5FLMH

Structure of transcribing mammalian rna polymerase ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
148
structure length
148
Chain Sequence
AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 16
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5flmH01
3T1HL 4GOPC 1XMOL 4BA2I 3RN2A 3CMAA 1VS0A 3RN5A 4P71A 1Q1EA 4POFA 4GKKL 4JI0Q 2K50A 4GN4B 1CKNA 3CPWA 2K52A 3E9HA 4X65Q 3HOUG 3PGZA 4IFDG 4DR5L 4DAYB 3PO2H 1N34L 2AMCB 3CCSA 3S14H 4GNXC 1E24A 1N32L 3S1RH 1JJGA 5C0XG 4GNXB 4QQBX 3CD6A 2VY3A 1C9OA 1XNRL 2WAQG 2KCMA 4WJ4A 4JI5L 1VQ5A 3AFPA 4DK3C 1NE3A 4GLVB 1TXYA 2R93H 4BY1G 3I2ZA 5LMUQ 4AYBE 4A3LH 2KBNA 5C3EH 2JA8H 5GROA 4Y52H 4KHZA 1UWVA 5IWAQ 3ULJA 3GTGH 4DK6C 4X6AH 2N3SA 3S1NH 4R4IA 2R92G 3PUXA 2UXBL 3A74A 1IBLQ 1B8AA 4A3KH 1WOCA 4IPDA 1CUKA 4OWXB 2OQKA 3I4NH 3M7NA 2ZTEA 4RG1A 4YCWA 1L2FA 3CAMA 4J15A 4JI0L 1Z9FA 3J80c 2E2HH 2GVBA 3JC66 4EQ5A 4L5SA 3GDEA 1IBMQ 1AH9A 1N36Q 3HOZG 2K75A 3HOVH 4DR5Q 1YNXA 1J5EL 3U50C 4TVAB 1Y1WH 1PV4A 2OWOA 3T1YL 3RZDH 4LF9Q 1JE5A 4Y7NH 2ZJQA 1N32Q 1BBWA 4QL5A 3FKIH 4O0AA 1VQBA 2JA6H 5FJ8G 1PH1A 1B70B 2Q2HA 1IYJB 2PNHA 4BBRG 5GAEC 4JBWA 4DV1Q 3W5OA 2HHHL 2HT1A 1K83H 2AKWB 4C3JH 3F2CA 1K0RA 4UP8A 4YY3Q 2ZJPA 4HIMA 1RL2A 4A75A 3ICEA 2IHEA 1XNQL 4X64Q 1EFWA 2B63G 2ASBA 4A3JG 3TREA 1HR0Q 1VQ9A 1EUJA 1X55A 3GTOH 4YHHL 1GM5A 3L0OA 1E7ZA 2NN6I 3KYHC 1XJVA 3ER0A 2VQFQ 1V9PA 2WB1G 5IYBH 1D8LA 4NXNQ 2JEBI 2FXQA 5HGQA 3CCRA 1PH9A 1UEBA 1HZBA 1GO3E 2GVAA 3U4ZA 1EQQA 4XTCS 4LFCQ 4NXMQ 5C0XJ 4JI3L 2NVTH 1PA6A 1A62A 2JA6G 1YJNA 3ZJYC 4LUZA 4LF7Q 1FJGQ 1HZCA 4IPHA 4AIMA 2UUAL 2IT1A 1SE8A 5IYCH 4BY1H 2UUCQ 2NZOA 2OTJA 2DGYA 2Z0SA 1JB7A 1VQNA 4LUVA 2F4VQ 4LFBL 1HR0W 3IRBA 1BKBA 4UY8C 3M9BA 4DR1Q 2UUBQ 4YY3L 4HJ9A 4LF8Q 4DR2Q 5E7NA 4JI7Q 2NVXH 1L1OC 1XNQQ 1IZ6A 3KDFB 5GAHC 2ZTDA 3S1QH 4DR4Q 1NY4A 1PHJA 3I56A 3PO2G 2VQEQ 1IL2A 3RLNA 1Y1VG 3KJOA 4C3IH 3STBD 5FJ8H 3OTOL 3HOWH 4DR7Q 1C0AA 1VCIA 4DV3L 1WFQA 4X62L 4JI8Q 3G6EA 3L2PA 4DR6L 3S17H 3S24A 1I3QH 1XPOA 4A3EH 1QZGA 4JOIA 3PF4A 3CXCA 4B3RQ 3MEFA 2AWOA 1PYSB 3CF5A 1PH6A 1TWCH 4GKKQ 4DR3L 3I4MG 5IP7H 4A3CH 2HQLA 4LF7L 1EOVA 1M1KC 3H15A 4GNXA 4B3TL 1PH2A 2VUMH 1D7QA 1HZ9A 1TWFH 2GN5A 1KXLA 3F1ZA 4DV0Q 1VQMA 1VQLA 2UU9Q 1VQCA 3AFQA 3H0GG 5M5YH 1NJIC 4LF5Q 4HJAA 1LUZA 1YITA 2ZTCA 4MZ9A 1FGUA 3EN2A 1PH4A 1A0IA 5FLMH 2I0QA 2IHFA 5C3EG 4A3EG 3PV0A 3CCMA 1L0WA 4A3FG 1C7YA 1PH8A 4LNQA 4OWWB 4IFDJ 2VL6A 4JCVE 4DV4Q 1WI5A 1KRTA 5IYDH 1P16A 2KENA 5GAGC 5C4JH 3RLOA 3GO5A 4DV3Q 2BA1A 4DUYL 4B3SQ 5C4XG 2YYZA 4BBSG 5BR8Q 2VS1A 1YIJA 2VUMG 1X3EA 1HNWQ 3JAMi 4QY7A 1CKNB 4JI1L 2ZM6Q 1Y14B 2YTYA 3PCOB 2K4KA 4JG2A 3CCUA 2ES2A 3J81i 4ALPA 2E5LL 1UE7A 4X66Q 1X3GA 1SR3A 4R1JA 2A8VA 3W1GA 3RR5A 1XMOQ 4JYAQ 1KRSA 1QVCA 4DV6L 4A3BG 3TS0A 3I55A 4WJ3M 3E9IA 2RF4A 1Q8KA 4LFAQ 2K5VA 4BBSH 1SLJA 2WB1E 1AE3A 3M4PA 5M3FH 1R9TH 3F2BA 3TRZA 2EIFA 5IP7G 1S72A 4JOIC 1HJPA 1XTDA 1SFOH 1JJCB 4HIDA 2E8GA 4JBJA 5JJIA 1CKMA 1MJCA 1E1OA 5C44G 2N78A 3HKZE 2WFWA 3W1BA 4XIGS 5IT9c 2VQFL 3HOXG 2I5HA 3K0XA 5LMUL 1E1TA 1S40A 2XTIA 3PUWA 4JI1Q 2ZM6L 5IP9G 1N9WA 4R4TA 1L1OA 3J80i 1SN8A 1X54A 1AE2A 4MNOA 2E5LQ 4A4IA 3EIVA 1EQRA 1GVPA 4YCUA 3UE0A 3MXNB 5JEAJ 1XMQQ 1FL0A 4OX9Q 2CQOA 4JBMA 1N33Q 2RHSB 5GADC 4DV5Q 1KQSA 5JJLA 4OXPA 5J3BA 4UP7A 4JC0A 2MNAA 1IBKQ 2JA7G 2N49A 4IOCA 1IBML 1N36L 2ATWA 1VQ6A 3GTQH 3CC4A 4AQYQ 2B63H 4A3DH 3LGJA 1J5EQ 4P74A 4A3KG 1OXSC 1X6OA 1Q46A 2D0PA 3DM3A 4LF6L 4DR4L 2PI2E 4JI4Q 1X3FA 4HIOA 1S3OA 2WP8J 4K0KL 3STBC 1UE1A 3S15H 4LF4Q 5HY6A 5IE8A 3I4MH 1XPUA 3J7A5 4KHPL 4OWTB 4C3HH 3H3VH 1VQJA 2LXJA 3CCQA 4GLAC 4YHHQ 1MIUA 4IO9A 5IYCG 2E2JH 4B3RL 5JJKA 5C44H 1UE6A 5EAYA 4A3FH 3J81c 5AJ3Q 3M85A 4A3MH 3WWVA 1QZHA 3OW2A 1Y1VH 1U0LA 3CCJA 1OTCA 3CP0A 1YJWA 4LF5L 1H95A 4EX5A 3UE1A 1Q86C 3M3YH 2B29A 2CFMA 4A3LG 5C4XH 2PQAA 4R4QA 4AQYL 5DLQE 4X65L 3RLFA 1OXXK 3BU2A 1GD7A 1YHQA 4LF6Q 2AHOB 2E2IH 3A5ZB 3KFUA 1HZAA 4JI6Q 2BH8A 4BXXG 2V1CC 4OO1G 2IX1A 4PMWA 1PH7A 4DNIA 4DV7L 2Q2UA 3I4NG 1KHIA 2UXDQ 1K8AC 3KF8B 3T1HQ 3CPFA 2JK8A 4BBRH 4QGUA 3TS2A 1HNWL 1WJJA 2JA9A 3FKIG 3PIPA 3PO3H 3FHWA 3K81C 2MFIA 3ERSX 1K73C 2K5HA 4L5TA 2OCEA 1VQ7A 3U58A 2YV5A 2N8NA 1EIYB 4A3GH 3GTJH 4JI2L 4OONA 1MJEA 2BH2A 4BY7H 4UPAA 1Z47A 2F52A 2K5NA 5H1SE 2VW9A 4UP9A 1ASYA 1G6PA 3AQQA 1T9HA 3GTMH 4DR3Q 2MO1A 5GQOA 3H3VI 4JI5Q 4KI0A 1N8RC 3FP9A 4B3MQ 3CC7A 2CWPA 2RHQB 4BA1I 3F2DA 1X9NA 1B7YB 4DV7Q 4A3CG 5IYBG 4GKJQ 3HOYH 4DV1L 1RIPA 2I5MX 1YI2A 3KF6B 1Q81C 1L1OB 2PMZE 2QGQA 3AEVA 1WCMH 3GTLH 4PG3A 1QUQB 2IX0A 3I7FA 2LSSA 4DV2Q 2JEAI 2Y0SG 3F8TA 2NZHA 4B3SL 3ULPA 3HOWG 4HJ7A 1YVCA 5BR8L 1TWHH 2MQHA 5M5XH 3PSIA 2HIXA 1N33L 2JA8G 1UE5A 4O2DA 1FVIA 2I5LX 3T1YQ 1SMXA 1YBYA 4A3IG 2NVQH 4IPGA 4BXXH 3PIOA 2R93G 3RZOH 3E0EA 1V1QA 3K8AA 5JEAG 2JA5H 4DUZL 4GN3B 3J81j 1G51A 1YHAA 2PQAB 3KOJA 4X64L 4A3IH 5LMNQ 3PO3G 4HIKA 4L5RC 1HNXL 3M4QA 1VQKA 4IJHA 1KL9A 1VQPA 1W2BA 2CWAA 4A3BH 2NVYH 1K9MC 2EXDA 1U5KA 4KHPQ 3K7UC 1TWAH 4DV2L 4BY7G 3GTPH 1JT8A 2VQEL 3S2HH 1NTGA 1QVFA 4JI3Q 2R7ZH 2KHJA 2A19A 3A5UA 3HOYG 3OYYA 2DUDA 2HIVA 1VQGA 5AJ3L 2R7FA 4DPGA 1CSPA 1X65A 4GS3A 4JI8L 4IOAA 2OQ0A 3G4SA 2UUCL 4ME3A 4AH6A 4HJ5A 4APVA 1VQEA 2R92H 2F4VL 4LFBQ 5IYDG 1I50H 5LMNW 3TEHB 3A0JA 1I94Q 3HOXH 4DR1L 2OTLA 4NPSA 2UUBL 4LF8L 3AYHB 3CW2C 4JI7L 2KCTA 2ALYB 2Y0SE 4A76A 1OXVA 4TQUS 4A3GG 1HNXQ 3HOZH 1YHBA 1PYBA 1K3RA 2VZAA 3D31A 4KLKA 3H0GH 5IWAL 2MO0A 4MTNA 1NBWA 2Q2IA 1Q82C 1VQAA 2L15A 3NBHB 1VQHA 2NN6G 2Q2TA 4GOPB 1IBLL 1HH2P 3S1MH 2VNUD 3PF5A 2LXKA 2R7DA 2B3GA 4A3MG 1PH3A 3NELA 4LWCA 4GLXA 2K14A 4PZ6A 4LF4L 4YCVA 2CCZA 1XPRA 2YTVA 1LTLA 4JI2Q 4DV0L 2PI2A 2ID0A 4AYBG 2UU9L 4LF9L 1K8GA 3HKSA 1LM0A 1WYDA 3RNUA 4JV5L 5K36G 4PZ8A 1I5FA 1EYGA 1BBUA 1I94L 3M4OH 1G291 1I6HH 1OXUA 2R6GA 3CCVA 2KHIA 1BVSA 5IY0A 5M5WH 3D0FA 4P73A 1N34Q 1P8LA 3EBEA 4JYAL 1O7IA 4DV6Q 1DGSA 1TWGH 4DV4L 4P72A 1YEZA 2R7ZG 4LW1A 4GKJL 1QUQA 3UDXA 4DUYQ 5M3MH 4A3DG 2IY5B 2AWNA 3PUZA 4L5QA 3GTKH 4A93G 4JI6L 1QVGA 4NXNL 5FLMG 3PUYA 1VQIA 3G48A 4NXML 1EWIA 3UDFA 1PVOA 1LYLA 2BA0A 1VQFA 4P75A 1EIFA 1E22A 3L7ZC 1M90C 1E3PA 1X56A 3TQYA 2UXBQ 1FJGL 4R4OA 3CCEA 4JV5Q 3U4VA 5C0XI 2UXCQ 1YZ6A 4DKAC 3VDYA 1SRUA 1W3SA 3K7AH 2ZJRA 3KDFA 4HJ8A 1Q7YC 1NMGA 1A8VA 4LFAL 4A3JH 3S2DH 3NEMA 4IFDI 1A63A 2JQOA 1VQOA 1KD1C 1Q12A 3CMEA 3UDIA 1NMFA 1SROA 3HFZB 4H02A 4DV5L 4C2MH 5LMNL 4R4CA 1PH5A 1JMCA 1HNZQ 3BZCA 4QJFA 3OTOQ 4NB3A 1PFSA 4RMFA 2HHHQ 5IP9H 3GD7A 4B3ML 4X66L 3JAMc 3KLWA 1YJ9A 1IXRA 2XGTA 3HOVG 2A1AA 2JA5G 3I4OA 4IJLA 4PZ7A 1HR0L 1VQ8A 4DR6Q 1J6QA 4K0KQ 2Z6KC 3B6YA 1JJ2A 5ELNA 2JA7H 4DAMA 5M3MG 4OX9L 1XMQL 2QEXA 4JBKA 4B3TQ 1V43A 1GKHA 5ELOA 2F3IA 4OO1I 2UXCL 1Q1BA 2QA4A 3KF6A 3CC2A 5M3FG 4LFCL 4LUOA 1IBKL 4POGA 2C35B 4YWMA 2D0OA 2RCNA 3Q8DA 2JJQA 4GN5A 1KIXA 1WCMG 3J7ZC 2Z6KA 2WAQE 4IPCA 3UDGA 2YU9H 2UUAQ 4YWKA 2EQSA 3CCLA 4A93H 2JE6I 4JI4L 3S16H 3G71A 3NENA 1HNZL 3K80C 4DUZQ 3BJUA 3KJPA 4GOPA 1CSQA 3DLLA 3HKZG 1XNRQ 3BZKA 4DR2L 2CKZB 1CKOA 4FDBA 1KC8C 3ULLA 1ASZA 1KAWA 2YTXA 4QIWE 3HOUH 3SGIA 3PUVA 1VQ4A 2D62A 2H5XA 2UXDL 4DR7L 1MKHA 4YWLA 1Y1WG 5FLXc 3CQZH 1VQDA 1OXTA 4X62Q
chains in the Genus database with same CATH superfamily
3RMHA 5FLXE 4CKBA 3RN2A 1SE2A 4P71A 4FF2A 1NR2A 2K50A 4GN4B 4ZCKA 2K52A 3E9HA 2RCFA 3HOUG 3PGZA 4DR5L 1R4QB 3PO2H 2AMCB 1F2LA 2A74C 3OWFA 3D3RA 5C0XG 1QCBD 2VY3A 1XNRL 2KCMA 2F0TA 4DK3C 1TXYA 1ONLA 4UAIA 1ICFB 4AYBE 2JA8H 1TWGB 3NSWA 5GROA 1EL0A 1B2TA 4I7AA 2QEJC 4DK6C 4X6AH 4OELB 1VF5C 2R92G 4G7HC 4LMQD 2PNRC 1TVXA 1CUKA 2RA4A 2OQKA 3OOCA 3M7NA 4J15A 2L9HA 1LTSD 5CV7A 3HOVH 1YNXA 1PV4A 3RUZA 4OHJA 4Y7NH 3FEWX 2MPMA 3FKIH 1VQBA 1KDBA 4ZK9B 1B70B 2Q2HA 2PNHA 5GAEC 2HHHL 4C3JH 2AKWB 3F2CA 1PRTF 1K0RA 3HP3A 3U9OA 4YY3Q 4HIMA 2PMZB 3BDCA 4JK1C 4X64Q 1RHPA 2R3ZA 2ASBA 4WJWA 3MAQA 3DUZA 4A3JG 1VQ9A 4GZYC 1VMCA 2L5TA 1I4GA 1PH9A 3U4ZA 4XTCS 5C0XJ 1S5DD 2JA6G 2A69D 4LF7Q 3MA2B 3GTKB 4AIMA 2UUCQ 1XX8A 2LFNA 3IFDA 4B9XA 4LFBL 4UY8C 3M9BA 2UUBQ 4DXFA 4HJ9A 1Y8OB 5E7NA 1XNQQ 3S1QH 1EIHA 3VYUA 5IOCA 2VQEQ 3N6RA 2VUMB 4BBSB 4X62L 3G6EA 3L2PA 1XPOA 3PF4A 3G6JB 3EVQA 3CF5A 4CGYB 5IP7H 4C3JB 4A3CH 1VMPA 1EOVA 1SBBB 4GNXA 1M1KC 4B3TL 3ONAB 4X3UA 1U4PA 1I4XA 3BVMA 1CQFA 1FNVA 3H0GG 5M5YH 4CDDC 1NJIC 1YITA 4LAAA 1A0IA 1GUNA 4NKLA 2I0QA 2EYMA 1L0WA 3H94A 1PH8A 1ESFA 1WTOA 2F0OA 3BDOA 1WI5A 5IYDH 2KENA 5C4JH 5BN3A 2OT2A 3GO5A 4DV3Q 4DUYL 1X3EA 2E75C 1DOKA 4QY7A 1AFPA 4A3IB 2B2TA 2ZM6Q 2YTYA 2Z6BA 4PQXA 3CCUA 3J81i 2E5LL 2AUJD 1SR3A 2A8VA 5DM73 3SK6A 1KRSA 4DV6L 1STEA 3I55A 2G9DA 2RF4A 4BBSH 1AE3A 1R9TH 4CJ2C 1TIID 1CA5A 1HJPA 2LY7A 4JBJA 1SNPA 1E1OA 5FKAC 1Y1VB 1TQOA 4K6LA 5LMUL 3PUWA 4JI1Q 2EJMA 5KYLA 3Q22A 3J80i 1SN8A 3SK4A 1AE2A 3K0YA 5K5PA 3S17H 5M3MB 3MXNB 3FPUB 2RHSB 4BBRB 4DV5Q 5J3BA 4JC0A 2MNAA 4IOCA 1SNMA 3CC4A 1TKWB 1QILA 4RGOS 4P74A 4A3KG 1Q46A 1YNJC 1WTXA 4LF6L 4FYDA 4OGQC 1GUGA 4M8AA 3SDZA 4V0BA 1EYAA 3SR1A 3K58A 1XPUA 3J7A5 4OIJA 4UHVA 3GTMB 2LXJA 2KA7A 1W6JA 4YHHQ 4IO9A 4B3RL 2E2JH 1DONA 5C44H 5EAYA 2PZTA 4HSVA 3J81c 1F9RA 2XN9C 3OW2A 5KIXA 2XRSD 1YJWA 4LF5L 3UE1A 3MFYA 4AQYL 5A35A 4KV6A 3RLFA 2A6ED 1V1PA 2N55A 4KN7C 1HZAA 4JI6Q 3KFUA 4RGMA 3I4NG 1KHIA 3CPFA 3R2IA 2EPBA 2NWGA 2JA9A 4BY1B 1RTOA 2OCEA 2F0IA 4H7BA 2HCCA 4WORA 4UPAA 1MSGA 3DMUA 1Z47A 5KGUA 2K5NA 4UP9A 1IL8A 1T9HA 2HD3A 4X3SA 5AFWA 5GQOA 1H9JA 3I4MB 1NR4A 2KVMA 4KI0A 4HMIA 1WCMB 2FMCA 3NBHA 5JAVA 5IYBG 3HGBA 3P1HA 5J1ZA 2I5MX 2QILA 1YI2A 1L1OB 2PMZE 1NNXA 3GTLH 1QUQB 4DV2Q 1JOKA 3F8TA 5E4WC 2F0MA 5EGTA 3A56A 4B3SL 3R2TA 1SYFA 1BBXC 1N33L 4A3IG 1FVIA 2NVQH 1SMXA 1D2BA 5HURA 1SE4A 2R93G 1GOZA 3MXUA 4C3HG 1V1QA 4ZYSA 4FVMA 2Z4IA 5CMDA 1GUTA 3QO2A 1A3UA 1QE6A 2IW3A 2NZ1D 4X64L 4RAUC 1ET6A 5LMNQ 4HIKA 1HNXL 4Q5VA 1TWCB 1VQKA 1KL9A 4A3BH 1HTLD 3M4OB 2NVYH 3NTIA 1EY9A 3I8ZA 1DJRD 1PRTC 2AQ3B 1RF2D 3GTPH 1WVLA 2CVRA 1NTGA 2EY5A 2ZXOA 4JI3Q 2A19A 2DUDA 1SNCA 3OMCA 1O78A 4DPGA 1X65A 4GS3A 4IOAA 1HCZA 4LFBQ 2E2JB 2J4XA 3TEHB 3HOXH 1EY8A 4LF8L 3AYHB 2KCTA 2ALYB 1OXVA 3VYSA 1HNXQ 3HOZH 2XIWA 1YHBA 3QR8A 1K3RA 2VZAA 4CDEC 1H9SA 1K3BC 4F88A 4RCOA 1R4PB 2Q2TA 2RKSA 5LL6S 2B3GA 1M4VA 1HXYD 4P2CB 4IQZA 2XWJB 1XPRA 1B9MA 2JSOA 2PI2A 2ID0A 4AYBG 3AB9A 1LABA 2UU9L 5I2YA 2EXZA 2AQ2B 1LM0A 5I4DA 3VA5A 3KLSA 3M4OH 1JORA 1I6HH 2JA7B 1NCVA 4QB4A 4JYAL 3D0FA 2RBMA 3EBEA 1DGSA 2L4NA 3I91A 4P72A 4DV4L 4KKUA 2K28A 4GKJL 4DF7A 3T4AC 4DNTB 2IY5B 4KK7A 4L5QA 4JI6L 5I6YA 4NXNL 1LLRD 2B39A 1K8MA 3KBGA 1EWIA 3D4RA 3L7ZC 3TQYA 3QOJA 5CV5A 4K5XA 3CCEA 5ISRA 3CRLC 1LTID 1RD9D 3K7AH 3S2DH 5E3FA 4A3JH 1LTAD 1SMYC 1FR3A 2AQ1B 2DJFC 1BXTA 1SROA 4C3IG 2RVLA 2JXMB 1LTRD 1B4OA 3BZCA 5DEHA 3OTOQ 4RMFA 1KLGD 4KHVA 1BDOA 5JVG3 1IXRA 1GUSA 2XGTA 3HOVG 1PRTD 1VQ8A 3A8IE 2Z6KC 5C4XB 5ELNA 2JA7H 5M3MG 1TS4A 3CC2A 4HSPA 5FO8B 4F8MA 1BQQT 4F7XA 1IBKL 5JVH3 1HA5A 5C3EB 1DD2A 1WCMG 4NDXA 3J7ZC 2Z6KA 2WAQE 3ND9A 2IX3A 1RTNA 5T1GA 4YWKA 1FNUA 2VB3X 3G71A 1T5EA 1HNZL 1LTBD 2HUGA 3K80C 4GOPA 1I4QA 1XNRQ 2CW0C 3BZKA 1KC8C 2CKZB 4FDBA 1ASZA 4LJZC 3HOUH 2L12A 1EZ8A 3PUVA 1STGA 2K5WA 1XYIA 4DR7L 2O2LD 1Y1WG 2B63B 4HTHA 1I4RA 1OXTA 3SEBA 4X66L 3T1HL 1F2ZA 5M3FB 1SJED 4GOPC 2XNAC 3TP8A 3ZYYX 1Q1EA 4POFA 1CZWA 4JI0Q 3CPWA 4IFDG 4R8NA 4GNXC 3WDNA 3S14H 1U4RA 4J6HA 3S1RH 4QQBX 3NQIA 1C9OA 3PMFA 2WAQG 4WJ4A 4JI5L 3NTKA 3AFPA 5CC4A 1NE3A 4O1NA 4FO2A 1AEXA 3J7AF 1BCPC 5LMUQ 1NAPA 3MXNA 1IKMA 5C3EH 4KHZA 4R8IA 1MI2A 3ULJA 3V96A 4C3JG 2N3SA 3GTJB 2DJGC 3PUXA 3BZDB 4H44C 1B8AA 4A3KH 3MEHA 2ZTEA 3ITPA 4RG1A 4JI0L 1Z9FA 2E2HH 4U673 1AH9A 2BOSA 5EPLA 3HOWB 1N36Q 3HOZG 2K75A 1LT4D 4XDXA 1Y8PB 3U50C 4TVAB 2OWOA 3RZDH 3S1MB 2D5DA 5FJ8G 4UDUC 2D2CC 3HOWG 1PDQA 2WIIB 4BBRG 1PTOF 4JBWA 4UP8A 2ZJPA 1Q3LA 1RL2A 2PYKA 1MBYA 5CV6A 1PFNA 3TREA 1HR0Q 3GTOH 2QW7A 2PZWA 1GM5A 1E7ZA 1RDPD 3KYHC 3FRPB 1GHJA 5M5XB 3ER0A 2VQFQ 1XJVA 1V9PA 3HG9A 4CKCA 1SNOA 4NXNQ 5CV9A 3TBIB 5HGQA 1UEBA 1EQQA 4NXMQ 4LFCQ 3C3LA 2Q8IB 2NVTH 2PCFB 1YJNA 1DZ1A 1FJGQ 2EE1A 1HZCA 4BY1H 2KOLA 2OTJA 2Z0SA 2QDLA 2F4VQ 1F9SA 5EPJA 3SHLA 3IRBA 4OIKA 1B50A 1L1OC 4C56C 1IZ6A 5GAHC 2ZTDA 1EY4A 3PO2G 3RLNA 4C3IH 4DR7Q 2F3WA 1VCIA 4DV3L 1J9OA 4IUUA 1PTOB 4DK1A 4DR6L 1J8IA 3S24A 4A3EH 4XYQA 1PYSB 3NQTA 4GKKQ 1K83B 2TMPA 4LF7L 1PH2A 1TWFH 1KXLA 1VQMA 2EOTA 1JWSD 1SYGA 1VQCA 2EZVA 4ZKBB 1LUZA 3EN2A 3VR3A 1ZEQX 2ICEC 1EWHA 3N52A 5C3EG 3PV0A 4JVZA 4IFDJ 1C7YA 5IODA 2VL6A 1JC7A 2L11A 3S14B 1KRTA 2KJXA 2B2WA 3NUCA 2BA1A 5C4XG 1S5CD 2YYZA 2FHTA 4N8X1 4BBSG 1QWYA 2VUMG 4G4KA 4XT1B 2FINB 4JI1L 2EY2A 5T1IA 3PCOB 1BF4A 1JOOA 4ALPA 2HDMA 4R1JA 3TZUA 5I9PA 4G7ZC 3MWYW 1XMOQ 5C5LA 2ZT9C 5LL6X 1SSOA 3L9AX 3HZXA 1EYCA 4WJ3M 2J0TD 4LFAQ 2K5VA 3OIPA 3W3AA 1HQRD 3SK5A 3I73A 3S9WA 2EIFA 3FMCA 4JOIC 5HGTA 2E8GA 5JJIA 2F0EA 5C44G 1KNEA 2N78A 3W1BA 2VQFL 1KLUD 3HOXG 2I5HA 1E1TA 1NSNS 2ZM6L 1MGSA 2CQAA 2KEDA 5IP9G 1N9WA 2XWBB 5CYUA 4YCUA 1D5ZC 3UE0A 4OX9Q 1F77A 1FL0A 2MHVA 1PMRA 2CQOA 4IUTA 5I9OA 1ENFA 1O7YA 4OXPA 1ILPA 2JA7G 2N88A 2DN8A 5EKIA 4NW2A 1J5EQ 1OXSC 1G2TA 4HIOA 1S3OA 2F0HA 4A3FB 4LF4Q 3EFXD 3K5OA 5HY6A 1F2YA 2X69A 5K36H 4OWTB 1D5XC 1D1IA 1B9NA 4KKTA 1VQJA 3RD4A 1LTGD 4N9TA 4ABNA 5AJ3Q 1QZHA 1Y1VH 2JP1A 1TT2A 1UUPA 1PTOD 5C4XH 4A3LG 2PQAA 4R4QA 4QMGA 3C46A 1CHQD 1DOLA 1YHQA 4LF6Q 1TWFB 2E2IH 3J7AV 2BH8A 3E3XA 5C4HA 2IX1A 3MXGA 4Q0FA 3KF8B 1X3QA 4EQNA 2JK8A 4QGUA 1U4LA 3PIPA 3FHWA 5KEEA 4RGTA 1F9PA 3ERSX 2K5HA 3KUPA 4A3GH 4KJOA 4JI2L 4OONA 1MJEA 4BY7H 2CH4W 5H1SE 5F2DA 1ASYA 4DR3Q 4JI5Q 3M7GA 2GA4B 1QNUA 2CWPA 2RHQB 1UAPA 1T5XD 2KCNA 3A54A 3PIP3 4PV1C 4HEDA 1RKNA 3AEVA 4DN4M 1WCMH 5IIFA 2IX0A 5M5YB 1A6XA 4K6DA 4ZRZA 2Y0SG 5CV4A 3NBIA 1G2SA 1YVCA 1TWHH 2MQHA 4KY5A 2WKCA 3PIOA 2EYJA 4FXGC 4EQOA 4DUZL 3IL8A 4GN3B 1G51A 2HCIA 1Y8NB 3KOJA 3TMEA 3PO3G 4ID6A 3EA6A 1W2BA 1F2MA 4ZUIA 2B2VC 1K9MC 2EXDA 3KBXA 4DAPA 3L3OC 1JT8A 1SXTA 3S2HH 2R7ZH 1ML0D 2KHJA 3A5UA 3HOYG 3F2UA 4QF4A 3OYYA 1VQGA 1ZKOA 2OQ0A 3MHBA 1VQEA 1I50H 1PTOC 3NWSA 4DR1L 4NPSA 1YNNC 2QCPX 4JI7L 3Q6SA 2Y0SE 4TQUS 1HPCA 5CV8A 1GUWA 1Q8IA 1EY5A 4XT3B 3HOXB 1NBWA 2Q2IA 4KTAA 4A3EB 2NN6G 2XSCA 5ELCA 1HH2P 3S1MH 3PF5A 4IFDH 4IUVA 4LWCA 2K14A 3AU7A 4LF4L 1LT6D 5I6WA 4JI2Q 5KRUA 4FXKC 5G3LF 3K5LA 4RKLA 2X6GA 4ULLA 1K8GA 3HKSA 5K36G 5L37A 3FDTA 5DAUA 1I5FA 1I94L 1YNJD 1G291 3C1FA 3CU7A 1OXUA 2K5QA 5NUCA 1SNQA 5IY0A 1ILQA 1CK1A 4KJNA 1O7IA 4CKEA 5DM63 4MTKA 4DNRB 1YEZA 1STYA 2R7ZG 1KDCA 5KNCA 3QIAA 5M3MH 1EEID 3GP7A 1H9KA 1QVGA 2G5DA 4CJ1B 4DXGA 3G48A 2WKDA 3UDFA 1PVOA 5JOBA 1LYLA 2BA0A 2D9UA 1X56A 2UXBQ 4DAVA 1EWCA 3K57A 1EOTA 5COYA 4R4OA 3I70A 3U4VA 4HN7A 4S3SA 1QNKA 4K2KA 4HJ8A 2L0CA 4C3IB 1NMGA 4LFAL 3HRZC 2RDFA 1KD1C 2ZXPA 4DK0A 1SFOB 1E2ZA 4J8QA 1I3QB 4C2MH 5LMNL 1AZPA 1PH5A 5CR3A 5IGFA 1Z7TA 1HNZQ 4NB3A 1ZYRD 3QOLA 3DWAA 5D65A 2KECA 1JCKB 4IJLA 4PZ7A 1J6QA 3PIO3 1SDFA 3B6YA 2SNSA 1XMQL 1CQVA 1GKHA 4MIUA 3S1RB 3KF6A 4LUOA 4GN5A 3OPOA 1GUOA 5D3IB 3SXHA 3CCLA 4A93H 2HQEA 1SMYD 3NENA 3BJUA 4XQJA 5IT9E 4YIJA 1HUNA 4DR2L 1CKOA 4EGVA 3ULLA 1KAWA 5BN5A 3J7YW 2YTXA 4QIWE 1ICWA 1W6KA 3SGIA 1VQ4A 2D62A 1WTVA 4YWLA 5FLXc 3H6MA 4X62Q 1DOMA 2PZUA 1XMOL 1EY6A 1PXUA 3VR4A 4KY7A 3RN5A 5ELBA 3VR6A 2EYFA 1CKNA 3JAML 1I4HA 1N34L 2PW7A 3CCSA 1E24A 1N32L 1JJGA 3CHBD 4GNXB 2FJ2A 3CD6A 3BDLA 3S1NB 2IWHA 1BCPF 3T16A 4BY1G 3I2ZA 1FNWA 1SYBA 2KBNA 3C1EA 5C0XH 2I46A 3HEJA 1UWVA 2L1BA 3GTGH 4R4IA 4IPDA 3X3MA 3I4NH 4YCWA 3TP6A 3J80c 2GVBA 4L5SA 1JICA 1JR0D 1IBMQ 4DR5Q 2XVSA 1J5EL 3A7LA 1N32Q 1V8QA 1GHKA 2V4DA 4C3HB 2KEEA 2O4XA 4OEMB 1BBWA 3FVQA 4QL5A 5JJZA 4G57A 4O0AA 2JA6H 1PH1A 2K5DA 1IYJB 4DV1Q 3W5OA 2HT1A 1PTOH 2WINB 4A75A 3LWEA 4XXEA 1XWEA 2IHEA 1Y1WB 2B63G 1EUJA 2R92B 4YHHL 3L0OA 2NN6I 3TP5A 3NP8A 2WB1G 5IYBH 5G3LD 2FXQA 1HZBA 1KDAA 2GVAA 1WTHA 4JI3L 1QJOA 2EJGC 2C9OA 1QB5D 4IPHA 5JPMC 2UUAL 1V1OA 1Q90A 2IT1A 3C2PA 1SE8A 4IN3A 4QUFA 3U9SA 1VQNA 3A8JE 2L55A 3DWPA 1BKBA 4DR1Q 1JOQA 4LF8Q 4K2LA 4DR2Q 2RSOA 3KDFB 4ZLTF 1EFID 3VA7A 4A3GB 3CRKC 1NY4A 2SEBD 4HCSA 3I56A 2DY7A 1IL2A 1Y1VG 3KJOA 3IAYA 1C0AA 4CBVA 3HOVB 1JWMD 1WFQA 2B8GA 1BO0A 3PO2B 4JI8Q 2NVXB 3EQLC 4DA2A 4CJ0B 1QZGA 2AWOA 1PH6A 2EJFC 1AN8A 3F1ZA 3K5MA 1VQLA 2UU9Q 1HRJA 1D1KA 4MZ9A 2IHFA 4A3EG 4A3FG 3CCMA 4LNQA 4HAEA 4DV4Q 2K33A 1P16A 5GAGC 3K7AB 4B3SQ 1MSHA 5BR8Q 2VS1A 4RA8A 3JAMi 1C8CA 1CKNB 3S16B 2EYHA 1STNA 1KNAA 1HA6A 2F03A 1C4QA 2F0FA 1UE7A 2NUCA 3J80L 3W1GA 1HFNA 1BUVT 4JYAQ 4XYOA 1ZXTA 1QVCA 3FPPA 4A3BG 2RDGA 3TS0A 2E76C 3M4YA 3GQBA 5C3WA 5C44B 2H4OA 1SLJA 2WB1E 1LT3D 3S2DB 3M4PA 5M3FH 3TRZA 2SDFA 3G7LA 5IP7G 1S72A 1XTDA 1JJCB 4Y7NB 1OO9B 4ODGA 1EY0A 2WFWA 4XIGS 2G9HD 5IGEA 4IUNA 5M5WB 3K0XA 3R3OA 5C5MA 3QG1A 3RZOB 1L1OA 1X54A 1EQRA 1GVPA 3D8GA 1XMQQ 1CA6A 4PMBA 1N33Q 5GADC 1KQSA 5JJLA 4RCNA 2E74C 1IBKQ 4UP7A 2ATWA 2JYOA 5IGGA 1VQ6A 4RH6A 2B63H 4AQYQ 3LGJA 4F87A 1EQTA 4Z9CB 2B2TC 4HCEA 4DR4L 3V05A 4JI4Q 1X3FA 4I7ZC 3STBC 1UE1A 3S15H 1MHWC 3LWUA 5IE8A 3I4MH 2EYPA 1Y69U 3RZDB 3H3VH 3CCQA 1MIUA 5IYCG 1UE6A 4A3FH 3KLSX 3DEOA 2YU9B 3M85A 4A3MH 3SE0A 5M9OA 3CCJA 4MHEA 2IL8A 3CP0A 1OTCA 3GTOB 2B2VA 2F0GA 3M3YH 2CFMA 3BVGA 3H0GB 3D6CA 4X65L 1OXXK 3EJIA 3BU2A 1GD7A 2AHOB 3A5ZB 1KTKA 2V1CC 2EYOA 4OO1G 2DY8A 2Q2UA 4DNIA 4DV7L 2NVTB 2X6LA 4XQQA 1K8AC 2BDNA 5LHY1 4FF3A 3T1HQ 4BBRH 1ET9A 1HNWL 1WJJA 4OO1H 3K59A 3U58A 2N8NA 4ZAIA 2CHBD 2EY6A 1EIYB 3GTJH 2BCOA 1G6PA 1SJHD 3LX0A 4ILWA 1TR5A 5D14A 3TZDA 4G7OC 1LACA 4J1MA 2MJ8A 1WTPA 2E2HB 3GV3A 5CBEE 5EKLA 3NPPA 2A5HA 3CC7A 1H9SB 2ICIA 4K5VA 4DV7Q 2R7ZB 4RWSC 3GTGB 3IKJA 3IFTA 4CDCC 1AZQA 4GKJQ 3S17B 3HOYH 1TS3A 1B53A 3KF6B 1Q81C 2QGQA 1JQYD 4DU9A 3KLRA 4PG3A 2A6HC 4FXDA 2IPKD 2E2IB 2B2WC 3HOZB 2NZHA 4A3JB 3ULPA 2F0LA 5BR8L 5M5XH 5EJWA 1UE5A 1ZYRC 2I5LX 4BXXH 4KN4C 3RZOH 1IYUA 1EU3A 2K04A 1TWHB 3BYYB 3J81j 5C6AA 3E5SA 4CDFC 3MVVA 3A7AB 2M9VA 4IURA 2WV6D 2WAQB 2VXWA 3SK8A 2K6AA 1U5KA 1LV9A 4KHPQ 5TSSA 3K7UC 1CTMA 3QJYA 1EQVA 3TN2A 1LO5D 3OIQA 1UEAB 2HIVA 4IALA 5AJ3L 2R7FA 2K03A 1CSPA 2PW5A 3BYTB 3G4SA 1DXMA 2UUCL 1K8OA 3HS0C 3QB3A 4HJ5A 2R92H 4APVA 1JB3A 1SEBD 5IYDG 3I3CA 5LMNW 1SE3A 1I94Q 2UUBL 1PZJD 3DM1A 3CW2C 2EY1A 5JPNC 4WRDA 1PZKD 4A3GG 3E6ZX 5E4XA 3H0GH 5IWAL 1TY2A 2MO0A 1G8ZD 4MTNA 1Q82C 1A3TA 1VQAA 2L15A 3NBHB 4GOPB 4K8JA 4A3MG 3NELA 1CFMA 3E0JA 2B2UA 2CCZA 2F0SA 2YTVA 1K0SA 2A6EC 1FGBD 2NTSA 3RNUA 2Y0SB 4O42A 3PQIA 4ME5A 2NVYB 3CCVA 3BG3A 2R93B 1BVSA 1B44D 4P73A 3GTLB 1P8LA 4C1NI 2AUKA 2Q8RE 4FP5D 1H9RA 4LW1A 1QUQA 4MN3A 4DUYQ 2AWNA 3PUZA 3GTKH 4A93G 3MC0B 1F9QA 3MFGA 5FLMG 3PUYA 1BCPD 4NXML 4BS9A 2Z9HA 1M90C 1E3PA 2F0NA 5J22A 3T53B 4V190 2F0UA 3OMGA 4ZKCB 1YZ6A 2J7ZA 2WACA 3NTHA 1X32A 3VYTA 4DKAC 2A68D 1SRUA 5C4JB 1Q7YC 2ZJRA 3KDFA 4L5RC 4IFDI 2JQOA 2NB0A 1NUCA 1RODA 3CMEA 3UDIA 1L0XB 3X3NA 4DV5L 2E2DC 4H02A 4R4CA 4X3KA 1JMCA 3URYA 3NXWA 4QJFA 3VR2A 4HMJA 3GTQB 2O5JC 5IP9H 2M2LA 3GD7A 4B3ML 3JAMc 3KLWA 1EU4A 4H0LC 2A1AA 5JEAH 3I4OA 2JA5G 4DR6Q 1SAPA 3AMUA 1ENAA 3BVZA 5KNBA 2QEXA 4JBKA 5FLXL 1V43A 2H1EA 5ELOA 2F3IA 4OO1I 2UXCL 1C48A 1Q1BA 5IGDA 2QA4A 4RFBA 2FFKB 2FMMA 4B9WA 4PMCA 2D0OA 2RCNA 2KUMA 3OHXC 2A68C 3T56B 2JA8B 2JE6I 4JI4L 3S16H 2F0JA 1TS2A 4DUZQ 3KJPA 3NE5B 1CSQA 3CKIB 3DLLA 5I2XA 2KHSA 2BE5C 2H5XA 1E2VA 1MKHA 4EVOA 5CORA 4R9WA 5FK9C 1I4PA 1R9TB 4BA2I 3CMAA 2F3VA 1VS0A 4GKKL 3Q23A 5EPKA 2B2YA 4X65Q 3CQZB 1PFMA 5FO9B 4DAYB 2MP1A 1QG7A 4TSSA 5EKKA 1O7LA 2A69C 4QIWB 2PPBC 1B3AA 5IT9L 1CI3M 1K28A 1VQ5A 2TSSA 4GLVB 2R93H 1H9MA 4M1UB 4K5WA 4A3LH 1HHVA 4Y52H 2SNMA 2C5CA 5IWAQ 4DFAA 3S1NH 2UXBL 4WFN3 3A74A 4DGZA 1IBLQ 1WOCA 4RGNA 4OWXB 1XXGA 1LT5D 1L2FA 3CAMA 2K7VA 3JC66 4LK1C 4EQ5A 2OXPA 3GDEA 3JAME 2B2UC 1A2TA 2B8FA 4RHRA 3HOUB 1Y1WH 3T1YL 4LF9Q 1JE5A 2ZJQA 4IZ8A 1STHA 5D3DA 1K83H 4ZQ3A 2ENBA 3ICEA 4ZUJA 1XNQL 1EFWA 1D6EC 3ERQA 1X55A 3A55A 4FF4A 4EQPA 1Z6HA 2Z8LA 4E6IA 1D8LA 2JEBI 2K32A 1S4ZA 3D4DA 3CCRA 1WD1A 1GO3E 1SNDA 1CZGA 1PA6A 1A62A 4KY6A 4LUZA 3ZJYC 5C4ZA 3MXPA 1YNND 5IYCH 1E0BA 2NZOA 2DGYA 2EYLA 3SVMA 1JB7A 4LUVA 1HR0W 1HFGA 1JWUD 4YY3L 4JI7Q 2NVXH 2QKIC 4DR4Q 1TS5A 1X3PA 1PHJA 1U9RA 5J39A 4BWGB 3STBD 5FJ8H 3OTOL 4JW0A 3HOWH 3FKIB 1I3QH 1M8AA 4N8FA 4C2MB 1JE4A 4JOIA 3A8KE 3CXCA 4B3RQ 3EROA 3MEFA 1U4MA 1TWCH 4DR3L 3I4MG 2HQLA 1UNSA 1STBA 3H15A 2VUMH 1D7QA 1HZ9A 2GN5A 4KD3A 2A73B 4DV0Q 4KD4A 3VYRA 1FYCA 3AFQA 4LF5Q 4HJAA 1IW7C 1PH4A 2ZTCA 1G6ZA 1FGUA 5FLMH 4OWWB 3PO3B 4JCVE 4QCLA 2ZXRA 1O80A 3DEPA 1A15A 2K05A 3RLOA 1YIJA 1HNWQ 1SYEA 4AYBB 1AW7A 1Y14B 2K4KA 2QDBA 4JG2A 4DAYA 3QWNA 1BNZA 1WTRA 2ES2A 4X66Q 1X3GA 1CT1D 3RR5A 2NTTA 2XRQD 3P7JA 4XQNA 4H13C 2F0WA 3S15B 3GTPB 2RSNA 3WOEA 3E9IA 1IYVA 1Q8KA 3F2BA 2Q8TA 5FO7B 4TKOB 3KF8A 1HQMC 1SFOH 2OEOA 4HIDA 2R61A 1CKMA 1EY7A 1MJCA 1I6HB 3HKZE 5CBAE 5IT9c 3P75A 3V2TA 1S40A 2XTIA 2A6HD 3LNNA 4R4TA 4C1NK 2E5LQ 4MNOA 4A4IA 3EIVA 5JEAJ 4JBMA 1PRTB 1PFBA 1L0YB 4RHSA 2N49A 3P20A 1IBML 1N36L 3GTQH 4A3DH 1KABA 2KCCA 2MUYA 2F0DA 1X6OA 2D0PA 2RQXA 3D6WA 3TSSA 3DM3A 2LKVA 2PI2E 2CH4A 1S5BD 4L6TB 2WP8J 1VF7A 4K0KL 4FNFA 1CM9A 5KYIA 2EVBA 4A3MB 2PQEA 4KHPL 1HUMA 4C3HH 5A2QE 4GLAC 4B08A 3GV6A 5JJKA 1ENCA 3WWVA 2WB1B 1BR9A 1U0LA 1LTTD 1H95A 2F0KA 4EX5A 3NHHA 4K14A 4N9PA 1G91A 1Q86C 2B29A 2KQ3A 5DLQE 1QOHA 4BXXG 3NWTA 4PMWA 1PH7A 2UXDQ 3M3YB 1KAAA 3MZ5A 4TRDA 3TS2A 2NVQB 4IUQA 5FOBB 3FKIG 3PO3H 3K81C 2MFIA 2BE5D 1K73C 2JA6B 4L5TA 1VQ7A 1IHZA 2YV5A 1EIGA 1EYDA 1WTQA 3S1QB 2BH2A 2K1BA 2F52A 2RDHA 2VW9A 1DCZA 3AQQA 3GTMH 1AP0A 4A3BB 2MO1A 3H3VI 3S2HB 2SOBA 1SYCA 3OW7A 2DNCA 1N8RC 3FP9A 4B3MQ 1BOSA 2O5IC 4BA1I 3F2DA 1X9NA 1B7YB 1XTCD 1PLFA 3BS1A 4A3CG 3WOFA 4L63B 4DV1L 4U68A 1RIPA 1I50B 4A3KB 3VR5A 3I7FA 2LSSA 2JEAI 1GJXA 1O7ZA 3KK7A 1RJTA 3J81E 3HOYB 4HJ7A 1VDZA 3K5NA 3I4LA 3PSIA 4KKSA 2F0PA 2HIXA 2JA8G 2F4IA 4O2DA 3T1YQ 1YBYA 3O13A 4IPGA 1ESRA 4IUPA 4PNYA 3E0EA 3K8AA 5JEAG 2JA5H 1PZID 3OSOA 1YHAA 2PQAB 4A3IH 1B1ZA 3T13A 3W2DA 3M4QA 1TY0A 4IJHA 1VQPA 2CWAA 1TU2B 4RKBA 1TWAH 4DV2L 4BY7G 2Z1CA 2VQEL 3H09A 1IKLA 1QVFA 3J80E 3H3VC 2I07B 1WD0A 4JI8L 5EBCA 4ME3A 1IW7D 4AH6A 3I72A 2F4VL 2OTLA 3A0JA 2EDGA 3T51B 3DXJC 4A76A 1A3VA 1MD2D 1PYBA 3D31A 5IGBA 4KLKA 3Q24A 2F0QA 1SYDA 1EZ6A 1VQHA 3I90A 4BY7B 2M00A 2B2YC 2QF7A 1IBLL 4A93B 5EQ0A 2VNUD 2LXKA 2R7DA 2PO4A 1DM0B 1PH3A 4GLXA 4PZ6A 3DHQA 1RCVD 4YCVA 5KNDA 5ELDA 1LTLA 4DV0L 5A2QL 1BCPB 5ELEA 2NBFA 4LF9L 4JV5L 1HTPA 1WYDA 4KMUC 4PZ8A 1EYGA 1BBUA 4QUCA 2R6GA 5E1FA 2LS01 2KHIA 5M5WH 1N34Q 4OL7A 4DV6Q 3OWEB 1TWGH 3NK9A 1FD7D 5BN4A 2LMCB 3UDXA 1B3QA 1E2WA 2OF1A 1WTWA 4A3DG 2DNEA 5ELFA 1I6VC 1S5ED 2F0VA 1VQIA 1V1PB 3HKZB 4I65A 2JA5B 1VQFA 4NMZA 4P75A 1D5MC 1EIFA 1E22A 4NP5A 3ND8A 4X3TA 1FJGL 1CHPD 2P5ZX 1STAA 4JV5Q 5C0XI 3Q0AA 2UXCQ 3VDYA 1A2UA 1DYQA 1W3SA 2F1MA 1A8VA 4L8JA 3NEMA 1A63A 2K01A 1VQOA 1Q12A 4HR7B 2BDOA 3MTSA 1NMFA 2IJ0A 3HFZB 3UI2A 3H91A 3I4NB 4CHTB 3R93A 2JN4A 3TP7A 4FF1A 1PFSA 1GXDC 2HHHQ 1YJ9A 1PYWD 5CGKA 3DWQA 1II3A 1HR0L 2NYZD 2VB2X 4K0KQ 1JJ2A 4DAMA 1EEFD 5DNFA 5IGCA 4OX9L 4JPBW 4B3TQ 3K6OA 2CW0D 1TWAB 5M3FG 4LFCL 2NN6H 3R8BA 4POGA 2C35B 4YWMA 3J81L 3Q8DA 2JJQA 1KIXA 5C3XA 4IPCA 3UDGA 2YU9H 2UUAQ 2EQSA 2MGSA 3TDQA 4K8IA 3D4WA 3HKZG 2HDLA 5EBDA 1S5FD 2UXDL 4A3DB 2Z4HA 3CQZH 1VQDA
chains in the Genus database with same CATH topology
3T1HL 4GOPC 1XMOL 4BA2I 3RN2A 3CMAA 1VS0A 3RN5A 4P71A 1Q1EA 4POFA 4GKKL 4JI0Q 2K50A 4GN4B 1CKNA 3CPWA 2K52A 3E9HA 4X65Q 3HOUG 3PGZA 4IFDG 4DR5L 4DAYB 3PO2H 1N34L 2AMCB 3CCSA 3S14H 4GNXC 1E24A 1N32L 3S1RH 1JJGA 5C0XG 4GNXB 4QQBX 3CD6A 2VY3A 1C9OA 1XNRL 2WAQG 2KCMA 4WJ4A 4JI5L 1VQ5A 3AFPA 4DK3C 1NE3A 4GLVB 1TXYA 2R93H 4BY1G 3I2ZA 5LMUQ 4AYBE 4A3LH 2KBNA 5C3EH 2JA8H 5GROA 4Y52H 4KHZA 1UWVA 5IWAQ 3ULJA 3GTGH 4DK6C 4X6AH 2N3SA 3S1NH 4R4IA 2R92G 3PUXA 2UXBL 3A74A 1IBLQ 1B8AA 4A3KH 1WOCA 4IPDA 1CUKA 4OWXB 2OQKA 3I4NH 3M7NA 2ZTEA 4RG1A 4YCWA 1L2FA 3CAMA 4J15A 4JI0L 1Z9FA 3J80c 2E2HH 2GVBA 3JC66 4EQ5A 4L5SA 3GDEA 1IBMQ 1AH9A 1N36Q 3HOZG 2K75A 3HOVH 4DR5Q 1YNXA 1J5EL 3U50C 4TVAB 1Y1WH 1PV4A 2OWOA 3T1YL 3RZDH 4LF9Q 1JE5A 4Y7NH 2ZJQA 1N32Q 1BBWA 4QL5A 3FKIH 4O0AA 1VQBA 2JA6H 5FJ8G 1PH1A 1B70B 2Q2HA 1IYJB 2PNHA 4BBRG 5GAEC 4JBWA 4DV1Q 3W5OA 2HHHL 2HT1A 1K83H 2AKWB 4C3JH 3F2CA 1K0RA 4UP8A 4YY3Q 2ZJPA 4HIMA 1RL2A 4A75A 3ICEA 2IHEA 1XNQL 4X64Q 1EFWA 2B63G 2ASBA 4A3JG 3TREA 1HR0Q 1VQ9A 1EUJA 1X55A 3GTOH 4YHHL 1GM5A 3L0OA 1E7ZA 2NN6I 3KYHC 1XJVA 3ER0A 2VQFQ 1V9PA 2WB1G 5IYBH 1D8LA 4NXNQ 2JEBI 2FXQA 5HGQA 3CCRA 1PH9A 1UEBA 1HZBA 1GO3E 2GVAA 3U4ZA 1EQQA 4XTCS 4LFCQ 4NXMQ 5C0XJ 4JI3L 2NVTH 1PA6A 1A62A 2JA6G 1YJNA 3ZJYC 4LUZA 4LF7Q 1FJGQ 1HZCA 4IPHA 4AIMA 2UUAL 2IT1A 1SE8A 5IYCH 4BY1H 2UUCQ 2NZOA 2OTJA 2DGYA 2Z0SA 1JB7A 1VQNA 4LUVA 2F4VQ 4LFBL 1HR0W 3IRBA 1BKBA 4UY8C 3M9BA 4DR1Q 2UUBQ 4YY3L 4HJ9A 4LF8Q 4DR2Q 5E7NA 4JI7Q 2NVXH 1L1OC 1XNQQ 1IZ6A 3KDFB 5GAHC 2ZTDA 3S1QH 4DR4Q 1NY4A 1PHJA 3I56A 3PO2G 2VQEQ 1IL2A 3RLNA 1Y1VG 3KJOA 4C3IH 3STBD 5FJ8H 3OTOL 3HOWH 4DR7Q 1C0AA 1VCIA 4DV3L 1WFQA 4X62L 4JI8Q 3G6EA 3L2PA 4DR6L 3S17H 3S24A 1I3QH 1XPOA 4A3EH 1QZGA 4JOIA 3PF4A 3CXCA 4B3RQ 3MEFA 2AWOA 1PYSB 3CF5A 1PH6A 1TWCH 4GKKQ 4DR3L 3I4MG 5IP7H 4A3CH 2HQLA 4LF7L 1EOVA 1M1KC 3H15A 4GNXA 4B3TL 1PH2A 2VUMH 1D7QA 1HZ9A 1TWFH 2GN5A 1KXLA 3F1ZA 4DV0Q 1VQMA 1VQLA 2UU9Q 1VQCA 3AFQA 3H0GG 5M5YH 1NJIC 4LF5Q 4HJAA 1LUZA 1YITA 2ZTCA 4MZ9A 1FGUA 3EN2A 1PH4A 1A0IA 5FLMH 2I0QA 2IHFA 5C3EG 4A3EG 3PV0A 3CCMA 1L0WA 4A3FG 1C7YA 1PH8A 4LNQA 4OWWB 4IFDJ 2VL6A 4JCVE 4DV4Q 1WI5A 1KRTA 5IYDH 1P16A 2KENA 5GAGC 5C4JH 3RLOA 3GO5A 4DV3Q 2BA1A 4DUYL 4B3SQ 5C4XG 2YYZA 4BBSG 5BR8Q 2VS1A 1YIJA 2VUMG 1X3EA 1HNWQ 3JAMi 4QY7A 1CKNB 4JI1L 2ZM6Q 1Y14B 2YTYA 3PCOB 2K4KA 4JG2A 3CCUA 2ES2A 3J81i 4ALPA 2E5LL 1UE7A 4X66Q 1X3GA 1SR3A 4R1JA 2A8VA 3W1GA 3RR5A 1XMOQ 4JYAQ 1KRSA 1QVCA 4DV6L 4A3BG 3TS0A 3I55A 4WJ3M 3E9IA 2RF4A 1Q8KA 4LFAQ 2K5VA 4BBSH 1SLJA 2WB1E 1AE3A 3M4PA 5M3FH 1R9TH 3F2BA 3TRZA 2EIFA 5IP7G 1S72A 4JOIC 1HJPA 1XTDA 1SFOH 1JJCB 4HIDA 2E8GA 4JBJA 5JJIA 1CKMA 1MJCA 1E1OA 5C44G 2N78A 3HKZE 2WFWA 3W1BA 4XIGS 5IT9c 2VQFL 3HOXG 2I5HA 3K0XA 5LMUL 1E1TA 1S40A 2XTIA 3PUWA 4JI1Q 2ZM6L 5IP9G 1N9WA 4R4TA 1L1OA 3J80i 1SN8A 1X54A 1AE2A 4MNOA 2E5LQ 4A4IA 3EIVA 1EQRA 1GVPA 4YCUA 3UE0A 3MXNB 5JEAJ 1XMQQ 1FL0A 4OX9Q 2CQOA 4JBMA 1N33Q 2RHSB 5GADC 4DV5Q 1KQSA 5JJLA 4OXPA 5J3BA 4UP7A 4JC0A 2MNAA 1IBKQ 2JA7G 2N49A 4IOCA 1IBML 1N36L 2ATWA 1VQ6A 3GTQH 3CC4A 4AQYQ 2B63H 4A3DH 3LGJA 1J5EQ 4P74A 4A3KG 1OXSC 1X6OA 1Q46A 2D0PA 3DM3A 4LF6L 4DR4L 2PI2E 4JI4Q 1X3FA 4HIOA 1S3OA 2WP8J 4K0KL 3STBC 1UE1A 3S15H 4LF4Q 5HY6A 5IE8A 3I4MH 1XPUA 3J7A5 4KHPL 4OWTB 4C3HH 3H3VH 1VQJA 2LXJA 3CCQA 4GLAC 4YHHQ 1MIUA 4IO9A 5IYCG 2E2JH 4B3RL 5JJKA 5C44H 1UE6A 5EAYA 4A3FH 3J81c 5AJ3Q 3M85A 4A3MH 3WWVA 1QZHA 3OW2A 1Y1VH 1U0LA 3CCJA 1OTCA 3CP0A 1YJWA 4LF5L 1H95A 4EX5A 3UE1A 1Q86C 3M3YH 2B29A 2CFMA 4A3LG 5C4XH 2PQAA 4R4QA 4AQYL 5DLQE 4X65L 3RLFA 1OXXK 3BU2A 1GD7A 1YHQA 4LF6Q 2AHOB 2E2IH 3A5ZB 3KFUA 1HZAA 4JI6Q 2BH8A 4BXXG 2V1CC 4OO1G 2IX1A 4PMWA 1PH7A 4DNIA 4DV7L 2Q2UA 3I4NG 1KHIA 2UXDQ 1K8AC 3KF8B 3T1HQ 3CPFA 2JK8A 4BBRH 4QGUA 3TS2A 1HNWL 1WJJA 2JA9A 3FKIG 3PIPA 3PO3H 3FHWA 3K81C 2MFIA 3ERSX 1K73C 2K5HA 4L5TA 2OCEA 1VQ7A 3U58A 2YV5A 2N8NA 1EIYB 4A3GH 3GTJH 4JI2L 4OONA 1MJEA 2BH2A 4BY7H 4UPAA 1Z47A 2F52A 2K5NA 5H1SE 2VW9A 4UP9A 1ASYA 1G6PA 3AQQA 1T9HA 3GTMH 4DR3Q 2MO1A 5GQOA 3H3VI 4JI5Q 4KI0A 1N8RC 3FP9A 4B3MQ 3CC7A 2CWPA 2RHQB 4BA1I 3F2DA 1X9NA 1B7YB 4DV7Q 4A3CG 5IYBG 4GKJQ 3HOYH 4DV1L 1RIPA 2I5MX 1YI2A 3KF6B 1Q81C 1L1OB 2PMZE 2QGQA 3AEVA 1WCMH 3GTLH 4PG3A 1QUQB 2IX0A 3I7FA 2LSSA 4DV2Q 2JEAI 2Y0SG 3F8TA 2NZHA 4B3SL 3ULPA 3HOWG 4HJ7A 1YVCA 5BR8L 1TWHH 2MQHA 5M5XH 3PSIA 2HIXA 1N33L 2JA8G 1UE5A 4O2DA 1FVIA 2I5LX 3T1YQ 1SMXA 1YBYA 4A3IG 2NVQH 4IPGA 4BXXH 3PIOA 2R93G 3RZOH 3E0EA 1V1QA 3K8AA 5JEAG 2JA5H 4DUZL 4GN3B 3J81j 1G51A 1YHAA 2PQAB 3KOJA 4X64L 4A3IH 5LMNQ 3PO3G 4HIKA 4L5RC 1HNXL 3M4QA 1VQKA 4IJHA 1KL9A 1VQPA 1W2BA 2CWAA 4A3BH 2NVYH 1K9MC 2EXDA 1U5KA 4KHPQ 3K7UC 1TWAH 4DV2L 4BY7G 3GTPH 1JT8A 2VQEL 3S2HH 1NTGA 1QVFA 4JI3Q 2R7ZH 2KHJA 2A19A 3A5UA 3HOYG 3OYYA 2DUDA 2HIVA 1VQGA 5AJ3L 2R7FA 4DPGA 1CSPA 1X65A 4GS3A 4JI8L 4IOAA 2OQ0A 3G4SA 2UUCL 4ME3A 4AH6A 4HJ5A 4APVA 1VQEA 2R92H 2F4VL 4LFBQ 5IYDG 1I50H 5LMNW 3TEHB 3A0JA 1I94Q 3HOXH 4DR1L 2OTLA 4NPSA 2UUBL 4LF8L 3AYHB 3CW2C 4JI7L 2KCTA 2ALYB 2Y0SE 4A76A 1OXVA 4TQUS 4A3GG 1HNXQ 3HOZH 1YHBA 1PYBA 1K3RA 2VZAA 3D31A 4KLKA 3H0GH 5IWAL 2MO0A 4MTNA 1NBWA 2Q2IA 1Q82C 1VQAA 2L15A 3NBHB 1VQHA 2NN6G 2Q2TA 4GOPB 1IBLL 1HH2P 3S1MH 2VNUD 3PF5A 2LXKA 2R7DA 2B3GA 4A3MG 1PH3A 3NELA 4LWCA 4GLXA 2K14A 4PZ6A 4LF4L 4YCVA 2CCZA 1XPRA 2YTVA 1LTLA 4JI2Q 4DV0L 2PI2A 2ID0A 4AYBG 2UU9L 4LF9L 1K8GA 3HKSA 1LM0A 1WYDA 3RNUA 4JV5L 5K36G 4PZ8A 1I5FA 1EYGA 1BBUA 1I94L 3M4OH 1G291 1I6HH 1OXUA 2R6GA 3CCVA 2KHIA 1BVSA 5IY0A 5M5WH 3D0FA 4P73A 1N34Q 1P8LA 3EBEA 4JYAL 1O7IA 4DV6Q 1DGSA 1TWGH 4DV4L 4P72A 1YEZA 2R7ZG 4LW1A 4GKJL 1QUQA 3UDXA 4DUYQ 5M3MH 4A3DG 2IY5B 2AWNA 3PUZA 4L5QA 3GTKH 4A93G 4JI6L 1QVGA 4NXNL 5FLMG 3PUYA 1VQIA 3G48A 4NXML 1EWIA 3UDFA 1PVOA 1LYLA 2BA0A 1VQFA 4P75A 1EIFA 1E22A 3L7ZC 1M90C 1E3PA 1X56A 3TQYA 2UXBQ 1FJGL 4R4OA 3CCEA 4JV5Q 3U4VA 5C0XI 2UXCQ 1YZ6A 4DKAC 3VDYA 1SRUA 1W3SA 3K7AH 2ZJRA 3KDFA 4HJ8A 1Q7YC 1NMGA 1A8VA 4LFAL 4A3JH 3S2DH 3NEMA 4IFDI 1A63A 2JQOA 1VQOA 1KD1C 1Q12A 3CMEA 3UDIA 1NMFA 1SROA 3HFZB 4H02A 4DV5L 4C2MH 5LMNL 4R4CA 1PH5A 1JMCA 1HNZQ 3BZCA 4QJFA 3OTOQ 4NB3A 1PFSA 4RMFA 2HHHQ 5IP9H 3GD7A 4B3ML 4X66L 3JAMc 3KLWA 1YJ9A 1IXRA 2XGTA 3HOVG 2A1AA 2JA5G 3I4OA 4IJLA 4PZ7A 1HR0L 1VQ8A 4DR6Q 1J6QA 4K0KQ 2Z6KC 3B6YA 1JJ2A 5ELNA 2JA7H 4DAMA 5M3MG 4OX9L 1XMQL 2QEXA 4JBKA 4B3TQ 1V43A 1GKHA 5ELOA 2F3IA 4OO1I 2UXCL 1Q1BA 2QA4A 3KF6A 3CC2A 5M3FG 4LFCL 4LUOA 1IBKL 4POGA 2C35B 4YWMA 2D0OA 2RCNA 3Q8DA 2JJQA 4GN5A 1KIXA 1WCMG 3J7ZC 2Z6KA 2WAQE 4IPCA 3UDGA 2YU9H 2UUAQ 4YWKA 2EQSA 3CCLA 4A93H 2JE6I 4JI4L 3S16H 3G71A 3NENA 1HNZL 3K80C 4DUZQ 3BJUA 3KJPA 4GOPA 1CSQA 3DLLA 3HKZG 1XNRQ 3BZKA 4DR2L 2CKZB 1CKOA 4FDBA 1KC8C 3ULLA 1ASZA 1KAWA 2YTXA 4QIWE 3HOUH 3SGIA 3PUVA 1VQ4A 2D62A 2H5XA 2UXDL 4DR7L 1MKHA 4YWLA 1Y1WG 5FLXc 3CQZH 1VQDA 1OXTA 4X62Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H L;  4GOP C;  1XMO L;  4BA2 I;  3RN2 A;  3CMA A;  1VS0 A;  3RN5 A;  4P71 A;  1Q1E A;  4POF A;  4GKK L;  4JI0 Q;  2K50 A;  4GN4 B;  1CKN A;  3CPW A;  2K52 A;  3E9H A;  4X65 Q;  3HOU G;  3PGZ A;  4IFD G;  4DR5 L;  4DAY B;  3PO2 H;  1N34 L;  2AMC B;  3CCS A;  3S14 H;  4GNX C;  1E24 A;  1N32 L;  3S1R H;  1JJG A;  5C0X G;  4GNX B;  4QQB X;  3CD6 A;  2VY3 A;  1C9O A;  1XNR L;  2WAQ G;  2KCM A;  4WJ4 A;  4JI5 L;  1VQ5 A;  3AFP A;  4DK3 C;  1NE3 A;  4GLV B;  1TXY A;  2R93 H;  4BY1 G;  3I2Z A;  5LMU Q;  4AYB E;  4A3L H;  2KBN A;  5C3E H;  2JA8 H;  5GRO A;  4Y52 H;  4KHZ A;  1UWV A;  5IWA Q;  3ULJ A;  3GTG H;  4DK6 C;  4X6A H;  2N3S A;  3S1N H;  4R4I A;  2R92 G;  3PUX A;  2UXB L;  3A74 A;  1IBL Q;  1B8A A;  4A3K H;  1WOC A;  4IPD A;  1CUK A;  4OWX B;  2OQK A;  3I4N H;  3M7N A;  2ZTE A;  4RG1 A;  4YCW A;  1L2F A;  3CAM A;  4J15 A;  4JI0 L;  1Z9F A;  3J80 c;  2E2H H;  2GVB A;  3JC6 6;  4EQ5 A;  4L5S A;  3GDE A;  1IBM Q;  1AH9 A;  1N36 Q;  3HOZ G;  2K75 A;  3HOV H;  4DR5 Q;  1YNX A;  1J5E L;  3U50 C;  4TVA B;  1Y1W H;  1PV4 A;  2OWO A;  3T1Y L;  3RZD H;  4LF9 Q;  1JE5 A;  4Y7N H;  2ZJQ A;  1N32 Q;  1BBW A;  4QL5 A;  3FKI H;  4O0A A;  1VQB A;  2JA6 H;  5FJ8 G;  1PH1 A;  1B70 B;  2Q2H A;  1IYJ B;  2PNH A;  4BBR G;  5GAE C;  4JBW A;  4DV1 Q;  3W5O A;  2HHH L;  2HT1 A;  1K83 H;  2AKW B;  4C3J H;  3F2C A;  1K0R A;  4UP8 A;  4YY3 Q;  2ZJP A;  4HIM A;  1RL2 A;  4A75 A;  3ICE A;  2IHE A;  1XNQ L;  4X64 Q;  1EFW A;  2B63 G;  2ASB A;  4A3J G;  3TRE A;  1HR0 Q;  1VQ9 A;  1EUJ A;  1X55 A;  3GTO H;  4YHH L;  1GM5 A;  3L0O A;  1E7Z A;  2NN6 I;  3KYH C;  1XJV A;  3ER0 A;  2VQF Q;  1V9P A;  2WB1 G;  5IYB H;  1D8L A;  4NXN Q;  2JEB I;  2FXQ A;  5HGQ A;  3CCR A;  1PH9 A;  1UEB A;  1HZB A;  1GO3 E;  2GVA A;  3U4Z A;  1EQQ A;  4XTC S;  4LFC Q;  4NXM Q;  5C0X J;  4JI3 L;  2NVT H;  1PA6 A;  1A62 A;  2JA6 G;  1YJN A;  3ZJY C;  4LUZ A;  4LF7 Q;  1FJG Q;  1HZC A;  4IPH A;  4AIM A;  2UUA L;  2IT1 A;  1SE8 A;  5IYC H;  4BY1 H;  2UUC Q;  2NZO A;  2OTJ A;  2DGY A;  2Z0S A;  1JB7 A;  1VQN A;  4LUV A;  2F4V Q;  4LFB L;  1HR0 W;  3IRB A;  1BKB A;  4UY8 C;  3M9B A;  4DR1 Q;  2UUB Q;  4YY3 L;  4HJ9 A;  4LF8 Q;  4DR2 Q;  5E7N A;  4JI7 Q;  2NVX H;  1L1O C;  1XNQ Q;  1IZ6 A;  3KDF B;  5GAH C;  2ZTD A;  3S1Q H;  4DR4 Q;  1NY4 A;  1PHJ A;  3I56 A;  3PO2 G;  2VQE Q;  1IL2 A;  3RLN A;  1Y1V G;  3KJO A;  4C3I H;  3STB D;  5FJ8 H;  3OTO L;  3HOW H;  4DR7 Q;  1C0A A;  1VCI A;  4DV3 L;  1WFQ A;  4X62 L;  4JI8 Q;  3G6E A;  3L2P A;  4DR6 L;  3S17 H;  3S24 A;  1I3Q H;  1XPO A;  4A3E H;  1QZG A;  4JOI A;  3PF4 A;  3CXC A;  4B3R Q;  3MEF A;  2AWO A;  1PYS B;  3CF5 A;  1PH6 A;  1TWC H;  4GKK Q;  4DR3 L;  3I4M G;  5IP7 H;  4A3C H;  2HQL A;  4LF7 L;  1EOV A;  1M1K C;  3H15 A;  4GNX A;  4B3T L;  1PH2 A;  2VUM H;  1D7Q A;  1HZ9 A;  1TWF H;  2GN5 A;  1KXL A;  3F1Z A;  4DV0 Q;  1VQM A;  1VQL A;  2UU9 Q;  1VQC A;  3AFQ A;  3H0G G;  5M5Y H;  1NJI C;  4LF5 Q;  4HJA A;  1LUZ A;  1YIT A;  2ZTC A;  4MZ9 A;  1FGU A;  3EN2 A;  1PH4 A;  1A0I A;  5FLM H;  2I0Q A;  2IHF A;  5C3E G;  4A3E G;  3PV0 A;  3CCM A;  1L0W A;  4A3F G;  1C7Y A;  1PH8 A;  4LNQ A;  4OWW B;  4IFD J;  2VL6 A;  4JCV E;  4DV4 Q;  1WI5 A;  1KRT A;  5IYD H;  1P16 A;  2KEN A;  5GAG C;  5C4J H;  3RLO A;  3GO5 A;  4DV3 Q;  2BA1 A;  4DUY L;  4B3S Q;  5C4X G;  2YYZ A;  4BBS G;  5BR8 Q;  2VS1 A;  1YIJ A;  2VUM G;  1X3E A;  1HNW Q;  3JAM i;  4QY7 A;  1CKN B;  4JI1 L;  2ZM6 Q;  1Y14 B;  2YTY A;  3PCO B;  2K4K A;  4JG2 A;  3CCU A;  2ES2 A;  3J81 i;  4ALP A;  2E5L L;  1UE7 A;  4X66 Q;  1X3G A;  1SR3 A;  4R1J A;  2A8V A;  3W1G A;  3RR5 A;  1XMO Q;  4JYA Q;  1KRS A;  1QVC A;  4DV6 L;  4A3B G;  3TS0 A;  3I55 A;  4WJ3 M;  3E9I A;  2RF4 A;  1Q8K A;  4LFA Q;  2K5V A;  4BBS H;  1SLJ A;  2WB1 E;  1AE3 A;  3M4P A;  5M3F H;  1R9T H;  3F2B A;  3TRZ A;  2EIF A;  5IP7 G;  1S72 A;  4JOI C;  1HJP A;  1XTD A;  1SFO H;  1JJC B;  4HID A;  2E8G A;  4JBJ A;  5JJI A;  1CKM A;  1MJC A;  1E1O A;  5C44 G;  2N78 A;  3HKZ E;  2WFW A;  3W1B A;  4XIG S;  5IT9 c;  2VQF L;  3HOX G;  2I5H A;  3K0X A;  5LMU L;  1E1T A;  1S40 A;  2XTI A;  3PUW A;  4JI1 Q;  2ZM6 L;  5IP9 G;  1N9W A;  4R4T A;  1L1O A;  3J80 i;  1SN8 A;  1X54 A;  1AE2 A;  4MNO A;  2E5L Q;  4A4I A;  3EIV A;  1EQR A;  1GVP A;  4YCU A;  3UE0 A;  3MXN B;  5JEA J;  1XMQ Q;  1FL0 A;  4OX9 Q;  2CQO A;  4JBM A;  1N33 Q;  2RHS B;  5GAD C;  4DV5 Q;  1KQS A;  5JJL A;  4OXP A;  5J3B A;  4UP7 A;  4JC0 A;  2MNA A;  1IBK Q;  2JA7 G;  2N49 A;  4IOC A;  1IBM L;  1N36 L;  2ATW A;  1VQ6 A;  3GTQ H;  3CC4 A;  4AQY Q;  2B63 H;  4A3D H;  3LGJ A;  1J5E Q;  4P74 A;  4A3K G;  1OXS C;  1X6O A;  1Q46 A;  2D0P A;  3DM3 A;  4LF6 L;  4DR4 L;  2PI2 E;  4JI4 Q;  1X3F A;  4HIO A;  1S3O A;  2WP8 J;  4K0K L;  3STB C;  1UE1 A;  3S15 H;  4LF4 Q;  5HY6 A;  5IE8 A;  3I4M H;  1XPU A;  3J7A 5;  4KHP L;  4OWT B;  4C3H H;  3H3V H;  1VQJ A;  2LXJ A;  3CCQ A;  4GLA C;  4YHH Q;  1MIU A;  4IO9 A;  5IYC G;  2E2J H;  4B3R L;  5JJK A;  5C44 H;  1UE6 A;  5EAY A;  4A3F H;  3J81 c;  5AJ3 Q;  3M85 A;  4A3M H;  3WWV A;  1QZH A;  3OW2 A;  1Y1V H;  1U0L A;  3CCJ A;  1OTC A;  3CP0 A;  1YJW A;  4LF5 L;  1H95 A;  4EX5 A;  3UE1 A;  1Q86 C;  3M3Y H;  2B29 A;  2CFM A;  4A3L G;  5C4X H;  2PQA A;  4R4Q A;  4AQY L;  5DLQ E;  4X65 L;  3RLF A;  1OXX K;  3BU2 A;  1GD7 A;  1YHQ A;  4LF6 Q;  2AHO B;  2E2I H;  3A5Z B;  3KFU A;  1HZA A;  4JI6 Q;  2BH8 A;  4BXX G;  2V1C C;  4OO1 G;  2IX1 A;  4PMW A;  1PH7 A;  4DNI A;  4DV7 L;  2Q2U A;  3I4N G;  1KHI A;  2UXD Q;  1K8A C;  3KF8 B;  3T1H Q;  3CPF A;  2JK8 A;  4BBR H;  4QGU A;  3TS2 A;  1HNW L;  1WJJ A;  2JA9 A;  3FKI G;  3PIP A;  3PO3 H;  3FHW A;  3K81 C;  2MFI A;  3ERS X;  1K73 C;  2K5H A;  4L5T A;  2OCE A;  1VQ7 A;  3U58 A;  2YV5 A;  2N8N A;  1EIY B;  4A3G H;  3GTJ H;  4JI2 L;  4OON A;  1MJE A;  2BH2 A;  4BY7 H;  4UPA A;  1Z47 A;  2F52 A;  2K5N A;  5H1S E;  2VW9 A;  4UP9 A;  1ASY A;  1G6P A;  3AQQ A;  1T9H A;  3GTM H;  4DR3 Q;  2MO1 A;  5GQO A;  3H3V I;  4JI5 Q;  4KI0 A;  1N8R C;  3FP9 A;  4B3M Q;  3CC7 A;  2CWP A;  2RHQ B;  4BA1 I;  3F2D A;  1X9N A;  1B7Y B;  4DV7 Q;  4A3C G;  5IYB G;  4GKJ Q;  3HOY H;  4DV1 L;  1RIP A;  2I5M X;  1YI2 A;  3KF6 B;  1Q81 C;  1L1O B;  2PMZ E;  2QGQ A;  3AEV A;  1WCM H;  3GTL H;  4PG3 A;  1QUQ B;  2IX0 A;  3I7F A;  2LSS A;  4DV2 Q;  2JEA I;  2Y0S G;  3F8T A;  2NZH A;  4B3S L;  3ULP A;  3HOW G;  4HJ7 A;  1YVC A;  5BR8 L;  1TWH H;  2MQH A;  5M5X H;  3PSI A;  2HIX A;  1N33 L;  2JA8 G;  1UE5 A;  4O2D A;  1FVI A;  2I5L X;  3T1Y Q;  1SMX A;  1YBY A;  4A3I G;  2NVQ H;  4IPG A;  4BXX H;  3PIO A;  2R93 G;  3RZO H;  3E0E A;  1V1Q A;  3K8A A;  5JEA G;  2JA5 H;  4DUZ L;  4GN3 B;  3J81 j;  1G51 A;  1YHA A;  2PQA B;  3KOJ A;  4X64 L;  4A3I H;  5LMN Q;  3PO3 G;  4HIK A;  4L5R C;  1HNX L;  3M4Q A;  1VQK A;  4IJH A;  1KL9 A;  1VQP A;  1W2B A;  2CWA A;  4A3B H;  2NVY H;  1K9M C;  2EXD A;  1U5K A;  4KHP Q;  3K7U C;  1TWA H;  4DV2 L;  4BY7 G;  3GTP H;  1JT8 A;  2VQE L;  3S2H H;  1NTG A;  1QVF A;  4JI3 Q;  2R7Z H;  2KHJ A;  2A19 A;  3A5U A;  3HOY G;  3OYY A;  2DUD A;  2HIV A;  1VQG A;  5AJ3 L;  2R7F A;  4DPG A;  1CSP A;  1X65 A;  4GS3 A;  4JI8 L;  4IOA A;  2OQ0 A;  3G4S A;  2UUC L;  4ME3 A;  4AH6 A;  4HJ5 A;  4APV A;  1VQE A;  2R92 H;  2F4V L;  4LFB Q;  5IYD G;  1I50 H;  5LMN W;  3TEH B;  3A0J A;  1I94 Q;  3HOX H;  4DR1 L;  2OTL A;  4NPS A;  2UUB L;  4LF8 L;  3AYH B;  3CW2 C;  4JI7 L;  2KCT A;  2ALY B;  2Y0S E;  4A76 A;  1OXV A;  4TQU S;  4A3G G;  1HNX Q;  3HOZ H;  1YHB A;  1PYB A;  1K3R A;  2VZA A;  3D31 A;  4KLK A;  3H0G H;  5IWA L;  2MO0 A;  4MTN A;  1NBW A;  2Q2I A;  1Q82 C;  1VQA A;  2L15 A;  3NBH B;  1VQH A;  2NN6 G;  2Q2T A;  4GOP B;  1IBL L;  1HH2 P;  3S1M H;  2VNU D;  3PF5 A;  2LXK A;  2R7D A;  2B3G A;  4A3M G;  1PH3 A;  3NEL A;  4LWC A;  4GLX A;  2K14 A;  4PZ6 A;  4LF4 L;  4YCV A;  2CCZ A;  1XPR A;  2YTV A;  1LTL A;  4JI2 Q;  4DV0 L;  2PI2 A;  2ID0 A;  4AYB G;  2UU9 L;  4LF9 L;  1K8G A;  3HKS A;  1LM0 A;  1WYD A;  3RNU A;  4JV5 L;  5K36 G;  4PZ8 A;  1I5F A;  1EYG A;  1BBU A;  1I94 L;  3M4O H;  1G29 1;  1I6H H;  1OXU A;  2R6G A;  3CCV A;  2KHI A;  1BVS A;  5IY0 A;  5M5W H;  3D0F A;  4P73 A;  1N34 Q;  1P8L A;  3EBE A;  4JYA L;  1O7I A;  4DV6 Q;  1DGS A;  1TWG H;  4DV4 L;  4P72 A;  1YEZ A;  2R7Z G;  4LW1 A;  4GKJ L;  1QUQ A;  3UDX A;  4DUY Q;  5M3M H;  4A3D G;  2IY5 B;  2AWN A;  3PUZ A;  4L5Q A;  3GTK H;  4A93 G;  4JI6 L;  1QVG A;  4NXN L;  5FLM G;  3PUY A;  1VQI A;  3G48 A;  4NXM L;  1EWI A;  3UDF A;  1PVO A;  1LYL A;  2BA0 A;  1VQF A;  4P75 A;  1EIF A;  1E22 A;  3L7Z C;  1M90 C;  1E3P A;  1X56 A;  3TQY A;  2UXB Q;  1FJG L;  4R4O A;  3CCE A;  4JV5 Q;  3U4V A;  5C0X I;  2UXC Q;  1YZ6 A;  4DKA C;  3VDY A;  1SRU A;  1W3S A;  3K7A H;  2ZJR A;  3KDF A;  4HJ8 A;  1Q7Y C;  1NMG A;  1A8V A;  4LFA L;  4A3J H;  3S2D H;  3NEM A;  4IFD I;  1A63 A;  2JQO A;  1VQO A;  1KD1 C;  1Q12 A;  3CME A;  3UDI A;  1NMF A;  1SRO A;  3HFZ B;  4H02 A;  4DV5 L;  4C2M H;  5LMN L;  4R4C A;  1PH5 A;  1JMC A;  1HNZ Q;  3BZC A;  4QJF A;  3OTO Q;  4NB3 A;  1PFS A;  4RMF A;  2HHH Q;  5IP9 H;  3GD7 A;  4B3M L;  4X66 L;  3JAM c;  3KLW A;  1YJ9 A;  1IXR A;  2XGT A;  3HOV G;  2A1A A;  2JA5 G;  3I4O A;  4IJL A;  4PZ7 A;  1HR0 L;  1VQ8 A;  4DR6 Q;  1J6Q A;  4K0K Q;  2Z6K C;  3B6Y A;  1JJ2 A;  5ELN A;  2JA7 H;  4DAM A;  5M3M G;  4OX9 L;  1XMQ L;  2QEX A;  4JBK A;  4B3T Q;  1V43 A;  1GKH A;  5ELO A;  2F3I A;  4OO1 I;  2UXC L;  1Q1B A;  2QA4 A;  3KF6 A;  3CC2 A;  5M3F G;  4LFC L;  4LUO A;  1IBK L;  4POG A;  2C35 B;  4YWM A;  2D0O A;  2RCN A;  3Q8D A;  2JJQ A;  4GN5 A;  1KIX A;  1WCM G;  3J7Z C;  2Z6K A;  2WAQ E;  4IPC A;  3UDG A;  2YU9 H;  2UUA Q;  4YWK A;  2EQS A;  3CCL A;  4A93 H;  2JE6 I;  4JI4 L;  3S16 H;  3G71 A;  3NEN A;  1HNZ L;  3K80 C;  4DUZ Q;  3BJU A;  3KJP A;  4GOP A;  1CSQ A;  3DLL A;  3HKZ G;  1XNR Q;  3BZK A;  4DR2 L;  2CKZ B;  1CKO A;  4FDB A;  1KC8 C;  3ULL A;  1ASZ A;  1KAW A;  2YTX A;  4QIW E;  3HOU H;  3SGI A;  3PUV A;  1VQ4 A;  2D62 A;  2H5X A;  2UXD L;  4DR7 L;  1MKH A;  4YWL A;  1Y1W G;  5FLX c;  3CQZ H;  1VQD A;  1OXT A;  4X62 Q; 
#chains in the Genus database with same CATH topology
 3RMH A;  5FLX E;  4CKB A;  3RN2 A;  1SE2 A;  4P71 A;  4FF2 A;  1NR2 A;  2K50 A;  4GN4 B;  4ZCK A;  2K52 A;  3E9H A;  2RCF A;  3HOU G;  3PGZ A;  4DR5 L;  1R4Q B;  3PO2 H;  2AMC B;  1F2L A;  2A74 C;  3OWF A;  3D3R A;  5C0X G;  1QCB D;  2VY3 A;  1XNR L;  2KCM A;  2F0T A;  4DK3 C;  1TXY A;  1ONL A;  4UAI A;  1ICF B;  4AYB E;  2JA8 H;  1TWG B;  3NSW A;  5GRO A;  1EL0 A;  1B2T A;  4I7A A;  2QEJ C;  4DK6 C;  4X6A H;  4OEL B;  1VF5 C;  2R92 G;  4G7H C;  4LMQ D;  2PNR C;  1TVX A;  1CUK A;  2RA4 A;  2OQK A;  3OOC A;  3M7N A;  4J15 A;  2L9H A;  1LTS D;  5CV7 A;  3HOV H;  1YNX A;  1PV4 A;  3RUZ A;  4OHJ A;  4Y7N H;  3FEW X;  2MPM A;  3FKI H;  1VQB A;  1KDB A;  4ZK9 B;  1B70 B;  2Q2H A;  2PNH A;  5GAE C;  2HHH L;  4C3J H;  2AKW B;  3F2C A;  1PRT F;  1K0R A;  3HP3 A;  3U9O A;  4YY3 Q;  4HIM A;  2PMZ B;  3BDC A;  4JK1 C;  4X64 Q;  1RHP A;  2R3Z A;  2ASB A;  4WJW A;  3MAQ A;  3DUZ A;  4A3J G;  1VQ9 A;  4GZY C;  1VMC A;  2L5T A;  1I4G A;  1PH9 A;  3U4Z A;  4XTC S;  5C0X J;  1S5D D;  2JA6 G;  2A69 D;  4LF7 Q;  3MA2 B;  3GTK B;  4AIM A;  2UUC Q;  1XX8 A;  2LFN A;  3IFD A;  4B9X A;  4LFB L;  4UY8 C;  3M9B A;  2UUB Q;  4DXF A;  4HJ9 A;  1Y8O B;  5E7N A;  1XNQ Q;  3S1Q H;  1EIH A;  3VYU A;  5IOC A;  2VQE Q;  3N6R A;  2VUM B;  4BBS B;  4X62 L;  3G6E A;  3L2P A;  1XPO A;  3PF4 A;  3G6J B;  3EVQ A;  3CF5 A;  4CGY B;  5IP7 H;  4C3J B;  4A3C H;  1VMP A;  1EOV A;  1SBB B;  4GNX A;  1M1K C;  4B3T L;  3ONA B;  4X3U A;  1U4P A;  1I4X A;  3BVM A;  1CQF A;  1FNV A;  3H0G G;  5M5Y H;  4CDD C;  1NJI C;  1YIT A;  4LAA A;  1A0I A;  1GUN A;  4NKL A;  2I0Q A;  2EYM A;  1L0W A;  3H94 A;  1PH8 A;  1ESF A;  1WTO A;  2F0O A;  3BDO A;  1WI5 A;  5IYD H;  2KEN A;  5C4J H;  5BN3 A;  2OT2 A;  3GO5 A;  4DV3 Q;  4DUY L;  1X3E A;  2E75 C;  1DOK A;  4QY7 A;  1AFP A;  4A3I B;  2B2T A;  2ZM6 Q;  2YTY A;  2Z6B A;  4PQX A;  3CCU A;  3J81 i;  2E5L L;  2AUJ D;  1SR3 A;  2A8V A;  5DM7 3;  3SK6 A;  1KRS A;  4DV6 L;  1STE A;  3I55 A;  2G9D A;  2RF4 A;  4BBS H;  1AE3 A;  1R9T H;  4CJ2 C;  1TII D;  1CA5 A;  1HJP A;  2LY7 A;  4JBJ A;  1SNP A;  1E1O A;  5FKA C;  1Y1V B;  1TQO A;  4K6L A;  5LMU L;  3PUW A;  4JI1 Q;  2EJM A;  5KYL A;  3Q22 A;  3J80 i;  1SN8 A;  3SK4 A;  1AE2 A;  3K0Y A;  5K5P A;  3S17 H;  5M3M B;  3MXN B;  3FPU B;  2RHS B;  4BBR B;  4DV5 Q;  5J3B A;  4JC0 A;  2MNA A;  4IOC A;  1SNM A;  3CC4 A;  1TKW B;  1QIL A;  4RGO S;  4P74 A;  4A3K G;  1Q46 A;  1YNJ C;  1WTX A;  4LF6 L;  4FYD A;  4OGQ C;  1GUG A;  4M8A A;  3SDZ A;  4V0B A;  1EYA A;  3SR1 A;  3K58 A;  1XPU A;  3J7A 5;  4OIJ A;  4UHV A;  3GTM B;  2LXJ A;  2KA7 A;  1W6J A;  4YHH Q;  4IO9 A;  4B3R L;  2E2J H;  1DON A;  5C44 H;  5EAY A;  2PZT A;  4HSV A;  3J81 c;  1F9R A;  2XN9 C;  3OW2 A;  5KIX A;  2XRS D;  1YJW A;  4LF5 L;  3UE1 A;  3MFY A;  4AQY L;  5A35 A;  4KV6 A;  3RLF A;  2A6E D;  1V1P A;  2N55 A;  4KN7 C;  1HZA A;  4JI6 Q;  3KFU A;  4RGM A;  3I4N G;  1KHI A;  3CPF A;  3R2I A;  2EPB A;  2NWG A;  2JA9 A;  4BY1 B;  1RTO A;  2OCE A;  2F0I A;  4H7B A;  2HCC A;  4WOR A;  4UPA A;  1MSG A;  3DMU A;  1Z47 A;  5KGU A;  2K5N A;  4UP9 A;  1IL8 A;  1T9H A;  2HD3 A;  4X3S A;  5AFW A;  5GQO A;  1H9J A;  3I4M B;  1NR4 A;  2KVM A;  4KI0 A;  4HMI A;  1WCM B;  2FMC A;  3NBH A;  5JAV A;  5IYB G;  3HGB A;  3P1H A;  5J1Z A;  2I5M X;  2QIL A;  1YI2 A;  1L1O B;  2PMZ E;  1NNX A;  3GTL H;  1QUQ B;  4DV2 Q;  1JOK A;  3F8T A;  5E4W C;  2F0M A;  5EGT A;  3A56 A;  4B3S L;  3R2T A;  1SYF A;  1BBX C;  1N33 L;  4A3I G;  1FVI A;  2NVQ H;  1SMX A;  1D2B A;  5HUR A;  1SE4 A;  2R93 G;  1GOZ A;  3MXU A;  4C3H G;  1V1Q A;  4ZYS A;  4FVM A;  2Z4I A;  5CMD A;  1GUT A;  3QO2 A;  1A3U A;  1QE6 A;  2IW3 A;  2NZ1 D;  4X64 L;  4RAU C;  1ET6 A;  5LMN Q;  4HIK A;  1HNX L;  4Q5V A;  1TWC B;  1VQK A;  1KL9 A;  4A3B H;  1HTL D;  3M4O B;  2NVY H;  3NTI A;  1EY9 A;  3I8Z A;  1DJR D;  1PRT C;  2AQ3 B;  1RF2 D;  3GTP H;  1WVL A;  2CVR A;  1NTG A;  2EY5 A;  2ZXO A;  4JI3 Q;  2A19 A;  2DUD A;  1SNC A;  3OMC A;  1O78 A;  4DPG A;  1X65 A;  4GS3 A;  4IOA A;  1HCZ A;  4LFB Q;  2E2J B;  2J4X A;  3TEH B;  3HOX H;  1EY8 A;  4LF8 L;  3AYH B;  2KCT A;  2ALY B;  1OXV A;  3VYS A;  1HNX Q;  3HOZ H;  2XIW A;  1YHB A;  3QR8 A;  1K3R A;  2VZA A;  4CDE C;  1H9S A;  1K3B C;  4F88 A;  4RCO A;  1R4P B;  2Q2T A;  2RKS A;  5LL6 S;  2B3G A;  1M4V A;  1HXY D;  4P2C B;  4IQZ A;  2XWJ B;  1XPR A;  1B9M A;  2JSO A;  2PI2 A;  2ID0 A;  4AYB G;  3AB9 A;  1LAB A;  2UU9 L;  5I2Y A;  2EXZ A;  2AQ2 B;  1LM0 A;  5I4D A;  3VA5 A;  3KLS A;  3M4O H;  1JOR A;  1I6H H;  2JA7 B;  1NCV A;  4QB4 A;  4JYA L;  3D0F A;  2RBM A;  3EBE A;  1DGS A;  2L4N A;  3I91 A;  4P72 A;  4DV4 L;  4KKU A;  2K28 A;  4GKJ L;  4DF7 A;  3T4A C;  4DNT B;  2IY5 B;  4KK7 A;  4L5Q A;  4JI6 L;  5I6Y A;  4NXN L;  1LLR D;  2B39 A;  1K8M A;  3KBG A;  1EWI A;  3D4R A;  3L7Z C;  3TQY A;  3QOJ A;  5CV5 A;  4K5X A;  3CCE A;  5ISR A;  3CRL C;  1LTI D;  1RD9 D;  3K7A H;  3S2D H;  5E3F A;  4A3J H;  1LTA D;  1SMY C;  1FR3 A;  2AQ1 B;  2DJF C;  1BXT A;  1SRO A;  4C3I G;  2RVL A;  2JXM B;  1LTR D;  1B4O A;  3BZC A;  5DEH A;  3OTO Q;  4RMF A;  1KLG D;  4KHV A;  1BDO A;  5JVG 3;  1IXR A;  1GUS A;  2XGT A;  3HOV G;  1PRT D;  1VQ8 A;  3A8I E;  2Z6K C;  5C4X B;  5ELN A;  2JA7 H;  5M3M G;  1TS4 A;  3CC2 A;  4HSP A;  5FO8 B;  4F8M A;  1BQQ T;  4F7X A;  1IBK L;  5JVH 3;  1HA5 A;  5C3E B;  1DD2 A;  1WCM G;  4NDX A;  3J7Z C;  2Z6K A;  2WAQ E;  3ND9 A;  2IX3 A;  1RTN A;  5T1G A;  4YWK A;  1FNU A;  2VB3 X;  3G71 A;  1T5E A;  1HNZ L;  1LTB D;  2HUG A;  3K80 C;  4GOP A;  1I4Q A;  1XNR Q;  2CW0 C;  3BZK A;  1KC8 C;  2CKZ B;  4FDB A;  1ASZ A;  4LJZ C;  3HOU H;  2L12 A;  1EZ8 A;  3PUV A;  1STG A;  2K5W A;  1XYI A;  4DR7 L;  2O2L D;  1Y1W G;  2B63 B;  4HTH A;  1I4R A;  1OXT A;  3SEB A;  4X66 L;  3T1H L;  1F2Z A;  5M3F B;  1SJE D;  4GOP C;  2XNA C;  3TP8 A;  3ZYY X;  1Q1E A;  4POF A;  1CZW A;  4JI0 Q;  3CPW A;  4IFD G;  4R8N A;  4GNX C;  3WDN A;  3S14 H;  1U4R A;  4J6H A;  3S1R H;  4QQB X;  3NQI A;  1C9O A;  3PMF A;  2WAQ G;  4WJ4 A;  4JI5 L;  3NTK A;  3AFP A;  5CC4 A;  1NE3 A;  4O1N A;  4FO2 A;  1AEX A;  3J7A F;  1BCP C;  5LMU Q;  1NAP A;  3MXN A;  1IKM A;  5C3E H;  4KHZ A;  4R8I A;  1MI2 A;  3ULJ A;  3V96 A;  4C3J G;  2N3S A;  3GTJ B;  2DJG C;  3PUX A;  3BZD B;  4H44 C;  1B8A A;  4A3K H;  3MEH A;  2ZTE A;  3ITP A;  4RG1 A;  4JI0 L;  1Z9F A;  2E2H H;  4U67 3;  1AH9 A;  2BOS A;  5EPL A;  3HOW B;  1N36 Q;  3HOZ G;  2K75 A;  1LT4 D;  4XDX A;  1Y8P B;  3U50 C;  4TVA B;  2OWO A;  3RZD H;  3S1M B;  2D5D A;  5FJ8 G;  4UDU C;  2D2C C;  3HOW G;  1PDQ A;  2WII B;  4BBR G;  1PTO F;  4JBW A;  4UP8 A;  2ZJP A;  1Q3L A;  1RL2 A;  2PYK A;  1MBY A;  5CV6 A;  1PFN A;  3TRE A;  1HR0 Q;  3GTO H;  2QW7 A;  2PZW A;  1GM5 A;  1E7Z A;  1RDP D;  3KYH C;  3FRP B;  1GHJ A;  5M5X B;  3ER0 A;  2VQF Q;  1XJV A;  1V9P A;  3HG9 A;  4CKC A;  1SNO A;  4NXN Q;  5CV9 A;  3TBI B;  5HGQ A;  1UEB A;  1EQQ A;  4NXM Q;  4LFC Q;  3C3L A;  2Q8I B;  2NVT H;  2PCF B;  1YJN A;  1DZ1 A;  1FJG Q;  2EE1 A;  1HZC A;  4BY1 H;  2KOL A;  2OTJ A;  2Z0S A;  2QDL A;  2F4V Q;  1F9S A;  5EPJ A;  3SHL A;  3IRB A;  4OIK A;  1B50 A;  1L1O C;  4C56 C;  1IZ6 A;  5GAH C;  2ZTD A;  1EY4 A;  3PO2 G;  3RLN A;  4C3I H;  4DR7 Q;  2F3W A;  1VCI A;  4DV3 L;  1J9O A;  4IUU A;  1PTO B;  4DK1 A;  4DR6 L;  1J8I A;  3S24 A;  4A3E H;  4XYQ A;  1PYS B;  3NQT A;  4GKK Q;  1K83 B;  2TMP A;  4LF7 L;  1PH2 A;  1TWF H;  1KXL A;  1VQM A;  2EOT A;  1JWS D;  1SYG A;  1VQC A;  2EZV A;  4ZKB B;  1LUZ A;  3EN2 A;  3VR3 A;  1ZEQ X;  2ICE C;  1EWH A;  3N52 A;  5C3E G;  3PV0 A;  4JVZ A;  4IFD J;  1C7Y A;  5IOD A;  2VL6 A;  1JC7 A;  2L11 A;  3S14 B;  1KRT A;  2KJX A;  2B2W A;  3NUC A;  2BA1 A;  5C4X G;  1S5C D;  2YYZ A;  2FHT A;  4N8X 1;  4BBS G;  1QWY A;  2VUM G;  4G4K A;  4XT1 B;  2FIN B;  4JI1 L;  2EY2 A;  5T1I A;  3PCO B;  1BF4 A;  1JOO A;  4ALP A;  2HDM A;  4R1J A;  3TZU A;  5I9P A;  4G7Z C;  3MWY W;  1XMO Q;  5C5L A;  2ZT9 C;  5LL6 X;  1SSO A;  3L9A X;  3HZX A;  1EYC A;  4WJ3 M;  2J0T D;  4LFA Q;  2K5V A;  3OIP A;  3W3A A;  1HQR D;  3SK5 A;  3I73 A;  3S9W A;  2EIF A;  3FMC A;  4JOI C;  5HGT A;  2E8G A;  5JJI A;  2F0E A;  5C44 G;  1KNE A;  2N78 A;  3W1B A;  2VQF L;  1KLU D;  3HOX G;  2I5H A;  1E1T A;  1NSN S;  2ZM6 L;  1MGS A;  2CQA A;  2KED A;  5IP9 G;  1N9W A;  2XWB B;  5CYU A;  4YCU A;  1D5Z C;  3UE0 A;  4OX9 Q;  1F77 A;  1FL0 A;  2MHV A;  1PMR A;  2CQO A;  4IUT A;  5I9O A;  1ENF A;  1O7Y A;  4OXP A;  1ILP A;  2JA7 G;  2N88 A;  2DN8 A;  5EKI A;  4NW2 A;  1J5E Q;  1OXS C;  1G2T A;  4HIO A;  1S3O A;  2F0H A;  4A3F B;  4LF4 Q;  3EFX D;  3K5O A;  5HY6 A;  1F2Y A;  2X69 A;  5K36 H;  4OWT B;  1D5X C;  1D1I A;  1B9N A;  4KKT A;  1VQJ A;  3RD4 A;  1LTG D;  4N9T A;  4ABN A;  5AJ3 Q;  1QZH A;  1Y1V H;  2JP1 A;  1TT2 A;  1UUP A;  1PTO D;  5C4X H;  4A3L G;  2PQA A;  4R4Q A;  4QMG A;  3C46 A;  1CHQ D;  1DOL A;  1YHQ A;  4LF6 Q;  1TWF B;  2E2I H;  3J7A V;  2BH8 A;  3E3X A;  5C4H A;  2IX1 A;  3MXG A;  4Q0F A;  3KF8 B;  1X3Q A;  4EQN A;  2JK8 A;  4QGU A;  1U4L A;  3PIP A;  3FHW A;  5KEE A;  4RGT A;  1F9P A;  3ERS X;  2K5H A;  3KUP A;  4A3G H;  4KJO A;  4JI2 L;  4OON A;  1MJE A;  4BY7 H;  2CH4 W;  5H1S E;  5F2D A;  1ASY A;  4DR3 Q;  4JI5 Q;  3M7G A;  2GA4 B;  1QNU A;  2CWP A;  2RHQ B;  1UAP A;  1T5X D;  2KCN A;  3A54 A;  3PIP 3;  4PV1 C;  4HED A;  1RKN A;  3AEV A;  4DN4 M;  1WCM H;  5IIF A;  2IX0 A;  5M5Y B;  1A6X A;  4K6D A;  4ZRZ A;  2Y0S G;  5CV4 A;  3NBI A;  1G2S A;  1YVC A;  1TWH H;  2MQH A;  4KY5 A;  2WKC A;  3PIO A;  2EYJ A;  4FXG C;  4EQO A;  4DUZ L;  3IL8 A;  4GN3 B;  1G51 A;  2HCI A;  1Y8N B;  3KOJ A;  3TME A;  3PO3 G;  4ID6 A;  3EA6 A;  1W2B A;  1F2M A;  4ZUI A;  2B2V C;  1K9M C;  2EXD A;  3KBX A;  4DAP A;  3L3O C;  1JT8 A;  1SXT A;  3S2H H;  2R7Z H;  1ML0 D;  2KHJ A;  3A5U A;  3HOY G;  3F2U A;  4QF4 A;  3OYY A;  1VQG A;  1ZKO A;  2OQ0 A;  3MHB A;  1VQE A;  1I50 H;  1PTO C;  3NWS A;  4DR1 L;  4NPS A;  1YNN C;  2QCP X;  4JI7 L;  3Q6S A;  2Y0S E;  4TQU S;  1HPC A;  5CV8 A;  1GUW A;  1Q8I A;  1EY5 A;  4XT3 B;  3HOX B;  1NBW A;  2Q2I A;  4KTA A;  4A3E B;  2NN6 G;  2XSC A;  5ELC A;  1HH2 P;  3S1M H;  3PF5 A;  4IFD H;  4IUV A;  4LWC A;  2K14 A;  3AU7 A;  4LF4 L;  1LT6 D;  5I6W A;  4JI2 Q;  5KRU A;  4FXK C;  5G3L F;  3K5L A;  4RKL A;  2X6G A;  4ULL A;  1K8G A;  3HKS A;  5K36 G;  5L37 A;  3FDT A;  5DAU A;  1I5F A;  1I94 L;  1YNJ D;  1G29 1;  3C1F A;  3CU7 A;  1OXU A;  2K5Q A;  5NUC A;  1SNQ A;  5IY0 A;  1ILQ A;  1CK1 A;  4KJN A;  1O7I A;  4CKE A;  5DM6 3;  4MTK A;  4DNR B;  1YEZ A;  1STY A;  2R7Z G;  1KDC A;  5KNC A;  3QIA A;  5M3M H;  1EEI D;  3GP7 A;  1H9K A;  1QVG A;  2G5D A;  4CJ1 B;  4DXG A;  3G48 A;  2WKD A;  3UDF A;  1PVO A;  5JOB A;  1LYL A;  2BA0 A;  2D9U A;  1X56 A;  2UXB Q;  4DAV A;  1EWC A;  3K57 A;  1EOT A;  5COY A;  4R4O A;  3I70 A;  3U4V A;  4HN7 A;  4S3S A;  1QNK A;  4K2K A;  4HJ8 A;  2L0C A;  4C3I B;  1NMG A;  4LFA L;  3HRZ C;  2RDF A;  1KD1 C;  2ZXP A;  4DK0 A;  1SFO B;  1E2Z A;  4J8Q A;  1I3Q B;  4C2M H;  5LMN L;  1AZP A;  1PH5 A;  5CR3 A;  5IGF A;  1Z7T A;  1HNZ Q;  4NB3 A;  1ZYR D;  3QOL A;  3DWA A;  5D65 A;  2KEC A;  1JCK B;  4IJL A;  4PZ7 A;  1J6Q A;  3PIO 3;  1SDF A;  3B6Y A;  2SNS A;  1XMQ L;  1CQV A;  1GKH A;  4MIU A;  3S1R B;  3KF6 A;  4LUO A;  4GN5 A;  3OPO A;  1GUO A;  5D3I B;  3SXH A;  3CCL A;  4A93 H;  2HQE A;  1SMY D;  3NEN A;  3BJU A;  4XQJ A;  5IT9 E;  4YIJ A;  1HUN A;  4DR2 L;  1CKO A;  4EGV A;  3ULL A;  1KAW A;  5BN5 A;  3J7Y W;  2YTX A;  4QIW E;  1ICW A;  1W6K A;  3SGI A;  1VQ4 A;  2D62 A;  1WTV A;  4YWL A;  5FLX c;  3H6M A;  4X62 Q;  1DOM A;  2PZU A;  1XMO L;  1EY6 A;  1PXU A;  3VR4 A;  4KY7 A;  3RN5 A;  5ELB A;  3VR6 A;  2EYF A;  1CKN A;  3JAM L;  1I4H A;  1N34 L;  2PW7 A;  3CCS A;  1E24 A;  1N32 L;  1JJG A;  3CHB D;  4GNX B;  2FJ2 A;  3CD6 A;  3BDL A;  3S1N B;  2IWH A;  1BCP F;  3T16 A;  4BY1 G;  3I2Z A;  1FNW A;  1SYB A;  2KBN A;  3C1E A;  5C0X H;  2I46 A;  3HEJ A;  1UWV A;  2L1B A;  3GTG H;  4R4I A;  4IPD A;  3X3M A;  3I4N H;  4YCW A;  3TP6 A;  3J80 c;  2GVB A;  4L5S A;  1JIC A;  1JR0 D;  1IBM Q;  4DR5 Q;  2XVS A;  1J5E L;  3A7L A;  1N32 Q;  1V8Q A;  1GHK A;  2V4D A;  4C3H B;  2KEE A;  2O4X A;  4OEM B;  1BBW A;  3FVQ A;  4QL5 A;  5JJZ A;  4G57 A;  4O0A A;  2JA6 H;  1PH1 A;  2K5D A;  1IYJ B;  4DV1 Q;  3W5O A;  2HT1 A;  1PTO H;  2WIN B;  4A75 A;  3LWE A;  4XXE A;  1XWE A;  2IHE A;  1Y1W B;  2B63 G;  1EUJ A;  2R92 B;  4YHH L;  3L0O A;  2NN6 I;  3TP5 A;  3NP8 A;  2WB1 G;  5IYB H;  5G3L D;  2FXQ A;  1HZB A;  1KDA A;  2GVA A;  1WTH A;  4JI3 L;  1QJO A;  2EJG C;  2C9O A;  1QB5 D;  4IPH A;  5JPM C;  2UUA L;  1V1O A;  1Q90 A;  2IT1 A;  3C2P A;  1SE8 A;  4IN3 A;  4QUF A;  3U9S A;  1VQN A;  3A8J E;  2L55 A;  3DWP A;  1BKB A;  4DR1 Q;  1JOQ A;  4LF8 Q;  4K2L A;  4DR2 Q;  2RSO A;  3KDF B;  4ZLT F;  1EFI D;  3VA7 A;  4A3G B;  3CRK C;  1NY4 A;  2SEB D;  4HCS A;  3I56 A;  2DY7 A;  1IL2 A;  1Y1V G;  3KJO A;  3IAY A;  1C0A A;  4CBV A;  3HOV B;  1JWM D;  1WFQ A;  2B8G A;  1BO0 A;  3PO2 B;  4JI8 Q;  2NVX B;  3EQL C;  4DA2 A;  4CJ0 B;  1QZG A;  2AWO A;  1PH6 A;  2EJF C;  1AN8 A;  3F1Z A;  3K5M A;  1VQL A;  2UU9 Q;  1HRJ A;  1D1K A;  4MZ9 A;  2IHF A;  4A3E G;  4A3F G;  3CCM A;  4LNQ A;  4HAE A;  4DV4 Q;  2K33 A;  1P16 A;  5GAG C;  3K7A B;  4B3S Q;  1MSH A;  5BR8 Q;  2VS1 A;  4RA8 A;  3JAM i;  1C8C A;  1CKN B;  3S16 B;  2EYH A;  1STN A;  1KNA A;  1HA6 A;  2F03 A;  1C4Q A;  2F0F A;  1UE7 A;  2NUC A;  3J80 L;  3W1G A;  1HFN A;  1BUV T;  4JYA Q;  4XYO A;  1ZXT A;  1QVC A;  3FPP A;  4A3B G;  2RDG A;  3TS0 A;  2E76 C;  3M4Y A;  3GQB A;  5C3W A;  5C44 B;  2H4O A;  1SLJ A;  2WB1 E;  1LT3 D;  3S2D B;  3M4P A;  5M3F H;  3TRZ A;  2SDF A;  3G7L A;  5IP7 G;  1S72 A;  1XTD A;  1JJC B;  4Y7N B;  1OO9 B;  4ODG A;  1EY0 A;  2WFW A;  4XIG S;  2G9H D;  5IGE A;  4IUN A;  5M5W B;  3K0X A;  3R3O A;  5C5M A;  3QG1 A;  3RZO B;  1L1O A;  1X54 A;  1EQR A;  1GVP A;  3D8G A;  1XMQ Q;  1CA6 A;  4PMB A;  1N33 Q;  5GAD C;  1KQS A;  5JJL A;  4RCN A;  2E74 C;  1IBK Q;  4UP7 A;  2ATW A;  2JYO A;  5IGG A;  1VQ6 A;  4RH6 A;  2B63 H;  4AQY Q;  3LGJ A;  4F87 A;  1EQT A;  4Z9C B;  2B2T C;  4HCE A;  4DR4 L;  3V05 A;  4JI4 Q;  1X3F A;  4I7Z C;  3STB C;  1UE1 A;  3S15 H;  1MHW C;  3LWU A;  5IE8 A;  3I4M H;  2EYP A;  1Y69 U;  3RZD B;  3H3V H;  3CCQ A;  1MIU A;  5IYC G;  1UE6 A;  4A3F H;  3KLS X;  3DEO A;  2YU9 B;  3M85 A;  4A3M H;  3SE0 A;  5M9O A;  3CCJ A;  4MHE A;  2IL8 A;  3CP0 A;  1OTC A;  3GTO B;  2B2V A;  2F0G A;  3M3Y H;  2CFM A;  3BVG A;  3H0G B;  3D6C A;  4X65 L;  1OXX K;  3EJI A;  3BU2 A;  1GD7 A;  2AHO B;  3A5Z B;  1KTK A;  2V1C C;  2EYO A;  4OO1 G;  2DY8 A;  2Q2U A;  4DNI A;  4DV7 L;  2NVT B;  2X6L A;  4XQQ A;  1K8A C;  2BDN A;  5LHY 1;  4FF3 A;  3T1H Q;  4BBR H;  1ET9 A;  1HNW L;  1WJJ A;  4OO1 H;  3K59 A;  3U58 A;  2N8N A;  4ZAI A;  2CHB D;  2EY6 A;  1EIY B;  3GTJ H;  2BCO A;  1G6P A;  1SJH D;  3LX0 A;  4ILW A;  1TR5 A;  5D14 A;  3TZD A;  4G7O C;  1LAC A;  4J1M A;  2MJ8 A;  1WTP A;  2E2H B;  3GV3 A;  5CBE E;  5EKL A;  3NPP A;  2A5H A;  3CC7 A;  1H9S B;  2ICI A;  4K5V A;  4DV7 Q;  2R7Z B;  4RWS C;  3GTG B;  3IKJ A;  3IFT A;  4CDC C;  1AZQ A;  4GKJ Q;  3S17 B;  3HOY H;  1TS3 A;  1B53 A;  3KF6 B;  1Q81 C;  2QGQ A;  1JQY D;  4DU9 A;  3KLR A;  4PG3 A;  2A6H C;  4FXD A;  2IPK D;  2E2I B;  2B2W C;  3HOZ B;  2NZH A;  4A3J B;  3ULP A;  2F0L A;  5BR8 L;  5M5X H;  5EJW A;  1UE5 A;  1ZYR C;  2I5L X;  4BXX H;  4KN4 C;  3RZO H;  1IYU A;  1EU3 A;  2K04 A;  1TWH B;  3BYY B;  3J81 j;  5C6A A;  3E5S A;  4CDF C;  3MVV A;  3A7A B;  2M9V A;  4IUR A;  2WV6 D;  2WAQ B;  2VXW A;  3SK8 A;  2K6A A;  1U5K A;  1LV9 A;  4KHP Q;  5TSS A;  3K7U C;  1CTM A;  3QJY A;  1EQV A;  3TN2 A;  1LO5 D;  3OIQ A;  1UEA B;  2HIV A;  4IAL A;  5AJ3 L;  2R7F A;  2K03 A;  1CSP A;  2PW5 A;  3BYT B;  3G4S A;  1DXM A;  2UUC L;  1K8O A;  3HS0 C;  3QB3 A;  4HJ5 A;  2R92 H;  4APV A;  1JB3 A;  1SEB D;  5IYD G;  3I3C A;  5LMN W;  1SE3 A;  1I94 Q;  2UUB L;  1PZJ D;  3DM1 A;  3CW2 C;  2EY1 A;  5JPN C;  4WRD A;  1PZK D;  4A3G G;  3E6Z X;  5E4X A;  3H0G H;  5IWA L;  1TY2 A;  2MO0 A;  1G8Z D;  4MTN A;  1Q82 C;  1A3T A;  1VQA A;  2L15 A;  3NBH B;  4GOP B;  4K8J A;  4A3M G;  3NEL A;  1CFM A;  3E0J A;  2B2U A;  2CCZ A;  2F0S A;  2YTV A;  1K0S A;  2A6E C;  1FGB D;  2NTS A;  3RNU A;  2Y0S B;  4O42 A;  3PQI A;  4ME5 A;  2NVY B;  3CCV A;  3BG3 A;  2R93 B;  1BVS A;  1B44 D;  4P73 A;  3GTL B;  1P8L A;  4C1N I;  2AUK A;  2Q8R E;  4FP5 D;  1H9R A;  4LW1 A;  1QUQ A;  4MN3 A;  4DUY Q;  2AWN A;  3PUZ A;  3GTK H;  4A93 G;  3MC0 B;  1F9Q A;  3MFG A;  5FLM G;  3PUY A;  1BCP D;  4NXM L;  4BS9 A;  2Z9H A;  1M90 C;  1E3P A;  2F0N A;  5J22 A;  3T53 B;  4V19 0;  2F0U A;  3OMG A;  4ZKC B;  1YZ6 A;  2J7Z A;  2WAC A;  3NTH A;  1X32 A;  3VYT A;  4DKA C;  2A68 D;  1SRU A;  5C4J B;  1Q7Y C;  2ZJR A;  3KDF A;  4L5R C;  4IFD I;  2JQO A;  2NB0 A;  1NUC A;  1ROD A;  3CME A;  3UDI A;  1L0X B;  3X3N A;  4DV5 L;  2E2D C;  4H02 A;  4R4C A;  4X3K A;  1JMC A;  3URY A;  3NXW A;  4QJF A;  3VR2 A;  4HMJ A;  3GTQ B;  2O5J C;  5IP9 H;  2M2L A;  3GD7 A;  4B3M L;  3JAM c;  3KLW A;  1EU4 A;  4H0L C;  2A1A A;  5JEA H;  3I4O A;  2JA5 G;  4DR6 Q;  1SAP A;  3AMU A;  1ENA A;  3BVZ A;  5KNB A;  2QEX A;  4JBK A;  5FLX L;  1V43 A;  2H1E A;  5ELO A;  2F3I A;  4OO1 I;  2UXC L;  1C48 A;  1Q1B A;  5IGD A;  2QA4 A;  4RFB A;  2FFK B;  2FMM A;  4B9W A;  4PMC A;  2D0O A;  2RCN A;  2KUM A;  3OHX C;  2A68 C;  3T56 B;  2JA8 B;  2JE6 I;  4JI4 L;  3S16 H;  2F0J A;  1TS2 A;  4DUZ Q;  3KJP A;  3NE5 B;  1CSQ A;  3CKI B;  3DLL A;  5I2X A;  2KHS A;  2BE5 C;  2H5X A;  1E2V A;  1MKH A;  4EVO A;  5COR A;  4R9W A;  5FK9 C;  1I4P A;  1R9T B;  4BA2 I;  3CMA A;  2F3V A;  1VS0 A;  4GKK L;  3Q23 A;  5EPK A;  2B2Y A;  4X65 Q;  3CQZ B;  1PFM A;  5FO9 B;  4DAY B;  2MP1 A;  1QG7 A;  4TSS A;  5EKK A;  1O7L A;  2A69 C;  4QIW B;  2PPB C;  1B3A A;  5IT9 L;  1CI3 M;  1K28 A;  1VQ5 A;  2TSS A;  4GLV B;  2R93 H;  1H9M A;  4M1U B;  4K5W A;  4A3L H;  1HHV A;  4Y52 H;  2SNM A;  2C5C A;  5IWA Q;  4DFA A;  3S1N H;  2UXB L;  4WFN 3;  3A74 A;  4DGZ A;  1IBL Q;  1WOC A;  4RGN A;  4OWX B;  1XXG A;  1LT5 D;  1L2F A;  3CAM A;  2K7V A;  3JC6 6;  4LK1 C;  4EQ5 A;  2OXP A;  3GDE A;  3JAM E;  2B2U C;  1A2T A;  2B8F A;  4RHR A;  3HOU B;  1Y1W H;  3T1Y L;  4LF9 Q;  1JE5 A;  2ZJQ A;  4IZ8 A;  1STH A;  5D3D A;  1K83 H;  4ZQ3 A;  2ENB A;  3ICE A;  4ZUJ A;  1XNQ L;  1EFW A;  1D6E C;  3ERQ A;  1X55 A;  3A55 A;  4FF4 A;  4EQP A;  1Z6H A;  2Z8L A;  4E6I A;  1D8L A;  2JEB I;  2K32 A;  1S4Z A;  3D4D A;  3CCR A;  1WD1 A;  1GO3 E;  1SND A;  1CZG A;  1PA6 A;  1A62 A;  4KY6 A;  4LUZ A;  3ZJY C;  5C4Z A;  3MXP A;  1YNN D;  5IYC H;  1E0B A;  2NZO A;  2DGY A;  2EYL A;  3SVM A;  1JB7 A;  4LUV A;  1HR0 W;  1HFG A;  1JWU D;  4YY3 L;  4JI7 Q;  2NVX H;  2QKI C;  4DR4 Q;  1TS5 A;  1X3P A;  1PHJ A;  1U9R A;  5J39 A;  4BWG B;  3STB D;  5FJ8 H;  3OTO L;  4JW0 A;  3HOW H;  3FKI B;  1I3Q H;  1M8A A;  4N8F A;  4C2M B;  1JE4 A;  4JOI A;  3A8K E;  3CXC A;  4B3R Q;  3ERO A;  3MEF A;  1U4M A;  1TWC H;  4DR3 L;  3I4M G;  2HQL A;  1UNS A;  1STB A;  3H15 A;  2VUM H;  1D7Q A;  1HZ9 A;  2GN5 A;  4KD3 A;  2A73 B;  4DV0 Q;  4KD4 A;  3VYR A;  1FYC A;  3AFQ A;  4LF5 Q;  4HJA A;  1IW7 C;  1PH4 A;  2ZTC A;  1G6Z A;  1FGU A;  5FLM H;  4OWW B;  3PO3 B;  4JCV E;  4QCL A;  2ZXR A;  1O80 A;  3DEP A;  1A15 A;  2K05 A;  3RLO A;  1YIJ A;  1HNW Q;  1SYE A;  4AYB B;  1AW7 A;  1Y14 B;  2K4K A;  2QDB A;  4JG2 A;  4DAY A;  3QWN A;  1BNZ A;  1WTR A;  2ES2 A;  4X66 Q;  1X3G A;  1CT1 D;  3RR5 A;  2NTT A;  2XRQ D;  3P7J A;  4XQN A;  4H13 C;  2F0W A;  3S15 B;  3GTP B;  2RSN A;  3WOE A;  3E9I A;  1IYV A;  1Q8K A;  3F2B A;  2Q8T A;  5FO7 B;  4TKO B;  3KF8 A;  1HQM C;  1SFO H;  2OEO A;  4HID A;  2R61 A;  1CKM A;  1EY7 A;  1MJC A;  1I6H B;  3HKZ E;  5CBA E;  5IT9 c;  3P75 A;  3V2T A;  1S40 A;  2XTI A;  2A6H D;  3LNN A;  4R4T A;  4C1N K;  2E5L Q;  4MNO A;  4A4I A;  3EIV A;  5JEA J;  4JBM A;  1PRT B;  1PFB A;  1L0Y B;  4RHS A;  2N49 A;  3P20 A;  1IBM L;  1N36 L;  3GTQ H;  4A3D H;  1KAB A;  2KCC A;  2MUY A;  2F0D A;  1X6O A;  2D0P A;  2RQX A;  3D6W A;  3TSS A;  3DM3 A;  2LKV A;  2PI2 E;  2CH4 A;  1S5B D;  4L6T B;  2WP8 J;  1VF7 A;  4K0K L;  4FNF A;  1CM9 A;  5KYI A;  2EVB A;  4A3M B;  2PQE A;  4KHP L;  1HUM A;  4C3H H;  5A2Q E;  4GLA C;  4B08 A;  3GV6 A;  5JJK A;  1ENC A;  3WWV A;  2WB1 B;  1BR9 A;  1U0L A;  1LTT D;  1H95 A;  2F0K A;  4EX5 A;  3NHH A;  4K14 A;  4N9P A;  1G91 A;  1Q86 C;  2B29 A;  2KQ3 A;  5DLQ E;  1QOH A;  4BXX G;  3NWT A;  4PMW A;  1PH7 A;  2UXD Q;  3M3Y B;  1KAA A;  3MZ5 A;  4TRD A;  3TS2 A;  2NVQ B;  4IUQ A;  5FOB B;  3FKI G;  3PO3 H;  3K81 C;  2MFI A;  2BE5 D;  1K73 C;  2JA6 B;  4L5T A;  1VQ7 A;  1IHZ A;  2YV5 A;  1EIG A;  1EYD A;  1WTQ A;  3S1Q B;  2BH2 A;  2K1B A;  2F52 A;  2RDH A;  2VW9 A;  1DCZ A;  3AQQ A;  3GTM H;  1AP0 A;  4A3B B;  2MO1 A;  3H3V I;  3S2H B;  2SOB A;  1SYC A;  3OW7 A;  2DNC A;  1N8R C;  3FP9 A;  4B3M Q;  1BOS A;  2O5I C;  4BA1 I;  3F2D A;  1X9N A;  1B7Y B;  1XTC D;  1PLF A;  3BS1 A;  4A3C G;  3WOF A;  4L63 B;  4DV1 L;  4U68 A;  1RIP A;  1I50 B;  4A3K B;  3VR5 A;  3I7F A;  2LSS A;  2JEA I;  1GJX A;  1O7Z A;  3KK7 A;  1RJT A;  3J81 E;  3HOY B;  4HJ7 A;  1VDZ A;  3K5N A;  3I4L A;  3PSI A;  4KKS A;  2F0P A;  2HIX A;  2JA8 G;  2F4I A;  4O2D A;  3T1Y Q;  1YBY A;  3O13 A;  4IPG A;  1ESR A;  4IUP A;  4PNY A;  3E0E A;  3K8A A;  5JEA G;  2JA5 H;  1PZI D;  3OSO A;  1YHA A;  2PQA B;  4A3I H;  1B1Z A;  3T13 A;  3W2D A;  3M4Q A;  1TY0 A;  4IJH A;  1VQP A;  2CWA A;  1TU2 B;  4RKB A;  1TWA H;  4DV2 L;  4BY7 G;  2Z1C A;  2VQE L;  3H09 A;  1IKL A;  1QVF A;  3J80 E;  3H3V C;  2I07 B;  1WD0 A;  4JI8 L;  5EBC A;  4ME3 A;  1IW7 D;  4AH6 A;  3I72 A;  2F4V L;  2OTL A;  3A0J A;  2EDG A;  3T51 B;  3DXJ C;  4A76 A;  1A3V A;  1MD2 D;  1PYB A;  3D31 A;  5IGB A;  4KLK A;  3Q24 A;  2F0Q A;  1SYD A;  1EZ6 A;  1VQH A;  3I90 A;  4BY7 B;  2M00 A;  2B2Y C;  2QF7 A;  1IBL L;  4A93 B;  5EQ0 A;  2VNU D;  2LXK A;  2R7D A;  2PO4 A;  1DM0 B;  1PH3 A;  4GLX A;  4PZ6 A;  3DHQ A;  1RCV D;  4YCV A;  5KND A;  5ELD A;  1LTL A;  4DV0 L;  5A2Q L;  1BCP B;  5ELE A;  2NBF A;  4LF9 L;  4JV5 L;  1HTP A;  1WYD A;  4KMU C;  4PZ8 A;  1EYG A;  1BBU A;  4QUC A;  2R6G A;  5E1F A;  2LS0 1;  2KHI A;  5M5W H;  1N34 Q;  4OL7 A;  4DV6 Q;  3OWE B;  1TWG H;  3NK9 A;  1FD7 D;  5BN4 A;  2LMC B;  3UDX A;  1B3Q A;  1E2W A;  2OF1 A;  1WTW A;  4A3D G;  2DNE A;  5ELF A;  1I6V C;  1S5E D;  2F0V A;  1VQI A;  1V1P B;  3HKZ B;  4I65 A;  2JA5 B;  1VQF A;  4NMZ A;  4P75 A;  1D5M C;  1EIF A;  1E22 A;  4NP5 A;  3ND8 A;  4X3T A;  1FJG L;  1CHP D;  2P5Z X;  1STA A;  4JV5 Q;  5C0X I;  3Q0A A;  2UXC Q;  3VDY A;  1A2U A;  1DYQ A;  1W3S A;  2F1M A;  1A8V A;  4L8J A;  3NEM A;  1A63 A;  2K01 A;  1VQO A;  1Q12 A;  4HR7 B;  2BDO A;  3MTS A;  1NMF A;  2IJ0 A;  3HFZ B;  3UI2 A;  3H91 A;  3I4N B;  4CHT B;  3R93 A;  2JN4 A;  3TP7 A;  4FF1 A;  1PFS A;  1GXD C;  2HHH Q;  1YJ9 A;  1PYW D;  5CGK A;  3DWQ A;  1II3 A;  1HR0 L;  2NYZ D;  2VB2 X;  4K0K Q;  1JJ2 A;  4DAM A;  1EEF D;  5DNF A;  5IGC A;  4OX9 L;  4JPB W;  4B3T Q;  3K6O A;  2CW0 D;  1TWA B;  5M3F G;  4LFC L;  2NN6 H;  3R8B A;  4POG A;  2C35 B;  4YWM A;  3J81 L;  3Q8D A;  2JJQ A;  1KIX A;  5C3X A;  4IPC A;  3UDG A;  2YU9 H;  2UUA Q;  2EQS A;  2MGS A;  3TDQ A;  4K8I A;  3D4W A;  3HKZ G;  2HDL A;  5EBD A;  1S5F D;  2UXD L;  4A3D B;  2Z4H A;  3CQZ H;  1VQD A; 
#chains in the Genus database with same CATH homology
 3T1H L;  4GOP C;  1XMO L;  4BA2 I;  3RN2 A;  3CMA A;  1VS0 A;  3RN5 A;  4P71 A;  1Q1E A;  4POF A;  4GKK L;  4JI0 Q;  2K50 A;  4GN4 B;  1CKN A;  3CPW A;  2K52 A;  3E9H A;  4X65 Q;  3HOU G;  3PGZ A;  4IFD G;  4DR5 L;  4DAY B;  3PO2 H;  1N34 L;  2AMC B;  3CCS A;  3S14 H;  4GNX C;  1E24 A;  1N32 L;  3S1R H;  1JJG A;  5C0X G;  4GNX B;  4QQB X;  3CD6 A;  2VY3 A;  1C9O A;  1XNR L;  2WAQ G;  2KCM A;  4WJ4 A;  4JI5 L;  1VQ5 A;  3AFP A;  4DK3 C;  1NE3 A;  4GLV B;  1TXY A;  2R93 H;  4BY1 G;  3I2Z A;  5LMU Q;  4AYB E;  4A3L H;  2KBN A;  5C3E H;  2JA8 H;  5GRO A;  4Y52 H;  4KHZ A;  1UWV A;  5IWA Q;  3ULJ A;  3GTG H;  4DK6 C;  4X6A H;  2N3S A;  3S1N H;  4R4I A;  2R92 G;  3PUX A;  2UXB L;  3A74 A;  1IBL Q;  1B8A A;  4A3K H;  1WOC A;  4IPD A;  1CUK A;  4OWX B;  2OQK A;  3I4N H;  3M7N A;  2ZTE A;  4RG1 A;  4YCW A;  1L2F A;  3CAM A;  4J15 A;  4JI0 L;  1Z9F A;  3J80 c;  2E2H H;  2GVB A;  3JC6 6;  4EQ5 A;  4L5S A;  3GDE A;  1IBM Q;  1AH9 A;  1N36 Q;  3HOZ G;  2K75 A;  3HOV H;  4DR5 Q;  1YNX A;  1J5E L;  3U50 C;  4TVA B;  1Y1W H;  1PV4 A;  2OWO A;  3T1Y L;  3RZD H;  4LF9 Q;  1JE5 A;  4Y7N H;  2ZJQ A;  1N32 Q;  1BBW A;  4QL5 A;  3FKI H;  4O0A A;  1VQB A;  2JA6 H;  5FJ8 G;  1PH1 A;  1B70 B;  2Q2H A;  1IYJ B;  2PNH A;  4BBR G;  5GAE C;  4JBW A;  4DV1 Q;  3W5O A;  2HHH L;  2HT1 A;  1K83 H;  2AKW B;  4C3J H;  3F2C A;  1K0R A;  4UP8 A;  4YY3 Q;  2ZJP A;  4HIM A;  1RL2 A;  4A75 A;  3ICE A;  2IHE A;  1XNQ L;  4X64 Q;  1EFW A;  2B63 G;  2ASB A;  4A3J G;  3TRE A;  1HR0 Q;  1VQ9 A;  1EUJ A;  1X55 A;  3GTO H;  4YHH L;  1GM5 A;  3L0O A;  1E7Z A;  2NN6 I;  3KYH C;  1XJV A;  3ER0 A;  2VQF Q;  1V9P A;  2WB1 G;  5IYB H;  1D8L A;  4NXN Q;  2JEB I;  2FXQ A;  5HGQ A;  3CCR A;  1PH9 A;  1UEB A;  1HZB A;  1GO3 E;  2GVA A;  3U4Z A;  1EQQ A;  4XTC S;  4LFC Q;  4NXM Q;  5C0X J;  4JI3 L;  2NVT H;  1PA6 A;  1A62 A;  2JA6 G;  1YJN A;  3ZJY C;  4LUZ A;  4LF7 Q;  1FJG Q;  1HZC A;  4IPH A;  4AIM A;  2UUA L;  2IT1 A;  1SE8 A;  5IYC H;  4BY1 H;  2UUC Q;  2NZO A;  2OTJ A;  2DGY A;  2Z0S A;  1JB7 A;  1VQN A;  4LUV A;  2F4V Q;  4LFB L;  1HR0 W;  3IRB A;  1BKB A;  4UY8 C;  3M9B A;  4DR1 Q;  2UUB Q;  4YY3 L;  4HJ9 A;  4LF8 Q;  4DR2 Q;  5E7N A;  4JI7 Q;  2NVX H;  1L1O C;  1XNQ Q;  1IZ6 A;  3KDF B;  5GAH C;  2ZTD A;  3S1Q H;  4DR4 Q;  1NY4 A;  1PHJ A;  3I56 A;  3PO2 G;  2VQE Q;  1IL2 A;  3RLN A;  1Y1V G;  3KJO A;  4C3I H;  3STB D;  5FJ8 H;  3OTO L;  3HOW H;  4DR7 Q;  1C0A A;  1VCI A;  4DV3 L;  1WFQ A;  4X62 L;  4JI8 Q;  3G6E A;  3L2P A;  4DR6 L;  3S17 H;  3S24 A;  1I3Q H;  1XPO A;  4A3E H;  1QZG A;  4JOI A;  3PF4 A;  3CXC A;  4B3R Q;  3MEF A;  2AWO A;  1PYS B;  3CF5 A;  1PH6 A;  1TWC H;  4GKK Q;  4DR3 L;  3I4M G;  5IP7 H;  4A3C H;  2HQL A;  4LF7 L;  1EOV A;  1M1K C;  3H15 A;  4GNX A;  4B3T L;  1PH2 A;  2VUM H;  1D7Q A;  1HZ9 A;  1TWF H;  2GN5 A;  1KXL A;  3F1Z A;  4DV0 Q;  1VQM A;  1VQL A;  2UU9 Q;  1VQC A;  3AFQ A;  3H0G G;  5M5Y H;  1NJI C;  4LF5 Q;  4HJA A;  1LUZ A;  1YIT A;  2ZTC A;  4MZ9 A;  1FGU A;  3EN2 A;  1PH4 A;  1A0I A;  5FLM H;  2I0Q A;  2IHF A;  5C3E G;  4A3E G;  3PV0 A;  3CCM A;  1L0W A;  4A3F G;  1C7Y A;  1PH8 A;  4LNQ A;  4OWW B;  4IFD J;  2VL6 A;  4JCV E;  4DV4 Q;  1WI5 A;  1KRT A;  5IYD H;  1P16 A;  2KEN A;  5GAG C;  5C4J H;  3RLO A;  3GO5 A;  4DV3 Q;  2BA1 A;  4DUY L;  4B3S Q;  5C4X G;  2YYZ A;  4BBS G;  5BR8 Q;  2VS1 A;  1YIJ A;  2VUM G;  1X3E A;  1HNW Q;  3JAM i;  4QY7 A;  1CKN B;  4JI1 L;  2ZM6 Q;  1Y14 B;  2YTY A;  3PCO B;  2K4K A;  4JG2 A;  3CCU A;  2ES2 A;  3J81 i;  4ALP A;  2E5L L;  1UE7 A;  4X66 Q;  1X3G A;  1SR3 A;  4R1J A;  2A8V A;  3W1G A;  3RR5 A;  1XMO Q;  4JYA Q;  1KRS A;  1QVC A;  4DV6 L;  4A3B G;  3TS0 A;  3I55 A;  4WJ3 M;  3E9I A;  2RF4 A;  1Q8K A;  4LFA Q;  2K5V A;  4BBS H;  1SLJ A;  2WB1 E;  1AE3 A;  3M4P A;  5M3F H;  1R9T H;  3F2B A;  3TRZ A;  2EIF A;  5IP7 G;  1S72 A;  4JOI C;  1HJP A;  1XTD A;  1SFO H;  1JJC B;  4HID A;  2E8G A;  4JBJ A;  5JJI A;  1CKM A;  1MJC A;  1E1O A;  5C44 G;  2N78 A;  3HKZ E;  2WFW A;  3W1B A;  4XIG S;  5IT9 c;  2VQF L;  3HOX G;  2I5H A;  3K0X A;  5LMU L;  1E1T A;  1S40 A;  2XTI A;  3PUW A;  4JI1 Q;  2ZM6 L;  5IP9 G;  1N9W A;  4R4T A;  1L1O A;  3J80 i;  1SN8 A;  1X54 A;  1AE2 A;  4MNO A;  2E5L Q;  4A4I A;  3EIV A;  1EQR A;  1GVP A;  4YCU A;  3UE0 A;  3MXN B;  5JEA J;  1XMQ Q;  1FL0 A;  4OX9 Q;  2CQO A;  4JBM A;  1N33 Q;  2RHS B;  5GAD C;  4DV5 Q;  1KQS A;  5JJL A;  4OXP A;  5J3B A;  4UP7 A;  4JC0 A;  2MNA A;  1IBK Q;  2JA7 G;  2N49 A;  4IOC A;  1IBM L;  1N36 L;  2ATW A;  1VQ6 A;  3GTQ H;  3CC4 A;  4AQY Q;  2B63 H;  4A3D H;  3LGJ A;  1J5E Q;  4P74 A;  4A3K G;  1OXS C;  1X6O A;  1Q46 A;  2D0P A;  3DM3 A;  4LF6 L;  4DR4 L;  2PI2 E;  4JI4 Q;  1X3F A;  4HIO A;  1S3O A;  2WP8 J;  4K0K L;  3STB C;  1UE1 A;  3S15 H;  4LF4 Q;  5HY6 A;  5IE8 A;  3I4M H;  1XPU A;  3J7A 5;  4KHP L;  4OWT B;  4C3H H;  3H3V H;  1VQJ A;  2LXJ A;  3CCQ A;  4GLA C;  4YHH Q;  1MIU A;  4IO9 A;  5IYC G;  2E2J H;  4B3R L;  5JJK A;  5C44 H;  1UE6 A;  5EAY A;  4A3F H;  3J81 c;  5AJ3 Q;  3M85 A;  4A3M H;  3WWV A;  1QZH A;  3OW2 A;  1Y1V H;  1U0L A;  3CCJ A;  1OTC A;  3CP0 A;  1YJW A;  4LF5 L;  1H95 A;  4EX5 A;  3UE1 A;  1Q86 C;  3M3Y H;  2B29 A;  2CFM A;  4A3L G;  5C4X H;  2PQA A;  4R4Q A;  4AQY L;  5DLQ E;  4X65 L;  3RLF A;  1OXX K;  3BU2 A;  1GD7 A;  1YHQ A;  4LF6 Q;  2AHO B;  2E2I H;  3A5Z B;  3KFU A;  1HZA A;  4JI6 Q;  2BH8 A;  4BXX G;  2V1C C;  4OO1 G;  2IX1 A;  4PMW A;  1PH7 A;  4DNI A;  4DV7 L;  2Q2U A;  3I4N G;  1KHI A;  2UXD Q;  1K8A C;  3KF8 B;  3T1H Q;  3CPF A;  2JK8 A;  4BBR H;  4QGU A;  3TS2 A;  1HNW L;  1WJJ A;  2JA9 A;  3FKI G;  3PIP A;  3PO3 H;  3FHW A;  3K81 C;  2MFI A;  3ERS X;  1K73 C;  2K5H A;  4L5T A;  2OCE A;  1VQ7 A;  3U58 A;  2YV5 A;  2N8N A;  1EIY B;  4A3G H;  3GTJ H;  4JI2 L;  4OON A;  1MJE A;  2BH2 A;  4BY7 H;  4UPA A;  1Z47 A;  2F52 A;  2K5N A;  5H1S E;  2VW9 A;  4UP9 A;  1ASY A;  1G6P A;  3AQQ A;  1T9H A;  3GTM H;  4DR3 Q;  2MO1 A;  5GQO A;  3H3V I;  4JI5 Q;  4KI0 A;  1N8R C;  3FP9 A;  4B3M Q;  3CC7 A;  2CWP A;  2RHQ B;  4BA1 I;  3F2D A;  1X9N A;  1B7Y B;  4DV7 Q;  4A3C G;  5IYB G;  4GKJ Q;  3HOY H;  4DV1 L;  1RIP A;  2I5M X;  1YI2 A;  3KF6 B;  1Q81 C;  1L1O B;  2PMZ E;  2QGQ A;  3AEV A;  1WCM H;  3GTL H;  4PG3 A;  1QUQ B;  2IX0 A;  3I7F A;  2LSS A;  4DV2 Q;  2JEA I;  2Y0S G;  3F8T A;  2NZH A;  4B3S L;  3ULP A;  3HOW G;  4HJ7 A;  1YVC A;  5BR8 L;  1TWH H;  2MQH A;  5M5X H;  3PSI A;  2HIX A;  1N33 L;  2JA8 G;  1UE5 A;  4O2D A;  1FVI A;  2I5L X;  3T1Y Q;  1SMX A;  1YBY A;  4A3I G;  2NVQ H;  4IPG A;  4BXX H;  3PIO A;  2R93 G;  3RZO H;  3E0E A;  1V1Q A;  3K8A A;  5JEA G;  2JA5 H;  4DUZ L;  4GN3 B;  3J81 j;  1G51 A;  1YHA A;  2PQA B;  3KOJ A;  4X64 L;  4A3I H;  5LMN Q;  3PO3 G;  4HIK A;  4L5R C;  1HNX L;  3M4Q A;  1VQK A;  4IJH A;  1KL9 A;  1VQP A;  1W2B A;  2CWA A;  4A3B H;  2NVY H;  1K9M C;  2EXD A;  1U5K A;  4KHP Q;  3K7U C;  1TWA H;  4DV2 L;  4BY7 G;  3GTP H;  1JT8 A;  2VQE L;  3S2H H;  1NTG A;  1QVF A;  4JI3 Q;  2R7Z H;  2KHJ A;  2A19 A;  3A5U A;  3HOY G;  3OYY A;  2DUD A;  2HIV A;  1VQG A;  5AJ3 L;  2R7F A;  4DPG A;  1CSP A;  1X65 A;  4GS3 A;  4JI8 L;  4IOA A;  2OQ0 A;  3G4S A;  2UUC L;  4ME3 A;  4AH6 A;  4HJ5 A;  4APV A;  1VQE A;  2R92 H;  2F4V L;  4LFB Q;  5IYD G;  1I50 H;  5LMN W;  3TEH B;  3A0J A;  1I94 Q;  3HOX H;  4DR1 L;  2OTL A;  4NPS A;  2UUB L;  4LF8 L;  3AYH B;  3CW2 C;  4JI7 L;  2KCT A;  2ALY B;  2Y0S E;  4A76 A;  1OXV A;  4TQU S;  4A3G G;  1HNX Q;  3HOZ H;  1YHB A;  1PYB A;  1K3R A;  2VZA A;  3D31 A;  4KLK A;  3H0G H;  5IWA L;  2MO0 A;  4MTN A;  1NBW A;  2Q2I A;  1Q82 C;  1VQA A;  2L15 A;  3NBH B;  1VQH A;  2NN6 G;  2Q2T A;  4GOP B;  1IBL L;  1HH2 P;  3S1M H;  2VNU D;  3PF5 A;  2LXK A;  2R7D A;  2B3G A;  4A3M G;  1PH3 A;  3NEL A;  4LWC A;  4GLX A;  2K14 A;  4PZ6 A;  4LF4 L;  4YCV A;  2CCZ A;  1XPR A;  2YTV A;  1LTL A;  4JI2 Q;  4DV0 L;  2PI2 A;  2ID0 A;  4AYB G;  2UU9 L;  4LF9 L;  1K8G A;  3HKS A;  1LM0 A;  1WYD A;  3RNU A;  4JV5 L;  5K36 G;  4PZ8 A;  1I5F A;  1EYG A;  1BBU A;  1I94 L;  3M4O H;  1G29 1;  1I6H H;  1OXU A;  2R6G A;  3CCV A;  2KHI A;  1BVS A;  5IY0 A;  5M5W H;  3D0F A;  4P73 A;  1N34 Q;  1P8L A;  3EBE A;  4JYA L;  1O7I A;  4DV6 Q;  1DGS A;  1TWG H;  4DV4 L;  4P72 A;  1YEZ A;  2R7Z G;  4LW1 A;  4GKJ L;  1QUQ A;  3UDX A;  4DUY Q;  5M3M H;  4A3D G;  2IY5 B;  2AWN A;  3PUZ A;  4L5Q A;  3GTK H;  4A93 G;  4JI6 L;  1QVG A;  4NXN L;  5FLM G;  3PUY A;  1VQI A;  3G48 A;  4NXM L;  1EWI A;  3UDF A;  1PVO A;  1LYL A;  2BA0 A;  1VQF A;  4P75 A;  1EIF A;  1E22 A;  3L7Z C;  1M90 C;  1E3P A;  1X56 A;  3TQY A;  2UXB Q;  1FJG L;  4R4O A;  3CCE A;  4JV5 Q;  3U4V A;  5C0X I;  2UXC Q;  1YZ6 A;  4DKA C;  3VDY A;  1SRU A;  1W3S A;  3K7A H;  2ZJR A;  3KDF A;  4HJ8 A;  1Q7Y C;  1NMG A;  1A8V A;  4LFA L;  4A3J H;  3S2D H;  3NEM A;  4IFD I;  1A63 A;  2JQO A;  1VQO A;  1KD1 C;  1Q12 A;  3CME A;  3UDI A;  1NMF A;  1SRO A;  3HFZ B;  4H02 A;  4DV5 L;  4C2M H;  5LMN L;  4R4C A;  1PH5 A;  1JMC A;  1HNZ Q;  3BZC A;  4QJF A;  3OTO Q;  4NB3 A;  1PFS A;  4RMF A;  2HHH Q;  5IP9 H;  3GD7 A;  4B3M L;  4X66 L;  3JAM c;  3KLW A;  1YJ9 A;  1IXR A;  2XGT A;  3HOV G;  2A1A A;  2JA5 G;  3I4O A;  4IJL A;  4PZ7 A;  1HR0 L;  1VQ8 A;  4DR6 Q;  1J6Q A;  4K0K Q;  2Z6K C;  3B6Y A;  1JJ2 A;  5ELN A;  2JA7 H;  4DAM A;  5M3M G;  4OX9 L;  1XMQ L;  2QEX A;  4JBK A;  4B3T Q;  1V43 A;  1GKH A;  5ELO A;  2F3I A;  4OO1 I;  2UXC L;  1Q1B A;  2QA4 A;  3KF6 A;  3CC2 A;  5M3F G;  4LFC L;  4LUO A;  1IBK L;  4POG A;  2C35 B;  4YWM A;  2D0O A;  2RCN A;  3Q8D A;  2JJQ A;  4GN5 A;  1KIX A;  1WCM G;  3J7Z C;  2Z6K A;  2WAQ E;  4IPC A;  3UDG A;  2YU9 H;  2UUA Q;  4YWK A;  2EQS A;  3CCL A;  4A93 H;  2JE6 I;  4JI4 L;  3S16 H;  3G71 A;  3NEN A;  1HNZ L;  3K80 C;  4DUZ Q;  3BJU A;  3KJP A;  4GOP A;  1CSQ A;  3DLL A;  3HKZ G;  1XNR Q;  3BZK A;  4DR2 L;  2CKZ B;  1CKO A;  4FDB A;  1KC8 C;  3ULL A;  1ASZ A;  1KAW A;  2YTX A;  4QIW E;  3HOU H;  3SGI A;  3PUV A;  1VQ4 A;  2D62 A;  2H5X A;  2UXD L;  4DR7 L;  1MKH A;  4YWL A;  1Y1W G;  5FLX c;  3CQZ H;  1VQD A;  1OXT A;  4X62 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...