length
148
Chain Sequence
b'AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5flmH01
2PNHA 1A8VA 2ID0A 5E7NA 4LF7Q 3RNUA 3GTKH 3I55A 4LWCA 5GAEC 3ER0A 2F4VQ 3HOUH 1X3EA 4HJ9A 5EAYA 1C9OA 4MTNA 3CXCA 5M3FH 2JA5G 4LFCL 1I94L 3PV0A 3PO3H 4DR7L 3L7ZC 1I3QH 4X62Q 3J81c 1Q12A 5K36G 3PGZA 4ME3A 1JMCA 1Y14B 4GOPA 4IJHA 1A62A 1U0LA 2R7FA 4GNXB 4NPSA 1SFOH 1YEZA 4AYBG 4YHHL 3GTJH 2VUMG 2HHHQ 4A3GH 4DR5Q 1HZBA 2KENA 4IO9A 4R1JA 4DV6L 4A3FH 2BA1A 2VQFL 4QQBX 4YCVA 1JT8A 5M5XH 1N34L 1R9TH 1PFSA 4B3MQ 3RLOA 1LTLA 2BA0A 4RMFA 4P72A 5BR8L 4A3BG 4JI7L 4L5QA 1ASYA 2YTXA 1XMOQ 3PF5A 4GKKL 1L1OA 4AQYQ 3A5ZB 3GO5A 1YJWA 4LFAL 1Q46A 4BBSH 4DV2L 3I4OA 2E5LL 1MIUA 4O2DA 1AH9A 1NMFA 4IPDA 2Z6KC 2NZHA 4J15A 1NE3A 5C0XG 3A5UA 4HJ7A 4DR3L 3FKIH 5IYBG 1PH8A 2R7ZH 1XNQQ 3S15H 3F2BA 1C0AA 1QUQA 3AFQA 2K14A 3AEVA 1PH7A 1PVOA 1NTGA 2E2JH 4LF9Q 3T1YL 1W3SA 4YY3Q 3PF4A 4BBRH 1K0RA 3KF6A 2UUCQ 1CSPA 4HIDA 3GTGH 1KAWA 1NY4A 5IYBH 4B3SQ 3CPWA 3S24A 2Y0SE 5IE8A 1D8LA 3G71A 1TWGH 3KDFB 1J6QA 4DR2Q 1SRUA 4YWKA 4A3MG 4DV0L 1PH3A 4XTCS 3PCOB 3OTOQ 3EN2A 1S72A 4LFBL 4RG1A 2VW9A 4YCWA 3CCUA 1LYLA 3CC7A 5C4XG 2PI2E 3D31A 2A8VA 1YJNA 3K8AA 1XJVA 1HNZL 1VQ6A 5JJIA 4NXNL 5J3BA 2N3SA 1H95A 4NXML 1E7ZA 1K73C 1JJCB 1I94Q 4LFCQ 4MZ9A 3W5OA 2R92H 3PUYA 4DR7Q 1U5KA 4A3LH 5DLQE 1E1TA 3B6YA 4GNXA 5ELOA 4JBKA 1KRTA 4DUZL 5AJ3L 4AH6A 4TVAB 1WCMG 3CCQA 1RL2A 2DGYA 4GKJL 3M3YH 1SMXA 3HKZE 4QY7A 4OXPA 2I5MX 4LW1A 2N8NA 4P73A 4C3IH 3BZKA 1IBML 4YHHQ 4R4TA 1CSQA 4A3KG 5LMNW 3GD7A 1OXVA 3HOYG 1V9PA 4DV6Q 1PH2A 2VQFQ 2AWNA 4JI1L 3JAMi 1VQKA 2N78A 1N34Q 4BA1I 4DV4L 4A3CG 1NBWA 4JOIA 2RHSB 3MXNB 4LF8L 2LSSA 1JJGA 4A3DH 4P74A 5BR8Q 1VQ9A 2JE6I 4JI7Q 1HJPA 4DAMA 2AWOA 2I0QA 4DUYL 4GKKQ 4A93G 2A1AA 2VY3A 2XTIA 4LFAQ 4OO1I 3CW2C 3I4NG 2QA4A 2I5HA 3J81j 3K7UC 2YV5A 1VQFA 4GLAC 4DV2Q 2E5LQ 1X3FA 2PQAB 1VQCA 2WAQE 2WB1E 5C44G 1N33L 5C3EH 3RZOH 1FJGL 4DR3Q 4DR4Q 2K5NA 2V1CC 2KHIA 1KRSA 3PO2G 1VQGA 1CKOA 1Q8KA 4C3HH 4X64L 3KJPA 2IY5B 4A3JG 4C3JH 4JYAL 3DLLA 3CF5A 3T1YQ 4JI8L 3OW2A 2OWOA 2LXJA 4P75A 3S16H 1K8GA 2VL6A 4IPGA 4ALPA 3HOUG 5LMUL 4NB3A 2NN6G 4DAYB 1XPOA 3KDFA 3TS2A 2YTVA 3PSIA 2AHOB 1HZAA 3PO2H 2K4KA 3J80i 1P8LA 4HIKA 2K75A 4QJFA 4OX9L 1NMGA 1WI5A 2VZAA 4EQ5A 3ICEA 1PH6A 2ZTCA 4LF6L 1D7QA 1BBWA 1OXUA 2PI2A 1HZ9A 4DV0Q 4BA2I 3M4QA 3HOVH 3PIOA 3CC4A 1G51A 5JJLA 1UE1A 1Q1BA 4K0KL 4LNQA 4KHPL 4LFBQ 4A3GG 1GKHA 1Y1WH 2UUBQ 3I4MH 4A3FG 1Q81C 3Q8DA 4PZ8A 1HNZQ 1TWCH 4OWTB 4NXNQ 1L1OC 5IYCH 4JBJA 4NXMQ 3GTLH 1EIYB 2R7DA 4DK3C 2JJQA 1X55A 1MJCA 1GM5A 4BXXH 4DUZQ 5AJ3Q 1YHQA 4GKJQ 2NVTH 1GO3E 1V43A 1YIJA 3D0FA 4BBSG 4UPAA 5FJ8H 1QVGA 1PYSB 2D0PA 1IBMQ 2K5VA 1HNXL 1EYGA 4X6AH 2VQEL 3UDXA 3G4SA 2R7ZG 2KHJA 2GN5A 2ZJQA 3RLFA 3FKIG 4UP7A 4JI1Q 3S1NH 1VQMA 3E9HA 2MFIA 1WOCA 3G6EA 4DV4Q 4JV5L 2Y0SG 4LF8Q 3GDEA 3U4VA 2UXDL 3CC2A 2CKZB 5C0XI 4DPGA 4BBRG 3JAMc 1JE5A 4R4OA 1VQ7A 4DUYQ 5H1SE 2PQAA 2EXDA 1TWHH 3ERSX 3CMEA 1B70B 2ZTDA 5GROA 5JEAG 1J5EL 2OQKA 2IHEA 3KF8B 1IBLL 1XNRL 1LUZA 4C2MH 2IHFA 2RHQB 1KD1C 1YNXA 2CFMA 1N33Q 3CCMA 2JA8G 3U58A 1FJGQ 3T1HL 2Q2HA 3H0GH 4OONA 1AE2A 2NVXH 1TXYA 2BH2A 5GADC 2JA6H 4X64Q 4B3TL 1PA6A 2L15A 1EFWA 4JYAQ 4BY7H 3U50C 4JI8Q 3K81C 3M4PA 2R93H 3F1ZA 2B3GA 1VCIA 5LMUQ 2JA8H 3GTQH 1E24A 4X66L 2MO1A 4AYBE 4GNXC 1MJEA 1HZCA 2ZTEA 1B8AA 3K0XA 1X9NA 2AKWB 1NJIC 2MO0A 1YZ6A 3TEHB 4DV5L 2R92G 4IFDG 4A3LG 1VQLA 4OX9Q 2ATWA 3PIPA 1Q7YC 4L5RC 1CKNB 1N32L 4O0AA 4LF6Q 3NEMA 3UDIA 4DV3L 3J80c 2A19A 2JK8A 5M5WH 4IPCA 1E3PA 1B7YB 1EWIA 2XGTA 4LF4L 3WWVA 4K0KQ 1SN8A 4KHZA 3CCJA 4LUOA 4KHPQ 4HIMA 4OWXB 4HIOA 4JOIC 1IL2A 3HOZH 2ALYB 2YTYA 1VQ4A 1IZ6A 4AIMA 1N36L 4DR6L 3AFPA 3I56A 2WP8J 2ZJPA 4A3DG 4JI0L 2F4VL 1I6HH 4A75A 4IPHA 2ES2A 1YHBA 2WB1G 4QIWE 1X54A 1XMQL 1Q1EA 2KBNA 3EIVA 2H5XA 3G48A 4MNOA 3DM3A 4LF5L 3GTOH 2QGQA 4WJ4A 1VQPA 2CWPA 1P16A 4H02A 2R6GA 3K7AH 5IY0A 4R4CA 1CUKA 1UE5A 1HNXQ 3KFUA 2UXBL 5C3EG 2VQEQ 1KC8C 2AMCB 1I5FA 1X6OA 1S3OA 1X56A 2K50A 1IYJB 3ZJYC 4WJ3M 2Q2TA 2YU9H 4DR5L 4JV5Q 3AQQA 4KLKA 1YI2A 1MKHA 5IWAL 1VQ5A 4JI3L 1XTDA 4POFA 3HOXH 3H3VH 2UXDQ 4PZ6A 3LGJA 3PUXA 2VNUD 1EIFA 4HJAA 4A3IG 1XPUA 1WYDA 3S1RH 1IBKL 1JB7A 3M4OH 4GN4B 1IBLQ 1XNRQ 1J5EQ 1VQEA 2BH8A 2D62A 3CMAA 1FVIA 3UE0A 4BY1H 3I2ZA 2RF4A 1C7YA 3M85A 2MQHA 2NN6I 4TQUS 2FXQA 1PH9A 5C0XJ 2UU9L 3T1HQ 3JC66 4A3IH 4JI4L 5M5YH 3CCRA 4GN5A 3TREA 4JI6L 3HOVG 1K3RA 3E0EA 1N8RC 1UWVA 1HH2P 3S2HH 1T9HA 4HJ5A 4GOPC 1EQRA 2Q2UA 1Y1WG 1FL0A 4Y7NH 3KOJA 5FLMH 3UDGA 1QZHA 3I4MG 1OXSC 2IX0A 1WJJA 1UEBA 4PMWA 1G6PA 4X66Q 2B63H 4X65L 3IRBA 1VQHA 1CKNA 4GLVB 5IYCG 4YWLA 3SGIA 5LMNL 4DV5Q 3BZCA 1FGUA 3PUZA 1ASZA 2K5HA 4BXXG 1N32Q 3RR5A 2ZM6L 1KQSA 1YVCA 1O7IA 3GTMH 2OCEA 3RLNA 1EOVA 3W1BA 3CPFA 4DV3Q 4DV7L 2DUDA 5FJ8G 4IFDJ 4LF4Q 3CCSA 2LXKA 4A3EH 1QZGA 4DKAC 2KCTA 3KLWA 1HR0L 2PMZE 4A76A 1E22A 4EX5A 2UXCL 1PH5A 2JA7G 2GVBA 1N36Q 1X65A 4DR6Q 4DNIA 4GN3B 4JI0Q 4DR1L 1Q82C 1XMQQ 1TWAH 4R4IA 3ULPA 4LUZA 4DV1L 2I5LX 5C4JH 4JC0A 4LF5Q 1GD7A 5IP7H 4JBMA 4YCUA 4B3RL 2JA7H 1E1OA 3CQZH 1LM0A 1Q86C 4UY8C 2UXBQ 1KXLA 1HNWL 4IOCA 3PUVA 3H0GG 2JA5H 2JA6G 2WFWA 3S1MH 4POGA 4L5TA 4PG3A 3BU2A 5IWAQ 1PH4A 4BY7G 4JI3Q 3L2PA 4LUVA 2YYZA 2R93G 3CD6A 2KCMA 3OYYA 1IBKQ 4APVA 2HT1A 1K8AC 3BJUA 5HY6A 4OWWB 1BKBA 4HJ8A 2VUMH 1L0WA 4JBWA 4JI2L 5JJKA 2C35B 2NVQH 2F3IA 4A4IA 1N9WA 4R4QA 2ZJRA 1VS0A 4JI5L 3W1GA 1EUJA 4QGUA 2HQLA 2K52A 2Q2IA 2UU9Q 2UUAL 4JI4Q 4IFDI 4JI6Q 3K80C 3F8TA 4L5SA 4A3BH 1X3GA 3CP0A 5IYDG 1BBUA 3I7FA 3TRZA 3HKZG 2E8GA 5GAHC 3S2DH 2N49A 1VQDA 1VQNA 3HOZG 4PZ7A 1SE8A 1SLJA 3M9BA 1BVSA 4JCVE 4X65Q 4FDBA 1JJ2A 3TQYA 3KJOA 5IT9c 5LMNQ 1V1QA 5ELNA 2NVYH 5IYDH 1M1KC 5FLXc 4JG2A 4QL5A 4DK6C 2EQSA 2GVAA 2ZM6Q 1K9MC 2Z6KA 4DV7Q 1IXRA 1OXXK 3HKSA 4LF7L 4IJLA 3RN5A 2D0OA 1KIXA 3UDFA 3ULLA 3J81i 3E9IA 2EIFA 1XPRA 1QVFA 3S1QH 4Y52H 2WAQG 1HR0Q 3CCLA 3A74A 3KYHC 1OXTA 1Z9FA 1CKMA 4KI0A 3H3VI 2Z0SA 3CCEA 3S14H 2UXCQ 2OTLA 1TWFH 2JEAI 4XIGS 4X62L 1UE6A 2B29A 2UUBL 4IOAA 3GTPH 3A0JA 3STBC 3HOXG 2JQOA 1RIPA 1AE3A 3NELA 3U4ZA 4DR1Q 1VQJA 3J7A5 4A3MH 4DR4L 3ULJA 4DV1Q 1L2FA 3RZDH 5M3MG 2IX1A 3EBEA 3L0OA 4B3RQ 2HHHL 4GOPB 5C4XH 3M7NA 4BY1G 1YJ9A 3HFZB 3F2DA 1SROA 1I50H 3S17H 4UP8A 1A63A 1HNWQ 3NBHB 3H15A 1QVCA 2MNAA 1VQ8A 4B3ML 5IP9G 3MEFA 2QEXA 1PV4A 5M3MH 4P71A 3HOWG 2F52A 3VDYA 1YBYA 1XMOL 3FHWA 4AQYL 4GLXA 2OTJA 2RCNA 2OQ0A 1WCMH 2E2HH 5GQOA 1SR3A 5FLMG 2HIVA 2JA9A 1Y1VG 3UE1A 2B63G 3AYHB 4A3JH 1L1OB 5JEAJ 5IP9H 4UP9A 4JI2Q 4A3KH 4B3TQ 3HOWH 2IT1A 2VS1A 4YWMA 3HOYH 1KHIA 1M90C 1YITA 1HR0W 2ASBA 1PYBA 4GS3A 1UE7A 4JI5Q 1XNQL 3TS0A 1VQBA 1OTCA 4A3CH 1K83H 2UUAQ 1S40A 2JEBI 2CWAA 4LF9L 1DGSA 4OO1G 1Y1VH 4YY3L 1GVPA 1QUQB 3J7ZC 1W2BA 3RN2A 5GAGC 4A3EG 2UUCL 3F2CA 4A93H 2NZOA 4B3SL 1G291 3FP9A 3I4NH 3NENA 3KF6B 1PHJA 1PH1A 2E2IH 2CQOA 3CAMA 5C44H 1VQOA 1KL9A 4DR2L 1Z47A 2CCZA 5M3FG 1VQIA 1EQQA 3PO3G 1A0IA 1YHAA 5HGQA 3OTOL 1VQAA 1WFQA 3CCVA 5IP7G 2HIXA 3STBD 3PUWA
chains in the Genus database with same CATH superfamily
2F4IA 3RNUA 3VYSA 3AU7A 3HP3A 3SVMA 4Q5VA 3GTKH 1PXUA 3DXJC 5GAEC 4HJ9A 5DAUA 4KN7C 4NW2A 2R3ZA 3CXCA 3J7YW 1I94L 3FVQA 3PO3H 3R3OA 4X62Q 1HRJA 2HQEA 1Q12A 2A6HC 2K05A 2QDBA 1JMCA 1EY6A 5EQ0A 4GOPA 4I65A 1U0LA 1WTQA 1WTWA 2K5WA 3NBHA 3GTMB 4YHHL 2HHHQ 2EVBA 2KENA 1RTOA 1N34L 4B9XA 5BR8L 2BA0A 1JCKB 4L5QA 1ASYA 2NVTB 4EQNA 3L9AX 2L1BA 3A5ZB 2E5LL 1ESFA 1AH9A 4IPDA 2NZHA 4HJ7A 3A5UA 4J1MA 1NTGA 4F87A 5I2XA 4KHVA 5JOBA 1I4HA 3I4LA 2K7VA 4DNRB 4BBRH 1K0RA 2PNRC 1UUPA 3GTGH 4B3SQ 5IE8A 1CHQD 3H0GB 3KDFB 1FNVA 2JA6B 4N8FA 2KCCA 4YWKA 4A3MG 4XTCS 5C3XA 1I4RA 2VW9A 4KJOA 1GJXA 1O78A 4OIKA 2EE1A 4NMZA 1NR2A 1HNZL 1VQ6A 1ZEQX 4NXNL 1K73C 1I94Q 3PUYA 4IFDH 4A3LH 4JBKA 1UNSA 3A56A 1SNOA 3LWEA 4DUZL 4TVAB 1WCMG 1ICFB 1JOQA 3M3YH 1SMXA 1E2VA 2Z8LA 4P73A 4ME5A 4YHHQ 4XQQA 4R4TA 1X32A 1EZ8A 1A2UA 1UEAB 5KNDA 1I6HB 1N34Q 4A3CG 2RHSB 5KNBA 1IYVA 4A3DH 5BR8Q 1VQ9A 5I6YA 1HJPA 4DAMA 4KKSA 2A73B 1I6VC 4OL7A 2AWOA 4DUYL 3J7AV 1CM9A 4OO1I 2Z1CA 2E5LQ 2YV5A 4IN3A 4XXEA 1X3FA 3O13A 1VQCA 3I73A 1FJGL 3MAQA 2F0TA 3PO2G 4C3HH 1U4MA 3NTHA 5J22A 1S5FD 5D3DA 2OWOA 1R4PB 1TY2A 2EY1A 5T1IA 3SK5A 4P75A 3S16H 4ALPA 1QG7A 3HOUG 2NUCA 4NB3A 2NN6G 2H4OA 5I9OA 4K8IA 4BY1B 3ZYYX 1VMPA 2AHOB 1Y8NB 3DMUA 3PO2H 1GUGA 3EROA 4KY5A 2XIWA 1LT6D 4EQ5A 2O2LD 4G7OC 2PI2A 4HEDA 4BA2I 3EFXD 1RDPD 3HOVH 2UUBQ 1Y1VB 3QR8A 3I4MH 5HGTA 2BOSA 3GP7A 3HG9A 1HNZQ 4NXNQ 2XSCA 2R7DA 3OSOA 1MJCA 4BXXH 4DUZQ 1VDZA 3VR4A 3S9WA 1GO3E 1V43A 3VR3A 4BBSG 1QVGA 2D0PA 1K28A 2F0HA 3JAML 1EYGA 1HNXL 4X6AH 1ENFA 3G4SA 2KHJA 2GN5A 3E9HA 1WOCA 3MTSA 2Y0SG 1J8IA 5EKKA 3PO3B 4ZRZA 3CC2A 2CKZB 2AQ2B 2L4NA 3JAMc 5C4JB 1VQ7A 4DUYQ 2DJFC 2EXDA 3U9OA 3CMEA 1B70B 5JEAG 5GROA 1XNRL 2IHEA 1LUZA 3HRZC 1KDCA 2KJXA 1RHPA 2CFMA 1KD1C 2JA8G 1FJGQ 1GUWA 2BH2A 1V1PB 5JEAH 2TMPA 3MC0B 3U50C 2FINB 2NBFA 1SBBB 3M4PA 2R93H 3T16A 2B3GA 3KLRA 5F2DA 2IX3A 1PTOD 1VCIA 4K2LA 2JA8H 1E24A 4GNXC 2L11A 2MO1A 1DONA 1HZCA 2E76C 1B8AA 2ATWA 3PIPA 1MD2D 5DM73 3UDIA 1J9OA 2A19A 3NQTA 1EIHA 3WWVA 1SN8A 3CCJA 2KA7A 4LUOA 4HIMA 4HIOA 2QW7A 4C56C 5AFWA 1WTXA 3T13A 3GTGB 4CDDC 3DUZA 3H91A 4QIWB 3BS1A 4QIWE 1Q1EA 1QNUA 2H5XA 2XVSA 3DM3A 5KNCA 3TDQA 2F0DA 2QGQA 4LF5L 2EYPA 1E2ZA 2F3VA 2CWPA 4H02A 2R6GA 5IY0A 4LJZC 1HNXQ 1UE5A 3KFUA 1XTCD 4OHJA 1FYCA 1I5FA 3N52A 1X56A 1LLRD 3Q23A 2F0EA 4PV1C 4V190 2DNEA 5IWAL 4JI3L 4A3MB 2FHTA 3LGJA 3PUXA 2VNUD 1DOKA 1EY8A 2B2UC 4IUPA 1B50A 1JB7A 1XNRQ 2BH8A 1FVIA 3UE0A 3QJYA 1C7YA 3M85A 2QF7A 2RDFA 2FXQA 3EA6A 5CBEE 3JC66 2B2YC 5M5YH 4HR7B 3TREA 4JI6L 1SE3A 1K3RA 3S2HH 1HH2P 1WCMB 5CV5A 4IURA 1T9HA 2NYZD 2Q2UA 1Y1WG 2F0GA 2GA4B 4Y7NH 3LX0A 1UEBA 4PMWA 1UAPA 5IYCG 3MEHA 2WIIB 2EJFC 3VR2A 4OEMB 1ASZA 2K5HA 1KQSA 1YVCA 1D1KA 5DNFA 2CVRA 3C46A 2DUDA 2MGSA 4IFDJ 4CDCC 2LXKA 1A2TA 1T5EA 1HR0L 3IFTA 4EX5A 1WD0A 1X65A 1LO5D 1RKNA 4DR1L 1L0YB 4R4IA 4LUZA 4DV1L 3H3VC 2I5LX 2D5DA 4LF5Q 2G5DA 3HOUB 1E1OA 3CQZH 4DXFA 1JQYD 5T1GA 3OWEB 5IIFA 3S1MH 3J7AF 1GUSA 2NTTA 2E74C 4QUFA 5IWAQ 2X69A 3TP5A 3L2PA 4JI3Q 4HAEA 5HY6A 4OWWB 5CGKA 1BKBA 3G7LA 1BCPD 4JBWA 5JJKA 2PCFB 5M5XB 2C35B 4R4QA 2EDGA 4RWSC 1TU2B 1SEBD 4JI6Q 4L5SA 4FXDA 3CP0A 4PMCA 1BBUA 2AUKA 2L12A 3H09A 4BBSB 4ZCKA 2EPBA 4HSPA 5EPLA 1SE8A 1SLJA 3M9BA 1BVSA 4JCVE 5M9OA 4S3SA 5CORA 4KMUC 5IGFA 2X6LA 1M1KC 5CBAE 4KTAA 5FOBB 1BBXC 4LF7L 1EY7A 3UDFA 2EIFA 3ITPA 1Y8PB 2WAQG 5JPNC 4M1UB 1HR0Q 3CCLA 1CKMA 3S14H 2JA8B 1TWFH 3K59A 2KOLA 2JEAI 2NZ1D 3GTPH 3HOXG 3BZDB 1G2SA 1KTKA 3WDNA 4DR1Q 3ULJA 4DV1Q 3RZDH 1RODA 3L0OA 3WOFA 4GOPB 2PW7A 3NWSA 5C4XH 1YJ9A 3HFZB 1A63A 3NBHB 1IKMA 4CKEA 1QVCA 3PMFA 2RBMA 1STBA 5IP9G 3MEFA 1PV4A 2F52A 1KLGD 4N9TA 2QILA 2RSNA 4GLXA 4AQYL 1DM0B 2M9VA 3NE5B 2HIVA 3RMHA 5EBDA 3UE1A 4ZKBB 5JEAJ 3OWFA 2CQAA 5EPKA 5IP9H 4IALA 2IT1A 3HOYH 1IKLA 1YITA 1E2WA 4F8MA 1HQMC 1A15A 3L3OC 2C5CA 1WVLA 4UDUC 1GVPA 3RN2A 3BYTB 4HN7A 3F2CA 4CHTB 1ENCA 1TVXA 2CQOA 1VQOA 1VF7A 4C1NK 1EQQA 1EU3A 4G4KA 1WFQA 5IP7G 3D6WA 3PUWA 4LF7Q 3S2HB 3FRPB 3ER0A 4L6TB 1O7ZA 2VXWA 2JA5G 4LFCL 4UAIA 1U9RA 5K36G 2KCNA 1BO0A 1Y14B 4N9PA 5COYA 4IJHA 1A62A 1SFOH 1Y1WB 1YEZA 4DR5Q 4IO9A 4R1JA 4DV6L 4JPBW 4YCVA 1JT8A 1K0SA 1QOHA 3OPOA 5EKLA 3TP8A 1PZJD 2EY5A 2F0PA 1IYUA 2M2LA 3RLOA 4A3BG 3NSWA 1SYGA 3PIP3 3D4WA 4AQYQ 1DZ1A 3GO5A 1YJWA 4LFAL 1Q46A 3I4OA 1MIUA 4ZAIA 4FYDA 2Z6KC 1K8MA 2PQEA 1RF2D 4DR3L 4G7HC 3CQZB 5C0XG 1C0AA 5IYBG 1B3QA 1DCZA 1QUQA 3AFQA 3MFGA 1LACA 1LTAD 5IGEA 2E2JH 3T1YL 3K57A 2SDFA 4TRDA 4CBVA 1AZQA 2DY8A 3A8KE 4IQZA 4C2MB 2SNSA 5C0XH 5IYBH 1Z7TA 3S24A 4EVOA 3IAYA 1HA5A 1SNDA 3OW7A 1LV9A 3K5LA 1ESRA 4DF7A 2KEEA 1TIID 3PCOB 1SNQA 1FD7D 4DNTB 1S72A 4RG1A 4MN3A 1AZPA 4YCWA 1LYLA 3CC7A 2PI2E 1YJNA 1GXDC 2N3SA 1S5DD 4NXML 4LFCQ 2R92H 2B2TA 1U5KA 1PTOH 3RD4A 4AH6A 3CCQA 4QY7A 4OXPA 4LW1A 1IBML 4C3IH 1PLFA 3T56B 3GV6A 4DV6Q 1PH2A 3R2IA 1B9NA 3JAMi 1VQKA 1OO9B 2N78A 4DV4L 5C3WA 2EY6A 4QB4A 1JJGA 2A69C 2I07B 3SEBA 2RDHA 4A93G 4RGMA 3G6JB 4B08A 2FJ2A 2VY3A 2XTIA 4LFAQ 3CW2C 4DU9A 2I5HA 2WAQB 2WB1B 2WAQE 1N33L 2WB1E 3RZOH 4DR3Q 2K5NA 1VQGA 3HOXB 3KJPA 1CT1D 3MXUA 3DLLA 3T1YQ 4Q0FA 1B4OA 1STAA 1PYWD 3TS2A 5KRUA 2PZWA 1AN8A 1HZAA 2K4KA 3KBGA 3NPPA 1WTRA 5FO8B 1LTGD 1B44D 1G51A 4U68A 5JJLA 1GKHA 4FF3A 1BUVT 2V4DA 3DWAA 1TWCH 1L1OC 2RCFA 4JBJA 4NXMQ 3GTLH 1EIYB 4DK3C 1X55A 5FO9B 3MZ5A 2IW3A 1ONLA 1JE4A 3E3XA 4MHEA 1SDFA 1YHQA 5CV4A 1TS2A 2A69D 1BCPF 4UPAA 1IBMQ 4HCEA 2F3WA 2L9HA 3KK7A 2ZJQA 3RLFA 1YNNC 1DD2A 2MFIA 4DV4Q 5HURA 4U673 3GDEA 3U4VA 1TWAB 3NK9A 3WOEA 2UXDL 1MHWC 4BBRG 4CDEC 1JE5A 4R4OA 5LHY1 1JB3A 5IT9E 5H1SE 3SK8A 2PQAA 4CJ1B 1HCZA 1TWHH 1J5EL 2OQKA 1ZKOA 3NTIA 1SFOB 3SHLA 3CRLC 1N33Q 2JA5B 3IFDA 3U58A 2L0CA 1HTLD 2Q2HA 4RKBA 1AE2A 2NVXH 4B3TL 5I4DA 2L15A 2RKSA 2QCPX 4BY7H 1LT5D 2DJGC 3A7AB 4G7ZC 1B3AA 3GTQH 2Z9HA 1MJEA 1JICA 5D3IB 2MO0A 1YZ6A 4OELB 4IFDG 4QF4A 1ZXTA 4DA2A 1VQLA 4A3LG 1EZ6A 1K8OA 1N32L 4O0AA 4A3BB 3NEMA 1CK1A 3J80c 1QB5D 4XYOA 5M5WH 4IPCA 3S2DB 1B7YB 5KEEA 1H95A 2HCIA 4K8JA 4KHZA 4DK1A 2E2JB 3CRKC 4JOIC 2IL8A 3HOZH 2YTYA 1IZ6A 4NP5A 4ZYSA 5KYIA 2NVYB 1N36L 4DR6L 3I56A 4A3DG 1PRTD 2F4VL 4IPHA 1YNND 1STNA 1X54A 2HCCA 1JR0D 3G48A 4MNOA 2PO4A 3GTOH 1AW7A 4WJ4A 3S1QB 1QE6A 1TS3A 2JYOA 2NTSA 1KC8C 2I46A 4CKBA 3NTKA 1SNCA 2YU9H 4C3HG 1YI2A 1MKHA 1VQ5A 1TKWB 4POFA 3H3VH 3FPUB 3UI2A 2UXDQ 4R9WA 2BDNA 1EIFA 3KF8A 4HJAA 4A3IG 1QCBD 3M4OH 5CV9A 1WTVA 2OEOA 1J5EQ 4IZ8A 5L37A 3CMAA 2MQHA 2NN6I 4KD3A 1PH9A 5C0XJ 2UU9L 4A3IH 4JI4L 4GN5A 2ICEC 3HOVG 1EYCA 1N8RC 2E2HB 1H9SA 4HJ5A 2WACA 3I4MG 5FLMH 3D3RA 2XWBB 2WV6D 1G6PA 3SR1A 2B63H 3IRBA 4GLVB 1CKNA 1PTOC 3SGIA 5LMNL 2A6EC 3V96A 1K83B 2K6AA 4BXXG 4TSSA 1N32Q 3K0YA 2A5HA 2OCEA 3W1BA 4DV7L 4A93B 3CCSA 4A3EH 4PNYA 4DKAC 2KCTA 2PMZB 3KLWA 3MA2B 1QILA 2PMZE 2UXCL 2JA7G 1SYEA 1N36Q 4DR6Q 4HSVA 4O1NA 3NQIA 4P2CB 4GN3B 4XT3B 5D65A 2B39A 2B8GA 1Q82C 3ULPA 3TP7A 1GD7A 3GTKB 4JBMA 2JA7H 1LTBD 1STEA 2F0LA 1Q86C 5CR3A 1KXLA 1HNWL 4WFN3 5CV8A 3W2DA 3NBIA 3BU2A 3P7JA 4ZQ3A 2L5TA 1EY0A 3GTLB 5DM63 2R93G 3CD6A 5IGCA 3OYYA 3NHHA 1K3BC 4RA8A 4APVA 1K8AC 2VUMH 3SK6A 1HHVA 2NVQH 3A8IE 4A4IA 1N9WA 2G9HD 2K52A 2UU9Q 1II3A 4DGZA 4JI4Q 2RQXA 2A6ED 3F8TA 1X3GA 5IYDG 4KKUA 1V8QA 2N49A 4LK1C 1VQNA 1MBYA 2DNCA 2ENBA 3TQYA 3I3CA 5ELFA 5LMNQ 1V1QA 5IYDH 4XDXA 5FLXc 4JG2A 1STYA 4QL5A 4DK6C 2GVAA 1K9MC 1CQFA 4DV7Q 1IXRA 3QO2A 4BBRB 1X3PA 1OXXK 2D0OA 3URYA 4CGYB 1I4PA 3E9IA 1XPRA 2K01A 2RSOA 1XXGA 3DWQA 1OXTA 1Z9FA 3BG3A 4HCSA 2UXCQ 2OTLA 4XIGS 1UE6A 2JQOA 3FPPA 5A2QL 1VQJA 5M3MG 1Y8OB 4K6LA 4WRDA 3Q24A 1MI2A 5BN4A 2X6GA 2PYKA 3V05A 3F2DA 1SROA 1I50H 4R8NA 3S17H 4F88A 1HNWQ 2MNAA 2ZXPA 4B3ML 3Q22A 5M3MH 2EYJA 1LTTD 1XMOL 3M3YB 3E6ZX 1ILQA 5DEHA 2KEDA 3X3MA 4A3KH 1TT2A 1MSHA 2ASBA 2AQ1B 4GS3A 1BCPC 1V1OA 2D9UA 4YIJA 3TS0A 1OTCA 4A3DB 1S40A 1EYAA 3IL8A 2CWAA 4LF9L 1DGSA 2MP1A 5CV7A 1DOMA 1QUQB 4ZKCB 4UHVA 1SAPA 3I4NH 3IKJA 3ERQA 1PH1A 5IODA 3CAMA 5C44H 4HTHA 2EOTA 1Z47A 4C3HB 5M3FG 1AEXA 1TS5A 1VQIA 1A0IA 1YHAA 2TSSA 5HGQA 3J81L 3OTOL 3S16B 4A3JH 2XWJB 4A3IB 2PNHA 1A8VA 1FNWA 3H94A 4LWCA 3PO2B 4FF4A 5EAYA 4MTNA 1Z6HA 5M3FH 1C8CA 3JAME 4DR7L 1NNXA 3L7ZC 1I3QH 3J81c 3D4DA 4ME3A 3HOVB 1DJRD 4QCLA 5C4HA 5ISRA 4NPSA 3I4MB 3GTJH 4A3GH 4OGQC 1HZBA 4QQBX 4A3FH 2BA1A 2VB2X 5C4ZA 1SE4A 1R9TH 3OIPA 1PFSA 4B3MQ 4PMBA 1LTLA 4RMFA 4P72A 4RH6A 3K5MA 2YTXA 1XMOQ 4GKKL 1SXTA 2HDMA 4IUTA 1FNUA 3GQBA 2KQ3A 2EJMA 1I4GA 1CTMA 1NMFA 2QEJC 2JA7B 2O4XA 4J15A 2R7ZH 3FKIH 3S15H 1EIGA 2EY2A 3QIAA 1S5BD 3AEVA 1PVOA 2K14A 2J4XA 4LF9Q 1W3SA 3PF4A 5C5MA 3KF6A 1NY4A 2Y0SB 3CPWA 2Y0SE 5G3LD 2CHBD 1PRTF 1TWGH 3X3NA 3BDOA 1KNAA 1SRUA 5D14A 1PH3A 1F9QA 3OTOQ 2PPBC 2R93B 4LFBL 5CMDA 3CCUA 5C4XG 3D31A 1WTOA 1XJVA 5JJIA 5J3BA 1E7ZA 4DR7Q 4MZ9A 3W5OA 5A2QE 5DLQE 3B6YA 4GNXA 5ELOA 1KRTA 5CYUA 5AJ3L 1D5MC 4KY7A 2I5MX 2Q8TA 5J39A 5LMNW 3GD7A 3HOYG 1V9PA 5EBCA 1HXYD 5BN3A 1VMCA 4DK0A 1C4QA 4LF8L 2LSSA 4P74A 2EYHA 4GKKQ 2J7ZA 2SNMA 2B2VC 2LY7A 2E2DC 1C48A 5JPMC 3NUCA 1EY5A 1VQFA 1SYCA 2PQAB 2F0MA 2MHVA 5C3EH 1KRSA 3S17B 1CKOA 4X64L 2IY5B 4JYAL 1QNKA 4JI8L 1K8GA 4ABNA 4WORA 1SMYC 2YTVA 3VYRA 1BR9A 4PQXA 3J80i 1HUMA 1P8LA 3C1FA 4HIKA 2B2UA 1NMGA 1WI5A 3ICEA 5M5YB 1PH6A 2KECA 1D7QA 4KD4A 1UE1A 1Q1BA 4Y7NB 4LNQA 4KHPL 4LFBQ 2B2YA 1FR3A 3T53B 4K5WA 4PZ8A 1M4VA 3QG1A 1G2TA 3VR6A 3BVMA 5E1FA 2AQ3B 1EEFD 1B9MA 5AJ3Q 2NVTH 3TP6A 3DWPA 1KLUD 3D0FA 5FJ8H 3K5OA 1A6XA 2K04A 5EPJA 3MXNA 4V0BA 2VQEL 1SNMA 4L63B 1VQMA 4QMGA 4LF8Q 3ONAB 4GZYC 5M3FB 1LT4D 1Y69U 2DY7A 5C0XI 4DPGA 1JOOA 4FXGC 1GUTA 2O5IC 1S5CD 1IBLL 2ZTDA 1D5ZC 3KF8B 1SYBA 1MGSA 2IHFA 2RHQB 4JW0A 1YNXA 3CCMA 2BCOA 3GTJB 1SMYD 3S1MB 3T1HL 3H0GH 4XT1B 1TXYA 5GADC 2F0WA 2JA6H 3DM1A 4X64Q 2Z6BA 1EFWA 4DAYA 3VYUA 1R9TB 4JYAQ 4JI8Q 1LTID 3C3LA 5ELEA 1ZYRC 2HUGA 1L0XB 4X66L 1H9SB 1R4QB 2ZTEA 3K0XA 5ELDA 1X9NA 2AKWB 1NJIC 1STGA 2EYFA 2Q8IB 2R92G 2IJ0A 3TEHB 4DV5L 4ILWA 4L5RC 1I4QA 1CKNB 4JVZA 1H9MA 1S4ZA 3K5NA 4JK1C 4K6DA 4DV3L 1E0BA 1E3PA 1BF4A 2OT2A 4C3IG 4KHPQ 3LWUA 4FXKC 1IL2A 2ZXRA 1VQ4A 5C5LA 3TBIB 3AFPA 1I6HH 2WP8J 2ZJPA 4JI0L 1HPCA 1YHBA 2ES2A 4RGTA 3T51B 4RAUC 1RD9D 1XMQL 2KBNA 2F0UA 4M8AA 2J0TD 2P5ZX 3K7AH 2UXBL 3S14B 2VQEQ 1TWFB 2QDLA 2JXMB 4RCOA 2K50A 3ZJYC 3GTPB 4WJ3M 4B9WA 3AQQA 4KLKA 1XTDA 5IGBA 4PZ6A 3RZDB 1LT3D 1NCVA 1WYDA 2F0IA 1IBKL 5C4XB 4GN4B 1IBLQ 1VQEA 1ZYRD 4BY1H 2KHSA 3I2ZA 2RF4A 1DYQA 5EKIA 1O7LA 2F0KA 3T1HQ 2E75C 3MVVA 3KLSA 1ET9A 3HS0C 4FNFA 1JOKA 2EXZA 1UWVA 1U4PA 1EQRA 4MIUA 1FL0A 1WD1A 3KOJA 1QZHA 2N88A 1OXSC 3AB9A 1SJED 4X66Q 3I8ZA 4X65L 3HOYB 1W6JA 4DV5Q 3MXPA 1FGUA 4FP5D 2B8FA 3U9SA 3RR5A 4XQNA 1O7IA 3RLNA 4CJ0B 4DV3Q 4RGOS 2DN8A 2LFNA 2SEBD 5CV6A 4A76A 1E22A 1PH5A 1DOLA 2H1EA 3MHBA 3C2PA 3P75A 1HFNA 4JI0Q 1PMRA 1NUCA 2CW0C 1XMQQ 1PRTC 1NAPA 5C4JH 1F2MA 3TN2A 4J8QA 4B3RL 4QUCA 3D8GA 1LM0A 4UY8C 2UXBQ 4IOCA 2MPMA 2WFWA 4POGA 4PG3A 4DN4M 1PH4A 4BY7G 1ENAA 5LL6X 1W6KA 2YYZA 3F2UA 3KLSX 2KCMA 5G3LF 3TMEA 1IBKQ 3BJUA 1L0WA 4JI2L 4RKLA 2F3IA 2ZJRA 3I70A 2HQLA 4Z9CB 2Q2IA 3J80L 2UUAL 5FO7B 4IFDI 2K03A 2PW5A 4L8JA 4RHSA 3VYTA 1FGBD 3I7FA 3TRZA 3HKZG 2PZTA 2EJGC 3QOJA 3HOZG 4PZ7A 3HGBA 1STHA 4RHRA 2FFKB 3VR5A 4X65Q 1BNZA 4FDBA 1JJ2A 1JC7A 3ND8A 2WKDA 3MFYA 4FO2A 5ELNA 3SE0A 2NWGA 2Z6KA 4FF2A 1CHPD 4IJLA 5IGDA 2CW0D 3BDLA 3J81i 4Y52H 5E3FA 3R8BA 1F9PA 1U4RA 3KYHC 4KI0A 1GOZA 2A6HD 3H3VI 2UUBL 4IOAA 4J6HA 3CKIB 5J1ZA 3A0JA 3STBC 1RIPA 2F0JA 3NELA 5EGTA 3U4ZA 2B2WC 4A3MH 5EJWA 5TSSA 1L2FA 2IX1A 3EBEA 5JVG3 3GV3A 4B3RQ 2PZUA 3C1EA 4I7ZC 1RTNA 4UP8A 2LS01 5IGGA 2R92B 1VQ8A 4IUVA 4ZLTF 1F9RA 1TS4A 1PTOB 2ICIA 3HOWG 3VDYA 2XRQD 3FHWA 2Q8RE 2RCNA 2K33A 1WCMH 2OQ0A 5FLMG 4DAPA 4C3IB 2WINB 2JA9A 4BS9A 2B63G 3AYHB 4FF1A 2Z4HA 4UP9A 4JI2Q 4B3TQ 3HOWH 1Q90A 2VS1A 1KHIA 4K14A 1M90C 3BVZA 3K7AB 1PYBA 1XNQL 4DXGA 4WJWA 4A3CH 2UUAQ 3T4AC 4OO1G 1ILPA 4YY3L 2IPKD 4RCNA 3Q6SA 3J7ZC 4A3EG 5GAGC 3K58A 2UUCL 2RDGA 1EWCA 1G291 3FP9A 3NENA 4ULLA 3KF6B 3RZOB 4X3SA 2E2IH 4C1NI 1ET6A 4OO1H 2ZT9C 1KL9A 4DR2L 3DEOA 5E4WC 3CCVA 1MSGA 2HIXA 3STBD 3RN5A 2ID0A 5E7NA 1JWSD 2C9OA 5FK9C 3I55A 3HOUH 2F4VQ 1H9KA 1X3EA 2NN6H 3EQLC 1C9OA 3PV0A 3MXGA 1D5XC 2F0OA 1O7YA 3PGZA 2K1BA 1LABA 4XYQA 1G91A 1B53A 5C6AA 1F2ZA 2R7FA 4GNXB 3H6MA 1JWUD 4AYBG 2VUMG 1EQVA 2HDLA 4K5XA 2VB3X 1TWCB 1Q3LA 2VQFL 4LMQD 3E0JA 5M5XH 2N55A 2R61A 2ZXOA 3BVGA 1TY0A 5I2YA 4JI7L 3PF5A 1L1OA 1BOSA 4X3KA 4BBSH 4KY6A 4DV2L 4O2DA 3A55A 3J80E 1G6ZA 5FLXL 1NE3A 4DR4L 1EFID 3N6RA 1PH8A 1XNQQ 3F2BA 1IHZA 1CFMA 1PH7A 3FMCA 4TKOB 4YY3Q 1EY9A 1TWHB 1WTHA 4X3UA 1CSPA 4HIDA 2UUCQ 3Q0AA 1KAWA 3A54A 1YNJC 1EWHA 1GUOA 1XX8A 3KBXA 1D8LA 3G71A 2WKCA 2NVXB 1J6QA 4DR2Q 3QB3A 5JJZA 4DV0L 4BY7B 4OIJA 2LKVA 1KDBA 3EN2A 1PDQA 1ML0D 4KN4C 3HEJA 1AP0A 1D6EC 3GTQB 2A8VA 3FDTA 3K8AA 1EY4A 2G9DA 2D2CC 1HTPA 1JJCB 4ZUJA 3SDZA 1PZKD 1E1TA 3A8JE 1A3VA 1HQRD 1BCPB 5M5WB 1EU4A 5JVH3 1RL2A 2DGYA 4GKJL 1F9SA 3HKZB 4IUQA 3HKZE 2FMCA 2N8NA 2NB0A 3BZKA 3HOZB 1CSQA 4A3KG 1CA6A 1OXVA 2VQFQ 2AWNA 4JI1L 4BA1I 4DAVA 1NBWA 4JOIA 3MXNB 3I91A 2BE5C 2JE6I 3R93A 4JI7Q 3ND9A 3GTOB 2I0QA 1TQOA 2K5QA 2A1AA 4C3JG 4K5VA 3I4NG 2QA4A 4DV2Q 3J81j 3K7UC 4GLAC 3TZDA 2K32A 5C44G 1EL0A 4KKTA 4H0LC 2YU9B 4DR4Q 2CH4W 2V1CC 1YNJD 1Q8IA 2KHIA 3D4RA 3BDCA 1Q8KA 2B2WA 1F77A 4A3JG 4C3JH 3CF5A 3OW2A 4KJNA 2LXJA 4ODGA 3M4OB 2VL6A 4IPGA 5LMUL 4DAYB 1XPOA 3KDFA 4IUNA 3PSIA 1M8AA 2M00A 2F1MA 2K75A 4QJFA 4OX9L 1F2LA 2VZAA 2ZTCA 4LF6L 3HOWB 1BBWA 1OXUA 1PFNA 5IOCA 1HZ9A 3M4YA 4DV0Q 4EGVA 3M4QA 2MJ8A 3PIOA 3CC4A 2JN4A 4K0KL 1RCVD 4A3GG 1IW7C 1Y1WH 2B63B 4A3FG 1Q81C 3Q8DA 1KAAA 2XRSD 3NP8A 4OWTB 2EYLA 5IYCH 3BYYB 3E5SA 2JJQA 4ID6A 1GM5A 2E2IB 4ZUIA 4GKJQ 1VF5C 1YIJA 2BE5D 4A3EB 1BXTA 2OXPA 1PYSB 4CDFC 2K5VA 1DXMA 3QOLA 3UDXA 2R7ZG 3FKIG 4UP7A 4JI1Q 1WTPA 3S1NH 3G6EA 4JV5L 3VA7A 4X3TA 4MTKA 1KIXA 3ERSX 4CJ2C 5FLXE 3LNNA 4C2MH 1KDAA 3TSSA 1A3TA 1ICWA 4OONA 3DEPA 1PA6A 1GHJA 1D1IA 1NSNS 3K81C 2A68C 1PFMA 3F1ZA 2B2TC 4AYBB 5LMUQ 2VUMB 1AFPA 4AYBE 2NVQB 2XNAC 4DFAA 1IW7D 4OX9Q 1Q7YC 2CH4A 2L55A 4LF6Q 4NKLA 3OMCA 3RUZA 2JK8A 1H9RA 4F7XA 2K28A 3NWTA 1EWIA 2XGTA 4LF4L 1F2YA 1BDOA 1CA5A 4K0KQ 3NXWA 2MUYA 4OWXB 1HUNA 1X3QA 1SE2A 2ALYB 3OHXC 4AIMA 3SK4A 3W3AA 2XN9C 4ZK9B 4RGNA 4A75A 1B2TA 2WB1G 4IUUA 3EIVA 4H44C 2KUMA 1H9JA 4H7BA 4RFBA 1VQPA 4BWGB 3EJIA 1P16A 3I72A 1CZWA 4R4CA 1CUKA 2LMCB 4O42A 5C3EG 4FVMA 2AMCB 1X6OA 1S3OA 1IYJB 2Q2TA 4DR5L 2A74C 2QKIC 5FKAC 4JV5Q 3D6CA 3HOXH 1PZID 4H13C 1GUNA 3SXHA 2FMMA 1XPUA 5NUCA 3S1RH 5A35A 1I50B 2A68D 5LL6S 2D62A 1XYIA 5KIXA 4TQUS 1V1PA 5M3MB 1JWMD 1HFGA 3HZXA 3E0EA 4KK7A 2KVMA 4GOPC 4E6IA 3UDGA 1I4XA 2IX0A 3J81E 1WJJA 3K6OA 1A3UA 3TZUA 4A3KB 1VQHA 3I90A 1XWEA 4YWLA 3BZCA 3DHQA 4G57A 3PUZA 1D2BA 1JORA 1U4LA 2ZM6L 3EVQA 3GTMH 1EOVA 3CU7A 1SYFA 3CPFA 2EZVA 5FJ8G 3MWYW 4LF4Q 3M7GA 4C3JB 1QZGA 3I4NB 3PQIA 1BQQT 1SNPA 4KV6A 5C44B 2GVBA 4DNIA 1GHKA 1CZGA 4A3JB 1TWAH 3VA5A 1CQVA 1HA6A 1KABA 4JC0A 5IP7H 4YCUA 3OMGA 1TR5A 5BN5A 1RJTA 4EQPA 2F0VA 3KUPA 3PUVA 1SJHD 1IL8A 1I3QB 1B1ZA 1QJOA 2HD3A 3H0GG 2JA5H 2JA6G 4L5TA 2RA4A 5K36H 5I9PA 4LUVA 3OOCA 5CC4A 1QWYA 4A3GB 2EYOA 2HT1A 2EYMA 3CHBD 1EQTA 4EQOA 4A3FB 4HJ8A 1PTOF 1T5XD 5JAVA 4I7AA 1VS0A 4JI5L 3W1GA 1EUJA 4QGUA 5IT9L 2Z4IA 4A3BH 3K80C 3S1NB 2RVLA 4LAAA 4CKCA 4XQJA 2E8GA 5GAHC 3OIQA 3S2DH 1G8ZD 1VQDA 5ELCA 3P20A 3KJOA 2R7ZB 5IT9c 3FKIB 3S15B 4N8X1 2NVYH 2EQSA 4HMIA 2ZM6Q 3AMUA 3FEWX 3HKSA 3ULLA 1QVFA 4HMJA 5E4XA 3S1QH 3A74A 2Z0SA 1TWGB 3CCEA 1SYDA 1LTSD 4X62L 2IWHA 2B29A 2JP1A 2OF1A 1EYDA 2AUJD 1AE3A 3J7A5 4K2KA 1KNEA 2F03A 5ELBA 1S5ED 2F0QA 2HHHL 3M7NA 4BY1G 3H15A 3QWNA 5K5PA 2QEXA 1EOTA 1EEID 4P71A 3R2TA 4NDXA 1YBYA 2OTJA 1SSOA 2E2HH 5GQOA 1SR3A 5I6WA 1PFBA 1Y1VG 3PIO3 1L1OB 2O5JC 4R8IA 4YWMA 1HR0W 1UE7A 4JI5Q 1VQBA 1LTRD 3A7LA 1K83H 2F0NA 5KYLA 2JEBI 1Y1VH 2JSOA 3P1HA 1W2BA 4A93H 1PRTB 2NZOA 3V2TA 1CI3M 2BDOA 2K5DA 4B3SL 5C3EB 3S1RB 1PHJA 2B2VA 2F0FA 2SOBA 5KGUA 2CCZA 1O80A 2F0SA 1NR4A 3PO3G 1VQAA 3CCRA
chains in the Genus database with same CATH topology
2PNHA 1A8VA 2ID0A 5E7NA 4LF7Q 3RNUA 3GTKH 3I55A 4LWCA 5GAEC 3ER0A 2F4VQ 3HOUH 1X3EA 4HJ9A 5EAYA 1C9OA 4MTNA 3CXCA 5M3FH 2JA5G 4LFCL 1I94L 3PV0A 3PO3H 4DR7L 3L7ZC 1I3QH 4X62Q 3J81c 1Q12A 5K36G 3PGZA 4ME3A 1JMCA 1Y14B 4GOPA 4IJHA 1A62A 1U0LA 2R7FA 4GNXB 4NPSA 1SFOH 1YEZA 4AYBG 4YHHL 3GTJH 2VUMG 2HHHQ 4A3GH 4DR5Q 1HZBA 2KENA 4IO9A 4R1JA 4DV6L 4A3FH 2BA1A 2VQFL 4QQBX 4YCVA 1JT8A 5M5XH 1N34L 1R9TH 1PFSA 4B3MQ 3RLOA 1LTLA 2BA0A 4RMFA 4P72A 5BR8L 4A3BG 4JI7L 4L5QA 1ASYA 2YTXA 1XMOQ 3PF5A 4GKKL 1L1OA 4AQYQ 3A5ZB 3GO5A 1YJWA 4LFAL 1Q46A 4BBSH 4DV2L 3I4OA 2E5LL 1MIUA 4O2DA 1AH9A 1NMFA 4IPDA 2Z6KC 2NZHA 4J15A 1NE3A 5C0XG 3A5UA 4HJ7A 4DR3L 3FKIH 5IYBG 1PH8A 2R7ZH 1XNQQ 3S15H 3F2BA 1C0AA 1QUQA 3AFQA 2K14A 3AEVA 1PH7A 1PVOA 1NTGA 2E2JH 4LF9Q 3T1YL 1W3SA 4YY3Q 3PF4A 4BBRH 1K0RA 3KF6A 2UUCQ 1CSPA 4HIDA 3GTGH 1KAWA 1NY4A 5IYBH 4B3SQ 3CPWA 3S24A 2Y0SE 5IE8A 1D8LA 3G71A 1TWGH 3KDFB 1J6QA 4DR2Q 1SRUA 4YWKA 4A3MG 4DV0L 1PH3A 4XTCS 3PCOB 3OTOQ 3EN2A 1S72A 4LFBL 4RG1A 2VW9A 4YCWA 3CCUA 1LYLA 3CC7A 5C4XG 2PI2E 3D31A 2A8VA 1YJNA 3K8AA 1XJVA 1HNZL 1VQ6A 5JJIA 4NXNL 5J3BA 2N3SA 1H95A 4NXML 1E7ZA 1K73C 1JJCB 1I94Q 4LFCQ 4MZ9A 3W5OA 2R92H 3PUYA 4DR7Q 1U5KA 4A3LH 5DLQE 1E1TA 3B6YA 4GNXA 5ELOA 4JBKA 1KRTA 4DUZL 5AJ3L 4AH6A 4TVAB 1WCMG 3CCQA 1RL2A 2DGYA 4GKJL 3M3YH 1SMXA 3HKZE 4QY7A 4OXPA 2I5MX 4LW1A 2N8NA 4P73A 4C3IH 3BZKA 1IBML 4YHHQ 4R4TA 1CSQA 4A3KG 5LMNW 3GD7A 1OXVA 3HOYG 1V9PA 4DV6Q 1PH2A 2VQFQ 2AWNA 4JI1L 3JAMi 1VQKA 2N78A 1N34Q 4BA1I 4DV4L 4A3CG 1NBWA 4JOIA 2RHSB 3MXNB 4LF8L 2LSSA 1JJGA 4A3DH 4P74A 5BR8Q 1VQ9A 2JE6I 4JI7Q 1HJPA 4DAMA 2AWOA 2I0QA 4DUYL 4GKKQ 4A93G 2A1AA 2VY3A 2XTIA 4LFAQ 4OO1I 3CW2C 3I4NG 2QA4A 2I5HA 3J81j 3K7UC 2YV5A 1VQFA 4GLAC 4DV2Q 2E5LQ 1X3FA 2PQAB 1VQCA 2WAQE 2WB1E 5C44G 1N33L 5C3EH 3RZOH 1FJGL 4DR3Q 4DR4Q 2K5NA 2V1CC 2KHIA 1KRSA 3PO2G 1VQGA 1CKOA 1Q8KA 4C3HH 4X64L 3KJPA 2IY5B 4A3JG 4C3JH 4JYAL 3DLLA 3CF5A 3T1YQ 4JI8L 3OW2A 2OWOA 2LXJA 4P75A 3S16H 1K8GA 2VL6A 4IPGA 4ALPA 3HOUG 5LMUL 4NB3A 2NN6G 4DAYB 1XPOA 3KDFA 3TS2A 2YTVA 3PSIA 2AHOB 1HZAA 3PO2H 2K4KA 3J80i 1P8LA 4HIKA 2K75A 4QJFA 4OX9L 1NMGA 1WI5A 2VZAA 4EQ5A 3ICEA 1PH6A 2ZTCA 4LF6L 1D7QA 1BBWA 1OXUA 2PI2A 1HZ9A 4DV0Q 4BA2I 3M4QA 3HOVH 3PIOA 3CC4A 1G51A 5JJLA 1UE1A 1Q1BA 4K0KL 4LNQA 4KHPL 4LFBQ 4A3GG 1GKHA 1Y1WH 2UUBQ 3I4MH 4A3FG 1Q81C 3Q8DA 4PZ8A 1HNZQ 1TWCH 4OWTB 4NXNQ 1L1OC 5IYCH 4JBJA 4NXMQ 3GTLH 1EIYB 2R7DA 4DK3C 2JJQA 1X55A 1MJCA 1GM5A 4BXXH 4DUZQ 5AJ3Q 1YHQA 4GKJQ 2NVTH 1GO3E 1V43A 1YIJA 3D0FA 4BBSG 4UPAA 5FJ8H 1QVGA 1PYSB 2D0PA 1IBMQ 2K5VA 1HNXL 1EYGA 4X6AH 2VQEL 3UDXA 3G4SA 2R7ZG 2KHJA 2GN5A 2ZJQA 3RLFA 3FKIG 4UP7A 4JI1Q 3S1NH 1VQMA 3E9HA 2MFIA 1WOCA 3G6EA 4DV4Q 4JV5L 2Y0SG 4LF8Q 3GDEA 3U4VA 2UXDL 3CC2A 2CKZB 5C0XI 4DPGA 4BBRG 3JAMc 1JE5A 4R4OA 1VQ7A 4DUYQ 5H1SE 2PQAA 2EXDA 1TWHH 3ERSX 3CMEA 1B70B 2ZTDA 5GROA 5JEAG 1J5EL 2OQKA 2IHEA 3KF8B 1IBLL 1XNRL 1LUZA 4C2MH 2IHFA 2RHQB 1KD1C 1YNXA 2CFMA 1N33Q 3CCMA 2JA8G 3U58A 1FJGQ 3T1HL 2Q2HA 3H0GH 4OONA 1AE2A 2NVXH 1TXYA 2BH2A 5GADC 2JA6H 4X64Q 4B3TL 1PA6A 2L15A 1EFWA 4JYAQ 4BY7H 3U50C 4JI8Q 3K81C 3M4PA 2R93H 3F1ZA 2B3GA 1VCIA 5LMUQ 2JA8H 3GTQH 1E24A 4X66L 2MO1A 4AYBE 4GNXC 1MJEA 1HZCA 2ZTEA 1B8AA 3K0XA 1X9NA 2AKWB 1NJIC 2MO0A 1YZ6A 3TEHB 4DV5L 2R92G 4IFDG 4A3LG 1VQLA 4OX9Q 2ATWA 3PIPA 1Q7YC 4L5RC 1CKNB 1N32L 4O0AA 4LF6Q 3NEMA 3UDIA 4DV3L 3J80c 2A19A 2JK8A 5M5WH 4IPCA 1E3PA 1B7YB 1EWIA 2XGTA 4LF4L 3WWVA 4K0KQ 1SN8A 4KHZA 3CCJA 4LUOA 4KHPQ 4HIMA 4OWXB 4HIOA 4JOIC 1IL2A 3HOZH 2ALYB 2YTYA 1VQ4A 1IZ6A 4AIMA 1N36L 4DR6L 3AFPA 3I56A 2WP8J 2ZJPA 4A3DG 4JI0L 2F4VL 1I6HH 4A75A 4IPHA 2ES2A 1YHBA 2WB1G 4QIWE 1X54A 1XMQL 1Q1EA 2KBNA 3EIVA 2H5XA 3G48A 4MNOA 3DM3A 4LF5L 3GTOH 2QGQA 4WJ4A 1VQPA 2CWPA 1P16A 4H02A 2R6GA 3K7AH 5IY0A 4R4CA 1CUKA 1UE5A 1HNXQ 3KFUA 2UXBL 5C3EG 2VQEQ 1KC8C 2AMCB 1I5FA 1X6OA 1S3OA 1X56A 2K50A 1IYJB 3ZJYC 4WJ3M 2Q2TA 2YU9H 4DR5L 4JV5Q 3AQQA 4KLKA 1YI2A 1MKHA 5IWAL 1VQ5A 4JI3L 1XTDA 4POFA 3HOXH 3H3VH 2UXDQ 4PZ6A 3LGJA 3PUXA 2VNUD 1EIFA 4HJAA 4A3IG 1XPUA 1WYDA 3S1RH 1IBKL 1JB7A 3M4OH 4GN4B 1IBLQ 1XNRQ 1J5EQ 1VQEA 2BH8A 2D62A 3CMAA 1FVIA 3UE0A 4BY1H 3I2ZA 2RF4A 1C7YA 3M85A 2MQHA 2NN6I 4TQUS 2FXQA 1PH9A 5C0XJ 2UU9L 3T1HQ 3JC66 4A3IH 4JI4L 5M5YH 3CCRA 4GN5A 3TREA 4JI6L 3HOVG 1K3RA 3E0EA 1N8RC 1UWVA 1HH2P 3S2HH 1T9HA 4HJ5A 4GOPC 1EQRA 2Q2UA 1Y1WG 1FL0A 4Y7NH 3KOJA 5FLMH 3UDGA 1QZHA 3I4MG 1OXSC 2IX0A 1WJJA 1UEBA 4PMWA 1G6PA 4X66Q 2B63H 4X65L 3IRBA 1VQHA 1CKNA 4GLVB 5IYCG 4YWLA 3SGIA 5LMNL 4DV5Q 3BZCA 1FGUA 3PUZA 1ASZA 2K5HA 4BXXG 1N32Q 3RR5A 2ZM6L 1KQSA 1YVCA 1O7IA 3GTMH 2OCEA 3RLNA 1EOVA 3W1BA 3CPFA 4DV3Q 4DV7L 2DUDA 5FJ8G 4IFDJ 4LF4Q 3CCSA 2LXKA 4A3EH 1QZGA 4DKAC 2KCTA 3KLWA 1HR0L 2PMZE 4A76A 1E22A 4EX5A 2UXCL 1PH5A 2JA7G 2GVBA 1N36Q 1X65A 4DR6Q 4DNIA 4GN3B 4JI0Q 4DR1L 1Q82C 1XMQQ 1TWAH 4R4IA 3ULPA 4LUZA 4DV1L 2I5LX 5C4JH 4JC0A 4LF5Q 1GD7A 5IP7H 4JBMA 4YCUA 4B3RL 2JA7H 1E1OA 3CQZH 1LM0A 1Q86C 4UY8C 2UXBQ 1KXLA 1HNWL 4IOCA 3PUVA 3H0GG 2JA5H 2JA6G 2WFWA 3S1MH 4POGA 4L5TA 4PG3A 3BU2A 5IWAQ 1PH4A 4BY7G 4JI3Q 3L2PA 4LUVA 2YYZA 2R93G 3CD6A 2KCMA 3OYYA 1IBKQ 4APVA 2HT1A 1K8AC 3BJUA 5HY6A 4OWWB 1BKBA 4HJ8A 2VUMH 1L0WA 4JBWA 4JI2L 5JJKA 2C35B 2NVQH 2F3IA 4A4IA 1N9WA 4R4QA 2ZJRA 1VS0A 4JI5L 3W1GA 1EUJA 4QGUA 2HQLA 2K52A 2Q2IA 2UU9Q 2UUAL 4JI4Q 4IFDI 4JI6Q 3K80C 3F8TA 4L5SA 4A3BH 1X3GA 3CP0A 5IYDG 1BBUA 3I7FA 3TRZA 3HKZG 2E8GA 5GAHC 3S2DH 2N49A 1VQDA 1VQNA 3HOZG 4PZ7A 1SE8A 1SLJA 3M9BA 1BVSA 4JCVE 4X65Q 4FDBA 1JJ2A 3TQYA 3KJOA 5IT9c 5LMNQ 1V1QA 5ELNA 2NVYH 5IYDH 1M1KC 5FLXc 4JG2A 4QL5A 4DK6C 2EQSA 2GVAA 2ZM6Q 1K9MC 2Z6KA 4DV7Q 1IXRA 1OXXK 3HKSA 4LF7L 4IJLA 3RN5A 2D0OA 1KIXA 3UDFA 3ULLA 3J81i 3E9IA 2EIFA 1XPRA 1QVFA 3S1QH 4Y52H 2WAQG 1HR0Q 3CCLA 3A74A 3KYHC 1OXTA 1Z9FA 1CKMA 4KI0A 3H3VI 2Z0SA 3CCEA 3S14H 2UXCQ 2OTLA 1TWFH 2JEAI 4XIGS 4X62L 1UE6A 2B29A 2UUBL 4IOAA 3GTPH 3A0JA 3STBC 3HOXG 2JQOA 1RIPA 1AE3A 3NELA 3U4ZA 4DR1Q 1VQJA 3J7A5 4A3MH 4DR4L 3ULJA 4DV1Q 1L2FA 3RZDH 5M3MG 2IX1A 3EBEA 3L0OA 4B3RQ 2HHHL 4GOPB 5C4XH 3M7NA 4BY1G 1YJ9A 3HFZB 3F2DA 1SROA 1I50H 3S17H 4UP8A 1A63A 1HNWQ 3NBHB 3H15A 1QVCA 2MNAA 1VQ8A 4B3ML 5IP9G 3MEFA 2QEXA 1PV4A 5M3MH 4P71A 3HOWG 2F52A 3VDYA 1YBYA 1XMOL 3FHWA 4AQYL 4GLXA 2OTJA 2RCNA 2OQ0A 1WCMH 2E2HH 5GQOA 1SR3A 5FLMG 2HIVA 2JA9A 1Y1VG 3UE1A 2B63G 3AYHB 4A3JH 1L1OB 5JEAJ 5IP9H 4UP9A 4JI2Q 4A3KH 4B3TQ 3HOWH 2IT1A 2VS1A 4YWMA 3HOYH 1KHIA 1M90C 1YITA 1HR0W 2ASBA 1PYBA 4GS3A 1UE7A 4JI5Q 1XNQL 3TS0A 1VQBA 1OTCA 4A3CH 1K83H 2UUAQ 1S40A 2JEBI 2CWAA 4LF9L 1DGSA 4OO1G 1Y1VH 4YY3L 1GVPA 1QUQB 3J7ZC 1W2BA 3RN2A 5GAGC 4A3EG 2UUCL 3F2CA 4A93H 2NZOA 4B3SL 1G291 3FP9A 3I4NH 3NENA 3KF6B 1PHJA 1PH1A 2E2IH 2CQOA 3CAMA 5C44H 1VQOA 1KL9A 4DR2L 1Z47A 2CCZA 5M3FG 1VQIA 1EQQA 3PO3G 1A0IA 1YHAA 5HGQA 3OTOL 1VQAA 1WFQA 3CCVA 5IP7G 2HIXA 3STBD 3PUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNH A;  1A8V A;  2ID0 A;  5E7N A;  4LF7 Q;  3RNU A;  3GTK H;  3I55 A;  4LWC A;  5GAE C;  3ER0 A;  2F4V Q;  3HOU H;  1X3E A;  4HJ9 A;  5EAY A;  1C9O A;  4MTN A;  3CXC A;  5M3F H;  2JA5 G;  4LFC L;  1I94 L;  3PV0 A;  3PO3 H;  4DR7 L;  3L7Z C;  1I3Q H;  4X62 Q;  3J81 c;  1Q12 A;  5K36 G;  3PGZ A;  4ME3 A;  1JMC A;  1Y14 B;  4GOP A;  4IJH A;  1A62 A;  1U0L A;  2R7F A;  4GNX B;  4NPS A;  1SFO H;  1YEZ A;  4AYB G;  4YHH L;  3GTJ H;  2VUM G;  2HHH Q;  4A3G H;  4DR5 Q;  1HZB A;  2KEN A;  4IO9 A;  4R1J A;  4DV6 L;  4A3F H;  2BA1 A;  2VQF L;  4QQB X;  4YCV A;  1JT8 A;  5M5X H;  1N34 L;  1R9T H;  1PFS A;  4B3M Q;  3RLO A;  1LTL A;  2BA0 A;  4RMF A;  4P72 A;  5BR8 L;  4A3B G;  4JI7 L;  4L5Q A;  1ASY A;  2YTX A;  1XMO Q;  3PF5 A;  4GKK L;  1L1O A;  4AQY Q;  3A5Z B;  3GO5 A;  1YJW A;  4LFA L;  1Q46 A;  4BBS H;  4DV2 L;  3I4O A;  2E5L L;  1MIU A;  4O2D A;  1AH9 A;  1NMF A;  4IPD A;  2Z6K C;  2NZH A;  4J15 A;  1NE3 A;  5C0X G;  3A5U A;  4HJ7 A;  4DR3 L;  3FKI H;  5IYB G;  1PH8 A;  2R7Z H;  1XNQ Q;  3S15 H;  3F2B A;  1C0A A;  1QUQ A;  3AFQ A;  2K14 A;  3AEV A;  1PH7 A;  1PVO A;  1NTG A;  2E2J H;  4LF9 Q;  3T1Y L;  1W3S A;  4YY3 Q;  3PF4 A;  4BBR H;  1K0R A;  3KF6 A;  2UUC Q;  1CSP A;  4HID A;  3GTG H;  1KAW A;  1NY4 A;  5IYB H;  4B3S Q;  3CPW A;  3S24 A;  2Y0S E;  5IE8 A;  1D8L A;  3G71 A;  1TWG H;  3KDF B;  1J6Q A;  4DR2 Q;  1SRU A;  4YWK A;  4A3M G;  4DV0 L;  1PH3 A;  4XTC S;  3PCO B;  3OTO Q;  3EN2 A;  1S72 A;  4LFB L;  4RG1 A;  2VW9 A;  4YCW A;  3CCU A;  1LYL A;  3CC7 A;  5C4X G;  2PI2 E;  3D31 A;  2A8V A;  1YJN A;  3K8A A;  1XJV A;  1HNZ L;  1VQ6 A;  5JJI A;  4NXN L;  5J3B A;  2N3S A;  1H95 A;  4NXM L;  1E7Z A;  1K73 C;  1JJC B;  1I94 Q;  4LFC Q;  4MZ9 A;  3W5O A;  2R92 H;  3PUY A;  4DR7 Q;  1U5K A;  4A3L H;  5DLQ E;  1E1T A;  3B6Y A;  4GNX A;  5ELO A;  4JBK A;  1KRT A;  4DUZ L;  5AJ3 L;  4AH6 A;  4TVA B;  1WCM G;  3CCQ A;  1RL2 A;  2DGY A;  4GKJ L;  3M3Y H;  1SMX A;  3HKZ E;  4QY7 A;  4OXP A;  2I5M X;  4LW1 A;  2N8N A;  4P73 A;  4C3I H;  3BZK A;  1IBM L;  4YHH Q;  4R4T A;  1CSQ A;  4A3K G;  5LMN W;  3GD7 A;  1OXV A;  3HOY G;  1V9P A;  4DV6 Q;  1PH2 A;  2VQF Q;  2AWN A;  4JI1 L;  3JAM i;  1VQK A;  2N78 A;  1N34 Q;  4BA1 I;  4DV4 L;  4A3C G;  1NBW A;  4JOI A;  2RHS B;  3MXN B;  4LF8 L;  2LSS A;  1JJG A;  4A3D H;  4P74 A;  5BR8 Q;  1VQ9 A;  2JE6 I;  4JI7 Q;  1HJP A;  4DAM A;  2AWO A;  2I0Q A;  4DUY L;  4GKK Q;  4A93 G;  2A1A A;  2VY3 A;  2XTI A;  4LFA Q;  4OO1 I;  3CW2 C;  3I4N G;  2QA4 A;  2I5H A;  3J81 j;  3K7U C;  2YV5 A;  1VQF A;  4GLA C;  4DV2 Q;  2E5L Q;  1X3F A;  2PQA B;  1VQC A;  2WAQ E;  2WB1 E;  5C44 G;  1N33 L;  5C3E H;  3RZO H;  1FJG L;  4DR3 Q;  4DR4 Q;  2K5N A;  2V1C C;  2KHI A;  1KRS A;  3PO2 G;  1VQG A;  1CKO A;  1Q8K A;  4C3H H;  4X64 L;  3KJP A;  2IY5 B;  4A3J G;  4C3J H;  4JYA L;  3DLL A;  3CF5 A;  3T1Y Q;  4JI8 L;  3OW2 A;  2OWO A;  2LXJ A;  4P75 A;  3S16 H;  1K8G A;  2VL6 A;  4IPG A;  4ALP A;  3HOU G;  5LMU L;  4NB3 A;  2NN6 G;  4DAY B;  1XPO A;  3KDF A;  3TS2 A;  2YTV A;  3PSI A;  2AHO B;  1HZA A;  3PO2 H;  2K4K A;  3J80 i;  1P8L A;  4HIK A;  2K75 A;  4QJF A;  4OX9 L;  1NMG A;  1WI5 A;  2VZA A;  4EQ5 A;  3ICE A;  1PH6 A;  2ZTC A;  4LF6 L;  1D7Q A;  1BBW A;  1OXU A;  2PI2 A;  1HZ9 A;  4DV0 Q;  4BA2 I;  3M4Q A;  3HOV H;  3PIO A;  3CC4 A;  1G51 A;  5JJL A;  1UE1 A;  1Q1B A;  4K0K L;  4LNQ A;  4KHP L;  4LFB Q;  4A3G G;  1GKH A;  1Y1W H;  2UUB Q;  3I4M H;  4A3F G;  1Q81 C;  3Q8D A;  4PZ8 A;  1HNZ Q;  1TWC H;  4OWT B;  4NXN Q;  1L1O C;  5IYC H;  4JBJ A;  4NXM Q;  3GTL H;  1EIY B;  2R7D A;  4DK3 C;  2JJQ A;  1X55 A;  1MJC A;  1GM5 A;  4BXX H;  4DUZ Q;  5AJ3 Q;  1YHQ A;  4GKJ Q;  2NVT H;  1GO3 E;  1V43 A;  1YIJ A;  3D0F A;  4BBS G;  4UPA A;  5FJ8 H;  1QVG A;  1PYS B;  2D0P A;  1IBM Q;  2K5V A;  1HNX L;  1EYG A;  4X6A H;  2VQE L;  3UDX A;  3G4S A;  2R7Z G;  2KHJ A;  2GN5 A;  2ZJQ A;  3RLF A;  3FKI G;  4UP7 A;  4JI1 Q;  3S1N H;  1VQM A;  3E9H A;  2MFI A;  1WOC A;  3G6E A;  4DV4 Q;  4JV5 L;  2Y0S G;  4LF8 Q;  3GDE A;  3U4V A;  2UXD L;  3CC2 A;  2CKZ B;  5C0X I;  4DPG A;  4BBR G;  3JAM c;  1JE5 A;  4R4O A;  1VQ7 A;  4DUY Q;  5H1S E;  2PQA A;  2EXD A;  1TWH H;  3ERS X;  3CME A;  1B70 B;  2ZTD A;  5GRO A;  5JEA G;  1J5E L;  2OQK A;  2IHE A;  3KF8 B;  1IBL L;  1XNR L;  1LUZ A;  4C2M H;  2IHF A;  2RHQ B;  1KD1 C;  1YNX A;  2CFM A;  1N33 Q;  3CCM A;  2JA8 G;  3U58 A;  1FJG Q;  3T1H L;  2Q2H A;  3H0G H;  4OON A;  1AE2 A;  2NVX H;  1TXY A;  2BH2 A;  5GAD C;  2JA6 H;  4X64 Q;  4B3T L;  1PA6 A;  2L15 A;  1EFW A;  4JYA Q;  4BY7 H;  3U50 C;  4JI8 Q;  3K81 C;  3M4P A;  2R93 H;  3F1Z A;  2B3G A;  1VCI A;  5LMU Q;  2JA8 H;  3GTQ H;  1E24 A;  4X66 L;  2MO1 A;  4AYB E;  4GNX C;  1MJE A;  1HZC A;  2ZTE A;  1B8A A;  3K0X A;  1X9N A;  2AKW B;  1NJI C;  2MO0 A;  1YZ6 A;  3TEH B;  4DV5 L;  2R92 G;  4IFD G;  4A3L G;  1VQL A;  4OX9 Q;  2ATW A;  3PIP A;  1Q7Y C;  4L5R C;  1CKN B;  1N32 L;  4O0A A;  4LF6 Q;  3NEM A;  3UDI A;  4DV3 L;  3J80 c;  2A19 A;  2JK8 A;  5M5W H;  4IPC A;  1E3P A;  1B7Y B;  1EWI A;  2XGT A;  4LF4 L;  3WWV A;  4K0K Q;  1SN8 A;  4KHZ A;  3CCJ A;  4LUO A;  4KHP Q;  4HIM A;  4OWX B;  4HIO A;  4JOI C;  1IL2 A;  3HOZ H;  2ALY B;  2YTY A;  1VQ4 A;  1IZ6 A;  4AIM A;  1N36 L;  4DR6 L;  3AFP A;  3I56 A;  2WP8 J;  2ZJP A;  4A3D G;  4JI0 L;  2F4V L;  1I6H H;  4A75 A;  4IPH A;  2ES2 A;  1YHB A;  2WB1 G;  4QIW E;  1X54 A;  1XMQ L;  1Q1E A;  2KBN A;  3EIV A;  2H5X A;  3G48 A;  4MNO A;  3DM3 A;  4LF5 L;  3GTO H;  2QGQ A;  4WJ4 A;  1VQP A;  2CWP A;  1P16 A;  4H02 A;  2R6G A;  3K7A H;  5IY0 A;  4R4C A;  1CUK A;  1UE5 A;  1HNX Q;  3KFU A;  2UXB L;  5C3E G;  2VQE Q;  1KC8 C;  2AMC B;  1I5F A;  1X6O A;  1S3O A;  1X56 A;  2K50 A;  1IYJ B;  3ZJY C;  4WJ3 M;  2Q2T A;  2YU9 H;  4DR5 L;  4JV5 Q;  3AQQ A;  4KLK A;  1YI2 A;  1MKH A;  5IWA L;  1VQ5 A;  4JI3 L;  1XTD A;  4POF A;  3HOX H;  3H3V H;  2UXD Q;  4PZ6 A;  3LGJ A;  3PUX A;  2VNU D;  1EIF A;  4HJA A;  4A3I G;  1XPU A;  1WYD A;  3S1R H;  1IBK L;  1JB7 A;  3M4O H;  4GN4 B;  1IBL Q;  1XNR Q;  1J5E Q;  1VQE A;  2BH8 A;  2D62 A;  3CMA A;  1FVI A;  3UE0 A;  4BY1 H;  3I2Z A;  2RF4 A;  1C7Y A;  3M85 A;  2MQH A;  2NN6 I;  4TQU S;  2FXQ A;  1PH9 A;  5C0X J;  2UU9 L;  3T1H Q;  3JC6 6;  4A3I H;  4JI4 L;  5M5Y H;  3CCR A;  4GN5 A;  3TRE A;  4JI6 L;  3HOV G;  1K3R A;  3E0E A;  1N8R C;  1UWV A;  1HH2 P;  3S2H H;  1T9H A;  4HJ5 A;  4GOP C;  1EQR A;  2Q2U A;  1Y1W G;  1FL0 A;  4Y7N H;  3KOJ A;  5FLM H;  3UDG A;  1QZH A;  3I4M G;  1OXS C;  2IX0 A;  1WJJ A;  1UEB A;  4PMW A;  1G6P A;  4X66 Q;  2B63 H;  4X65 L;  3IRB A;  1VQH A;  1CKN A;  4GLV B;  5IYC G;  4YWL A;  3SGI A;  5LMN L;  4DV5 Q;  3BZC A;  1FGU A;  3PUZ A;  1ASZ A;  2K5H A;  4BXX G;  1N32 Q;  3RR5 A;  2ZM6 L;  1KQS A;  1YVC A;  1O7I A;  3GTM H;  2OCE A;  3RLN A;  1EOV A;  3W1B A;  3CPF A;  4DV3 Q;  4DV7 L;  2DUD A;  5FJ8 G;  4IFD J;  4LF4 Q;  3CCS A;  2LXK A;  4A3E H;  1QZG A;  4DKA C;  2KCT A;  3KLW A;  1HR0 L;  2PMZ E;  4A76 A;  1E22 A;  4EX5 A;  2UXC L;  1PH5 A;  2JA7 G;  2GVB A;  1N36 Q;  1X65 A;  4DR6 Q;  4DNI A;  4GN3 B;  4JI0 Q;  4DR1 L;  1Q82 C;  1XMQ Q;  1TWA H;  4R4I A;  3ULP A;  4LUZ A;  4DV1 L;  2I5L X;  5C4J H;  4JC0 A;  4LF5 Q;  1GD7 A;  5IP7 H;  4JBM A;  4YCU A;  4B3R L;  2JA7 H;  1E1O A;  3CQZ H;  1LM0 A;  1Q86 C;  4UY8 C;  2UXB Q;  1KXL A;  1HNW L;  4IOC A;  3PUV A;  3H0G G;  2JA5 H;  2JA6 G;  2WFW A;  3S1M H;  4POG A;  4L5T A;  4PG3 A;  3BU2 A;  5IWA Q;  1PH4 A;  4BY7 G;  4JI3 Q;  3L2P A;  4LUV A;  2YYZ A;  2R93 G;  3CD6 A;  2KCM A;  3OYY A;  1IBK Q;  4APV A;  2HT1 A;  1K8A C;  3BJU A;  5HY6 A;  4OWW B;  1BKB A;  4HJ8 A;  2VUM H;  1L0W A;  4JBW A;  4JI2 L;  5JJK A;  2C35 B;  2NVQ H;  2F3I A;  4A4I A;  1N9W A;  4R4Q A;  2ZJR A;  1VS0 A;  4JI5 L;  3W1G A;  1EUJ A;  4QGU A;  2HQL A;  2K52 A;  2Q2I A;  2UU9 Q;  2UUA L;  4JI4 Q;  4IFD I;  4JI6 Q;  3K80 C;  3F8T A;  4L5S A;  4A3B H;  1X3G A;  3CP0 A;  5IYD G;  1BBU A;  3I7F A;  3TRZ A;  3HKZ G;  2E8G A;  5GAH C;  3S2D H;  2N49 A;  1VQD A;  1VQN A;  3HOZ G;  4PZ7 A;  1SE8 A;  1SLJ A;  3M9B A;  1BVS A;  4JCV E;  4X65 Q;  4FDB A;  1JJ2 A;  3TQY A;  3KJO A;  5IT9 c;  5LMN Q;  1V1Q A;  5ELN A;  2NVY H;  5IYD H;  1M1K C;  5FLX c;  4JG2 A;  4QL5 A;  4DK6 C;  2EQS A;  2GVA A;  2ZM6 Q;  1K9M C;  2Z6K A;  4DV7 Q;  1IXR A;  1OXX K;  3HKS A;  4LF7 L;  4IJL A;  3RN5 A;  2D0O A;  1KIX A;  3UDF A;  3ULL A;  3J81 i;  3E9I A;  2EIF A;  1XPR A;  1QVF A;  3S1Q H;  4Y52 H;  2WAQ G;  1HR0 Q;  3CCL A;  3A74 A;  3KYH C;  1OXT A;  1Z9F A;  1CKM A;  4KI0 A;  3H3V I;  2Z0S A;  3CCE A;  3S14 H;  2UXC Q;  2OTL A;  1TWF H;  2JEA I;  4XIG S;  4X62 L;  1UE6 A;  2B29 A;  2UUB L;  4IOA A;  3GTP H;  3A0J A;  3STB C;  3HOX G;  2JQO A;  1RIP A;  1AE3 A;  3NEL A;  3U4Z A;  4DR1 Q;  1VQJ A;  3J7A 5;  4A3M H;  4DR4 L;  3ULJ A;  4DV1 Q;  1L2F A;  3RZD H;  5M3M G;  2IX1 A;  3EBE A;  3L0O A;  4B3R Q;  2HHH L;  4GOP B;  5C4X H;  3M7N A;  4BY1 G;  1YJ9 A;  3HFZ B;  3F2D A;  1SRO A;  1I50 H;  3S17 H;  4UP8 A;  1A63 A;  1HNW Q;  3NBH B;  3H15 A;  1QVC A;  2MNA A;  1VQ8 A;  4B3M L;  5IP9 G;  3MEF A;  2QEX A;  1PV4 A;  5M3M H;  4P71 A;  3HOW G;  2F52 A;  3VDY A;  1YBY A;  1XMO L;  3FHW A;  4AQY L;  4GLX A;  2OTJ A;  2RCN A;  2OQ0 A;  1WCM H;  2E2H H;  5GQO A;  1SR3 A;  5FLM G;  2HIV A;  2JA9 A;  1Y1V G;  3UE1 A;  2B63 G;  3AYH B;  4A3J H;  1L1O B;  5JEA J;  5IP9 H;  4UP9 A;  4JI2 Q;  4A3K H;  4B3T Q;  3HOW H;  2IT1 A;  2VS1 A;  4YWM A;  3HOY H;  1KHI A;  1M90 C;  1YIT A;  1HR0 W;  2ASB A;  1PYB A;  4GS3 A;  1UE7 A;  4JI5 Q;  1XNQ L;  3TS0 A;  1VQB A;  1OTC A;  4A3C H;  1K83 H;  2UUA Q;  1S40 A;  2JEB I;  2CWA A;  4LF9 L;  1DGS A;  4OO1 G;  1Y1V H;  4YY3 L;  1GVP A;  1QUQ B;  3J7Z C;  1W2B A;  3RN2 A;  5GAG C;  4A3E G;  2UUC L;  3F2C A;  4A93 H;  2NZO A;  4B3S L;  1G29 1;  3FP9 A;  3I4N H;  3NEN A;  3KF6 B;  1PHJ A;  1PH1 A;  2E2I H;  2CQO A;  3CAM A;  5C44 H;  1VQO A;  1KL9 A;  4DR2 L;  1Z47 A;  2CCZ A;  5M3F G;  1VQI A;  1EQQ A;  3PO3 G;  1A0I A;  1YHA A;  5HGQ A;  3OTO L;  1VQA A;  1WFQ A;  3CCV A;  5IP7 G;  2HIX A;  3STB D;  3PUW A; 
#chains in the Genus database with same CATH topology
 2F4I A;  3RNU A;  3VYS A;  3AU7 A;  3HP3 A;  3SVM A;  4Q5V A;  3GTK H;  1PXU A;  3DXJ C;  5GAE C;  4HJ9 A;  5DAU A;  4KN7 C;  4NW2 A;  2R3Z A;  3CXC A;  3J7Y W;  1I94 L;  3FVQ A;  3PO3 H;  3R3O A;  4X62 Q;  1HRJ A;  2HQE A;  1Q12 A;  2A6H C;  2K05 A;  2QDB A;  1JMC A;  1EY6 A;  5EQ0 A;  4GOP A;  4I65 A;  1U0L A;  1WTQ A;  1WTW A;  2K5W A;  3NBH A;  3GTM B;  4YHH L;  2HHH Q;  2EVB A;  2KEN A;  1RTO A;  1N34 L;  4B9X A;  5BR8 L;  2BA0 A;  1JCK B;  4L5Q A;  1ASY A;  2NVT B;  4EQN A;  3L9A X;  2L1B A;  3A5Z B;  2E5L L;  1ESF A;  1AH9 A;  4IPD A;  2NZH A;  4HJ7 A;  3A5U A;  4J1M A;  1NTG A;  4F87 A;  5I2X A;  4KHV A;  5JOB A;  1I4H A;  3I4L A;  2K7V A;  4DNR B;  4BBR H;  1K0R A;  2PNR C;  1UUP A;  3GTG H;  4B3S Q;  5IE8 A;  1CHQ D;  3H0G B;  3KDF B;  1FNV A;  2JA6 B;  4N8F A;  2KCC A;  4YWK A;  4A3M G;  4XTC S;  5C3X A;  1I4R A;  2VW9 A;  4KJO A;  1GJX A;  1O78 A;  4OIK A;  2EE1 A;  4NMZ A;  1NR2 A;  1HNZ L;  1VQ6 A;  1ZEQ X;  4NXN L;  1K73 C;  1I94 Q;  3PUY A;  4IFD H;  4A3L H;  4JBK A;  1UNS A;  3A56 A;  1SNO A;  3LWE A;  4DUZ L;  4TVA B;  1WCM G;  1ICF B;  1JOQ A;  3M3Y H;  1SMX A;  1E2V A;  2Z8L A;  4P73 A;  4ME5 A;  4YHH Q;  4XQQ A;  4R4T A;  1X32 A;  1EZ8 A;  1A2U A;  1UEA B;  5KND A;  1I6H B;  1N34 Q;  4A3C G;  2RHS B;  5KNB A;  1IYV A;  4A3D H;  5BR8 Q;  1VQ9 A;  5I6Y A;  1HJP A;  4DAM A;  4KKS A;  2A73 B;  1I6V C;  4OL7 A;  2AWO A;  4DUY L;  3J7A V;  1CM9 A;  4OO1 I;  2Z1C A;  2E5L Q;  2YV5 A;  4IN3 A;  4XXE A;  1X3F A;  3O13 A;  1VQC A;  3I73 A;  1FJG L;  3MAQ A;  2F0T A;  3PO2 G;  4C3H H;  1U4M A;  3NTH A;  5J22 A;  1S5F D;  5D3D A;  2OWO A;  1R4P B;  1TY2 A;  2EY1 A;  5T1I A;  3SK5 A;  4P75 A;  3S16 H;  4ALP A;  1QG7 A;  3HOU G;  2NUC A;  4NB3 A;  2NN6 G;  2H4O A;  5I9O A;  4K8I A;  4BY1 B;  3ZYY X;  1VMP A;  2AHO B;  1Y8N B;  3DMU A;  3PO2 H;  1GUG A;  3ERO A;  4KY5 A;  2XIW A;  1LT6 D;  4EQ5 A;  2O2L D;  4G7O C;  2PI2 A;  4HED A;  4BA2 I;  3EFX D;  1RDP D;  3HOV H;  2UUB Q;  1Y1V B;  3QR8 A;  3I4M H;  5HGT A;  2BOS A;  3GP7 A;  3HG9 A;  1HNZ Q;  4NXN Q;  2XSC A;  2R7D A;  3OSO A;  1MJC A;  4BXX H;  4DUZ Q;  1VDZ A;  3VR4 A;  3S9W A;  1GO3 E;  1V43 A;  3VR3 A;  4BBS G;  1QVG A;  2D0P A;  1K28 A;  2F0H A;  3JAM L;  1EYG A;  1HNX L;  4X6A H;  1ENF A;  3G4S A;  2KHJ A;  2GN5 A;  3E9H A;  1WOC A;  3MTS A;  2Y0S G;  1J8I A;  5EKK A;  3PO3 B;  4ZRZ A;  3CC2 A;  2CKZ B;  2AQ2 B;  2L4N A;  3JAM c;  5C4J B;  1VQ7 A;  4DUY Q;  2DJF C;  2EXD A;  3U9O A;  3CME A;  1B70 B;  5JEA G;  5GRO A;  1XNR L;  2IHE A;  1LUZ A;  3HRZ C;  1KDC A;  2KJX A;  1RHP A;  2CFM A;  1KD1 C;  2JA8 G;  1FJG Q;  1GUW A;  2BH2 A;  1V1P B;  5JEA H;  2TMP A;  3MC0 B;  3U50 C;  2FIN B;  2NBF A;  1SBB B;  3M4P A;  2R93 H;  3T16 A;  2B3G A;  3KLR A;  5F2D A;  2IX3 A;  1PTO D;  1VCI A;  4K2L A;  2JA8 H;  1E24 A;  4GNX C;  2L11 A;  2MO1 A;  1DON A;  1HZC A;  2E76 C;  1B8A A;  2ATW A;  3PIP A;  1MD2 D;  5DM7 3;  3UDI A;  1J9O A;  2A19 A;  3NQT A;  1EIH A;  3WWV A;  1SN8 A;  3CCJ A;  2KA7 A;  4LUO A;  4HIM A;  4HIO A;  2QW7 A;  4C56 C;  5AFW A;  1WTX A;  3T13 A;  3GTG B;  4CDD C;  3DUZ A;  3H91 A;  4QIW B;  3BS1 A;  4QIW E;  1Q1E A;  1QNU A;  2H5X A;  2XVS A;  3DM3 A;  5KNC A;  3TDQ A;  2F0D A;  2QGQ A;  4LF5 L;  2EYP A;  1E2Z A;  2F3V A;  2CWP A;  4H02 A;  2R6G A;  5IY0 A;  4LJZ C;  1HNX Q;  1UE5 A;  3KFU A;  1XTC D;  4OHJ A;  1FYC A;  1I5F A;  3N52 A;  1X56 A;  1LLR D;  3Q23 A;  2F0E A;  4PV1 C;  4V19 0;  2DNE A;  5IWA L;  4JI3 L;  4A3M B;  2FHT A;  3LGJ A;  3PUX A;  2VNU D;  1DOK A;  1EY8 A;  2B2U C;  4IUP A;  1B50 A;  1JB7 A;  1XNR Q;  2BH8 A;  1FVI A;  3UE0 A;  3QJY A;  1C7Y A;  3M85 A;  2QF7 A;  2RDF A;  2FXQ A;  3EA6 A;  5CBE E;  3JC6 6;  2B2Y C;  5M5Y H;  4HR7 B;  3TRE A;  4JI6 L;  1SE3 A;  1K3R A;  3S2H H;  1HH2 P;  1WCM B;  5CV5 A;  4IUR A;  1T9H A;  2NYZ D;  2Q2U A;  1Y1W G;  2F0G A;  2GA4 B;  4Y7N H;  3LX0 A;  1UEB A;  4PMW A;  1UAP A;  5IYC G;  3MEH A;  2WII B;  2EJF C;  3VR2 A;  4OEM B;  1ASZ A;  2K5H A;  1KQS A;  1YVC A;  1D1K A;  5DNF A;  2CVR A;  3C46 A;  2DUD A;  2MGS A;  4IFD J;  4CDC C;  2LXK A;  1A2T A;  1T5E A;  1HR0 L;  3IFT A;  4EX5 A;  1WD0 A;  1X65 A;  1LO5 D;  1RKN A;  4DR1 L;  1L0Y B;  4R4I A;  4LUZ A;  4DV1 L;  3H3V C;  2I5L X;  2D5D A;  4LF5 Q;  2G5D A;  3HOU B;  1E1O A;  3CQZ H;  4DXF A;  1JQY D;  5T1G A;  3OWE B;  5IIF A;  3S1M H;  3J7A F;  1GUS A;  2NTT A;  2E74 C;  4QUF A;  5IWA Q;  2X69 A;  3TP5 A;  3L2P A;  4JI3 Q;  4HAE A;  5HY6 A;  4OWW B;  5CGK A;  1BKB A;  3G7L A;  1BCP D;  4JBW A;  5JJK A;  2PCF B;  5M5X B;  2C35 B;  4R4Q A;  2EDG A;  4RWS C;  1TU2 B;  1SEB D;  4JI6 Q;  4L5S A;  4FXD A;  3CP0 A;  4PMC A;  1BBU A;  2AUK A;  2L12 A;  3H09 A;  4BBS B;  4ZCK A;  2EPB A;  4HSP A;  5EPL A;  1SE8 A;  1SLJ A;  3M9B A;  1BVS A;  4JCV E;  5M9O A;  4S3S A;  5COR A;  4KMU C;  5IGF A;  2X6L A;  1M1K C;  5CBA E;  4KTA A;  5FOB B;  1BBX C;  4LF7 L;  1EY7 A;  3UDF A;  2EIF A;  3ITP A;  1Y8P B;  2WAQ G;  5JPN C;  4M1U B;  1HR0 Q;  3CCL A;  1CKM A;  3S14 H;  2JA8 B;  1TWF H;  3K59 A;  2KOL A;  2JEA I;  2NZ1 D;  3GTP H;  3HOX G;  3BZD B;  1G2S A;  1KTK A;  3WDN A;  4DR1 Q;  3ULJ A;  4DV1 Q;  3RZD H;  1ROD A;  3L0O A;  3WOF A;  4GOP B;  2PW7 A;  3NWS A;  5C4X H;  1YJ9 A;  3HFZ B;  1A63 A;  3NBH B;  1IKM A;  4CKE A;  1QVC A;  3PMF A;  2RBM A;  1STB A;  5IP9 G;  3MEF A;  1PV4 A;  2F52 A;  1KLG D;  4N9T A;  2QIL A;  2RSN A;  4GLX A;  4AQY L;  1DM0 B;  2M9V A;  3NE5 B;  2HIV A;  3RMH A;  5EBD A;  3UE1 A;  4ZKB B;  5JEA J;  3OWF A;  2CQA A;  5EPK A;  5IP9 H;  4IAL A;  2IT1 A;  3HOY H;  1IKL A;  1YIT A;  1E2W A;  4F8M A;  1HQM C;  1A15 A;  3L3O C;  2C5C A;  1WVL A;  4UDU C;  1GVP A;  3RN2 A;  3BYT B;  4HN7 A;  3F2C A;  4CHT B;  1ENC A;  1TVX A;  2CQO A;  1VQO A;  1VF7 A;  4C1N K;  1EQQ A;  1EU3 A;  4G4K A;  1WFQ A;  5IP7 G;  3D6W A;  3PUW A;  4LF7 Q;  3S2H B;  3FRP B;  3ER0 A;  4L6T B;  1O7Z A;  2VXW A;  2JA5 G;  4LFC L;  4UAI A;  1U9R A;  5K36 G;  2KCN A;  1BO0 A;  1Y14 B;  4N9P A;  5COY A;  4IJH A;  1A62 A;  1SFO H;  1Y1W B;  1YEZ A;  4DR5 Q;  4IO9 A;  4R1J A;  4DV6 L;  4JPB W;  4YCV A;  1JT8 A;  1K0S A;  1QOH A;  3OPO A;  5EKL A;  3TP8 A;  1PZJ D;  2EY5 A;  2F0P A;  1IYU A;  2M2L A;  3RLO A;  4A3B G;  3NSW A;  1SYG A;  3PIP 3;  3D4W A;  4AQY Q;  1DZ1 A;  3GO5 A;  1YJW A;  4LFA L;  1Q46 A;  3I4O A;  1MIU A;  4ZAI A;  4FYD A;  2Z6K C;  1K8M A;  2PQE A;  1RF2 D;  4DR3 L;  4G7H C;  3CQZ B;  5C0X G;  1C0A A;  5IYB G;  1B3Q A;  1DCZ A;  1QUQ A;  3AFQ A;  3MFG A;  1LAC A;  1LTA D;  5IGE A;  2E2J H;  3T1Y L;  3K57 A;  2SDF A;  4TRD A;  4CBV A;  1AZQ A;  2DY8 A;  3A8K E;  4IQZ A;  4C2M B;  2SNS A;  5C0X H;  5IYB H;  1Z7T A;  3S24 A;  4EVO A;  3IAY A;  1HA5 A;  1SND A;  3OW7 A;  1LV9 A;  3K5L A;  1ESR A;  4DF7 A;  2KEE A;  1TII D;  3PCO B;  1SNQ A;  1FD7 D;  4DNT B;  1S72 A;  4RG1 A;  4MN3 A;  1AZP A;  4YCW A;  1LYL A;  3CC7 A;  2PI2 E;  1YJN A;  1GXD C;  2N3S A;  1S5D D;  4NXM L;  4LFC Q;  2R92 H;  2B2T A;  1U5K A;  1PTO H;  3RD4 A;  4AH6 A;  3CCQ A;  4QY7 A;  4OXP A;  4LW1 A;  1IBM L;  4C3I H;  1PLF A;  3T56 B;  3GV6 A;  4DV6 Q;  1PH2 A;  3R2I A;  1B9N A;  3JAM i;  1VQK A;  1OO9 B;  2N78 A;  4DV4 L;  5C3W A;  2EY6 A;  4QB4 A;  1JJG A;  2A69 C;  2I07 B;  3SEB A;  2RDH A;  4A93 G;  4RGM A;  3G6J B;  4B08 A;  2FJ2 A;  2VY3 A;  2XTI A;  4LFA Q;  3CW2 C;  4DU9 A;  2I5H A;  2WAQ B;  2WB1 B;  2WAQ E;  1N33 L;  2WB1 E;  3RZO H;  4DR3 Q;  2K5N A;  1VQG A;  3HOX B;  3KJP A;  1CT1 D;  3MXU A;  3DLL A;  3T1Y Q;  4Q0F A;  1B4O A;  1STA A;  1PYW D;  3TS2 A;  5KRU A;  2PZW A;  1AN8 A;  1HZA A;  2K4K A;  3KBG A;  3NPP A;  1WTR A;  5FO8 B;  1LTG D;  1B44 D;  1G51 A;  4U68 A;  5JJL A;  1GKH A;  4FF3 A;  1BUV T;  2V4D A;  3DWA A;  1TWC H;  1L1O C;  2RCF A;  4JBJ A;  4NXM Q;  3GTL H;  1EIY B;  4DK3 C;  1X55 A;  5FO9 B;  3MZ5 A;  2IW3 A;  1ONL A;  1JE4 A;  3E3X A;  4MHE A;  1SDF A;  1YHQ A;  5CV4 A;  1TS2 A;  2A69 D;  1BCP F;  4UPA A;  1IBM Q;  4HCE A;  2F3W A;  2L9H A;  3KK7 A;  2ZJQ A;  3RLF A;  1YNN C;  1DD2 A;  2MFI A;  4DV4 Q;  5HUR A;  4U67 3;  3GDE A;  3U4V A;  1TWA B;  3NK9 A;  3WOE A;  2UXD L;  1MHW C;  4BBR G;  4CDE C;  1JE5 A;  4R4O A;  5LHY 1;  1JB3 A;  5IT9 E;  5H1S E;  3SK8 A;  2PQA A;  4CJ1 B;  1HCZ A;  1TWH H;  1J5E L;  2OQK A;  1ZKO A;  3NTI A;  1SFO B;  3SHL A;  3CRL C;  1N33 Q;  2JA5 B;  3IFD A;  3U58 A;  2L0C A;  1HTL D;  2Q2H A;  4RKB A;  1AE2 A;  2NVX H;  4B3T L;  5I4D A;  2L15 A;  2RKS A;  2QCP X;  4BY7 H;  1LT5 D;  2DJG C;  3A7A B;  4G7Z C;  1B3A A;  3GTQ H;  2Z9H A;  1MJE A;  1JIC A;  5D3I B;  2MO0 A;  1YZ6 A;  4OEL B;  4IFD G;  4QF4 A;  1ZXT A;  4DA2 A;  1VQL A;  4A3L G;  1EZ6 A;  1K8O A;  1N32 L;  4O0A A;  4A3B B;  3NEM A;  1CK1 A;  3J80 c;  1QB5 D;  4XYO A;  5M5W H;  4IPC A;  3S2D B;  1B7Y B;  5KEE A;  1H95 A;  2HCI A;  4K8J A;  4KHZ A;  4DK1 A;  2E2J B;  3CRK C;  4JOI C;  2IL8 A;  3HOZ H;  2YTY A;  1IZ6 A;  4NP5 A;  4ZYS A;  5KYI A;  2NVY B;  1N36 L;  4DR6 L;  3I56 A;  4A3D G;  1PRT D;  2F4V L;  4IPH A;  1YNN D;  1STN A;  1X54 A;  2HCC A;  1JR0 D;  3G48 A;  4MNO A;  2PO4 A;  3GTO H;  1AW7 A;  4WJ4 A;  3S1Q B;  1QE6 A;  1TS3 A;  2JYO A;  2NTS A;  1KC8 C;  2I46 A;  4CKB A;  3NTK A;  1SNC A;  2YU9 H;  4C3H G;  1YI2 A;  1MKH A;  1VQ5 A;  1TKW B;  4POF A;  3H3V H;  3FPU B;  3UI2 A;  2UXD Q;  4R9W A;  2BDN A;  1EIF A;  3KF8 A;  4HJA A;  4A3I G;  1QCB D;  3M4O H;  5CV9 A;  1WTV A;  2OEO A;  1J5E Q;  4IZ8 A;  5L37 A;  3CMA A;  2MQH A;  2NN6 I;  4KD3 A;  1PH9 A;  5C0X J;  2UU9 L;  4A3I H;  4JI4 L;  4GN5 A;  2ICE C;  3HOV G;  1EYC A;  1N8R C;  2E2H B;  1H9S A;  4HJ5 A;  2WAC A;  3I4M G;  5FLM H;  3D3R A;  2XWB B;  2WV6 D;  1G6P A;  3SR1 A;  2B63 H;  3IRB A;  4GLV B;  1CKN A;  1PTO C;  3SGI A;  5LMN L;  2A6E C;  3V96 A;  1K83 B;  2K6A A;  4BXX G;  4TSS A;  1N32 Q;  3K0Y A;  2A5H A;  2OCE A;  3W1B A;  4DV7 L;  4A93 B;  3CCS A;  4A3E H;  4PNY A;  4DKA C;  2KCT A;  2PMZ B;  3KLW A;  3MA2 B;  1QIL A;  2PMZ E;  2UXC L;  2JA7 G;  1SYE A;  1N36 Q;  4DR6 Q;  4HSV A;  4O1N A;  3NQI A;  4P2C B;  4GN3 B;  4XT3 B;  5D65 A;  2B39 A;  2B8G A;  1Q82 C;  3ULP A;  3TP7 A;  1GD7 A;  3GTK B;  4JBM A;  2JA7 H;  1LTB D;  1STE A;  2F0L A;  1Q86 C;  5CR3 A;  1KXL A;  1HNW L;  4WFN 3;  5CV8 A;  3W2D A;  3NBI A;  3BU2 A;  3P7J A;  4ZQ3 A;  2L5T A;  1EY0 A;  3GTL B;  5DM6 3;  2R93 G;  3CD6 A;  5IGC A;  3OYY A;  3NHH A;  1K3B C;  4RA8 A;  4APV A;  1K8A C;  2VUM H;  3SK6 A;  1HHV A;  2NVQ H;  3A8I E;  4A4I A;  1N9W A;  2G9H D;  2K52 A;  2UU9 Q;  1II3 A;  4DGZ A;  4JI4 Q;  2RQX A;  2A6E D;  3F8T A;  1X3G A;  5IYD G;  4KKU A;  1V8Q A;  2N49 A;  4LK1 C;  1VQN A;  1MBY A;  2DNC A;  2ENB A;  3TQY A;  3I3C A;  5ELF A;  5LMN Q;  1V1Q A;  5IYD H;  4XDX A;  5FLX c;  4JG2 A;  1STY A;  4QL5 A;  4DK6 C;  2GVA A;  1K9M C;  1CQF A;  4DV7 Q;  1IXR A;  3QO2 A;  4BBR B;  1X3P A;  1OXX K;  2D0O A;  3URY A;  4CGY B;  1I4P A;  3E9I A;  1XPR A;  2K01 A;  2RSO A;  1XXG A;  3DWQ A;  1OXT A;  1Z9F A;  3BG3 A;  4HCS A;  2UXC Q;  2OTL A;  4XIG S;  1UE6 A;  2JQO A;  3FPP A;  5A2Q L;  1VQJ A;  5M3M G;  1Y8O B;  4K6L A;  4WRD A;  3Q24 A;  1MI2 A;  5BN4 A;  2X6G A;  2PYK A;  3V05 A;  3F2D A;  1SRO A;  1I50 H;  4R8N A;  3S17 H;  4F88 A;  1HNW Q;  2MNA A;  2ZXP A;  4B3M L;  3Q22 A;  5M3M H;  2EYJ A;  1LTT D;  1XMO L;  3M3Y B;  3E6Z X;  1ILQ A;  5DEH A;  2KED A;  3X3M A;  4A3K H;  1TT2 A;  1MSH A;  2ASB A;  2AQ1 B;  4GS3 A;  1BCP C;  1V1O A;  2D9U A;  4YIJ A;  3TS0 A;  1OTC A;  4A3D B;  1S40 A;  1EYA A;  3IL8 A;  2CWA A;  4LF9 L;  1DGS A;  2MP1 A;  5CV7 A;  1DOM A;  1QUQ B;  4ZKC B;  4UHV A;  1SAP A;  3I4N H;  3IKJ A;  3ERQ A;  1PH1 A;  5IOD A;  3CAM A;  5C44 H;  4HTH A;  2EOT A;  1Z47 A;  4C3H B;  5M3F G;  1AEX A;  1TS5 A;  1VQI A;  1A0I A;  1YHA A;  2TSS A;  5HGQ A;  3J81 L;  3OTO L;  3S16 B;  4A3J H;  2XWJ B;  4A3I B;  2PNH A;  1A8V A;  1FNW A;  3H94 A;  4LWC A;  3PO2 B;  4FF4 A;  5EAY A;  4MTN A;  1Z6H A;  5M3F H;  1C8C A;  3JAM E;  4DR7 L;  1NNX A;  3L7Z C;  1I3Q H;  3J81 c;  3D4D A;  4ME3 A;  3HOV B;  1DJR D;  4QCL A;  5C4H A;  5ISR A;  4NPS A;  3I4M B;  3GTJ H;  4A3G H;  4OGQ C;  1HZB A;  4QQB X;  4A3F H;  2BA1 A;  2VB2 X;  5C4Z A;  1SE4 A;  1R9T H;  3OIP A;  1PFS A;  4B3M Q;  4PMB A;  1LTL A;  4RMF A;  4P72 A;  4RH6 A;  3K5M A;  2YTX A;  1XMO Q;  4GKK L;  1SXT A;  2HDM A;  4IUT A;  1FNU A;  3GQB A;  2KQ3 A;  2EJM A;  1I4G A;  1CTM A;  1NMF A;  2QEJ C;  2JA7 B;  2O4X A;  4J15 A;  2R7Z H;  3FKI H;  3S15 H;  1EIG A;  2EY2 A;  3QIA A;  1S5B D;  3AEV A;  1PVO A;  2K14 A;  2J4X A;  4LF9 Q;  1W3S A;  3PF4 A;  5C5M A;  3KF6 A;  1NY4 A;  2Y0S B;  3CPW A;  2Y0S E;  5G3L D;  2CHB D;  1PRT F;  1TWG H;  3X3N A;  3BDO A;  1KNA A;  1SRU A;  5D14 A;  1PH3 A;  1F9Q A;  3OTO Q;  2PPB C;  2R93 B;  4LFB L;  5CMD A;  3CCU A;  5C4X G;  3D31 A;  1WTO A;  1XJV A;  5JJI A;  5J3B A;  1E7Z A;  4DR7 Q;  4MZ9 A;  3W5O A;  5A2Q E;  5DLQ E;  3B6Y A;  4GNX A;  5ELO A;  1KRT A;  5CYU A;  5AJ3 L;  1D5M C;  4KY7 A;  2I5M X;  2Q8T A;  5J39 A;  5LMN W;  3GD7 A;  3HOY G;  1V9P A;  5EBC A;  1HXY D;  5BN3 A;  1VMC A;  4DK0 A;  1C4Q A;  4LF8 L;  2LSS A;  4P74 A;  2EYH A;  4GKK Q;  2J7Z A;  2SNM A;  2B2V C;  2LY7 A;  2E2D C;  1C48 A;  5JPM C;  3NUC A;  1EY5 A;  1VQF A;  1SYC A;  2PQA B;  2F0M A;  2MHV A;  5C3E H;  1KRS A;  3S17 B;  1CKO A;  4X64 L;  2IY5 B;  4JYA L;  1QNK A;  4JI8 L;  1K8G A;  4ABN A;  4WOR A;  1SMY C;  2YTV A;  3VYR A;  1BR9 A;  4PQX A;  3J80 i;  1HUM A;  1P8L A;  3C1F A;  4HIK A;  2B2U A;  1NMG A;  1WI5 A;  3ICE A;  5M5Y B;  1PH6 A;  2KEC A;  1D7Q A;  4KD4 A;  1UE1 A;  1Q1B A;  4Y7N B;  4LNQ A;  4KHP L;  4LFB Q;  2B2Y A;  1FR3 A;  3T53 B;  4K5W A;  4PZ8 A;  1M4V A;  3QG1 A;  1G2T A;  3VR6 A;  3BVM A;  5E1F A;  2AQ3 B;  1EEF D;  1B9M A;  5AJ3 Q;  2NVT H;  3TP6 A;  3DWP A;  1KLU D;  3D0F A;  5FJ8 H;  3K5O A;  1A6X A;  2K04 A;  5EPJ A;  3MXN A;  4V0B A;  2VQE L;  1SNM A;  4L63 B;  1VQM A;  4QMG A;  4LF8 Q;  3ONA B;  4GZY C;  5M3F B;  1LT4 D;  1Y69 U;  2DY7 A;  5C0X I;  4DPG A;  1JOO A;  4FXG C;  1GUT A;  2O5I C;  1S5C D;  1IBL L;  2ZTD A;  1D5Z C;  3KF8 B;  1SYB A;  1MGS A;  2IHF A;  2RHQ B;  4JW0 A;  1YNX A;  3CCM A;  2BCO A;  3GTJ B;  1SMY D;  3S1M B;  3T1H L;  3H0G H;  4XT1 B;  1TXY A;  5GAD C;  2F0W A;  2JA6 H;  3DM1 A;  4X64 Q;  2Z6B A;  1EFW A;  4DAY A;  3VYU A;  1R9T B;  4JYA Q;  4JI8 Q;  1LTI D;  3C3L A;  5ELE A;  1ZYR C;  2HUG A;  1L0X B;  4X66 L;  1H9S B;  1R4Q B;  2ZTE A;  3K0X A;  5ELD A;  1X9N A;  2AKW B;  1NJI C;  1STG A;  2EYF A;  2Q8I B;  2R92 G;  2IJ0 A;  3TEH B;  4DV5 L;  4ILW A;  4L5R C;  1I4Q A;  1CKN B;  4JVZ A;  1H9M A;  1S4Z A;  3K5N A;  4JK1 C;  4K6D A;  4DV3 L;  1E0B A;  1E3P A;  1BF4 A;  2OT2 A;  4C3I G;  4KHP Q;  3LWU A;  4FXK C;  1IL2 A;  2ZXR A;  1VQ4 A;  5C5L A;  3TBI B;  3AFP A;  1I6H H;  2WP8 J;  2ZJP A;  4JI0 L;  1HPC A;  1YHB A;  2ES2 A;  4RGT A;  3T51 B;  4RAU C;  1RD9 D;  1XMQ L;  2KBN A;  2F0U A;  4M8A A;  2J0T D;  2P5Z X;  3K7A H;  2UXB L;  3S14 B;  2VQE Q;  1TWF B;  2QDL A;  2JXM B;  4RCO A;  2K50 A;  3ZJY C;  3GTP B;  4WJ3 M;  4B9W A;  3AQQ A;  4KLK A;  1XTD A;  5IGB A;  4PZ6 A;  3RZD B;  1LT3 D;  1NCV A;  1WYD A;  2F0I A;  1IBK L;  5C4X B;  4GN4 B;  1IBL Q;  1VQE A;  1ZYR D;  4BY1 H;  2KHS A;  3I2Z A;  2RF4 A;  1DYQ A;  5EKI A;  1O7L A;  2F0K A;  3T1H Q;  2E75 C;  3MVV A;  3KLS A;  1ET9 A;  3HS0 C;  4FNF A;  1JOK A;  2EXZ A;  1UWV A;  1U4P A;  1EQR A;  4MIU A;  1FL0 A;  1WD1 A;  3KOJ A;  1QZH A;  2N88 A;  1OXS C;  3AB9 A;  1SJE D;  4X66 Q;  3I8Z A;  4X65 L;  3HOY B;  1W6J A;  4DV5 Q;  3MXP A;  1FGU A;  4FP5 D;  2B8F A;  3U9S A;  3RR5 A;  4XQN A;  1O7I A;  3RLN A;  4CJ0 B;  4DV3 Q;  4RGO S;  2DN8 A;  2LFN A;  2SEB D;  5CV6 A;  4A76 A;  1E22 A;  1PH5 A;  1DOL A;  2H1E A;  3MHB A;  3C2P A;  3P75 A;  1HFN A;  4JI0 Q;  1PMR A;  1NUC A;  2CW0 C;  1XMQ Q;  1PRT C;  1NAP A;  5C4J H;  1F2M A;  3TN2 A;  4J8Q A;  4B3R L;  4QUC A;  3D8G A;  1LM0 A;  4UY8 C;  2UXB Q;  4IOC A;  2MPM A;  2WFW A;  4POG A;  4PG3 A;  4DN4 M;  1PH4 A;  4BY7 G;  1ENA A;  5LL6 X;  1W6K A;  2YYZ A;  3F2U A;  3KLS X;  2KCM A;  5G3L F;  3TME A;  1IBK Q;  3BJU A;  1L0W A;  4JI2 L;  4RKL A;  2F3I A;  2ZJR A;  3I70 A;  2HQL A;  4Z9C B;  2Q2I A;  3J80 L;  2UUA L;  5FO7 B;  4IFD I;  2K03 A;  2PW5 A;  4L8J A;  4RHS A;  3VYT A;  1FGB D;  3I7F A;  3TRZ A;  3HKZ G;  2PZT A;  2EJG C;  3QOJ A;  3HOZ G;  4PZ7 A;  3HGB A;  1STH A;  4RHR A;  2FFK B;  3VR5 A;  4X65 Q;  1BNZ A;  4FDB A;  1JJ2 A;  1JC7 A;  3ND8 A;  2WKD A;  3MFY A;  4FO2 A;  5ELN A;  3SE0 A;  2NWG A;  2Z6K A;  4FF2 A;  1CHP D;  4IJL A;  5IGD A;  2CW0 D;  3BDL A;  3J81 i;  4Y52 H;  5E3F A;  3R8B A;  1F9P A;  1U4R A;  3KYH C;  4KI0 A;  1GOZ A;  2A6H D;  3H3V I;  2UUB L;  4IOA A;  4J6H A;  3CKI B;  5J1Z A;  3A0J A;  3STB C;  1RIP A;  2F0J A;  3NEL A;  5EGT A;  3U4Z A;  2B2W C;  4A3M H;  5EJW A;  5TSS A;  1L2F A;  2IX1 A;  3EBE A;  5JVG 3;  3GV3 A;  4B3R Q;  2PZU A;  3C1E A;  4I7Z C;  1RTN A;  4UP8 A;  2LS0 1;  5IGG A;  2R92 B;  1VQ8 A;  4IUV A;  4ZLT F;  1F9R A;  1TS4 A;  1PTO B;  2ICI A;  3HOW G;  3VDY A;  2XRQ D;  3FHW A;  2Q8R E;  2RCN A;  2K33 A;  1WCM H;  2OQ0 A;  5FLM G;  4DAP A;  4C3I B;  2WIN B;  2JA9 A;  4BS9 A;  2B63 G;  3AYH B;  4FF1 A;  2Z4H A;  4UP9 A;  4JI2 Q;  4B3T Q;  3HOW H;  1Q90 A;  2VS1 A;  1KHI A;  4K14 A;  1M90 C;  3BVZ A;  3K7A B;  1PYB A;  1XNQ L;  4DXG A;  4WJW A;  4A3C H;  2UUA Q;  3T4A C;  4OO1 G;  1ILP A;  4YY3 L;  2IPK D;  4RCN A;  3Q6S A;  3J7Z C;  4A3E G;  5GAG C;  3K58 A;  2UUC L;  2RDG A;  1EWC A;  1G29 1;  3FP9 A;  3NEN A;  4ULL A;  3KF6 B;  3RZO B;  4X3S A;  2E2I H;  4C1N I;  1ET6 A;  4OO1 H;  2ZT9 C;  1KL9 A;  4DR2 L;  3DEO A;  5E4W C;  3CCV A;  1MSG A;  2HIX A;  3STB D;  3RN5 A;  2ID0 A;  5E7N A;  1JWS D;  2C9O A;  5FK9 C;  3I55 A;  3HOU H;  2F4V Q;  1H9K A;  1X3E A;  2NN6 H;  3EQL C;  1C9O A;  3PV0 A;  3MXG A;  1D5X C;  2F0O A;  1O7Y A;  3PGZ A;  2K1B A;  1LAB A;  4XYQ A;  1G91 A;  1B53 A;  5C6A A;  1F2Z A;  2R7F A;  4GNX B;  3H6M A;  1JWU D;  4AYB G;  2VUM G;  1EQV A;  2HDL A;  4K5X A;  2VB3 X;  1TWC B;  1Q3L A;  2VQF L;  4LMQ D;  3E0J A;  5M5X H;  2N55 A;  2R61 A;  2ZXO A;  3BVG A;  1TY0 A;  5I2Y A;  4JI7 L;  3PF5 A;  1L1O A;  1BOS A;  4X3K A;  4BBS H;  4KY6 A;  4DV2 L;  4O2D A;  3A55 A;  3J80 E;  1G6Z A;  5FLX L;  1NE3 A;  4DR4 L;  1EFI D;  3N6R A;  1PH8 A;  1XNQ Q;  3F2B A;  1IHZ A;  1CFM A;  1PH7 A;  3FMC A;  4TKO B;  4YY3 Q;  1EY9 A;  1TWH B;  1WTH A;  4X3U A;  1CSP A;  4HID A;  2UUC Q;  3Q0A A;  1KAW A;  3A54 A;  1YNJ C;  1EWH A;  1GUO A;  1XX8 A;  3KBX A;  1D8L A;  3G71 A;  2WKC A;  2NVX B;  1J6Q A;  4DR2 Q;  3QB3 A;  5JJZ A;  4DV0 L;  4BY7 B;  4OIJ A;  2LKV A;  1KDB A;  3EN2 A;  1PDQ A;  1ML0 D;  4KN4 C;  3HEJ A;  1AP0 A;  1D6E C;  3GTQ B;  2A8V A;  3FDT A;  3K8A A;  1EY4 A;  2G9D A;  2D2C C;  1HTP A;  1JJC B;  4ZUJ A;  3SDZ A;  1PZK D;  1E1T A;  3A8J E;  1A3V A;  1HQR D;  1BCP B;  5M5W B;  1EU4 A;  5JVH 3;  1RL2 A;  2DGY A;  4GKJ L;  1F9S A;  3HKZ B;  4IUQ A;  3HKZ E;  2FMC A;  2N8N A;  2NB0 A;  3BZK A;  3HOZ B;  1CSQ A;  4A3K G;  1CA6 A;  1OXV A;  2VQF Q;  2AWN A;  4JI1 L;  4BA1 I;  4DAV A;  1NBW A;  4JOI A;  3MXN B;  3I91 A;  2BE5 C;  2JE6 I;  3R93 A;  4JI7 Q;  3ND9 A;  3GTO B;  2I0Q A;  1TQO A;  2K5Q A;  2A1A A;  4C3J G;  4K5V A;  3I4N G;  2QA4 A;  4DV2 Q;  3J81 j;  3K7U C;  4GLA C;  3TZD A;  2K32 A;  5C44 G;  1EL0 A;  4KKT A;  4H0L C;  2YU9 B;  4DR4 Q;  2CH4 W;  2V1C C;  1YNJ D;  1Q8I A;  2KHI A;  3D4R A;  3BDC A;  1Q8K A;  2B2W A;  1F77 A;  4A3J G;  4C3J H;  3CF5 A;  3OW2 A;  4KJN A;  2LXJ A;  4ODG A;  3M4O B;  2VL6 A;  4IPG A;  5LMU L;  4DAY B;  1XPO A;  3KDF A;  4IUN A;  3PSI A;  1M8A A;  2M00 A;  2F1M A;  2K75 A;  4QJF A;  4OX9 L;  1F2L A;  2VZA A;  2ZTC A;  4LF6 L;  3HOW B;  1BBW A;  1OXU A;  1PFN A;  5IOC A;  1HZ9 A;  3M4Y A;  4DV0 Q;  4EGV A;  3M4Q A;  2MJ8 A;  3PIO A;  3CC4 A;  2JN4 A;  4K0K L;  1RCV D;  4A3G G;  1IW7 C;  1Y1W H;  2B63 B;  4A3F G;  1Q81 C;  3Q8D A;  1KAA A;  2XRS D;  3NP8 A;  4OWT B;  2EYL A;  5IYC H;  3BYY B;  3E5S A;  2JJQ A;  4ID6 A;  1GM5 A;  2E2I B;  4ZUI A;  4GKJ Q;  1VF5 C;  1YIJ A;  2BE5 D;  4A3E B;  1BXT A;  2OXP A;  1PYS B;  4CDF C;  2K5V A;  1DXM A;  3QOL A;  3UDX A;  2R7Z G;  3FKI G;  4UP7 A;  4JI1 Q;  1WTP A;  3S1N H;  3G6E A;  4JV5 L;  3VA7 A;  4X3T A;  4MTK A;  1KIX A;  3ERS X;  4CJ2 C;  5FLX E;  3LNN A;  4C2M H;  1KDA A;  3TSS A;  1A3T A;  1ICW A;  4OON A;  3DEP A;  1PA6 A;  1GHJ A;  1D1I A;  1NSN S;  3K81 C;  2A68 C;  1PFM A;  3F1Z A;  2B2T C;  4AYB B;  5LMU Q;  2VUM B;  1AFP A;  4AYB E;  2NVQ B;  2XNA C;  4DFA A;  1IW7 D;  4OX9 Q;  1Q7Y C;  2CH4 A;  2L55 A;  4LF6 Q;  4NKL A;  3OMC A;  3RUZ A;  2JK8 A;  1H9R A;  4F7X A;  2K28 A;  3NWT A;  1EWI A;  2XGT A;  4LF4 L;  1F2Y A;  1BDO A;  1CA5 A;  4K0K Q;  3NXW A;  2MUY A;  4OWX B;  1HUN A;  1X3Q A;  1SE2 A;  2ALY B;  3OHX C;  4AIM A;  3SK4 A;  3W3A A;  2XN9 C;  4ZK9 B;  4RGN A;  4A75 A;  1B2T A;  2WB1 G;  4IUU A;  3EIV A;  4H44 C;  2KUM A;  1H9J A;  4H7B A;  4RFB A;  1VQP A;  4BWG B;  3EJI A;  1P16 A;  3I72 A;  1CZW A;  4R4C A;  1CUK A;  2LMC B;  4O42 A;  5C3E G;  4FVM A;  2AMC B;  1X6O A;  1S3O A;  1IYJ B;  2Q2T A;  4DR5 L;  2A74 C;  2QKI C;  5FKA C;  4JV5 Q;  3D6C A;  3HOX H;  1PZI D;  4H13 C;  1GUN A;  3SXH A;  2FMM A;  1XPU A;  5NUC A;  3S1R H;  5A35 A;  1I50 B;  2A68 D;  5LL6 S;  2D62 A;  1XYI A;  5KIX A;  4TQU S;  1V1P A;  5M3M B;  1JWM D;  1HFG A;  3HZX A;  3E0E A;  4KK7 A;  2KVM A;  4GOP C;  4E6I A;  3UDG A;  1I4X A;  2IX0 A;  3J81 E;  1WJJ A;  3K6O A;  1A3U A;  3TZU A;  4A3K B;  1VQH A;  3I90 A;  1XWE A;  4YWL A;  3BZC A;  3DHQ A;  4G57 A;  3PUZ A;  1D2B A;  1JOR A;  1U4L A;  2ZM6 L;  3EVQ A;  3GTM H;  1EOV A;  3CU7 A;  1SYF A;  3CPF A;  2EZV A;  5FJ8 G;  3MWY W;  4LF4 Q;  3M7G A;  4C3J B;  1QZG A;  3I4N B;  3PQI A;  1BQQ T;  1SNP A;  4KV6 A;  5C44 B;  2GVB A;  4DNI A;  1GHK A;  1CZG A;  4A3J B;  1TWA H;  3VA5 A;  1CQV A;  1HA6 A;  1KAB A;  4JC0 A;  5IP7 H;  4YCU A;  3OMG A;  1TR5 A;  5BN5 A;  1RJT A;  4EQP A;  2F0V A;  3KUP A;  3PUV A;  1SJH D;  1IL8 A;  1I3Q B;  1B1Z A;  1QJO A;  2HD3 A;  3H0G G;  2JA5 H;  2JA6 G;  4L5T A;  2RA4 A;  5K36 H;  5I9P A;  4LUV A;  3OOC A;  5CC4 A;  1QWY A;  4A3G B;  2EYO A;  2HT1 A;  2EYM A;  3CHB D;  1EQT A;  4EQO A;  4A3F B;  4HJ8 A;  1PTO F;  1T5X D;  5JAV A;  4I7A A;  1VS0 A;  4JI5 L;  3W1G A;  1EUJ A;  4QGU A;  5IT9 L;  2Z4I A;  4A3B H;  3K80 C;  3S1N B;  2RVL A;  4LAA A;  4CKC A;  4XQJ A;  2E8G A;  5GAH C;  3OIQ A;  3S2D H;  1G8Z D;  1VQD A;  5ELC A;  3P20 A;  3KJO A;  2R7Z B;  5IT9 c;  3FKI B;  3S15 B;  4N8X 1;  2NVY H;  2EQS A;  4HMI A;  2ZM6 Q;  3AMU A;  3FEW X;  3HKS A;  3ULL A;  1QVF A;  4HMJ A;  5E4X A;  3S1Q H;  3A74 A;  2Z0S A;  1TWG B;  3CCE A;  1SYD A;  1LTS D;  4X62 L;  2IWH A;  2B29 A;  2JP1 A;  2OF1 A;  1EYD A;  2AUJ D;  1AE3 A;  3J7A 5;  4K2K A;  1KNE A;  2F03 A;  5ELB A;  1S5E D;  2F0Q A;  2HHH L;  3M7N A;  4BY1 G;  3H15 A;  3QWN A;  5K5P A;  2QEX A;  1EOT A;  1EEI D;  4P71 A;  3R2T A;  4NDX A;  1YBY A;  2OTJ A;  1SSO A;  2E2H H;  5GQO A;  1SR3 A;  5I6W A;  1PFB A;  1Y1V G;  3PIO 3;  1L1O B;  2O5J C;  4R8I A;  4YWM A;  1HR0 W;  1UE7 A;  4JI5 Q;  1VQB A;  1LTR D;  3A7L A;  1K83 H;  2F0N A;  5KYL A;  2JEB I;  1Y1V H;  2JSO A;  3P1H A;  1W2B A;  4A93 H;  1PRT B;  2NZO A;  3V2T A;  1CI3 M;  2BDO A;  2K5D A;  4B3S L;  5C3E B;  3S1R B;  1PHJ A;  2B2V A;  2F0F A;  2SOB A;  5KGU A;  2CCZ A;  1O80 A;  2F0S A;  1NR4 A;  3PO3 G;  1VQA A;  3CCR A; 
#chains in the Genus database with same CATH homology
 2PNH A;  1A8V A;  2ID0 A;  5E7N A;  4LF7 Q;  3RNU A;  3GTK H;  3I55 A;  4LWC A;  5GAE C;  3ER0 A;  2F4V Q;  3HOU H;  1X3E A;  4HJ9 A;  5EAY A;  1C9O A;  4MTN A;  3CXC A;  5M3F H;  2JA5 G;  4LFC L;  1I94 L;  3PV0 A;  3PO3 H;  4DR7 L;  3L7Z C;  1I3Q H;  4X62 Q;  3J81 c;  1Q12 A;  5K36 G;  3PGZ A;  4ME3 A;  1JMC A;  1Y14 B;  4GOP A;  4IJH A;  1A62 A;  1U0L A;  2R7F A;  4GNX B;  4NPS A;  1SFO H;  1YEZ A;  4AYB G;  4YHH L;  3GTJ H;  2VUM G;  2HHH Q;  4A3G H;  4DR5 Q;  1HZB A;  2KEN A;  4IO9 A;  4R1J A;  4DV6 L;  4A3F H;  2BA1 A;  2VQF L;  4QQB X;  4YCV A;  1JT8 A;  5M5X H;  1N34 L;  1R9T H;  1PFS A;  4B3M Q;  3RLO A;  1LTL A;  2BA0 A;  4RMF A;  4P72 A;  5BR8 L;  4A3B G;  4JI7 L;  4L5Q A;  1ASY A;  2YTX A;  1XMO Q;  3PF5 A;  4GKK L;  1L1O A;  4AQY Q;  3A5Z B;  3GO5 A;  1YJW A;  4LFA L;  1Q46 A;  4BBS H;  4DV2 L;  3I4O A;  2E5L L;  1MIU A;  4O2D A;  1AH9 A;  1NMF A;  4IPD A;  2Z6K C;  2NZH A;  4J15 A;  1NE3 A;  5C0X G;  3A5U A;  4HJ7 A;  4DR3 L;  3FKI H;  5IYB G;  1PH8 A;  2R7Z H;  1XNQ Q;  3S15 H;  3F2B A;  1C0A A;  1QUQ A;  3AFQ A;  2K14 A;  3AEV A;  1PH7 A;  1PVO A;  1NTG A;  2E2J H;  4LF9 Q;  3T1Y L;  1W3S A;  4YY3 Q;  3PF4 A;  4BBR H;  1K0R A;  3KF6 A;  2UUC Q;  1CSP A;  4HID A;  3GTG H;  1KAW A;  1NY4 A;  5IYB H;  4B3S Q;  3CPW A;  3S24 A;  2Y0S E;  5IE8 A;  1D8L A;  3G71 A;  1TWG H;  3KDF B;  1J6Q A;  4DR2 Q;  1SRU A;  4YWK A;  4A3M G;  4DV0 L;  1PH3 A;  4XTC S;  3PCO B;  3OTO Q;  3EN2 A;  1S72 A;  4LFB L;  4RG1 A;  2VW9 A;  4YCW A;  3CCU A;  1LYL A;  3CC7 A;  5C4X G;  2PI2 E;  3D31 A;  2A8V A;  1YJN A;  3K8A A;  1XJV A;  1HNZ L;  1VQ6 A;  5JJI A;  4NXN L;  5J3B A;  2N3S A;  1H95 A;  4NXM L;  1E7Z A;  1K73 C;  1JJC B;  1I94 Q;  4LFC Q;  4MZ9 A;  3W5O A;  2R92 H;  3PUY A;  4DR7 Q;  1U5K A;  4A3L H;  5DLQ E;  1E1T A;  3B6Y A;  4GNX A;  5ELO A;  4JBK A;  1KRT A;  4DUZ L;  5AJ3 L;  4AH6 A;  4TVA B;  1WCM G;  3CCQ A;  1RL2 A;  2DGY A;  4GKJ L;  3M3Y H;  1SMX A;  3HKZ E;  4QY7 A;  4OXP A;  2I5M X;  4LW1 A;  2N8N A;  4P73 A;  4C3I H;  3BZK A;  1IBM L;  4YHH Q;  4R4T A;  1CSQ A;  4A3K G;  5LMN W;  3GD7 A;  1OXV A;  3HOY G;  1V9P A;  4DV6 Q;  1PH2 A;  2VQF Q;  2AWN A;  4JI1 L;  3JAM i;  1VQK A;  2N78 A;  1N34 Q;  4BA1 I;  4DV4 L;  4A3C G;  1NBW A;  4JOI A;  2RHS B;  3MXN B;  4LF8 L;  2LSS A;  1JJG A;  4A3D H;  4P74 A;  5BR8 Q;  1VQ9 A;  2JE6 I;  4JI7 Q;  1HJP A;  4DAM A;  2AWO A;  2I0Q A;  4DUY L;  4GKK Q;  4A93 G;  2A1A A;  2VY3 A;  2XTI A;  4LFA Q;  4OO1 I;  3CW2 C;  3I4N G;  2QA4 A;  2I5H A;  3J81 j;  3K7U C;  2YV5 A;  1VQF A;  4GLA C;  4DV2 Q;  2E5L Q;  1X3F A;  2PQA B;  1VQC A;  2WAQ E;  2WB1 E;  5C44 G;  1N33 L;  5C3E H;  3RZO H;  1FJG L;  4DR3 Q;  4DR4 Q;  2K5N A;  2V1C C;  2KHI A;  1KRS A;  3PO2 G;  1VQG A;  1CKO A;  1Q8K A;  4C3H H;  4X64 L;  3KJP A;  2IY5 B;  4A3J G;  4C3J H;  4JYA L;  3DLL A;  3CF5 A;  3T1Y Q;  4JI8 L;  3OW2 A;  2OWO A;  2LXJ A;  4P75 A;  3S16 H;  1K8G A;  2VL6 A;  4IPG A;  4ALP A;  3HOU G;  5LMU L;  4NB3 A;  2NN6 G;  4DAY B;  1XPO A;  3KDF A;  3TS2 A;  2YTV A;  3PSI A;  2AHO B;  1HZA A;  3PO2 H;  2K4K A;  3J80 i;  1P8L A;  4HIK A;  2K75 A;  4QJF A;  4OX9 L;  1NMG A;  1WI5 A;  2VZA A;  4EQ5 A;  3ICE A;  1PH6 A;  2ZTC A;  4LF6 L;  1D7Q A;  1BBW A;  1OXU A;  2PI2 A;  1HZ9 A;  4DV0 Q;  4BA2 I;  3M4Q A;  3HOV H;  3PIO A;  3CC4 A;  1G51 A;  5JJL A;  1UE1 A;  1Q1B A;  4K0K L;  4LNQ A;  4KHP L;  4LFB Q;  4A3G G;  1GKH A;  1Y1W H;  2UUB Q;  3I4M H;  4A3F G;  1Q81 C;  3Q8D A;  4PZ8 A;  1HNZ Q;  1TWC H;  4OWT B;  4NXN Q;  1L1O C;  5IYC H;  4JBJ A;  4NXM Q;  3GTL H;  1EIY B;  2R7D A;  4DK3 C;  2JJQ A;  1X55 A;  1MJC A;  1GM5 A;  4BXX H;  4DUZ Q;  5AJ3 Q;  1YHQ A;  4GKJ Q;  2NVT H;  1GO3 E;  1V43 A;  1YIJ A;  3D0F A;  4BBS G;  4UPA A;  5FJ8 H;  1QVG A;  1PYS B;  2D0P A;  1IBM Q;  2K5V A;  1HNX L;  1EYG A;  4X6A H;  2VQE L;  3UDX A;  3G4S A;  2R7Z G;  2KHJ A;  2GN5 A;  2ZJQ A;  3RLF A;  3FKI G;  4UP7 A;  4JI1 Q;  3S1N H;  1VQM A;  3E9H A;  2MFI A;  1WOC A;  3G6E A;  4DV4 Q;  4JV5 L;  2Y0S G;  4LF8 Q;  3GDE A;  3U4V A;  2UXD L;  3CC2 A;  2CKZ B;  5C0X I;  4DPG A;  4BBR G;  3JAM c;  1JE5 A;  4R4O A;  1VQ7 A;  4DUY Q;  5H1S E;  2PQA A;  2EXD A;  1TWH H;  3ERS X;  3CME A;  1B70 B;  2ZTD A;  5GRO A;  5JEA G;  1J5E L;  2OQK A;  2IHE A;  3KF8 B;  1IBL L;  1XNR L;  1LUZ A;  4C2M H;  2IHF A;  2RHQ B;  1KD1 C;  1YNX A;  2CFM A;  1N33 Q;  3CCM A;  2JA8 G;  3U58 A;  1FJG Q;  3T1H L;  2Q2H A;  3H0G H;  4OON A;  1AE2 A;  2NVX H;  1TXY A;  2BH2 A;  5GAD C;  2JA6 H;  4X64 Q;  4B3T L;  1PA6 A;  2L15 A;  1EFW A;  4JYA Q;  4BY7 H;  3U50 C;  4JI8 Q;  3K81 C;  3M4P A;  2R93 H;  3F1Z A;  2B3G A;  1VCI A;  5LMU Q;  2JA8 H;  3GTQ H;  1E24 A;  4X66 L;  2MO1 A;  4AYB E;  4GNX C;  1MJE A;  1HZC A;  2ZTE A;  1B8A A;  3K0X A;  1X9N A;  2AKW B;  1NJI C;  2MO0 A;  1YZ6 A;  3TEH B;  4DV5 L;  2R92 G;  4IFD G;  4A3L G;  1VQL A;  4OX9 Q;  2ATW A;  3PIP A;  1Q7Y C;  4L5R C;  1CKN B;  1N32 L;  4O0A A;  4LF6 Q;  3NEM A;  3UDI A;  4DV3 L;  3J80 c;  2A19 A;  2JK8 A;  5M5W H;  4IPC A;  1E3P A;  1B7Y B;  1EWI A;  2XGT A;  4LF4 L;  3WWV A;  4K0K Q;  1SN8 A;  4KHZ A;  3CCJ A;  4LUO A;  4KHP Q;  4HIM A;  4OWX B;  4HIO A;  4JOI C;  1IL2 A;  3HOZ H;  2ALY B;  2YTY A;  1VQ4 A;  1IZ6 A;  4AIM A;  1N36 L;  4DR6 L;  3AFP A;  3I56 A;  2WP8 J;  2ZJP A;  4A3D G;  4JI0 L;  2F4V L;  1I6H H;  4A75 A;  4IPH A;  2ES2 A;  1YHB A;  2WB1 G;  4QIW E;  1X54 A;  1XMQ L;  1Q1E A;  2KBN A;  3EIV A;  2H5X A;  3G48 A;  4MNO A;  3DM3 A;  4LF5 L;  3GTO H;  2QGQ A;  4WJ4 A;  1VQP A;  2CWP A;  1P16 A;  4H02 A;  2R6G A;  3K7A H;  5IY0 A;  4R4C A;  1CUK A;  1UE5 A;  1HNX Q;  3KFU A;  2UXB L;  5C3E G;  2VQE Q;  1KC8 C;  2AMC B;  1I5F A;  1X6O A;  1S3O A;  1X56 A;  2K50 A;  1IYJ B;  3ZJY C;  4WJ3 M;  2Q2T A;  2YU9 H;  4DR5 L;  4JV5 Q;  3AQQ A;  4KLK A;  1YI2 A;  1MKH A;  5IWA L;  1VQ5 A;  4JI3 L;  1XTD A;  4POF A;  3HOX H;  3H3V H;  2UXD Q;  4PZ6 A;  3LGJ A;  3PUX A;  2VNU D;  1EIF A;  4HJA A;  4A3I G;  1XPU A;  1WYD A;  3S1R H;  1IBK L;  1JB7 A;  3M4O H;  4GN4 B;  1IBL Q;  1XNR Q;  1J5E Q;  1VQE A;  2BH8 A;  2D62 A;  3CMA A;  1FVI A;  3UE0 A;  4BY1 H;  3I2Z A;  2RF4 A;  1C7Y A;  3M85 A;  2MQH A;  2NN6 I;  4TQU S;  2FXQ A;  1PH9 A;  5C0X J;  2UU9 L;  3T1H Q;  3JC6 6;  4A3I H;  4JI4 L;  5M5Y H;  3CCR A;  4GN5 A;  3TRE A;  4JI6 L;  3HOV G;  1K3R A;  3E0E A;  1N8R C;  1UWV A;  1HH2 P;  3S2H H;  1T9H A;  4HJ5 A;  4GOP C;  1EQR A;  2Q2U A;  1Y1W G;  1FL0 A;  4Y7N H;  3KOJ A;  5FLM H;  3UDG A;  1QZH A;  3I4M G;  1OXS C;  2IX0 A;  1WJJ A;  1UEB A;  4PMW A;  1G6P A;  4X66 Q;  2B63 H;  4X65 L;  3IRB A;  1VQH A;  1CKN A;  4GLV B;  5IYC G;  4YWL A;  3SGI A;  5LMN L;  4DV5 Q;  3BZC A;  1FGU A;  3PUZ A;  1ASZ A;  2K5H A;  4BXX G;  1N32 Q;  3RR5 A;  2ZM6 L;  1KQS A;  1YVC A;  1O7I A;  3GTM H;  2OCE A;  3RLN A;  1EOV A;  3W1B A;  3CPF A;  4DV3 Q;  4DV7 L;  2DUD A;  5FJ8 G;  4IFD J;  4LF4 Q;  3CCS A;  2LXK A;  4A3E H;  1QZG A;  4DKA C;  2KCT A;  3KLW A;  1HR0 L;  2PMZ E;  4A76 A;  1E22 A;  4EX5 A;  2UXC L;  1PH5 A;  2JA7 G;  2GVB A;  1N36 Q;  1X65 A;  4DR6 Q;  4DNI A;  4GN3 B;  4JI0 Q;  4DR1 L;  1Q82 C;  1XMQ Q;  1TWA H;  4R4I A;  3ULP A;  4LUZ A;  4DV1 L;  2I5L X;  5C4J H;  4JC0 A;  4LF5 Q;  1GD7 A;  5IP7 H;  4JBM A;  4YCU A;  4B3R L;  2JA7 H;  1E1O A;  3CQZ H;  1LM0 A;  1Q86 C;  4UY8 C;  2UXB Q;  1KXL A;  1HNW L;  4IOC A;  3PUV A;  3H0G G;  2JA5 H;  2JA6 G;  2WFW A;  3S1M H;  4POG A;  4L5T A;  4PG3 A;  3BU2 A;  5IWA Q;  1PH4 A;  4BY7 G;  4JI3 Q;  3L2P A;  4LUV A;  2YYZ A;  2R93 G;  3CD6 A;  2KCM A;  3OYY A;  1IBK Q;  4APV A;  2HT1 A;  1K8A C;  3BJU A;  5HY6 A;  4OWW B;  1BKB A;  4HJ8 A;  2VUM H;  1L0W A;  4JBW A;  4JI2 L;  5JJK A;  2C35 B;  2NVQ H;  2F3I A;  4A4I A;  1N9W A;  4R4Q A;  2ZJR A;  1VS0 A;  4JI5 L;  3W1G A;  1EUJ A;  4QGU A;  2HQL A;  2K52 A;  2Q2I A;  2UU9 Q;  2UUA L;  4JI4 Q;  4IFD I;  4JI6 Q;  3K80 C;  3F8T A;  4L5S A;  4A3B H;  1X3G A;  3CP0 A;  5IYD G;  1BBU A;  3I7F A;  3TRZ A;  3HKZ G;  2E8G A;  5GAH C;  3S2D H;  2N49 A;  1VQD A;  1VQN A;  3HOZ G;  4PZ7 A;  1SE8 A;  1SLJ A;  3M9B A;  1BVS A;  4JCV E;  4X65 Q;  4FDB A;  1JJ2 A;  3TQY A;  3KJO A;  5IT9 c;  5LMN Q;  1V1Q A;  5ELN A;  2NVY H;  5IYD H;  1M1K C;  5FLX c;  4JG2 A;  4QL5 A;  4DK6 C;  2EQS A;  2GVA A;  2ZM6 Q;  1K9M C;  2Z6K A;  4DV7 Q;  1IXR A;  1OXX K;  3HKS A;  4LF7 L;  4IJL A;  3RN5 A;  2D0O A;  1KIX A;  3UDF A;  3ULL A;  3J81 i;  3E9I A;  2EIF A;  1XPR A;  1QVF A;  3S1Q H;  4Y52 H;  2WAQ G;  1HR0 Q;  3CCL A;  3A74 A;  3KYH C;  1OXT A;  1Z9F A;  1CKM A;  4KI0 A;  3H3V I;  2Z0S A;  3CCE A;  3S14 H;  2UXC Q;  2OTL A;  1TWF H;  2JEA I;  4XIG S;  4X62 L;  1UE6 A;  2B29 A;  2UUB L;  4IOA A;  3GTP H;  3A0J A;  3STB C;  3HOX G;  2JQO A;  1RIP A;  1AE3 A;  3NEL A;  3U4Z A;  4DR1 Q;  1VQJ A;  3J7A 5;  4A3M H;  4DR4 L;  3ULJ A;  4DV1 Q;  1L2F A;  3RZD H;  5M3M G;  2IX1 A;  3EBE A;  3L0O A;  4B3R Q;  2HHH L;  4GOP B;  5C4X H;  3M7N A;  4BY1 G;  1YJ9 A;  3HFZ B;  3F2D A;  1SRO A;  1I50 H;  3S17 H;  4UP8 A;  1A63 A;  1HNW Q;  3NBH B;  3H15 A;  1QVC A;  2MNA A;  1VQ8 A;  4B3M L;  5IP9 G;  3MEF A;  2QEX A;  1PV4 A;  5M3M H;  4P71 A;  3HOW G;  2F52 A;  3VDY A;  1YBY A;  1XMO L;  3FHW A;  4AQY L;  4GLX A;  2OTJ A;  2RCN A;  2OQ0 A;  1WCM H;  2E2H H;  5GQO A;  1SR3 A;  5FLM G;  2HIV A;  2JA9 A;  1Y1V G;  3UE1 A;  2B63 G;  3AYH B;  4A3J H;  1L1O B;  5JEA J;  5IP9 H;  4UP9 A;  4JI2 Q;  4A3K H;  4B3T Q;  3HOW H;  2IT1 A;  2VS1 A;  4YWM A;  3HOY H;  1KHI A;  1M90 C;  1YIT A;  1HR0 W;  2ASB A;  1PYB A;  4GS3 A;  1UE7 A;  4JI5 Q;  1XNQ L;  3TS0 A;  1VQB A;  1OTC A;  4A3C H;  1K83 H;  2UUA Q;  1S40 A;  2JEB I;  2CWA A;  4LF9 L;  1DGS A;  4OO1 G;  1Y1V H;  4YY3 L;  1GVP A;  1QUQ B;  3J7Z C;  1W2B A;  3RN2 A;  5GAG C;  4A3E G;  2UUC L;  3F2C A;  4A93 H;  2NZO A;  4B3S L;  1G29 1;  3FP9 A;  3I4N H;  3NEN A;  3KF6 B;  1PHJ A;  1PH1 A;  2E2I H;  2CQO A;  3CAM A;  5C44 H;  1VQO A;  1KL9 A;  4DR2 L;  1Z47 A;  2CCZ A;  5M3F G;  1VQI A;  1EQQ A;  3PO3 G;  1A0I A;  1YHA A;  5HGQ A;  3OTO L;  1VQA A;  1WFQ A;  3CCV A;  5IP7 G;  2HIX A;  3STB D;  3PUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...