5FLMH

Structure of transcribing mammalian rna polymerase ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
148
structure length
148
Chain Sequence
AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5flmH01
1X3EA 1FVIA 3RLNA 1XPRA 1SE8A 2HIVA 4OWXB 2YTVA 5C3EH 2UUCL 5JEAJ 5ELNA 1IZ6A 3CCJA 1HNXQ 3CC2A 1N32Q 1GO3E 4X64Q 1IXRA 2I0QA 2IX1A 2IY5B 4C2MH 2VQFQ 4BBSG 2ASBA 2AHOB 4LF7Q 4X66Q 1JJGA 3F1ZA 4OWTB 4DR5L 4AQYL 1W2BA 4OO1I 4A3KG 1QZGA 4A3JG 1H95A 1QVFA 1OXTA 4LUZA 2CKZB 4PMWA 1VQOA 1YJWA 1B70B 1HZ9A 4KHPL 4WJ3M 1SLJA 2VQEL 2ES2A 2VS1A 1VQGA 4DUYQ 3GDEA 4DV3L 1PH8A 1IBMQ 4LF9L 1G51A 3HOVG 4DV2L 3OW2A 2UXBQ 2XTIA 5HY6A 1YIJA 1N8RC 2UUAQ 1CKOA 3CQZH 2K5HA 1L2FA 2UUBQ 3ULJA 3D0FA 4A3DG 1E22A 3MXNB 2KCTA 1EQQA 3KYHC 3TEHB 3I56A 3PIPA 4L5QA 1VQIA 4YHHL 2NN6I 4OX9Q 3K8AA 2KHJA 1HJPA 3D31A 5GROA 4XTCS 4LUOA 4BY1G 5IP9G 3E0EA 3M85A 4X65Q 3I4NH 4K0KQ 1E1TA 4HJAA 4H02A 3JC66 4LFAL 4X62Q 4LF5Q 5C0XI 1HNWL 2VUMH 1BVSA 1Q12A 1PYSB 3S1NH 1Y1WG 4LF6Q 1YITA 3A5ZB 2JJQA 2N49A 2ZTDA 2K50A 4A3JH 1KL9A 1NJIC 3I7FA 3PGZA 4OXPA 1TWCH 1X3GA 1WFQA 4JI3Q 5IWAL 4KHZA 4GN5A 1WYDA 4NXML 4P73A 4UY8C 1VQ9A 4Y52H 2RHQB 2K75A 5IYBG 4A3DH 3KDFB 3M3YH 3H15A 1WCMG 4Y7NH 1NBWA 2ZTCA 1PH6A 1JMCA 4BY7G 1GD7A 2KCMA 5ELOA 2JA5H 4BXXG 1XNQL 2NVTH 1XMOQ 1IBLL 1I50H 1NE3A 2IT1A 3KOJA 4LW1A 2JA7G 4JYAQ 2VNUD 3EN2A 3A0JA 1J5EQ 4A3FH 4JI8L 5IP9H 3I4OA 2Q2IA 1N9WA 3Q8DA 4DPGA 2B29A 1T9HA 1X54A 3CP0A 3OYYA 4JC0A 3RN2A 3GTPH 2OQ0A 1EIFA 4DR4L 4JI0Q 3FKIG 5FLMH 2D0OA 5H1SE 4DV7L 3TS2A 4JV5L 3HKZE 2KBNA 3K7UC 2EIFA 1N36L 4DV5L 2BA0A 1TWFH 3U4ZA 4JBKA 4B3ML 3HOUG 4JI5L 3PO2G 1AE3A 2UXDL 5C44G 1PH9A 3M4QA 1P8LA 5M5YH 4A3EG 2PI2A 4DR1Q 4BA2I 4GN4B 1J6QA 1TXYA 3PUVA 3PF5A 2D62A 3CPWA 3RN5A 1HR0Q 1K9MC 1FJGQ 4B3TL 4B3SL 4BY7H 4DV0Q 3UDGA 1WOCA 3CCSA 1I5FA 4KLKA 1EUJA 1QZHA 3PIOA 1VQHA 2NZHA 2JA7H 3PF4A 3S17H 1EQRA 3KLWA 4A3IG 4O0AA 3S2HH 5LMUL 1K73C 2B63G 1I3QH 2RCNA 1XNRQ 2K5NA 2BH2A 3T1YQ 4LF8Q 1CSPA 1OXUA 1R9TH 3PUYA 1VQ4A 1Y14B 2UU9Q 2ZJPA 3AQQA 1P16A 2ID0A 4P74A 4R4OA 1PH3A 4YY3Q 4P75A 3CCVA 2HHHQ 1N33L 1I6HH 2UXCQ 2LSSA 3CAMA 2EXDA 1EIYB 2HIXA 1X9NA 2Q2HA 3HOUH 3NELA 3CC4A 1AH9A 3PO2H 4GOPA 2VL6A 2K4KA 1OXSC 4GKJQ 2NVYH 5HGQA 3KF8B 2OQKA 5C4XG 2YYZA 5LMNW 3GTJH 1MJEA 1Q1EA 4B3RL 1VQDA 3G4SA 1VQAA 2ZJRA 3AEVA 2CWPA 2KHIA 3B6YA 3HOYG 5K36G 3GO5A 3HOXG 2B63H 5JJIA 4LF4L 2E8GA 2XGTA 2QEXA 4HIDA 1Q46A 4JBWA 4JI4L 1EYGA 1KRTA 2K5VA 2F4VQ 3ULPA 1Q82C 4QJFA 1A62A 1CUKA 1O7IA 2KENA 1HNXL 4JI7Q 1N32L 3OTOL 1Z9FA 4DUZQ 2LXJA 1I94L 3I4MH 4RMFA 3KFUA 4A3LG 3K7AH 3AFPA 2MNAA 4GN3B 4MZ9A 2VQFL 3H0GG 4JI2Q 3WWVA 4LF7L 5IYDG 3PUWA 2MO0A 4X66L 5FLXc 2CCZA 2E2HH 1YZ6A 4IJLA 1E24A 4GOPB 4RG1A 4QQBX 2BA1A 1X6OA 4OWWB 3KDFA 2JK8A 3AYHB 4UP8A 2R6GA 2WFWA 1YVCA 3CPFA 2D0PA 1S72A 1NMFA 3W1GA 4A3CG 1RIPA 4JI1L 1TWHH 3RNUA 1V9PA 2F52A 3CW2C 2JEAI 2UXBL 3DM3A 3PO3G 2UUAL 1FGUA 2CFMA 1YBYA 4YWMA 4BBRG 2Q2TA 2UUBL 2VY3A 1ASZA 4J15A 4ME3A 2MQHA 4DR2Q 2VZAA 3L2PA 2JQOA 3G71A 2VQEQ 4OX9L 4DV3Q 3T1HQ 4BBSH 4K0KL 4X65L 3W1BA 2WAQE 4DR3Q 4HIMA 4HJ9A 3H0GH 4X62L 4LF5L 4A3KH 1PYBA 5IYDH 2WAQG 3BJUA 4WJ4A 5BR8Q 4GLVB 1UE6A 4LF6L 3STBC 1S40A 3EIVA 4DKAC 4XIGS 3VDYA 2R93G 4YHHQ 4DV4Q 3RLFA 3BZKA 4YCVA 4YWLA 3GTQH 1VQNA 3HOVH 2JA6G 1QVGA 4DAYB 1QUQB 3GTOH 5IP7G 4A3CH 1JT8A 1NMGA 2CWAA 1XMQQ 1GM5A 1PH4A 3J7ZC 1K83H 1UE7A 2WP8J 3PO3H 1XJVA 3S15H 2A1AA 2DGYA 2AWNA 3K81C 4NPSA 1PH7A 4A3GG 1DGSA 1VQFA 4GLAC 4UPAA 3CCUA 1EWIA 2IX0A 4GNXB 1VQKA 1D7QA 3KF6A 3AFQA 2WB1E 2EQSA 5IWAQ 1XMOL 3S2DH 3FHWA 4BY1H 4JYAL 4QY7A 2WB1G 4HIOA 1IBKQ 5IYCG 5GADC 1X56A 3M4PA 3UDIA 4LFCQ 2YU9H 4UP9A 1Y1WH 4R4QA 2R7DA 4JCVE 2GVBA 1S3OA 5GQOA 3S14H 1GKHA 4JI0L 3SGIA 3HKZG 1XPUA 1VQ7A 2E2JH 4DV1L 2E5LL 2Z0SA 4YCWA 1N34L 1IBLQ 4JI6Q 2R93H 1EOVA 2QA4A 2HT1A 4JI8Q 5IP7H 1HNZQ 4MNOA 5AJ3Q 1BKBA 5GAGC 5IYBH 3NEMA 3CCEA 3RZOH 4A93G 1WCMH 1G6PA 4DR1L 4LFBQ 2RF4A 2AMCB 4BXXH 1HR0L 3ERSX 4JV5Q 3U58A 1CKNA 2ZM6Q 1MKHA 1SMXA 3IRBA 1C7YA 1KD1C 4C3IH 3CMEA 1XPOA 2FXQA 2UXDQ 2I5LX 3UDXA 4DR7Q 3U50C 1SN8A 3KF6B 3CCQA 1XNRL 2BH8A 3J81c 2OWOA 2IHEA 3TREA 3T1YL 4LF8L 3HOZG 1RL2A 1KXLA 3FKIH 1E7ZA 1UWVA 3LGJA 4A75A 1K8GA 4B3SQ 2NZOA 2YTXA 3S16H 2UXCL 1SRUA 3HFZB 5M3MG 1HZBA 3BU2A 3PUZA 4YY3L 1K8AC 2HHHL 1C0AA 1D8LA 5C44H 2JA8G 5LMUQ 1AE2A 3A5UA 4A3EH 4GOPC 4POGA 4NXNL 4A3BG 4DR6Q 2K52A 2JEBI 4GKJL 2IHFA 4A3MG 3GTGH 3PUXA 3J80c 3M4OH 3S1QH 1L1OA 5LMNQ 2DUDA 5C3EG 3DLLA 4DV6Q 1N33Q 4IFDG 1OXVA 1KHIA 4OONA 1L1OC 4A3IH 3HOWG 4P71A 2B3GA 2OCEA 3ZJYC 4GKKQ 3G6EA 1QVCA 2JA9A 4GS3A 3ICEA 1CKNB 4BA1I 1SFOH 1L0WA 3S1RH 4A4IA 1BBWA 1Y1VG 2N78A 3GTLH 1A63A 1YNXA 2F4VL 3NENA 1MIUA 1X3FA 4YCUA 3CXCA 4APVA 1K0RA 2QGQA 4X64L 4IOAA 3S24A 2E2IH 4B3RQ 4JI7L 1GVPA 4ALPA 4JOIA 2JA8H 1ASYA 2YTYA 4DAMA 2R7ZG 3HKSA 3JAMc 1Q7YC 1QUQA 4JOIC 5C4XH 3CMAA 4JI2L 4JI4Q 4HJ5A 3S1MH 2UUCQ 1KRSA 3EBEA 1B8AA 1PFSA 2RHSB 4R4IA 1EFWA 1UE1A 4DUYL 4L5TA 1IBML 3HOYH 1VQLA 2Z6KA 1YHAA 3OTOQ 3RZDH 1VQCA 1KIXA 1I94Q 3HOWH 1HZCA 3HOXH 4GNXA 1L1OB 2AWOA 2NVQH 3I4NG 2Z6KC 2OTJA 4R4CA 4GNXC 1WJJA 4HJ7A 4DR5Q 4AQYQ 1X55A 2PI2E 4JBJA 2VUMG 2LXKA 1TWGH 4PZ6A 1Y1VH 4DK6C 2N8NA 4LUVA 4PG3A 4KHPQ 1JJCB 3I2ZA 1MJCA 4TVAB 5DLQE 5IE8A 3TQYA 1VCIA 4DR2L 4LF9Q 2R7FA 5EAYA 4QIWE 1VQ5A 3J81i 1PVOA 4R1JA 4DV2Q 4A3LH 4DK3C 1JJ2A 1SROA 1SR3A 4JI1Q 1VQMA 3T1HL 1OXXK 1U5KA 2V1CC 3U4VA 4YWKA 1UE5A 2A19A 4EQ5A 4IFDJ 1YI2A 1G291 4DR3L 3F2DA 1HZAA 4P72A 4JI3L 5BR8L 3GTKH 5E7NA 3F2BA 3CF5A 2Q2UA 2H5XA 3STBD 1YJ9A 1WI5A 2JA5G 4L5SA 2N3SA 4DV4L 3J81j 4LNQA 4TQUS 2R7ZH 3CCLA 4JBMA 1PA6A 1PH5A 3J7A5 3J80i 3K0XA 4LFAQ 4A3FG 1NTGA 1A0IA 4QGUA 5M3FG 1XMQL 1HNWQ 4BBRH 1B7YB 3GD7A 2JE6I 4OO1G 1A8VA 2CQOA 1E1OA 5GAHC 1Q86C 1LYLA 3TRZA 1IYJB 1PV4A 2A8VA 3ER0A 1Q81C 5FLMG 3GTMH 1UEBA 4PZ7A 1VQ8A 1YJNA 2ZTEA 5IY0A 2NVXH 1J5EL 3PCOB 4PZ8A 4NXMQ 4IPHA 4O2DA 1NY4A 2GN5A 4MTNA 1IBKL 2MO1A 5FJ8G 2AKWB 5J3BA 4LFCL 1CSQA 1VS0A 3F2CA 3W5OA 1VQEA 4IPGA 2I5MX 1VQPA 1YHQA 3A74A 5JJKA 1PH2A 1XNQQ 1W3SA 4C3JH 1IL2A 2NN6G 3M9BA 5M5XH 1PHJA 2JA6H 3I55A 4AH6A 3FP9A 4QL5A 3JAMi 1X65A 1KC8C 4JI6L 3TS0A 1C9OA 1JE5A 5IT9c 3UDFA 3RR5A 4POFA 4FDBA 1YEZA 5C0XG 5AJ3L 2PNHA 3NBHB 5M3FH 5M5WH 1HNZL 4DR4Q 4DV7Q 3H3VI 3MEFA 1FJGL 2YV5A 4A3GH 1VQBA 2L15A 4LFBL 4A76A 4DV0L 1K3RA 3ULLA 4NB3A 3UE1A 2R92G 3CCRA 4R4TA 5JJLA 1LM0A 4LWCA 4DV5Q 3CCMA 4IOCA 1N36Q 4B3MQ 2E5LQ 3CD6A 4AIMA 2ZM6L 4DV1Q 1N34Q 4JI5Q 3M7NA 5IYCH 4L5RC 4IFDI 1Q8KA 4DNIA 4EX5A 3L7ZC 3CC7A 5JEAG 5FJ8H 3KJPA 4DR7L 2GVAA 5GAEC 1OTCA 1VQ6A 1HR0W 2UU9L 2PQAA 4B3TQ 1U0LA 3BZCA 1XTDA 1KAWA 4IO9A 1Z47A 3UE0A 5C4JH 2C35B 2ALYB 1HH2P 2K14A 2OTLA 4A93H 4HIKA 2HQLA 1JB7A 4KI0A 2F3IA 1LUZA 4DR6L 1CKMA 3G48A 3KJOA 2R92H 4UP7A 1PH1A 5LMNL 4DV6L 2MFIA 2PMZE 4C3HH 1YHBA 2ZJQA 1V43A 4IPCA 3F8TA 3PSIA 4IJHA 3I4MG 1KQSA 2VW9A 2ATWA 4IPDA 4GKKL 3HOZH 4NXNQ 1E3PA 3E9HA 3E9IA 4X6AH 2I5HA 3RLOA 1M90C 5C0XJ 5M3MH 4AYBE 1BBUA 4DUZL 4HJ8A 3K80C 1Q1BA 1V1QA 2PQAB 4AYBG 2Y0SE 3PV0A 4LF4Q 4A3BH 1VQJA 4GLXA 1FL0A 3L0OA 4JG2A 3H3VH 1LTLA 2Y0SG 1TWAH 4A3MH 1M1KC
chains in the Genus database with same CATH superfamily
4OIJA 1XPRA 2HIVA 1H9SA 2UUCL 4FO2A 1GO3E 2I0QA 2IY5B 4HEDA 1IW7C 2ASBA 4ULLA 1JJGA 1X32A 1LTBD 5M3FB 4OO1I 5M5WB 4A3JG 1STEA 1YJWA 4KJOA 3P20A 4A3GB 1FNUA 2VQEL 4DUYQ 1G51A 1I6HB 2UXBQ 2WB1B 3WOFA 5HY6A 1N8RC 3A8JE 1CKOA 1PXUA 4A3DG 1PZJD 4DNRB 4E6IA 3MXNB 3OOCA 1GUSA 1IKMA 5J22A 4H7BA 5FK9C 1RF2D 3K8AA 2AQ1B 3M85A 4LUOA 3I4NH 3E0EA 4A93B 2EYMA 3LWUA 1BVSA 3S1NH 3S2HB 4LF6Q 1MSGA 3A5ZB 4I7ZC 5FO7B 2ZTDA 1NJIC 3I7FA 3PGZA 2LKVA 3NBIA 1BDOA 1WFQA 3CU7A 2R92B 1CZWA 4CDEC 3OIQA 2RDGA 4C56C 1TU2B 2K75A 1AP0A 5EBCA 1WCMG 4Y7NH 2B2UA 1FD7D 1PFBA 1GD7A 5ELOA 4BXXG 2NVTH 1XMOQ 3FMCA 3KOJA 4RCOA 3TP7A 3EN2A 3A0JA 5M3MB 4A3FH 4JI8L 5IP9H 3I4OA 1K3BC 3CP0A 2K5WA 3OYYA 3FPUB 2OQ0A 2L1BA 3EFXD 5FLMH 4DV7L 3TS2A 1RTNA 3X3MA 3C2PA 4JV5L 2KUMA 1RD9D 1KDCA 2WV6D 1SE4A 1DONA 1SYCA 1B3AA 3D4DA 1PH9A 2C5CA 2PI2A 4DR1Q 4A3EG 5KNDA 3SHLA 1DM0B 4C2MB 3AMUA 1QG7A 2D62A 3QWNA 2QEJC 1WD0A 2SEBD 4DV0Q 3UDGA 4KLKA 1QZHA 3PIOA 3PF4A 2JA7H 3S17H 5FO9B 1F9SA 3KLWA 4A3IG 2K7VA 4UAIA 3LWEA 2BH2A 1PTOD 1JOKA 4DGZA 5CV7A 1D5MC 3PUYA 4EVOA 3OWEB 2ZJPA 2ID0A 4P74A 2UXCQ 3CCVA 4H13C 2LSSA 2NB0A 5E1FA 1PRTC 1AH9A 2RSOA 4X3SA 4ZYSA 1EL0A 1EY0A 3CRKC 2YYZA 2L12A 5IT9L 5KIXA 1Q1EA 4A3JB 1FNVA 1VQDA 3AEVA 2CWPA 2KHIA 4HSPA 3VR2A 2B63H 4QIWB 2E8GA 2F3VA 1GHJA 1Q46A 4JBWA 4RAUC 4XYQA 2K5VA 4A3DB 3K58A 1Q82C 1CA6A 4DK1A 1A62A 1O7IA 2KENA 4JI7Q 4DUZQ 2E2DC 1I94L 1G6ZA 3KFUA 3AFPA 3O13A 4FYDA 4MZ9A 1EU3A 3WWVA 4IUQA 4LF7L 5IYDG 4ZAIA 1YZ6A 3GTPB 4GOPB 5G3LF 5IIFA 1GJXA 2BA1A 3TP6A 2R6GA 2D0PA 1QJOA 3W1GA 1CZGA 4G7ZC 1TWFB 1WTHA 3DM3A 1NUCA 1SNDA 1YBYA 4ZK9B 2VY3A 5M5YB 1PFNA 3WOEA 2X69A 2RSNA 3L2PA 2JQOA 4RGTA 4OX9L 1AZQA 4G7OC 5T1GA 1Z6HA 3MFYA 2WAQE 4DR3Q 4HIMA 1I3QB 4X62L 4LF5L 2AUJD 2WAQG 3STBC 3IFTA 1B44D 3VDYA 1LABA 1D6EC 3DWAA 3S9WA 4DAYB 4WFN3 4A3CH 5IP7G 1ML0D 3J7ZC 1K83H 1JOOA 2EYFA 1BCPF 3J7AV 4A3EB 2AWNA 1W6JA 1VQFA 2WKCA 4UPAA 3CCUA 1VQKA 4HAEA 1EY5A 5CV4A 4GNXB 4XT1B 3S2DH 1NAPA 4JW0A 3T51B 1EEID 2KEDA 1BUVT 4LMQD 2J7ZA 4JI0L 2B2WA 1XTCD 1N34L 4K5WA 1IBLQ 2EOTA 2Z1CA 1HNZQ 4KV6A 3CCEA 5GAGC 4ZQ3A 3MC0B 2AMCB 2WKDA 4M8AA 3U58A 2ZM6Q 1MKHA 1KD1C 4C3IH 3CMEA 2FXQA 2OXPA 2R61A 2M2LA 2I5LX 3KF6B 4DAPA 3RZDB 4RCNA 2D2CC 3FKIH 2BE5D 2MGSA 4A75A 2EJFC 1K8GA 2YTXA 5EPKA 2HHHL 2EVBA 3BU2A 3PUZA 1W6KA 1C0AA 5IGBA 5LMUQ 1AE2A 1AEXA 3V2TA 4NXNL 4A3BG 4GKJL 3D6CA 3CHBD 4A3MG 1BCPB 1L1OA 3DXJC 2PZUA 2TSSA 4OONA 2F0WA 3M7GA 3TZUA 4P71A 5JPNC 2OCEA 2PYKA 2DY7A 3MA2B 1KNEA 4GS3A 3GTOB 2MJ8A 1JR0D 4A4IA 1BBWA 1Y1VG 4CKEA 1H9MA 3S15B 2E75C 4ZKCB 1X3FA 2RQXA 4YCUA 5CV5A 1K0RA 3CXCA 2PPBC 3R8BA 2PCFB 1KDAA 4V190 4OHJA 2Q8TA 4K6DA 2JA8H 3VYTA 4DAMA 1IW7D 1Q7YC 5C3XA 2B8GA 4DAYA 4JI2L 3R93A 2UUCQ 1Y1WB 3EBEA 1B8AA 1EFWA 1I4QA 3S14B 4DUYL 4L5TA 2E2JB 1HZCA 4GNXA 5IGGA 3NE5B 2FINB 1NR4A 2VUMG 3RZOB 2LXKA 5I9OA 4RGNA 1AZPA 3I2ZA 3HP3A 4KK7A 2MHVA 5IE8A 1I4XA 2R7FA 1VQ5A 1EZ6A 4R1JA 3K5LA 5F2DA 3J80L 4JI1Q 3BYTB 1VQMA 2DY8A 5CV6A 3ZYYX 4CKBA 4Q0FA 4IUPA 4F87A 1HZAA 5BR8L 5E7NA 1EYAA 2Q2UA 2JA5G 1U4PA 1ILQA 4DV4L 4LNQA 4RFBA 1PA6A 1PH5A 3J80i 3VYRA 4KTAA 1SXTA 5C5MA 4QGUA 1BOSA 4XQQA 4OO1G 2CQOA 5GAHC 3TRZA 1IYJB 1DJRD 4EQOA 1Q81C 1UNSA 1HFGA 5BN5A 2RVLA 4ID6A 1QB5D 1K0SA 1YJNA 3A55A 3JAML 3T56B 5A2QL 4MTNA 4CDFC 1ET6A 2ICIA 5FJ8G 1YNNC 4LFCL 1CSQA 1VS0A 1EY4A 1VQPA 3A74A 1PH2A 5HGTA 1IL2A 1B1ZA 2EYHA 2JA6H 3I55A 3I73A 2CQAA 4AH6A 1STHA 3JAMi 1ZXTA 4POFA 4FDBA 5M3FH 5L37A 3NBHB 1K8OA 2L4NA 5M5WH 3TDQA 4DAVA 2EYOA 4DK0A 4DV7Q 4A3GH 2YV5A 2L15A 4A76A 4DV0L 1K3RA 4A3MB 1I6HH 2E5LQ 1RTOA 3M7NA 4L5RC 3CC7A 3HOYB 1BBXC 3KUPA 1K8MA 4F8MA 1HR0W 1STAA 1XTDA 2H4OA 2G5DA 1Y1VB 4KHVA 2A69D 1BXTA 2HUGA 1PRTD 2OTLA 4A93H 1PTOC 1JB7A 4KI0A 2F3IA 5IGEA 4DR6L 3C3LA 2RCFA 3CQZB 2R92H 1SYGA 2MFIA 2IL8A 2F0VA 1YHBA 3PSIA 1KQSA 4CDCC 1HPCA 1ENFA 2I5HA 3RLOA 4BBRB 1F9PA 2G9DA 1HXYD 2L0CA 3Q23A 5C0XJ 5M3MH 1VMPA 4AYBE 1BBUA 4DUZL 4HJ8A 4Z9CB 1Q1BA 4AYBG 4GLXA 1FL0A 5KRUA 1M1KC 1E0BA 3RLNA 1D1KA 2YTVA 3QIAA 1B4OA 5T1IA 5JEAJ 3HEJA 1IZ6A 5ELNA 4X64Q 1IXRA 4C2MH 1A2UA 4BBSG 3DWQA 4LF7Q 1PRTB 3Q6SA 2M00A 1H95A 4A3KG 1KTKA 4LUZA 4PMWA 1QVFA 1VQOA 1HZ9A 2EZVA 1VQGA 3SK4A 4LF9L 1F2ZA 1IBMQ 3OPOA 2F0SA 4HMIA 1TT2A 1YIJA 2K5HA 3D0FA 2XN9C 3R2IA 1EQQA 4RGMA 1SYEA 5C5LA 3KYHC 3TEHB 1RODA 1VQIA 4L5QA 4OX9Q 4DU9A 3D4WA 4BY1G 1H9SB 4HR7B 4HTHA 5ELFA 1E1TA 4H02A 4X62Q 4LF5Q 4FXDA 1PYSB 2D9UA 2NTTA 1YITA 4K14A 4CDDC 4A3JH 1KL9A 4HSVA 3I3CA 4OXPA 1X3GA 1J8IA 4NXML 4B9XA 4CBVA 4A3DH 1QWYA 2ZTCA 3HOZB 4IUUA 1LTAD 2SOBA 4BY7G 1IL8A 4OIKA 1XNQL 1IBLL 1I50H 2IT1A 3ND8A 5EKLA 5IT9E 3TSSA 2XIWA 5TSSA 3NUCA 1N9WA 3EVQA 3E5SA 1X54A 3GTPH 1OO9B 1BQQT 4X3TA 1EIFA 1BNZA 1TWAB 4JI0Q 4DR4L 2D0OA 2PZTA 3HKZE 2KBNA 2F0TA 3K7UC 2EIFA 5C3EB 1TWFH 2AQ3B 3U4ZA 3HOUG 3PO2G 4MTKA 5C44G 1ESRA 5D3DA 3QR8A 1P8LA 5M5YH 1EY7A 4GN4B 1TXYA 3PUVA 3CPWA 1FJGQ 3BDOA 5KYIA 1WOCA 2A6HD 5EPJA 4O0AA 5LMUL 1K73C 1I3QH 3DMUA 3BVMA 4ZUJA 3A8IE 2BE5C 3NQIA 1PFMA 1OXUA 2UU9Q 1VQ4A 1Y14B 2QCPX 3AQQA 4IZ8A 2HHHQ 1EZ8A 3CAMA 1I6VC 2EXDA 1EIYB 1VF5C 2Q2HA 3VA5A 1PZKD 4GKJQ 3P7JA 2OQKA 5C4XG 5LMNW 1O78A 3T13A 5CBAE 1MJEA 2FFKB 5IODA 1VQAA 2ZJRA 2WINB 5K36G 5KYLA 3N52A 3HOXG 2XGTA 3ONAB 4KKUA 5I2YA 1SBBB 2F0PA 1EYGA 3ITPA 4NW2A 1GXDC 1FYCA 1Z9FA 2LMCB 3I4MH 2BDNA 4G7HC 1SNOA 4WORA 3MFGA 1S5BD 5DEHA 4GN3B 5JPMC 2MNAA 1SJED 3H0GG 4JI2Q 4X66L 2CCZA 1E24A 2Q8IB 3FPPA 4QQBX 1X6OA 2JK8A 3R2TA 4IN3A 4UP8A 1YVCA 1S72A 4MN3A 1NMFA 4JI1L 3RD4A 2F52A 3W2DA 2UUBL 4YWMA 4J8QA 3HG9A 1U4MA 1ASZA 4J15A 4ME3A 2MQHA 1DOLA 1O7ZA 4EGVA 4BY7B 3G71A 5I4DA 4DV3Q 1CI3M 4K0KL 3EJIA 4NMZA 3W1BA 3SXHA 2F0LA 3KK7A 5IYDH 5BR8Q 1UE6A 2TMPA 3VA7A 4DKAC 1S40A 2R93G 1H9KA 4DV4Q 3BZKA 3HOVH 5JJZA 1LTID 1VQNA 1CM9A 3GTOH 1C48A 1JT8A 2CWAA 3HOUB 2WP8J 3PO2B 1XJVA 1YNND 3S15H 3MEHA 5BN4A 2J0TD 1WVLA 2DGYA 3K81C 4NPSA 4GLAC 1DGSA 1D7QA 2NVYB 2IX0A 4ZLTF 5KNBA 3ERQA 2EQSA 4A93G 5IWAQ 3M4OB 5J39A 3GTJB 1X56A 4LFCQ 1JC7A 4UP9A 1EY9A 2P5ZX 1Y1WH 4J1MA 5A35A 2GVBA 3S14H 1GKHA 3SGIA 5LHY1 1XPUA 2OF1A 3NTHA 2E2JH 2E5LL 1Y8OB 1LTRD 1A3VA 4L6TB 2QA4A 1LT5D 2HT1A 3QJYA 5IP7H 1EQVA 2PMZB 3FVQA 5IYBH 3RZOH 1G6PA 2HQEA 1S5DD 1CKNA 5C4XB 4JK1C 4C3HG 2MUYA 4RKLA 4HCSA 3UDXA 2XVSA 1XNRL 1DZ1A 5CYUA 3J81c 1TWHB 3TREA 1RL2A 2RA4A 1E7ZA 4K2KA 2A6EC 1UWVA 3LGJA 2JN4A 2A69C 4B3SQ 4O1NA 4YY3L 3HFZB 1HZBA 1K8AC 1ZEQX 1D8LA 2KECA 4DR6Q 5KGUA 2IHFA 1F2MA 4DN4M 3H0GB 3MXGA 2PQEA 1N33Q 1B3QA 4M1UB 1KHIA 4TSSA 2CHBD 3ICEA 1DXMA 2KVMA 1XX8A 1JORA 3VYSA 2N78A 1SYDA 1JOQA 2F4VL 1MIUA 4IQZA 4CGYB 4APVA 4X64L 4IUNA 5HURA 2PO4A 5KEEA 3CKIB 5FLXE 2YTYA 3JAME 5A2QE 3HKSA 4JI4Q 1PTOB 1T5XD 1IYVA 1KRSA 5CGKA 2ICEC 3EA6A 1IBML 3HOYH 1YHAA 1STNA 2R7ZG 2R93B 3HZXA 1L1OB 3I4NG 1U9RA 1Y69U 4LK1C 4H44C 4JBJA 2WACA 1WCMB 1Y1VH 4PZ6A 2N8NA 4LUVA 4PG3A 2KQ3A 1MJCA 3TQYA 4DR2L 4LF9Q 2E76C 4A3LH 1SROA 4K2LA 5I6YA 3T1HL 3U4VA 2V1CC 3CRLC 4YWKA 1UE5A 4IFDJ 1JICA 5C4ZA 1AFPA 4DXGA 1CTMA 2H5XA 3KLRA 1YJ9A 5I6WA 5IGCA 1L0YB 4JBMA 2A5HA 1II3A 4A3FG 1NTGA 1A0IA 1VF7A 4BBRH 2G9HD 1A8VA 2ZXOA 2F0EA 1LYLA 2EDGA 2Z8LA 3ER0A 3DUZA 1IHZA 5FLMG 1A2TA 1UEBA 1B9MA 4J6HA 3PIO3 3S1QB 4NXMQ 4IPHA 1NY4A 4A3IB 2K04A 1YNJC 4C3HB 4IPGA 1CQFA 4XQJA 1SFOB 1XNQQ 4C3JH 1SNMA 3M9BA 3GTLB 1JB3A 1PHJA 4IUTA 4JI6L 3FP9A 4QL5A 1JE5A 3EQLC 5IT9c 4DR4Q 4OO1H 1SDFA 3MEFA 1FJGL 4LFBL 3M4YA 2O4XA 1V1PA 3I8ZA 1LV9A 3UE1A 2EY6A 4R4TA 1MD2D 3DHQA 3CCMA 3FRPB 5IYCH 5DNFA 3L7ZC 1GUGA 4G4KA 1A15A 5FJ8H 4DR7L 5GAEC 1VQ6A 2NVQB 2DNCA 2UU9L 2PQAA 1U0LA 2XNAC 3IAYA 2A6HC 3NP8A 4UDUC 1KLUD 1KAWA 4K8JA 1Z47A 3UE0A 1PYWD 2LFNA 1HH2P 3WDNA 4MHEA 4HIKA 2MPMA 1CKMA 3MAQA 2F1MA 2KHSA 3G48A 3K59A 4I7AA 1PH1A 1RHPA 4DV6L 2ZXRA 3GTKB 3P1HA 2ZJQA 1V43A 4IPCA 1ENAA 2QDBA 2ATWA 2R7ZB 2CW0C 1STGA 3HOZH 4X6AH 3E9IA 3MWYW 1SNQA 5K5PA 4K8IA 4CHTB 2KOLA 1Q90A 5EJWA 3GTMB 3PV0A 3QOLA 2NVXB 3C1FA 1WTOA 3H3VH 1TWAH 1FVIA 1SE8A 2EPBA 2WAQB 2HDMA 5C3EH 4IFDH 5C6AA 3CC2A 4PMCA 1PMRA 1GUOA 2M9VA 3I70A 4R8NA 2K05A 1MGSA 1GUTA 4X66Q 3F1ZA 4DR5L 4AQYL 3PQIA 5JVH3 1W2BA 1QZGA 1OXTA 2CKZB 1O80A 4KHPL 5EQ0A 5LL6X 2ES2A 1HHVA 2VS1A 1DOKA 2DN8A 4DV3L 1PH8A 1B9NA 4DV2L 2AUKA 2UUBQ 1B2TA 4KY6A 1EYDA 3ULJA 1SE3A 1JQYD 5C3WA 1ENCA 4RHRA 1FR3A 3I56A 3PIPA 1VMCA 2SNSA 1WTRA 5GROA 4K0KQ 3KLSA 2NUCA 3MXUA 4LFAL 3JC66 4FF3A 1D2BA 1S5FD 3E3XA 5C0XI 2XWJB 5IGDA 2N49A 1S5CD 4KJNA 2QDLA 3AU7A 3SK8A 5IGFA 1SYFA 5IWAL 4F7XA 4UY8C 3G6JB 1AN8A 2RHQB 2SNMA 3GP7A 1NBWA 5I9PA 5CMDA 1PH6A 1A3UA 2JSOA 1STBA 2FHTA 2KCMA 3L9AX 4LW1A 4DNTB 2VNUD 5NUCA 2XSCA 1V1OA 1G8ZD 2Q2IA 3Q8DA 4UHVA 4DPGA 2B29A 4CJ0B 1T9HA 3I90A 4JC0A 3RN2A 4A3BB 1TS2A 3FKIG 3I72A 1O7LA 2RBMA 4WJWA 1N36L 5CBEE 4JI5L 3KF8A 2Z4HA 1EQTA 1PRTF 3A56A 1VDZA 4BA2I 1A3TA 4FP5D 3OHXC 1CK1A 3PF5A 1K9MC 2A6ED 2NN6H 4B3TL 4B3SL 4BY7H 1X3PA 3CCSA 1I5FA 1NNXA 1EUJA 1VQHA 1HTPA 1EQRA 3S2HH 1I4HA 1XNRQ 2K5NA 2F0JA 4QF4A 1P16A 1N33L 4R4OA 2XRQD 4YY3Q 3W3AA 4L63B 3HOUH 3HS0C 3NELA 2F0OA 3CC4A 1TY0A 3PO2H 1TY2A 2K4KA 1OXSC 3OSOA 2NVYH 3OMGA 5HGQA 1B50A 2VB3X 2VUMB 1C8CA 3GTJH 1TWCB 1C4QA 1CHPD 4HIDA 4N8FA 4JI4L 3TMEA 1KRTA 3Q0AA 4RHSA 2F4VQ 3M3YB 4KD4A 3X3NA 4QJFA 1HNXL 1N32L 1RKNA 2O5JC 2JA5B 1XXGA 3NXWA 4RMFA 4ODGA 3K5MA 1WTPA 2K03A 3Q24A 4DFAA 2VQFL 1KDBA 2MO0A 3PUWA 5FLXc 2EE1A 5I2XA 4RG1A 1F9RA 4QCLA 2WIIB 2NBFA 3AYHB 2WFWA 5ELDA 1TWHH 4N9PA 1V9PA 3CW2C 3RNUA 2JEAI 5K36H 3PO3G 2UUAL 1KLGD 2CFMA 1LTTD 3SR1A 1QE6A 5ELCA 4ABNA 4DR2Q 1SYBA 4GZYC 1BR9A 4LAAA 1MSHA 3OW7A 3T1HQ 3MVVA 1MI2A 4X65L 2C9OA 4HJ9A 3H0GH 1RCVD 2EYJA 3BJUA 4WJ4A 2XWBB 1EY8A 3EIVA 1R9TB 1B53A 4HCEA 4YHHQ 3RLFA 4YCVA 2F0MA 4ZKBB 2JA6G 3NHHA 1QVGA 4OGQC 1NMGA 2H1EA 3QB3A 4ILWA 1YNJD 3K5NA 2A1AA 1ESFA 2K01A 1PH7A 4A3GG 1EWIA 1SEBD 2WB1E 2QF7A 4JYAL 1D1IA 2WB1G 4HIOA 5CR3A 5GADC 1PTOH 2L5TA 4R4QA 1SE2A 2R7DA 3H09A 1S3OA 5GQOA 1QNUA 3HRZC 3SE0A 3HKZG 4L8JA 1VQ7A 2R93H 5EKKA 4JI6Q 1EOVA 2KEEA 2KJXA 3QO2A 4MNOA 1ZYRC 1BKBA 2PZWA 2V4DA 2VXWA 3E0JA 3K7AB 3NEMA 1SMYC 1WCMH 1BCPC 4PV1C 4LFBQ 4BXXH 1HR0L 2BCOA 2E2HB 2K6AA 1Q3LA 1SMXA 4AYBB 2UXDQ 4DR7Q 1SN8A 2OWOA 3T1YL 4LF8L 3NK9A 5ISRA 4NDXA 3NTIA 2NZOA 1HFNA 3QG1A 1X3QA 1SRUA 5M3MG 1EY6A 1Z7TA 3KBGA 3A5UA 4A3EH 4S3SA 2CW0D 4BBSB 2JEBI 4EQPA 3PUXA 4XYOA 3OIPA 3S1QH 4IUVA 4A3KB 4DV6Q 3DLLA 4OL7A 1OXVA 4A3IH 3IFDA 3HOWG 4QMGA 2B3GA 3GTQB 3ZJYC 2JA9A 1CKNB 4BA1I 3U9OA 2BDOA 3QOJA 1SFOH 1S5ED 3D8GA 3GTLH 3PO3B 1YNXA 1LACA 1V8QA 3NENA 1GUWA 5KNCA 4IOAA 3S24A 4B3RQ 3D6WA 4ALPA 4BY1B 1GOZA 1ASYA 2LY7A 4JOIC 2YU9B 4HJ5A 1J9OA 2AQ2B 2EXZA 4ME5A 2RHSB 1G91A 1LT3D 3VR3A 3J81L 1VQLA 3RZDH 3OTOQ 1KIXA 1VQCA 3F2UA 2NVQH 2Z6KC 2JA6B 4R4CA 4HJ7A 4DR5Q 4AQYQ 1X55A 4DK6C 1H9RA 2K33A 4Q5VA 1KAAA 4KHPQ 4TVAB 1VCIA 5EAYA 4QIWE 3J81i 1PVOA 4DV2Q 2OT2A 1STYA 1SR3A 3R3OA 2SDFA 4KY5A 2A19A 4EQ5A 4K6LA 1H9JA 3F2DA 4P72A 3MXPA 3GTKH 5DAUA 3CF5A 4OEMB 4L5SA 2N3SA 3HKZB 2R7ZH 1T5EA 3J7A5 3RUZA 3S16B 2F0HA 4LFAQ 1HA5A 1F2LA 2NZ1D 5C44B 4N9TA 1XMQL 1A6XA 1B7YB 2JE6I 1Q86C 1E1OA 3K6OA 3D4RA 3GTGB 3GTMH 1SNCA 1EU4A 2EYPA 1WTWA 1LTSD 4HN7A 5IY0A 2NVXH 3LNNA 3PCOB 4PZ8A 1DCZA 4PMBA 4O2DA 2GN5A 1IBKL 3TZDA 3GQBA 2A68D 1HQMC 2AKWB 3FEWX 2KA7A 3F2CA 1VQEA 1S4ZA 1YHQA 2J4XA 3DEOA 3S1RB 2BOSA 1BF4A 1G2SA 1X65A 2E2IB 1QNKA 2EY1A 5C0XG 3RR5A 1PTOF 3TN2A 2DNEA 5AJ3L 3KBXA 3H3VI 1VQBA 1F77A 3T16A 3ULLA 1Y8PB 4NB3A 3Q22A 2KCNA 3S1MB 4LWCA 3UI2A 4IOCA 1JE4A 1N36Q 2ZXPA 4AIMA 4DV1Q 4JI5Q 4K5VA 4IFDI 1NCVA 2PW5A 1Q8KA 4FXKC 4DNIA 4EX5A 2K28A 3HGBA 4PNYA 5JEAG 3HOWB 3KJPA 3HOXB 1OTCA 1JWUD 4B3TQ 3A7LA 4ZUIA 4C1NK 4MIUA 2VB2X 2NWGA 1TWGB 4IO9A 1HRJA 2C35B 2ALYB 4QB4A 4IALA 3SVMA 1EEFD 1EWHA 4DA2A 3J80E 4XXEA 3PMFA 1O7YA 1Y8NB 3GV6A 1TQOA 4UP7A 4FNFA 5LMNL 3F8TA 3I4MG 4IJHA 1V1PB 2VW9A 1CA5A 4IPDA 4GKKL 2QW7A 4U68A 1WD1A 1E3PA 3DWPA 3E9HA 2FJ2A 4OELB 1ONLA 4ZRZA 2FMCA 1TS5A 2F0UA 3BZDB 5EPLA 2RKSA 1NSNS 4WRDA 4HMJA 1EOTA 3NWTA 1WTXA 1V1QA 2PQAB 2B2VC 2EY5A 3MXNA 4CJ2C 2Y0SE 2IWHA 4A3BH 1VQJA 1Q8IA 3L0OA 1TS4A 1LTLA 3URYA 2Y0SG 4A3MH 5CORA 1X3EA 4OWXB 2QILA 1HNXQ 3CCJA 1N32Q 2QKIC 1ET9A 5M5XB 2IX1A 3FDTA 4P2CB 1LO5D 2F4IA 1I50B 2VQFQ 4FF1A 2AHOB 5JVG3 4OWTB 1F9QA 1ILPA 4PQXA 1B70B 4WJ3M 1SLJA 3T53B 1U4LA 3BVGA 3GDEA 3HOVG 2I07B 3OW2A 2ENBA 2XTIA 5E4WC 3NWSA 4RH6A 2UUAQ 3CQZH 1L2FA 5E4XA 1E22A 1FNWA 2KCTA 5G3LD 1K28A 3KLSX 3VR6A 4YHHL 4X3UA 2NN6I 4U673 2KHJA 1HJPA 3D31A 4XTCS 5FOBB 5IP9G 5C4JB 4X65Q 4HJAA 3AB9A 3H3VC 2XRSD 3H91A 1HNWL 2VUMH 1MBYA 1LTGD 1Q12A 1Y1WG 1QCBD 2JJQA 2K50A 2Z4IA 4RWSC 4JI3Q 2RDHA 2E74C 1TWCH 4KHZA 4XT3B 3GV3A 4GN5A 5CC4A 1WYDA 1XWEA 2F0GA 4P73A 4H0LC 1VQ9A 4Y52H 5ELEA 2F03A 4R9WA 5IYBG 3KDFB 3M3YH 3H15A 2GA4B 3BDCA 3G7LA 1JMCA 2DJFC 2NYZD 3SDZA 2JA5H 2B2UC 3MZ5A 2JA7G 1NE3A 4JYAQ 3BG3A 5COYA 2X6GA 5IOCA 2ZT9C 2EJGC 1J5EQ 5D65A 1ZYRD 1SMYD 2O5IC 1BCPD 5D14A 5H1SE 4DF7A 2IPKD 3EROA 4DV5L 2BA0A 4JBKA 2EJMA 4B3ML 1ICWA 1BO0A 1NR2A 3A54A 1AE3A 2UXDL 1PLFA 4NP5A 3M4QA 4CJ1B 5DM63 5FKAC 3I4MB 1J6QA 5J1ZA 1R4PB 3VYUA 3E6ZX 3RN5A 1HR0Q 1GUNA 5D3IB 2NZHA 4YIJA 1R4QB 1UAPA 2B63G 5FO8B 2RCNA 1D5XC 3C1EA 3T1YQ 4LF8Q 1HQRD 1CSPA 2F0QA 1R9TH 2Y0SB 4KKSA 1TKWB 5JAVA 3T4AC 1PH3A 4P75A 3DM1A 2HIXA 4B08A 1X9NA 1FGBD 1U4RA 4GOPA 2B8FA 2VL6A 2CVRA 5JOBA 3I4NB 2PW7A 3KF8B 3K5OA 3S1NB 4B3RL 3G4SA 1EFID 1G2TA 3B6YA 4QUFA 3HOYG 3GO5A 5JJIA 4LF4L 5CV9A 3P75A 5C4HA 2QEXA 3HOVB 3J7YW 1TR5A 3ULPA 4Y7NB 3K0YA 3ND9A 1CUKA 1TVXA 3IKJA 5AFWA 3OTOL 2IW3A 2K5QA 1WTVA 2LXJA 2K1BA 2NVTB 3BVZA 4A3LG 3K7AH 3OWFA 3A8KE 4A3FB 2DJGC 4FF2A 2E2HH 3BYYB 4IJLA 3SK6A 2EYLA 4OWWB 3KDFA 2F3WA 3CPFA 1AW7A 5EGTA 4A3CG 1RIPA 2MP1A 1LLRD 2UXBL 3IL8A 1FGUA 2Q2TA 4BBRG 3DEPA 1HA6A 2NTSA 5ELBA 2VZAA 2VQEQ 1SJHD 5EBDA 3S17B 2JA7B 3NSWA 4BBSH 1I4PA 4A3KH 1PYBA 4GLVB 4LF6L 1SSOA 1IKLA 1LT4D 2L11A 4XIGS 4C3JG 3GTQH 4YWLA 1QUQB 1XMQQ 1GM5A 1PH4A 1UE7A 3PO3H 4O42A 1RDPD 4XQNA 3TP5A 1JWMD 1LT6D 3NPPA 2I46A 3KF6A 3AFQA 5M9OA 4IURA 1XMOL 4C3IG 3FHWA 2K5DA 4BY1H 4QY7A 2A68C 4BWGB 1IBKQ 2IX3A 5IYCG 1WTQA 5FLXL 3M4PA 1EYCA 3N6RA 3UDIA 2JXMB 2YU9H 4KY7A 3V96A 2B63B 4JCVE 1UEAB 2JYOA 2LS01 1F2YA 1UUPA 4DV1L 1QILA 2Z0SA 4YCWA 3H6MA 2B2WC 1IYUA 4JVZA 4JI8Q 5AJ3Q 5DM73 4DR1L 1KABA 1MHWC 2RF4A 3ERSX 4JV5Q 3D3RA 4KD3A 2KCCA 4LJZC 2B2TA 3IRBA 5LL6S 4EQNA 1C7YA 1XPOA 1HTLD 3U50C 3J81E 3CCQA 1KXLA 2BH8A 2IHEA 3HOZG 3MTSA 3S16H 2UXCL 4K5XA 2D5DA 2RDFA 5C44H 4RGOS 3BDLA 2FMMA 2JA8G 4GOPC 4POGA 3TBIB 1KNAA 3SEBA 2K52A 1TS3A 1E2ZA 2N55A 4RKBA 3GTGH 3J80c 4X3KA 3M4OH 4I65A 4QUCA 3U9SA 4NKLA 2DUDA 5C3EG 5LMNQ 1EIHA 4IFDG 1HUNA 1JCKB 1L1OC 2CH4W 2F0KA 4BS9A 3BS1A 4GKKQ 4G57A 1QVCA 3G6EA 2K32A 2A74C 2B2YA 3LX0A 1L0WA 3S1RH 1K83B 2L9HA 1A63A 5BN3A 3PIP3 4C1NI 2QGQA 2E2IH 4JI7L 1I4RA 1GVPA 3RMHA 1E2VA 4JOIA 3S2DB 4FF4A 2HCIA 3A7AB 3JAMc 1QUQA 5C4XH 3S1MH 3CMAA 1PFSA 4R4IA 4FXGC 1UE1A 2Z6KA 4B9WA 3HOWH 1I94Q 4C3JB 2F0FA 3HOXH 3OMCA 2AWOA 2PNRC 4TKOB 2OTJA 1EWCA 4GNXC 1WJJA 2PI2E 1TWGH 1JJCB 5DLQE 2O2LD 2F0DA 1CHQD 1CFMA 4KN7C 4DK3C 1JJ2A 1OXXK 4C3IB 1U5KA 3K57A 1YI2A 1G291 4DR3L 4RA8A 3L3OC 4JI3L 3FKIB 1SAPA 3F2BA 3STBD 3VR5A 1WI5A 3NBHA 1I4GA 3J81j 2IJ0A 4TQUS 3CCLA 4N8X1 2OEOA 3K0XA 4XDXA 5M3FG 1ICFB 1M8AA 1HNWQ 3GD7A 4KMUC 1DYQA 1PV4A 2A8VA 2R3ZA 5EKIA 4PZ7A 1VQ8A 3I91A 1DOMA 2ZTEA 4JPBW 3H94A 2N88A 1J5EL 2MO1A 5J3BA 2HD3A 3W5OA 1PDQA 2HDLA 2I5MX 2JP1A 4R8IA 5JJKA 1RJTA 1W3SA 2NN6G 5M5XH 3TP8A 3J7AF 4CKCA 4F88A 1KC8C 1CT1D 2EY2A 1C9OA 3TS0A 1XYIA 3UDFA 1HNZL 1YEZA 2PNHA 2JA8B 3SK5A 1M4VA 1D5ZC 2R92G 3CCRA 5JJLA 1LM0A 4DV5Q 2F0IA 3I4LA 4B3MQ 1CQVA 3CD6A 2Z9HA 2ZM6L 1N34Q 1EIGA 3NQTA 2B2TC 1TIID 1PZID 2GVAA 1JWSD 4FVMA 3BZCA 1QOHA 1ZKOA 5C4JH 2K14A 3V05A 2HQLA 5C0XH 1LUZA 4KN4C 3KJOA 2A73B 4KKTA 2F0NA 2B39A 4TRDA 1GHKA 2PMZE 4V0BA 5E3FA 4C3HH 3MHBA 2CH4A 2L55A 1HCZA 5CV8A 5JEAH 2HCCA 4NXNQ 3VR4A 4ZCKA 2B2YC 1HUMA 1DD2A 2Q8RE 1M90C 2B2VA 3K80C 1L0XB 3C46A 4DXFA 2X6LA 4LF4Q 2Z6BA 3NTKA 4JG2A 1SNPA 1E2WA
chains in the Genus database with same CATH topology
1X3EA 1FVIA 3RLNA 1XPRA 1SE8A 2HIVA 4OWXB 2YTVA 5C3EH 2UUCL 5JEAJ 5ELNA 1IZ6A 3CCJA 1HNXQ 3CC2A 1N32Q 1GO3E 4X64Q 1IXRA 2I0QA 2IX1A 2IY5B 4C2MH 2VQFQ 4BBSG 2ASBA 2AHOB 4LF7Q 4X66Q 1JJGA 3F1ZA 4OWTB 4DR5L 4AQYL 1W2BA 4OO1I 4A3KG 1QZGA 4A3JG 1H95A 1QVFA 1OXTA 4LUZA 2CKZB 4PMWA 1VQOA 1YJWA 1B70B 1HZ9A 4KHPL 4WJ3M 1SLJA 2VQEL 2ES2A 2VS1A 1VQGA 4DUYQ 3GDEA 4DV3L 1PH8A 1IBMQ 4LF9L 1G51A 3HOVG 4DV2L 3OW2A 2UXBQ 2XTIA 5HY6A 1YIJA 1N8RC 2UUAQ 1CKOA 3CQZH 2K5HA 1L2FA 2UUBQ 3ULJA 3D0FA 4A3DG 1E22A 3MXNB 2KCTA 1EQQA 3KYHC 3TEHB 3I56A 3PIPA 4L5QA 1VQIA 4YHHL 2NN6I 4OX9Q 3K8AA 2KHJA 1HJPA 3D31A 5GROA 4XTCS 4LUOA 4BY1G 5IP9G 3E0EA 3M85A 4X65Q 3I4NH 4K0KQ 1E1TA 4HJAA 4H02A 3JC66 4LFAL 4X62Q 4LF5Q 5C0XI 1HNWL 2VUMH 1BVSA 1Q12A 1PYSB 3S1NH 1Y1WG 4LF6Q 1YITA 3A5ZB 2JJQA 2N49A 2ZTDA 2K50A 4A3JH 1KL9A 1NJIC 3I7FA 3PGZA 4OXPA 1TWCH 1X3GA 1WFQA 4JI3Q 5IWAL 4KHZA 4GN5A 1WYDA 4NXML 4P73A 4UY8C 1VQ9A 4Y52H 2RHQB 2K75A 5IYBG 4A3DH 3KDFB 3M3YH 3H15A 1WCMG 4Y7NH 1NBWA 2ZTCA 1PH6A 1JMCA 4BY7G 1GD7A 2KCMA 5ELOA 2JA5H 4BXXG 1XNQL 2NVTH 1XMOQ 1IBLL 1I50H 1NE3A 2IT1A 3KOJA 4LW1A 2JA7G 4JYAQ 2VNUD 3EN2A 3A0JA 1J5EQ 4A3FH 4JI8L 5IP9H 3I4OA 2Q2IA 1N9WA 3Q8DA 4DPGA 2B29A 1T9HA 1X54A 3CP0A 3OYYA 4JC0A 3RN2A 3GTPH 2OQ0A 1EIFA 4DR4L 4JI0Q 3FKIG 5FLMH 2D0OA 5H1SE 4DV7L 3TS2A 4JV5L 3HKZE 2KBNA 3K7UC 2EIFA 1N36L 4DV5L 2BA0A 1TWFH 3U4ZA 4JBKA 4B3ML 3HOUG 4JI5L 3PO2G 1AE3A 2UXDL 5C44G 1PH9A 3M4QA 1P8LA 5M5YH 4A3EG 2PI2A 4DR1Q 4BA2I 4GN4B 1J6QA 1TXYA 3PUVA 3PF5A 2D62A 3CPWA 3RN5A 1HR0Q 1K9MC 1FJGQ 4B3TL 4B3SL 4BY7H 4DV0Q 3UDGA 1WOCA 3CCSA 1I5FA 4KLKA 1EUJA 1QZHA 3PIOA 1VQHA 2NZHA 2JA7H 3PF4A 3S17H 1EQRA 3KLWA 4A3IG 4O0AA 3S2HH 5LMUL 1K73C 2B63G 1I3QH 2RCNA 1XNRQ 2K5NA 2BH2A 3T1YQ 4LF8Q 1CSPA 1OXUA 1R9TH 3PUYA 1VQ4A 1Y14B 2UU9Q 2ZJPA 3AQQA 1P16A 2ID0A 4P74A 4R4OA 1PH3A 4YY3Q 4P75A 3CCVA 2HHHQ 1N33L 1I6HH 2UXCQ 2LSSA 3CAMA 2EXDA 1EIYB 2HIXA 1X9NA 2Q2HA 3HOUH 3NELA 3CC4A 1AH9A 3PO2H 4GOPA 2VL6A 2K4KA 1OXSC 4GKJQ 2NVYH 5HGQA 3KF8B 2OQKA 5C4XG 2YYZA 5LMNW 3GTJH 1MJEA 1Q1EA 4B3RL 1VQDA 3G4SA 1VQAA 2ZJRA 3AEVA 2CWPA 2KHIA 3B6YA 3HOYG 5K36G 3GO5A 3HOXG 2B63H 5JJIA 4LF4L 2E8GA 2XGTA 2QEXA 4HIDA 1Q46A 4JBWA 4JI4L 1EYGA 1KRTA 2K5VA 2F4VQ 3ULPA 1Q82C 4QJFA 1A62A 1CUKA 1O7IA 2KENA 1HNXL 4JI7Q 1N32L 3OTOL 1Z9FA 4DUZQ 2LXJA 1I94L 3I4MH 4RMFA 3KFUA 4A3LG 3K7AH 3AFPA 2MNAA 4GN3B 4MZ9A 2VQFL 3H0GG 4JI2Q 3WWVA 4LF7L 5IYDG 3PUWA 2MO0A 4X66L 5FLXc 2CCZA 2E2HH 1YZ6A 4IJLA 1E24A 4GOPB 4RG1A 4QQBX 2BA1A 1X6OA 4OWWB 3KDFA 2JK8A 3AYHB 4UP8A 2R6GA 2WFWA 1YVCA 3CPFA 2D0PA 1S72A 1NMFA 3W1GA 4A3CG 1RIPA 4JI1L 1TWHH 3RNUA 1V9PA 2F52A 3CW2C 2JEAI 2UXBL 3DM3A 3PO3G 2UUAL 1FGUA 2CFMA 1YBYA 4YWMA 4BBRG 2Q2TA 2UUBL 2VY3A 1ASZA 4J15A 4ME3A 2MQHA 4DR2Q 2VZAA 3L2PA 2JQOA 3G71A 2VQEQ 4OX9L 4DV3Q 3T1HQ 4BBSH 4K0KL 4X65L 3W1BA 2WAQE 4DR3Q 4HIMA 4HJ9A 3H0GH 4X62L 4LF5L 4A3KH 1PYBA 5IYDH 2WAQG 3BJUA 4WJ4A 5BR8Q 4GLVB 1UE6A 4LF6L 3STBC 1S40A 3EIVA 4DKAC 4XIGS 3VDYA 2R93G 4YHHQ 4DV4Q 3RLFA 3BZKA 4YCVA 4YWLA 3GTQH 1VQNA 3HOVH 2JA6G 1QVGA 4DAYB 1QUQB 3GTOH 5IP7G 4A3CH 1JT8A 1NMGA 2CWAA 1XMQQ 1GM5A 1PH4A 3J7ZC 1K83H 1UE7A 2WP8J 3PO3H 1XJVA 3S15H 2A1AA 2DGYA 2AWNA 3K81C 4NPSA 1PH7A 4A3GG 1DGSA 1VQFA 4GLAC 4UPAA 3CCUA 1EWIA 2IX0A 4GNXB 1VQKA 1D7QA 3KF6A 3AFQA 2WB1E 2EQSA 5IWAQ 1XMOL 3S2DH 3FHWA 4BY1H 4JYAL 4QY7A 2WB1G 4HIOA 1IBKQ 5IYCG 5GADC 1X56A 3M4PA 3UDIA 4LFCQ 2YU9H 4UP9A 1Y1WH 4R4QA 2R7DA 4JCVE 2GVBA 1S3OA 5GQOA 3S14H 1GKHA 4JI0L 3SGIA 3HKZG 1XPUA 1VQ7A 2E2JH 4DV1L 2E5LL 2Z0SA 4YCWA 1N34L 1IBLQ 4JI6Q 2R93H 1EOVA 2QA4A 2HT1A 4JI8Q 5IP7H 1HNZQ 4MNOA 5AJ3Q 1BKBA 5GAGC 5IYBH 3NEMA 3CCEA 3RZOH 4A93G 1WCMH 1G6PA 4DR1L 4LFBQ 2RF4A 2AMCB 4BXXH 1HR0L 3ERSX 4JV5Q 3U58A 1CKNA 2ZM6Q 1MKHA 1SMXA 3IRBA 1C7YA 1KD1C 4C3IH 3CMEA 1XPOA 2FXQA 2UXDQ 2I5LX 3UDXA 4DR7Q 3U50C 1SN8A 3KF6B 3CCQA 1XNRL 2BH8A 3J81c 2OWOA 2IHEA 3TREA 3T1YL 4LF8L 3HOZG 1RL2A 1KXLA 3FKIH 1E7ZA 1UWVA 3LGJA 4A75A 1K8GA 4B3SQ 2NZOA 2YTXA 3S16H 2UXCL 1SRUA 3HFZB 5M3MG 1HZBA 3BU2A 3PUZA 4YY3L 1K8AC 2HHHL 1C0AA 1D8LA 5C44H 2JA8G 5LMUQ 1AE2A 3A5UA 4A3EH 4GOPC 4POGA 4NXNL 4A3BG 4DR6Q 2K52A 2JEBI 4GKJL 2IHFA 4A3MG 3GTGH 3PUXA 3J80c 3M4OH 3S1QH 1L1OA 5LMNQ 2DUDA 5C3EG 3DLLA 4DV6Q 1N33Q 4IFDG 1OXVA 1KHIA 4OONA 1L1OC 4A3IH 3HOWG 4P71A 2B3GA 2OCEA 3ZJYC 4GKKQ 3G6EA 1QVCA 2JA9A 4GS3A 3ICEA 1CKNB 4BA1I 1SFOH 1L0WA 3S1RH 4A4IA 1BBWA 1Y1VG 2N78A 3GTLH 1A63A 1YNXA 2F4VL 3NENA 1MIUA 1X3FA 4YCUA 3CXCA 4APVA 1K0RA 2QGQA 4X64L 4IOAA 3S24A 2E2IH 4B3RQ 4JI7L 1GVPA 4ALPA 4JOIA 2JA8H 1ASYA 2YTYA 4DAMA 2R7ZG 3HKSA 3JAMc 1Q7YC 1QUQA 4JOIC 5C4XH 3CMAA 4JI2L 4JI4Q 4HJ5A 3S1MH 2UUCQ 1KRSA 3EBEA 1B8AA 1PFSA 2RHSB 4R4IA 1EFWA 1UE1A 4DUYL 4L5TA 1IBML 3HOYH 1VQLA 2Z6KA 1YHAA 3OTOQ 3RZDH 1VQCA 1KIXA 1I94Q 3HOWH 1HZCA 3HOXH 4GNXA 1L1OB 2AWOA 2NVQH 3I4NG 2Z6KC 2OTJA 4R4CA 4GNXC 1WJJA 4HJ7A 4DR5Q 4AQYQ 1X55A 2PI2E 4JBJA 2VUMG 2LXKA 1TWGH 4PZ6A 1Y1VH 4DK6C 2N8NA 4LUVA 4PG3A 4KHPQ 1JJCB 3I2ZA 1MJCA 4TVAB 5DLQE 5IE8A 3TQYA 1VCIA 4DR2L 4LF9Q 2R7FA 5EAYA 4QIWE 1VQ5A 3J81i 1PVOA 4R1JA 4DV2Q 4A3LH 4DK3C 1JJ2A 1SROA 1SR3A 4JI1Q 1VQMA 3T1HL 1OXXK 1U5KA 2V1CC 3U4VA 4YWKA 1UE5A 2A19A 4EQ5A 4IFDJ 1YI2A 1G291 4DR3L 3F2DA 1HZAA 4P72A 4JI3L 5BR8L 3GTKH 5E7NA 3F2BA 3CF5A 2Q2UA 2H5XA 3STBD 1YJ9A 1WI5A 2JA5G 4L5SA 2N3SA 4DV4L 3J81j 4LNQA 4TQUS 2R7ZH 3CCLA 4JBMA 1PA6A 1PH5A 3J7A5 3J80i 3K0XA 4LFAQ 4A3FG 1NTGA 1A0IA 4QGUA 5M3FG 1XMQL 1HNWQ 4BBRH 1B7YB 3GD7A 2JE6I 4OO1G 1A8VA 2CQOA 1E1OA 5GAHC 1Q86C 1LYLA 3TRZA 1IYJB 1PV4A 2A8VA 3ER0A 1Q81C 5FLMG 3GTMH 1UEBA 4PZ7A 1VQ8A 1YJNA 2ZTEA 5IY0A 2NVXH 1J5EL 3PCOB 4PZ8A 4NXMQ 4IPHA 4O2DA 1NY4A 2GN5A 4MTNA 1IBKL 2MO1A 5FJ8G 2AKWB 5J3BA 4LFCL 1CSQA 1VS0A 3F2CA 3W5OA 1VQEA 4IPGA 2I5MX 1VQPA 1YHQA 3A74A 5JJKA 1PH2A 1XNQQ 1W3SA 4C3JH 1IL2A 2NN6G 3M9BA 5M5XH 1PHJA 2JA6H 3I55A 4AH6A 3FP9A 4QL5A 3JAMi 1X65A 1KC8C 4JI6L 3TS0A 1C9OA 1JE5A 5IT9c 3UDFA 3RR5A 4POFA 4FDBA 1YEZA 5C0XG 5AJ3L 2PNHA 3NBHB 5M3FH 5M5WH 1HNZL 4DR4Q 4DV7Q 3H3VI 3MEFA 1FJGL 2YV5A 4A3GH 1VQBA 2L15A 4LFBL 4A76A 4DV0L 1K3RA 3ULLA 4NB3A 3UE1A 2R92G 3CCRA 4R4TA 5JJLA 1LM0A 4LWCA 4DV5Q 3CCMA 4IOCA 1N36Q 4B3MQ 2E5LQ 3CD6A 4AIMA 2ZM6L 4DV1Q 1N34Q 4JI5Q 3M7NA 5IYCH 4L5RC 4IFDI 1Q8KA 4DNIA 4EX5A 3L7ZC 3CC7A 5JEAG 5FJ8H 3KJPA 4DR7L 2GVAA 5GAEC 1OTCA 1VQ6A 1HR0W 2UU9L 2PQAA 4B3TQ 1U0LA 3BZCA 1XTDA 1KAWA 4IO9A 1Z47A 3UE0A 5C4JH 2C35B 2ALYB 1HH2P 2K14A 2OTLA 4A93H 4HIKA 2HQLA 1JB7A 4KI0A 2F3IA 1LUZA 4DR6L 1CKMA 3G48A 3KJOA 2R92H 4UP7A 1PH1A 5LMNL 4DV6L 2MFIA 2PMZE 4C3HH 1YHBA 2ZJQA 1V43A 4IPCA 3F8TA 3PSIA 4IJHA 3I4MG 1KQSA 2VW9A 2ATWA 4IPDA 4GKKL 3HOZH 4NXNQ 1E3PA 3E9HA 3E9IA 4X6AH 2I5HA 3RLOA 1M90C 5C0XJ 5M3MH 4AYBE 1BBUA 4DUZL 4HJ8A 3K80C 1Q1BA 1V1QA 2PQAB 4AYBG 2Y0SE 3PV0A 4LF4Q 4A3BH 1VQJA 4GLXA 1FL0A 3L0OA 4JG2A 3H3VH 1LTLA 2Y0SG 1TWAH 4A3MH 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3E A;  1FVI A;  3RLN A;  1XPR A;  1SE8 A;  2HIV A;  4OWX B;  2YTV A;  5C3E H;  2UUC L;  5JEA J;  5ELN A;  1IZ6 A;  3CCJ A;  1HNX Q;  3CC2 A;  1N32 Q;  1GO3 E;  4X64 Q;  1IXR A;  2I0Q A;  2IX1 A;  2IY5 B;  4C2M H;  2VQF Q;  4BBS G;  2ASB A;  2AHO B;  4LF7 Q;  4X66 Q;  1JJG A;  3F1Z A;  4OWT B;  4DR5 L;  4AQY L;  1W2B A;  4OO1 I;  4A3K G;  1QZG A;  4A3J G;  1H95 A;  1QVF A;  1OXT A;  4LUZ A;  2CKZ B;  4PMW A;  1VQO A;  1YJW A;  1B70 B;  1HZ9 A;  4KHP L;  4WJ3 M;  1SLJ A;  2VQE L;  2ES2 A;  2VS1 A;  1VQG A;  4DUY Q;  3GDE A;  4DV3 L;  1PH8 A;  1IBM Q;  4LF9 L;  1G51 A;  3HOV G;  4DV2 L;  3OW2 A;  2UXB Q;  2XTI A;  5HY6 A;  1YIJ A;  1N8R C;  2UUA Q;  1CKO A;  3CQZ H;  2K5H A;  1L2F A;  2UUB Q;  3ULJ A;  3D0F A;  4A3D G;  1E22 A;  3MXN B;  2KCT A;  1EQQ A;  3KYH C;  3TEH B;  3I56 A;  3PIP A;  4L5Q A;  1VQI A;  4YHH L;  2NN6 I;  4OX9 Q;  3K8A A;  2KHJ A;  1HJP A;  3D31 A;  5GRO A;  4XTC S;  4LUO A;  4BY1 G;  5IP9 G;  3E0E A;  3M85 A;  4X65 Q;  3I4N H;  4K0K Q;  1E1T A;  4HJA A;  4H02 A;  3JC6 6;  4LFA L;  4X62 Q;  4LF5 Q;  5C0X I;  1HNW L;  2VUM H;  1BVS A;  1Q12 A;  1PYS B;  3S1N H;  1Y1W G;  4LF6 Q;  1YIT A;  3A5Z B;  2JJQ A;  2N49 A;  2ZTD A;  2K50 A;  4A3J H;  1KL9 A;  1NJI C;  3I7F A;  3PGZ A;  4OXP A;  1TWC H;  1X3G A;  1WFQ A;  4JI3 Q;  5IWA L;  4KHZ A;  4GN5 A;  1WYD A;  4NXM L;  4P73 A;  4UY8 C;  1VQ9 A;  4Y52 H;  2RHQ B;  2K75 A;  5IYB G;  4A3D H;  3KDF B;  3M3Y H;  3H15 A;  1WCM G;  4Y7N H;  1NBW A;  2ZTC A;  1PH6 A;  1JMC A;  4BY7 G;  1GD7 A;  2KCM A;  5ELO A;  2JA5 H;  4BXX G;  1XNQ L;  2NVT H;  1XMO Q;  1IBL L;  1I50 H;  1NE3 A;  2IT1 A;  3KOJ A;  4LW1 A;  2JA7 G;  4JYA Q;  2VNU D;  3EN2 A;  3A0J A;  1J5E Q;  4A3F H;  4JI8 L;  5IP9 H;  3I4O A;  2Q2I A;  1N9W A;  3Q8D A;  4DPG A;  2B29 A;  1T9H A;  1X54 A;  3CP0 A;  3OYY A;  4JC0 A;  3RN2 A;  3GTP H;  2OQ0 A;  1EIF A;  4DR4 L;  4JI0 Q;  3FKI G;  5FLM H;  2D0O A;  5H1S E;  4DV7 L;  3TS2 A;  4JV5 L;  3HKZ E;  2KBN A;  3K7U C;  2EIF A;  1N36 L;  4DV5 L;  2BA0 A;  1TWF H;  3U4Z A;  4JBK A;  4B3M L;  3HOU G;  4JI5 L;  3PO2 G;  1AE3 A;  2UXD L;  5C44 G;  1PH9 A;  3M4Q A;  1P8L A;  5M5Y H;  4A3E G;  2PI2 A;  4DR1 Q;  4BA2 I;  4GN4 B;  1J6Q A;  1TXY A;  3PUV A;  3PF5 A;  2D62 A;  3CPW A;  3RN5 A;  1HR0 Q;  1K9M C;  1FJG Q;  4B3T L;  4B3S L;  4BY7 H;  4DV0 Q;  3UDG A;  1WOC A;  3CCS A;  1I5F A;  4KLK A;  1EUJ A;  1QZH A;  3PIO A;  1VQH A;  2NZH A;  2JA7 H;  3PF4 A;  3S17 H;  1EQR A;  3KLW A;  4A3I G;  4O0A A;  3S2H H;  5LMU L;  1K73 C;  2B63 G;  1I3Q H;  2RCN A;  1XNR Q;  2K5N A;  2BH2 A;  3T1Y Q;  4LF8 Q;  1CSP A;  1OXU A;  1R9T H;  3PUY A;  1VQ4 A;  1Y14 B;  2UU9 Q;  2ZJP A;  3AQQ A;  1P16 A;  2ID0 A;  4P74 A;  4R4O A;  1PH3 A;  4YY3 Q;  4P75 A;  3CCV A;  2HHH Q;  1N33 L;  1I6H H;  2UXC Q;  2LSS A;  3CAM A;  2EXD A;  1EIY B;  2HIX A;  1X9N A;  2Q2H A;  3HOU H;  3NEL A;  3CC4 A;  1AH9 A;  3PO2 H;  4GOP A;  2VL6 A;  2K4K A;  1OXS C;  4GKJ Q;  2NVY H;  5HGQ A;  3KF8 B;  2OQK A;  5C4X G;  2YYZ A;  5LMN W;  3GTJ H;  1MJE A;  1Q1E A;  4B3R L;  1VQD A;  3G4S A;  1VQA A;  2ZJR A;  3AEV A;  2CWP A;  2KHI A;  3B6Y A;  3HOY G;  5K36 G;  3GO5 A;  3HOX G;  2B63 H;  5JJI A;  4LF4 L;  2E8G A;  2XGT A;  2QEX A;  4HID A;  1Q46 A;  4JBW A;  4JI4 L;  1EYG A;  1KRT A;  2K5V A;  2F4V Q;  3ULP A;  1Q82 C;  4QJF A;  1A62 A;  1CUK A;  1O7I A;  2KEN A;  1HNX L;  4JI7 Q;  1N32 L;  3OTO L;  1Z9F A;  4DUZ Q;  2LXJ A;  1I94 L;  3I4M H;  4RMF A;  3KFU A;  4A3L G;  3K7A H;  3AFP A;  2MNA A;  4GN3 B;  4MZ9 A;  2VQF L;  3H0G G;  4JI2 Q;  3WWV A;  4LF7 L;  5IYD G;  3PUW A;  2MO0 A;  4X66 L;  5FLX c;  2CCZ A;  2E2H H;  1YZ6 A;  4IJL A;  1E24 A;  4GOP B;  4RG1 A;  4QQB X;  2BA1 A;  1X6O A;  4OWW B;  3KDF A;  2JK8 A;  3AYH B;  4UP8 A;  2R6G A;  2WFW A;  1YVC A;  3CPF A;  2D0P A;  1S72 A;  1NMF A;  3W1G A;  4A3C G;  1RIP A;  4JI1 L;  1TWH H;  3RNU A;  1V9P A;  2F52 A;  3CW2 C;  2JEA I;  2UXB L;  3DM3 A;  3PO3 G;  2UUA L;  1FGU A;  2CFM A;  1YBY A;  4YWM A;  4BBR G;  2Q2T A;  2UUB L;  2VY3 A;  1ASZ A;  4J15 A;  4ME3 A;  2MQH A;  4DR2 Q;  2VZA A;  3L2P A;  2JQO A;  3G71 A;  2VQE Q;  4OX9 L;  4DV3 Q;  3T1H Q;  4BBS H;  4K0K L;  4X65 L;  3W1B A;  2WAQ E;  4DR3 Q;  4HIM A;  4HJ9 A;  3H0G H;  4X62 L;  4LF5 L;  4A3K H;  1PYB A;  5IYD H;  2WAQ G;  3BJU A;  4WJ4 A;  5BR8 Q;  4GLV B;  1UE6 A;  4LF6 L;  3STB C;  1S40 A;  3EIV A;  4DKA C;  4XIG S;  3VDY A;  2R93 G;  4YHH Q;  4DV4 Q;  3RLF A;  3BZK A;  4YCV A;  4YWL A;  3GTQ H;  1VQN A;  3HOV H;  2JA6 G;  1QVG A;  4DAY B;  1QUQ B;  3GTO H;  5IP7 G;  4A3C H;  1JT8 A;  1NMG A;  2CWA A;  1XMQ Q;  1GM5 A;  1PH4 A;  3J7Z C;  1K83 H;  1UE7 A;  2WP8 J;  3PO3 H;  1XJV A;  3S15 H;  2A1A A;  2DGY A;  2AWN A;  3K81 C;  4NPS A;  1PH7 A;  4A3G G;  1DGS A;  1VQF A;  4GLA C;  4UPA A;  3CCU A;  1EWI A;  2IX0 A;  4GNX B;  1VQK A;  1D7Q A;  3KF6 A;  3AFQ A;  2WB1 E;  2EQS A;  5IWA Q;  1XMO L;  3S2D H;  3FHW A;  4BY1 H;  4JYA L;  4QY7 A;  2WB1 G;  4HIO A;  1IBK Q;  5IYC G;  5GAD C;  1X56 A;  3M4P A;  3UDI A;  4LFC Q;  2YU9 H;  4UP9 A;  1Y1W H;  4R4Q A;  2R7D A;  4JCV E;  2GVB A;  1S3O A;  5GQO A;  3S14 H;  1GKH A;  4JI0 L;  3SGI A;  3HKZ G;  1XPU A;  1VQ7 A;  2E2J H;  4DV1 L;  2E5L L;  2Z0S A;  4YCW A;  1N34 L;  1IBL Q;  4JI6 Q;  2R93 H;  1EOV A;  2QA4 A;  2HT1 A;  4JI8 Q;  5IP7 H;  1HNZ Q;  4MNO A;  5AJ3 Q;  1BKB A;  5GAG C;  5IYB H;  3NEM A;  3CCE A;  3RZO H;  4A93 G;  1WCM H;  1G6P A;  4DR1 L;  4LFB Q;  2RF4 A;  2AMC B;  4BXX H;  1HR0 L;  3ERS X;  4JV5 Q;  3U58 A;  1CKN A;  2ZM6 Q;  1MKH A;  1SMX A;  3IRB A;  1C7Y A;  1KD1 C;  4C3I H;  3CME A;  1XPO A;  2FXQ A;  2UXD Q;  2I5L X;  3UDX A;  4DR7 Q;  3U50 C;  1SN8 A;  3KF6 B;  3CCQ A;  1XNR L;  2BH8 A;  3J81 c;  2OWO A;  2IHE A;  3TRE A;  3T1Y L;  4LF8 L;  3HOZ G;  1RL2 A;  1KXL A;  3FKI H;  1E7Z A;  1UWV A;  3LGJ A;  4A75 A;  1K8G A;  4B3S Q;  2NZO A;  2YTX A;  3S16 H;  2UXC L;  1SRU A;  3HFZ B;  5M3M G;  1HZB A;  3BU2 A;  3PUZ A;  4YY3 L;  1K8A C;  2HHH L;  1C0A A;  1D8L A;  5C44 H;  2JA8 G;  5LMU Q;  1AE2 A;  3A5U A;  4A3E H;  4GOP C;  4POG A;  4NXN L;  4A3B G;  4DR6 Q;  2K52 A;  2JEB I;  4GKJ L;  2IHF A;  4A3M G;  3GTG H;  3PUX A;  3J80 c;  3M4O H;  3S1Q H;  1L1O A;  5LMN Q;  2DUD A;  5C3E G;  3DLL A;  4DV6 Q;  1N33 Q;  4IFD G;  1OXV A;  1KHI A;  4OON A;  1L1O C;  4A3I H;  3HOW G;  4P71 A;  2B3G A;  2OCE A;  3ZJY C;  4GKK Q;  3G6E A;  1QVC A;  2JA9 A;  4GS3 A;  3ICE A;  1CKN B;  4BA1 I;  1SFO H;  1L0W A;  3S1R H;  4A4I A;  1BBW A;  1Y1V G;  2N78 A;  3GTL H;  1A63 A;  1YNX A;  2F4V L;  3NEN A;  1MIU A;  1X3F A;  4YCU A;  3CXC A;  4APV A;  1K0R A;  2QGQ A;  4X64 L;  4IOA A;  3S24 A;  2E2I H;  4B3R Q;  4JI7 L;  1GVP A;  4ALP A;  4JOI A;  2JA8 H;  1ASY A;  2YTY A;  4DAM A;  2R7Z G;  3HKS A;  3JAM c;  1Q7Y C;  1QUQ A;  4JOI C;  5C4X H;  3CMA A;  4JI2 L;  4JI4 Q;  4HJ5 A;  3S1M H;  2UUC Q;  1KRS A;  3EBE A;  1B8A A;  1PFS A;  2RHS B;  4R4I A;  1EFW A;  1UE1 A;  4DUY L;  4L5T A;  1IBM L;  3HOY H;  1VQL A;  2Z6K A;  1YHA A;  3OTO Q;  3RZD H;  1VQC A;  1KIX A;  1I94 Q;  3HOW H;  1HZC A;  3HOX H;  4GNX A;  1L1O B;  2AWO A;  2NVQ H;  3I4N G;  2Z6K C;  2OTJ A;  4R4C A;  4GNX C;  1WJJ A;  4HJ7 A;  4DR5 Q;  4AQY Q;  1X55 A;  2PI2 E;  4JBJ A;  2VUM G;  2LXK A;  1TWG H;  4PZ6 A;  1Y1V H;  4DK6 C;  2N8N A;  4LUV A;  4PG3 A;  4KHP Q;  1JJC B;  3I2Z A;  1MJC A;  4TVA B;  5DLQ E;  5IE8 A;  3TQY A;  1VCI A;  4DR2 L;  4LF9 Q;  2R7F A;  5EAY A;  4QIW E;  1VQ5 A;  3J81 i;  1PVO A;  4R1J A;  4DV2 Q;  4A3L H;  4DK3 C;  1JJ2 A;  1SRO A;  1SR3 A;  4JI1 Q;  1VQM A;  3T1H L;  1OXX K;  1U5K A;  2V1C C;  3U4V A;  4YWK A;  1UE5 A;  2A19 A;  4EQ5 A;  4IFD J;  1YI2 A;  1G29 1;  4DR3 L;  3F2D A;  1HZA A;  4P72 A;  4JI3 L;  5BR8 L;  3GTK H;  5E7N A;  3F2B A;  3CF5 A;  2Q2U A;  2H5X A;  3STB D;  1YJ9 A;  1WI5 A;  2JA5 G;  4L5S A;  2N3S A;  4DV4 L;  3J81 j;  4LNQ A;  4TQU S;  2R7Z H;  3CCL A;  4JBM A;  1PA6 A;  1PH5 A;  3J7A 5;  3J80 i;  3K0X A;  4LFA Q;  4A3F G;  1NTG A;  1A0I A;  4QGU A;  5M3F G;  1XMQ L;  1HNW Q;  4BBR H;  1B7Y B;  3GD7 A;  2JE6 I;  4OO1 G;  1A8V A;  2CQO A;  1E1O A;  5GAH C;  1Q86 C;  1LYL A;  3TRZ A;  1IYJ B;  1PV4 A;  2A8V A;  3ER0 A;  1Q81 C;  5FLM G;  3GTM H;  1UEB A;  4PZ7 A;  1VQ8 A;  1YJN A;  2ZTE A;  5IY0 A;  2NVX H;  1J5E L;  3PCO B;  4PZ8 A;  4NXM Q;  4IPH A;  4O2D A;  1NY4 A;  2GN5 A;  4MTN A;  1IBK L;  2MO1 A;  5FJ8 G;  2AKW B;  5J3B A;  4LFC L;  1CSQ A;  1VS0 A;  3F2C A;  3W5O A;  1VQE A;  4IPG A;  2I5M X;  1VQP A;  1YHQ A;  3A74 A;  5JJK A;  1PH2 A;  1XNQ Q;  1W3S A;  4C3J H;  1IL2 A;  2NN6 G;  3M9B A;  5M5X H;  1PHJ A;  2JA6 H;  3I55 A;  4AH6 A;  3FP9 A;  4QL5 A;  3JAM i;  1X65 A;  1KC8 C;  4JI6 L;  3TS0 A;  1C9O A;  1JE5 A;  5IT9 c;  3UDF A;  3RR5 A;  4POF A;  4FDB A;  1YEZ A;  5C0X G;  5AJ3 L;  2PNH A;  3NBH B;  5M3F H;  5M5W H;  1HNZ L;  4DR4 Q;  4DV7 Q;  3H3V I;  3MEF A;  1FJG L;  2YV5 A;  4A3G H;  1VQB A;  2L15 A;  4LFB L;  4A76 A;  4DV0 L;  1K3R A;  3ULL A;  4NB3 A;  3UE1 A;  2R92 G;  3CCR A;  4R4T A;  5JJL A;  1LM0 A;  4LWC A;  4DV5 Q;  3CCM A;  4IOC A;  1N36 Q;  4B3M Q;  2E5L Q;  3CD6 A;  4AIM A;  2ZM6 L;  4DV1 Q;  1N34 Q;  4JI5 Q;  3M7N A;  5IYC H;  4L5R C;  4IFD I;  1Q8K A;  4DNI A;  4EX5 A;  3L7Z C;  3CC7 A;  5JEA G;  5FJ8 H;  3KJP A;  4DR7 L;  2GVA A;  5GAE C;  1OTC A;  1VQ6 A;  1HR0 W;  2UU9 L;  2PQA A;  4B3T Q;  1U0L A;  3BZC A;  1XTD A;  1KAW A;  4IO9 A;  1Z47 A;  3UE0 A;  5C4J H;  2C35 B;  2ALY B;  1HH2 P;  2K14 A;  2OTL A;  4A93 H;  4HIK A;  2HQL A;  1JB7 A;  4KI0 A;  2F3I A;  1LUZ A;  4DR6 L;  1CKM A;  3G48 A;  3KJO A;  2R92 H;  4UP7 A;  1PH1 A;  5LMN L;  4DV6 L;  2MFI A;  2PMZ E;  4C3H H;  1YHB A;  2ZJQ A;  1V43 A;  4IPC A;  3F8T A;  3PSI A;  4IJH A;  3I4M G;  1KQS A;  2VW9 A;  2ATW A;  4IPD A;  4GKK L;  3HOZ H;  4NXN Q;  1E3P A;  3E9H A;  3E9I A;  4X6A H;  2I5H A;  3RLO A;  1M90 C;  5C0X J;  5M3M H;  4AYB E;  1BBU A;  4DUZ L;  4HJ8 A;  3K80 C;  1Q1B A;  1V1Q A;  2PQA B;  4AYB G;  2Y0S E;  3PV0 A;  4LF4 Q;  4A3B H;  1VQJ A;  4GLX A;  1FL0 A;  3L0O A;  4JG2 A;  3H3V H;  1LTL A;  2Y0S G;  1TWA H;  4A3M H;  1M1K C; 
#chains in the Genus database with same CATH topology
 4OIJ A;  1XPR A;  2HIV A;  1H9S A;  2UUC L;  4FO2 A;  1GO3 E;  2I0Q A;  2IY5 B;  4HED A;  1IW7 C;  2ASB A;  4ULL A;  1JJG A;  1X32 A;  1LTB D;  5M3F B;  4OO1 I;  5M5W B;  4A3J G;  1STE A;  1YJW A;  4KJO A;  3P20 A;  4A3G B;  1FNU A;  2VQE L;  4DUY Q;  1G51 A;  1I6H B;  2UXB Q;  2WB1 B;  3WOF A;  5HY6 A;  1N8R C;  3A8J E;  1CKO A;  1PXU A;  4A3D G;  1PZJ D;  4DNR B;  4E6I A;  3MXN B;  3OOC A;  1GUS A;  1IKM A;  5J22 A;  4H7B A;  5FK9 C;  1RF2 D;  3K8A A;  2AQ1 B;  3M85 A;  4LUO A;  3I4N H;  3E0E A;  4A93 B;  2EYM A;  3LWU A;  1BVS A;  3S1N H;  3S2H B;  4LF6 Q;  1MSG A;  3A5Z B;  4I7Z C;  5FO7 B;  2ZTD A;  1NJI C;  3I7F A;  3PGZ A;  2LKV A;  3NBI A;  1BDO A;  1WFQ A;  3CU7 A;  2R92 B;  1CZW A;  4CDE C;  3OIQ A;  2RDG A;  4C56 C;  1TU2 B;  2K75 A;  1AP0 A;  5EBC A;  1WCM G;  4Y7N H;  2B2U A;  1FD7 D;  1PFB A;  1GD7 A;  5ELO A;  4BXX G;  2NVT H;  1XMO Q;  3FMC A;  3KOJ A;  4RCO A;  3TP7 A;  3EN2 A;  3A0J A;  5M3M B;  4A3F H;  4JI8 L;  5IP9 H;  3I4O A;  1K3B C;  3CP0 A;  2K5W A;  3OYY A;  3FPU B;  2OQ0 A;  2L1B A;  3EFX D;  5FLM H;  4DV7 L;  3TS2 A;  1RTN A;  3X3M A;  3C2P A;  4JV5 L;  2KUM A;  1RD9 D;  1KDC A;  2WV6 D;  1SE4 A;  1DON A;  1SYC A;  1B3A A;  3D4D A;  1PH9 A;  2C5C A;  2PI2 A;  4DR1 Q;  4A3E G;  5KND A;  3SHL A;  1DM0 B;  4C2M B;  3AMU A;  1QG7 A;  2D62 A;  3QWN A;  2QEJ C;  1WD0 A;  2SEB D;  4DV0 Q;  3UDG A;  4KLK A;  1QZH A;  3PIO A;  3PF4 A;  2JA7 H;  3S17 H;  5FO9 B;  1F9S A;  3KLW A;  4A3I G;  2K7V A;  4UAI A;  3LWE A;  2BH2 A;  1PTO D;  1JOK A;  4DGZ A;  5CV7 A;  1D5M C;  3PUY A;  4EVO A;  3OWE B;  2ZJP A;  2ID0 A;  4P74 A;  2UXC Q;  3CCV A;  4H13 C;  2LSS A;  2NB0 A;  5E1F A;  1PRT C;  1AH9 A;  2RSO A;  4X3S A;  4ZYS A;  1EL0 A;  1EY0 A;  3CRK C;  2YYZ A;  2L12 A;  5IT9 L;  5KIX A;  1Q1E A;  4A3J B;  1FNV A;  1VQD A;  3AEV A;  2CWP A;  2KHI A;  4HSP A;  3VR2 A;  2B63 H;  4QIW B;  2E8G A;  2F3V A;  1GHJ A;  1Q46 A;  4JBW A;  4RAU C;  4XYQ A;  2K5V A;  4A3D B;  3K58 A;  1Q82 C;  1CA6 A;  4DK1 A;  1A62 A;  1O7I A;  2KEN A;  4JI7 Q;  4DUZ Q;  2E2D C;  1I94 L;  1G6Z A;  3KFU A;  3AFP A;  3O13 A;  4FYD A;  4MZ9 A;  1EU3 A;  3WWV A;  4IUQ A;  4LF7 L;  5IYD G;  4ZAI A;  1YZ6 A;  3GTP B;  4GOP B;  5G3L F;  5IIF A;  1GJX A;  2BA1 A;  3TP6 A;  2R6G A;  2D0P A;  1QJO A;  3W1G A;  1CZG A;  4G7Z C;  1TWF B;  1WTH A;  3DM3 A;  1NUC A;  1SND A;  1YBY A;  4ZK9 B;  2VY3 A;  5M5Y B;  1PFN A;  3WOE A;  2X69 A;  2RSN A;  3L2P A;  2JQO A;  4RGT A;  4OX9 L;  1AZQ A;  4G7O C;  5T1G A;  1Z6H A;  3MFY A;  2WAQ E;  4DR3 Q;  4HIM A;  1I3Q B;  4X62 L;  4LF5 L;  2AUJ D;  2WAQ G;  3STB C;  3IFT A;  1B44 D;  3VDY A;  1LAB A;  1D6E C;  3DWA A;  3S9W A;  4DAY B;  4WFN 3;  4A3C H;  5IP7 G;  1ML0 D;  3J7Z C;  1K83 H;  1JOO A;  2EYF A;  1BCP F;  3J7A V;  4A3E B;  2AWN A;  1W6J A;  1VQF A;  2WKC A;  4UPA A;  3CCU A;  1VQK A;  4HAE A;  1EY5 A;  5CV4 A;  4GNX B;  4XT1 B;  3S2D H;  1NAP A;  4JW0 A;  3T51 B;  1EEI D;  2KED A;  1BUV T;  4LMQ D;  2J7Z A;  4JI0 L;  2B2W A;  1XTC D;  1N34 L;  4K5W A;  1IBL Q;  2EOT A;  2Z1C A;  1HNZ Q;  4KV6 A;  3CCE A;  5GAG C;  4ZQ3 A;  3MC0 B;  2AMC B;  2WKD A;  4M8A A;  3U58 A;  2ZM6 Q;  1MKH A;  1KD1 C;  4C3I H;  3CME A;  2FXQ A;  2OXP A;  2R61 A;  2M2L A;  2I5L X;  3KF6 B;  4DAP A;  3RZD B;  4RCN A;  2D2C C;  3FKI H;  2BE5 D;  2MGS A;  4A75 A;  2EJF C;  1K8G A;  2YTX A;  5EPK A;  2HHH L;  2EVB A;  3BU2 A;  3PUZ A;  1W6K A;  1C0A A;  5IGB A;  5LMU Q;  1AE2 A;  1AEX A;  3V2T A;  4NXN L;  4A3B G;  4GKJ L;  3D6C A;  3CHB D;  4A3M G;  1BCP B;  1L1O A;  3DXJ C;  2PZU A;  2TSS A;  4OON A;  2F0W A;  3M7G A;  3TZU A;  4P71 A;  5JPN C;  2OCE A;  2PYK A;  2DY7 A;  3MA2 B;  1KNE A;  4GS3 A;  3GTO B;  2MJ8 A;  1JR0 D;  4A4I A;  1BBW A;  1Y1V G;  4CKE A;  1H9M A;  3S15 B;  2E75 C;  4ZKC B;  1X3F A;  2RQX A;  4YCU A;  5CV5 A;  1K0R A;  3CXC A;  2PPB C;  3R8B A;  2PCF B;  1KDA A;  4V19 0;  4OHJ A;  2Q8T A;  4K6D A;  2JA8 H;  3VYT A;  4DAM A;  1IW7 D;  1Q7Y C;  5C3X A;  2B8G A;  4DAY A;  4JI2 L;  3R93 A;  2UUC Q;  1Y1W B;  3EBE A;  1B8A A;  1EFW A;  1I4Q A;  3S14 B;  4DUY L;  4L5T A;  2E2J B;  1HZC A;  4GNX A;  5IGG A;  3NE5 B;  2FIN B;  1NR4 A;  2VUM G;  3RZO B;  2LXK A;  5I9O A;  4RGN A;  1AZP A;  3I2Z A;  3HP3 A;  4KK7 A;  2MHV A;  5IE8 A;  1I4X A;  2R7F A;  1VQ5 A;  1EZ6 A;  4R1J A;  3K5L A;  5F2D A;  3J80 L;  4JI1 Q;  3BYT B;  1VQM A;  2DY8 A;  5CV6 A;  3ZYY X;  4CKB A;  4Q0F A;  4IUP A;  4F87 A;  1HZA A;  5BR8 L;  5E7N A;  1EYA A;  2Q2U A;  2JA5 G;  1U4P A;  1ILQ A;  4DV4 L;  4LNQ A;  4RFB A;  1PA6 A;  1PH5 A;  3J80 i;  3VYR A;  4KTA A;  1SXT A;  5C5M A;  4QGU A;  1BOS A;  4XQQ A;  4OO1 G;  2CQO A;  5GAH C;  3TRZ A;  1IYJ B;  1DJR D;  4EQO A;  1Q81 C;  1UNS A;  1HFG A;  5BN5 A;  2RVL A;  4ID6 A;  1QB5 D;  1K0S A;  1YJN A;  3A55 A;  3JAM L;  3T56 B;  5A2Q L;  4MTN A;  4CDF C;  1ET6 A;  2ICI A;  5FJ8 G;  1YNN C;  4LFC L;  1CSQ A;  1VS0 A;  1EY4 A;  1VQP A;  3A74 A;  1PH2 A;  5HGT A;  1IL2 A;  1B1Z A;  2EYH A;  2JA6 H;  3I55 A;  3I73 A;  2CQA A;  4AH6 A;  1STH A;  3JAM i;  1ZXT A;  4POF A;  4FDB A;  5M3F H;  5L37 A;  3NBH B;  1K8O A;  2L4N A;  5M5W H;  3TDQ A;  4DAV A;  2EYO A;  4DK0 A;  4DV7 Q;  4A3G H;  2YV5 A;  2L15 A;  4A76 A;  4DV0 L;  1K3R A;  4A3M B;  1I6H H;  2E5L Q;  1RTO A;  3M7N A;  4L5R C;  3CC7 A;  3HOY B;  1BBX C;  3KUP A;  1K8M A;  4F8M A;  1HR0 W;  1STA A;  1XTD A;  2H4O A;  2G5D A;  1Y1V B;  4KHV A;  2A69 D;  1BXT A;  2HUG A;  1PRT D;  2OTL A;  4A93 H;  1PTO C;  1JB7 A;  4KI0 A;  2F3I A;  5IGE A;  4DR6 L;  3C3L A;  2RCF A;  3CQZ B;  2R92 H;  1SYG A;  2MFI A;  2IL8 A;  2F0V A;  1YHB A;  3PSI A;  1KQS A;  4CDC C;  1HPC A;  1ENF A;  2I5H A;  3RLO A;  4BBR B;  1F9P A;  2G9D A;  1HXY D;  2L0C A;  3Q23 A;  5C0X J;  5M3M H;  1VMP A;  4AYB E;  1BBU A;  4DUZ L;  4HJ8 A;  4Z9C B;  1Q1B A;  4AYB G;  4GLX A;  1FL0 A;  5KRU A;  1M1K C;  1E0B A;  3RLN A;  1D1K A;  2YTV A;  3QIA A;  1B4O A;  5T1I A;  5JEA J;  3HEJ A;  1IZ6 A;  5ELN A;  4X64 Q;  1IXR A;  4C2M H;  1A2U A;  4BBS G;  3DWQ A;  4LF7 Q;  1PRT B;  3Q6S A;  2M00 A;  1H95 A;  4A3K G;  1KTK A;  4LUZ A;  4PMW A;  1QVF A;  1VQO A;  1HZ9 A;  2EZV A;  1VQG A;  3SK4 A;  4LF9 L;  1F2Z A;  1IBM Q;  3OPO A;  2F0S A;  4HMI A;  1TT2 A;  1YIJ A;  2K5H A;  3D0F A;  2XN9 C;  3R2I A;  1EQQ A;  4RGM A;  1SYE A;  5C5L A;  3KYH C;  3TEH B;  1ROD A;  1VQI A;  4L5Q A;  4OX9 Q;  4DU9 A;  3D4W A;  4BY1 G;  1H9S B;  4HR7 B;  4HTH A;  5ELF A;  1E1T A;  4H02 A;  4X62 Q;  4LF5 Q;  4FXD A;  1PYS B;  2D9U A;  2NTT A;  1YIT A;  4K14 A;  4CDD C;  4A3J H;  1KL9 A;  4HSV A;  3I3C A;  4OXP A;  1X3G A;  1J8I A;  4NXM L;  4B9X A;  4CBV A;  4A3D H;  1QWY A;  2ZTC A;  3HOZ B;  4IUU A;  1LTA D;  2SOB A;  4BY7 G;  1IL8 A;  4OIK A;  1XNQ L;  1IBL L;  1I50 H;  2IT1 A;  3ND8 A;  5EKL A;  5IT9 E;  3TSS A;  2XIW A;  5TSS A;  3NUC A;  1N9W A;  3EVQ A;  3E5S A;  1X54 A;  3GTP H;  1OO9 B;  1BQQ T;  4X3T A;  1EIF A;  1BNZ A;  1TWA B;  4JI0 Q;  4DR4 L;  2D0O A;  2PZT A;  3HKZ E;  2KBN A;  2F0T A;  3K7U C;  2EIF A;  5C3E B;  1TWF H;  2AQ3 B;  3U4Z A;  3HOU G;  3PO2 G;  4MTK A;  5C44 G;  1ESR A;  5D3D A;  3QR8 A;  1P8L A;  5M5Y H;  1EY7 A;  4GN4 B;  1TXY A;  3PUV A;  3CPW A;  1FJG Q;  3BDO A;  5KYI A;  1WOC A;  2A6H D;  5EPJ A;  4O0A A;  5LMU L;  1K73 C;  1I3Q H;  3DMU A;  3BVM A;  4ZUJ A;  3A8I E;  2BE5 C;  3NQI A;  1PFM A;  1OXU A;  2UU9 Q;  1VQ4 A;  1Y14 B;  2QCP X;  3AQQ A;  4IZ8 A;  2HHH Q;  1EZ8 A;  3CAM A;  1I6V C;  2EXD A;  1EIY B;  1VF5 C;  2Q2H A;  3VA5 A;  1PZK D;  4GKJ Q;  3P7J A;  2OQK A;  5C4X G;  5LMN W;  1O78 A;  3T13 A;  5CBA E;  1MJE A;  2FFK B;  5IOD A;  1VQA A;  2ZJR A;  2WIN B;  5K36 G;  5KYL A;  3N52 A;  3HOX G;  2XGT A;  3ONA B;  4KKU A;  5I2Y A;  1SBB B;  2F0P A;  1EYG A;  3ITP A;  4NW2 A;  1GXD C;  1FYC A;  1Z9F A;  2LMC B;  3I4M H;  2BDN A;  4G7H C;  1SNO A;  4WOR A;  3MFG A;  1S5B D;  5DEH A;  4GN3 B;  5JPM C;  2MNA A;  1SJE D;  3H0G G;  4JI2 Q;  4X66 L;  2CCZ A;  1E24 A;  2Q8I B;  3FPP A;  4QQB X;  1X6O A;  2JK8 A;  3R2T A;  4IN3 A;  4UP8 A;  1YVC A;  1S72 A;  4MN3 A;  1NMF A;  4JI1 L;  3RD4 A;  2F52 A;  3W2D A;  2UUB L;  4YWM A;  4J8Q A;  3HG9 A;  1U4M A;  1ASZ A;  4J15 A;  4ME3 A;  2MQH A;  1DOL A;  1O7Z A;  4EGV A;  4BY7 B;  3G71 A;  5I4D A;  4DV3 Q;  1CI3 M;  4K0K L;  3EJI A;  4NMZ A;  3W1B A;  3SXH A;  2F0L A;  3KK7 A;  5IYD H;  5BR8 Q;  1UE6 A;  2TMP A;  3VA7 A;  4DKA C;  1S40 A;  2R93 G;  1H9K A;  4DV4 Q;  3BZK A;  3HOV H;  5JJZ A;  1LTI D;  1VQN A;  1CM9 A;  3GTO H;  1C48 A;  1JT8 A;  2CWA A;  3HOU B;  2WP8 J;  3PO2 B;  1XJV A;  1YNN D;  3S15 H;  3MEH A;  5BN4 A;  2J0T D;  1WVL A;  2DGY A;  3K81 C;  4NPS A;  4GLA C;  1DGS A;  1D7Q A;  2NVY B;  2IX0 A;  4ZLT F;  5KNB A;  3ERQ A;  2EQS A;  4A93 G;  5IWA Q;  3M4O B;  5J39 A;  3GTJ B;  1X56 A;  4LFC Q;  1JC7 A;  4UP9 A;  1EY9 A;  2P5Z X;  1Y1W H;  4J1M A;  5A35 A;  2GVB A;  3S14 H;  1GKH A;  3SGI A;  5LHY 1;  1XPU A;  2OF1 A;  3NTH A;  2E2J H;  2E5L L;  1Y8O B;  1LTR D;  1A3V A;  4L6T B;  2QA4 A;  1LT5 D;  2HT1 A;  3QJY A;  5IP7 H;  1EQV A;  2PMZ B;  3FVQ A;  5IYB H;  3RZO H;  1G6P A;  2HQE A;  1S5D D;  1CKN A;  5C4X B;  4JK1 C;  4C3H G;  2MUY A;  4RKL A;  4HCS A;  3UDX A;  2XVS A;  1XNR L;  1DZ1 A;  5CYU A;  3J81 c;  1TWH B;  3TRE A;  1RL2 A;  2RA4 A;  1E7Z A;  4K2K A;  2A6E C;  1UWV A;  3LGJ A;  2JN4 A;  2A69 C;  4B3S Q;  4O1N A;  4YY3 L;  3HFZ B;  1HZB A;  1K8A C;  1ZEQ X;  1D8L A;  2KEC A;  4DR6 Q;  5KGU A;  2IHF A;  1F2M A;  4DN4 M;  3H0G B;  3MXG A;  2PQE A;  1N33 Q;  1B3Q A;  4M1U B;  1KHI A;  4TSS A;  2CHB D;  3ICE A;  1DXM A;  2KVM A;  1XX8 A;  1JOR A;  3VYS A;  2N78 A;  1SYD A;  1JOQ A;  2F4V L;  1MIU A;  4IQZ A;  4CGY B;  4APV A;  4X64 L;  4IUN A;  5HUR A;  2PO4 A;  5KEE A;  3CKI B;  5FLX E;  2YTY A;  3JAM E;  5A2Q E;  3HKS A;  4JI4 Q;  1PTO B;  1T5X D;  1IYV A;  1KRS A;  5CGK A;  2ICE C;  3EA6 A;  1IBM L;  3HOY H;  1YHA A;  1STN A;  2R7Z G;  2R93 B;  3HZX A;  1L1O B;  3I4N G;  1U9R A;  1Y69 U;  4LK1 C;  4H44 C;  4JBJ A;  2WAC A;  1WCM B;  1Y1V H;  4PZ6 A;  2N8N A;  4LUV A;  4PG3 A;  2KQ3 A;  1MJC A;  3TQY A;  4DR2 L;  4LF9 Q;  2E76 C;  4A3L H;  1SRO A;  4K2L A;  5I6Y A;  3T1H L;  3U4V A;  2V1C C;  3CRL C;  4YWK A;  1UE5 A;  4IFD J;  1JIC A;  5C4Z A;  1AFP A;  4DXG A;  1CTM A;  2H5X A;  3KLR A;  1YJ9 A;  5I6W A;  5IGC A;  1L0Y B;  4JBM A;  2A5H A;  1II3 A;  4A3F G;  1NTG A;  1A0I A;  1VF7 A;  4BBR H;  2G9H D;  1A8V A;  2ZXO A;  2F0E A;  1LYL A;  2EDG A;  2Z8L A;  3ER0 A;  3DUZ A;  1IHZ A;  5FLM G;  1A2T A;  1UEB A;  1B9M A;  4J6H A;  3PIO 3;  3S1Q B;  4NXM Q;  4IPH A;  1NY4 A;  4A3I B;  2K04 A;  1YNJ C;  4C3H B;  4IPG A;  1CQF A;  4XQJ A;  1SFO B;  1XNQ Q;  4C3J H;  1SNM A;  3M9B A;  3GTL B;  1JB3 A;  1PHJ A;  4IUT A;  4JI6 L;  3FP9 A;  4QL5 A;  1JE5 A;  3EQL C;  5IT9 c;  4DR4 Q;  4OO1 H;  1SDF A;  3MEF A;  1FJG L;  4LFB L;  3M4Y A;  2O4X A;  1V1P A;  3I8Z A;  1LV9 A;  3UE1 A;  2EY6 A;  4R4T A;  1MD2 D;  3DHQ A;  3CCM A;  3FRP B;  5IYC H;  5DNF A;  3L7Z C;  1GUG A;  4G4K A;  1A15 A;  5FJ8 H;  4DR7 L;  5GAE C;  1VQ6 A;  2NVQ B;  2DNC A;  2UU9 L;  2PQA A;  1U0L A;  2XNA C;  3IAY A;  2A6H C;  3NP8 A;  4UDU C;  1KLU D;  1KAW A;  4K8J A;  1Z47 A;  3UE0 A;  1PYW D;  2LFN A;  1HH2 P;  3WDN A;  4MHE A;  4HIK A;  2MPM A;  1CKM A;  3MAQ A;  2F1M A;  2KHS A;  3G48 A;  3K59 A;  4I7A A;  1PH1 A;  1RHP A;  4DV6 L;  2ZXR A;  3GTK B;  3P1H A;  2ZJQ A;  1V43 A;  4IPC A;  1ENA A;  2QDB A;  2ATW A;  2R7Z B;  2CW0 C;  1STG A;  3HOZ H;  4X6A H;  3E9I A;  3MWY W;  1SNQ A;  5K5P A;  4K8I A;  4CHT B;  2KOL A;  1Q90 A;  5EJW A;  3GTM B;  3PV0 A;  3QOL A;  2NVX B;  3C1F A;  1WTO A;  3H3V H;  1TWA H;  1FVI A;  1SE8 A;  2EPB A;  2WAQ B;  2HDM A;  5C3E H;  4IFD H;  5C6A A;  3CC2 A;  4PMC A;  1PMR A;  1GUO A;  2M9V A;  3I70 A;  4R8N A;  2K05 A;  1MGS A;  1GUT A;  4X66 Q;  3F1Z A;  4DR5 L;  4AQY L;  3PQI A;  5JVH 3;  1W2B A;  1QZG A;  1OXT A;  2CKZ B;  1O80 A;  4KHP L;  5EQ0 A;  5LL6 X;  2ES2 A;  1HHV A;  2VS1 A;  1DOK A;  2DN8 A;  4DV3 L;  1PH8 A;  1B9N A;  4DV2 L;  2AUK A;  2UUB Q;  1B2T A;  4KY6 A;  1EYD A;  3ULJ A;  1SE3 A;  1JQY D;  5C3W A;  1ENC A;  4RHR A;  1FR3 A;  3I56 A;  3PIP A;  1VMC A;  2SNS A;  1WTR A;  5GRO A;  4K0K Q;  3KLS A;  2NUC A;  3MXU A;  4LFA L;  3JC6 6;  4FF3 A;  1D2B A;  1S5F D;  3E3X A;  5C0X I;  2XWJ B;  5IGD A;  2N49 A;  1S5C D;  4KJN A;  2QDL A;  3AU7 A;  3SK8 A;  5IGF A;  1SYF A;  5IWA L;  4F7X A;  4UY8 C;  3G6J B;  1AN8 A;  2RHQ B;  2SNM A;  3GP7 A;  1NBW A;  5I9P A;  5CMD A;  1PH6 A;  1A3U A;  2JSO A;  1STB A;  2FHT A;  2KCM A;  3L9A X;  4LW1 A;  4DNT B;  2VNU D;  5NUC A;  2XSC A;  1V1O A;  1G8Z D;  2Q2I A;  3Q8D A;  4UHV A;  4DPG A;  2B29 A;  4CJ0 B;  1T9H A;  3I90 A;  4JC0 A;  3RN2 A;  4A3B B;  1TS2 A;  3FKI G;  3I72 A;  1O7L A;  2RBM A;  4WJW A;  1N36 L;  5CBE E;  4JI5 L;  3KF8 A;  2Z4H A;  1EQT A;  1PRT F;  3A56 A;  1VDZ A;  4BA2 I;  1A3T A;  4FP5 D;  3OHX C;  1CK1 A;  3PF5 A;  1K9M C;  2A6E D;  2NN6 H;  4B3T L;  4B3S L;  4BY7 H;  1X3P A;  3CCS A;  1I5F A;  1NNX A;  1EUJ A;  1VQH A;  1HTP A;  1EQR A;  3S2H H;  1I4H A;  1XNR Q;  2K5N A;  2F0J A;  4QF4 A;  1P16 A;  1N33 L;  4R4O A;  2XRQ D;  4YY3 Q;  3W3A A;  4L63 B;  3HOU H;  3HS0 C;  3NEL A;  2F0O A;  3CC4 A;  1TY0 A;  3PO2 H;  1TY2 A;  2K4K A;  1OXS C;  3OSO A;  2NVY H;  3OMG A;  5HGQ A;  1B50 A;  2VB3 X;  2VUM B;  1C8C A;  3GTJ H;  1TWC B;  1C4Q A;  1CHP D;  4HID A;  4N8F A;  4JI4 L;  3TME A;  1KRT A;  3Q0A A;  4RHS A;  2F4V Q;  3M3Y B;  4KD4 A;  3X3N A;  4QJF A;  1HNX L;  1N32 L;  1RKN A;  2O5J C;  2JA5 B;  1XXG A;  3NXW A;  4RMF A;  4ODG A;  3K5M A;  1WTP A;  2K03 A;  3Q24 A;  4DFA A;  2VQF L;  1KDB A;  2MO0 A;  3PUW A;  5FLX c;  2EE1 A;  5I2X A;  4RG1 A;  1F9R A;  4QCL A;  2WII B;  2NBF A;  3AYH B;  2WFW A;  5ELD A;  1TWH H;  4N9P A;  1V9P A;  3CW2 C;  3RNU A;  2JEA I;  5K36 H;  3PO3 G;  2UUA L;  1KLG D;  2CFM A;  1LTT D;  3SR1 A;  1QE6 A;  5ELC A;  4ABN A;  4DR2 Q;  1SYB A;  4GZY C;  1BR9 A;  4LAA A;  1MSH A;  3OW7 A;  3T1H Q;  3MVV A;  1MI2 A;  4X65 L;  2C9O A;  4HJ9 A;  3H0G H;  1RCV D;  2EYJ A;  3BJU A;  4WJ4 A;  2XWB B;  1EY8 A;  3EIV A;  1R9T B;  1B53 A;  4HCE A;  4YHH Q;  3RLF A;  4YCV A;  2F0M A;  4ZKB B;  2JA6 G;  3NHH A;  1QVG A;  4OGQ C;  1NMG A;  2H1E A;  3QB3 A;  4ILW A;  1YNJ D;  3K5N A;  2A1A A;  1ESF A;  2K01 A;  1PH7 A;  4A3G G;  1EWI A;  1SEB D;  2WB1 E;  2QF7 A;  4JYA L;  1D1I A;  2WB1 G;  4HIO A;  5CR3 A;  5GAD C;  1PTO H;  2L5T A;  4R4Q A;  1SE2 A;  2R7D A;  3H09 A;  1S3O A;  5GQO A;  1QNU A;  3HRZ C;  3SE0 A;  3HKZ G;  4L8J A;  1VQ7 A;  2R93 H;  5EKK A;  4JI6 Q;  1EOV A;  2KEE A;  2KJX A;  3QO2 A;  4MNO A;  1ZYR C;  1BKB A;  2PZW A;  2V4D A;  2VXW A;  3E0J A;  3K7A B;  3NEM A;  1SMY C;  1WCM H;  1BCP C;  4PV1 C;  4LFB Q;  4BXX H;  1HR0 L;  2BCO A;  2E2H B;  2K6A A;  1Q3L A;  1SMX A;  4AYB B;  2UXD Q;  4DR7 Q;  1SN8 A;  2OWO A;  3T1Y L;  4LF8 L;  3NK9 A;  5ISR A;  4NDX A;  3NTI A;  2NZO A;  1HFN A;  3QG1 A;  1X3Q A;  1SRU A;  5M3M G;  1EY6 A;  1Z7T A;  3KBG A;  3A5U A;  4A3E H;  4S3S A;  2CW0 D;  4BBS B;  2JEB I;  4EQP A;  3PUX A;  4XYO A;  3OIP A;  3S1Q H;  4IUV A;  4A3K B;  4DV6 Q;  3DLL A;  4OL7 A;  1OXV A;  4A3I H;  3IFD A;  3HOW G;  4QMG A;  2B3G A;  3GTQ B;  3ZJY C;  2JA9 A;  1CKN B;  4BA1 I;  3U9O A;  2BDO A;  3QOJ A;  1SFO H;  1S5E D;  3D8G A;  3GTL H;  3PO3 B;  1YNX A;  1LAC A;  1V8Q A;  3NEN A;  1GUW A;  5KNC A;  4IOA A;  3S24 A;  4B3R Q;  3D6W A;  4ALP A;  4BY1 B;  1GOZ A;  1ASY A;  2LY7 A;  4JOI C;  2YU9 B;  4HJ5 A;  1J9O A;  2AQ2 B;  2EXZ A;  4ME5 A;  2RHS B;  1G91 A;  1LT3 D;  3VR3 A;  3J81 L;  1VQL A;  3RZD H;  3OTO Q;  1KIX A;  1VQC A;  3F2U A;  2NVQ H;  2Z6K C;  2JA6 B;  4R4C A;  4HJ7 A;  4DR5 Q;  4AQY Q;  1X55 A;  4DK6 C;  1H9R A;  2K33 A;  4Q5V A;  1KAA A;  4KHP Q;  4TVA B;  1VCI A;  5EAY A;  4QIW E;  3J81 i;  1PVO A;  4DV2 Q;  2OT2 A;  1STY A;  1SR3 A;  3R3O A;  2SDF A;  4KY5 A;  2A19 A;  4EQ5 A;  4K6L A;  1H9J A;  3F2D A;  4P72 A;  3MXP A;  3GTK H;  5DAU A;  3CF5 A;  4OEM B;  4L5S A;  2N3S A;  3HKZ B;  2R7Z H;  1T5E A;  3J7A 5;  3RUZ A;  3S16 B;  2F0H A;  4LFA Q;  1HA5 A;  1F2L A;  2NZ1 D;  5C44 B;  4N9T A;  1XMQ L;  1A6X A;  1B7Y B;  2JE6 I;  1Q86 C;  1E1O A;  3K6O A;  3D4R A;  3GTG B;  3GTM H;  1SNC A;  1EU4 A;  2EYP A;  1WTW A;  1LTS D;  4HN7 A;  5IY0 A;  2NVX H;  3LNN A;  3PCO B;  4PZ8 A;  1DCZ A;  4PMB A;  4O2D A;  2GN5 A;  1IBK L;  3TZD A;  3GQB A;  2A68 D;  1HQM C;  2AKW B;  3FEW X;  2KA7 A;  3F2C A;  1VQE A;  1S4Z A;  1YHQ A;  2J4X A;  3DEO A;  3S1R B;  2BOS A;  1BF4 A;  1G2S A;  1X65 A;  2E2I B;  1QNK A;  2EY1 A;  5C0X G;  3RR5 A;  1PTO F;  3TN2 A;  2DNE A;  5AJ3 L;  3KBX A;  3H3V I;  1VQB A;  1F77 A;  3T16 A;  3ULL A;  1Y8P B;  4NB3 A;  3Q22 A;  2KCN A;  3S1M B;  4LWC A;  3UI2 A;  4IOC A;  1JE4 A;  1N36 Q;  2ZXP A;  4AIM A;  4DV1 Q;  4JI5 Q;  4K5V A;  4IFD I;  1NCV A;  2PW5 A;  1Q8K A;  4FXK C;  4DNI A;  4EX5 A;  2K28 A;  3HGB A;  4PNY A;  5JEA G;  3HOW B;  3KJP A;  3HOX B;  1OTC A;  1JWU D;  4B3T Q;  3A7L A;  4ZUI A;  4C1N K;  4MIU A;  2VB2 X;  2NWG A;  1TWG B;  4IO9 A;  1HRJ A;  2C35 B;  2ALY B;  4QB4 A;  4IAL A;  3SVM A;  1EEF D;  1EWH A;  4DA2 A;  3J80 E;  4XXE A;  3PMF A;  1O7Y A;  1Y8N B;  3GV6 A;  1TQO A;  4UP7 A;  4FNF A;  5LMN L;  3F8T A;  3I4M G;  4IJH A;  1V1P B;  2VW9 A;  1CA5 A;  4IPD A;  4GKK L;  2QW7 A;  4U68 A;  1WD1 A;  1E3P A;  3DWP A;  3E9H A;  2FJ2 A;  4OEL B;  1ONL A;  4ZRZ A;  2FMC A;  1TS5 A;  2F0U A;  3BZD B;  5EPL A;  2RKS A;  1NSN S;  4WRD A;  4HMJ A;  1EOT A;  3NWT A;  1WTX A;  1V1Q A;  2PQA B;  2B2V C;  2EY5 A;  3MXN A;  4CJ2 C;  2Y0S E;  2IWH A;  4A3B H;  1VQJ A;  1Q8I A;  3L0O A;  1TS4 A;  1LTL A;  3URY A;  2Y0S G;  4A3M H;  5COR A;  1X3E A;  4OWX B;  2QIL A;  1HNX Q;  3CCJ A;  1N32 Q;  2QKI C;  1ET9 A;  5M5X B;  2IX1 A;  3FDT A;  4P2C B;  1LO5 D;  2F4I A;  1I50 B;  2VQF Q;  4FF1 A;  2AHO B;  5JVG 3;  4OWT B;  1F9Q A;  1ILP A;  4PQX A;  1B70 B;  4WJ3 M;  1SLJ A;  3T53 B;  1U4L A;  3BVG A;  3GDE A;  3HOV G;  2I07 B;  3OW2 A;  2ENB A;  2XTI A;  5E4W C;  3NWS A;  4RH6 A;  2UUA Q;  3CQZ H;  1L2F A;  5E4X A;  1E22 A;  1FNW A;  2KCT A;  5G3L D;  1K28 A;  3KLS X;  3VR6 A;  4YHH L;  4X3U A;  2NN6 I;  4U67 3;  2KHJ A;  1HJP A;  3D31 A;  4XTC S;  5FOB B;  5IP9 G;  5C4J B;  4X65 Q;  4HJA A;  3AB9 A;  3H3V C;  2XRS D;  3H91 A;  1HNW L;  2VUM H;  1MBY A;  1LTG D;  1Q12 A;  1Y1W G;  1QCB D;  2JJQ A;  2K50 A;  2Z4I A;  4RWS C;  4JI3 Q;  2RDH A;  2E74 C;  1TWC H;  4KHZ A;  4XT3 B;  3GV3 A;  4GN5 A;  5CC4 A;  1WYD A;  1XWE A;  2F0G A;  4P73 A;  4H0L C;  1VQ9 A;  4Y52 H;  5ELE A;  2F03 A;  4R9W A;  5IYB G;  3KDF B;  3M3Y H;  3H15 A;  2GA4 B;  3BDC A;  3G7L A;  1JMC A;  2DJF C;  2NYZ D;  3SDZ A;  2JA5 H;  2B2U C;  3MZ5 A;  2JA7 G;  1NE3 A;  4JYA Q;  3BG3 A;  5COY A;  2X6G A;  5IOC A;  2ZT9 C;  2EJG C;  1J5E Q;  5D65 A;  1ZYR D;  1SMY D;  2O5I C;  1BCP D;  5D14 A;  5H1S E;  4DF7 A;  2IPK D;  3ERO A;  4DV5 L;  2BA0 A;  4JBK A;  2EJM A;  4B3M L;  1ICW A;  1BO0 A;  1NR2 A;  3A54 A;  1AE3 A;  2UXD L;  1PLF A;  4NP5 A;  3M4Q A;  4CJ1 B;  5DM6 3;  5FKA C;  3I4M B;  1J6Q A;  5J1Z A;  1R4P B;  3VYU A;  3E6Z X;  3RN5 A;  1HR0 Q;  1GUN A;  5D3I B;  2NZH A;  4YIJ A;  1R4Q B;  1UAP A;  2B63 G;  5FO8 B;  2RCN A;  1D5X C;  3C1E A;  3T1Y Q;  4LF8 Q;  1HQR D;  1CSP A;  2F0Q A;  1R9T H;  2Y0S B;  4KKS A;  1TKW B;  5JAV A;  3T4A C;  1PH3 A;  4P75 A;  3DM1 A;  2HIX A;  4B08 A;  1X9N A;  1FGB D;  1U4R A;  4GOP A;  2B8F A;  2VL6 A;  2CVR A;  5JOB A;  3I4N B;  2PW7 A;  3KF8 B;  3K5O A;  3S1N B;  4B3R L;  3G4S A;  1EFI D;  1G2T A;  3B6Y A;  4QUF A;  3HOY G;  3GO5 A;  5JJI A;  4LF4 L;  5CV9 A;  3P75 A;  5C4H A;  2QEX A;  3HOV B;  3J7Y W;  1TR5 A;  3ULP A;  4Y7N B;  3K0Y A;  3ND9 A;  1CUK A;  1TVX A;  3IKJ A;  5AFW A;  3OTO L;  2IW3 A;  2K5Q A;  1WTV A;  2LXJ A;  2K1B A;  2NVT B;  3BVZ A;  4A3L G;  3K7A H;  3OWF A;  3A8K E;  4A3F B;  2DJG C;  4FF2 A;  2E2H H;  3BYY B;  4IJL A;  3SK6 A;  2EYL A;  4OWW B;  3KDF A;  2F3W A;  3CPF A;  1AW7 A;  5EGT A;  4A3C G;  1RIP A;  2MP1 A;  1LLR D;  2UXB L;  3IL8 A;  1FGU A;  2Q2T A;  4BBR G;  3DEP A;  1HA6 A;  2NTS A;  5ELB A;  2VZA A;  2VQE Q;  1SJH D;  5EBD A;  3S17 B;  2JA7 B;  3NSW A;  4BBS H;  1I4P A;  4A3K H;  1PYB A;  4GLV B;  4LF6 L;  1SSO A;  1IKL A;  1LT4 D;  2L11 A;  4XIG S;  4C3J G;  3GTQ H;  4YWL A;  1QUQ B;  1XMQ Q;  1GM5 A;  1PH4 A;  1UE7 A;  3PO3 H;  4O42 A;  1RDP D;  4XQN A;  3TP5 A;  1JWM D;  1LT6 D;  3NPP A;  2I46 A;  3KF6 A;  3AFQ A;  5M9O A;  4IUR A;  1XMO L;  4C3I G;  3FHW A;  2K5D A;  4BY1 H;  4QY7 A;  2A68 C;  4BWG B;  1IBK Q;  2IX3 A;  5IYC G;  1WTQ A;  5FLX L;  3M4P A;  1EYC A;  3N6R A;  3UDI A;  2JXM B;  2YU9 H;  4KY7 A;  3V96 A;  2B63 B;  4JCV E;  1UEA B;  2JYO A;  2LS0 1;  1F2Y A;  1UUP A;  4DV1 L;  1QIL A;  2Z0S A;  4YCW A;  3H6M A;  2B2W C;  1IYU A;  4JVZ A;  4JI8 Q;  5AJ3 Q;  5DM7 3;  4DR1 L;  1KAB A;  1MHW C;  2RF4 A;  3ERS X;  4JV5 Q;  3D3R A;  4KD3 A;  2KCC A;  4LJZ C;  2B2T A;  3IRB A;  5LL6 S;  4EQN A;  1C7Y A;  1XPO A;  1HTL D;  3U50 C;  3J81 E;  3CCQ A;  1KXL A;  2BH8 A;  2IHE A;  3HOZ G;  3MTS A;  3S16 H;  2UXC L;  4K5X A;  2D5D A;  2RDF A;  5C44 H;  4RGO S;  3BDL A;  2FMM A;  2JA8 G;  4GOP C;  4POG A;  3TBI B;  1KNA A;  3SEB A;  2K52 A;  1TS3 A;  1E2Z A;  2N55 A;  4RKB A;  3GTG H;  3J80 c;  4X3K A;  3M4O H;  4I65 A;  4QUC A;  3U9S A;  4NKL A;  2DUD A;  5C3E G;  5LMN Q;  1EIH A;  4IFD G;  1HUN A;  1JCK B;  1L1O C;  2CH4 W;  2F0K A;  4BS9 A;  3BS1 A;  4GKK Q;  4G57 A;  1QVC A;  3G6E A;  2K32 A;  2A74 C;  2B2Y A;  3LX0 A;  1L0W A;  3S1R H;  1K83 B;  2L9H A;  1A63 A;  5BN3 A;  3PIP 3;  4C1N I;  2QGQ A;  2E2I H;  4JI7 L;  1I4R A;  1GVP A;  3RMH A;  1E2V A;  4JOI A;  3S2D B;  4FF4 A;  2HCI A;  3A7A B;  3JAM c;  1QUQ A;  5C4X H;  3S1M H;  3CMA A;  1PFS A;  4R4I A;  4FXG C;  1UE1 A;  2Z6K A;  4B9W A;  3HOW H;  1I94 Q;  4C3J B;  2F0F A;  3HOX H;  3OMC A;  2AWO A;  2PNR C;  4TKO B;  2OTJ A;  1EWC A;  4GNX C;  1WJJ A;  2PI2 E;  1TWG H;  1JJC B;  5DLQ E;  2O2L D;  2F0D A;  1CHQ D;  1CFM A;  4KN7 C;  4DK3 C;  1JJ2 A;  1OXX K;  4C3I B;  1U5K A;  3K57 A;  1YI2 A;  1G29 1;  4DR3 L;  4RA8 A;  3L3O C;  4JI3 L;  3FKI B;  1SAP A;  3F2B A;  3STB D;  3VR5 A;  1WI5 A;  3NBH A;  1I4G A;  3J81 j;  2IJ0 A;  4TQU S;  3CCL A;  4N8X 1;  2OEO A;  3K0X A;  4XDX A;  5M3F G;  1ICF B;  1M8A A;  1HNW Q;  3GD7 A;  4KMU C;  1DYQ A;  1PV4 A;  2A8V A;  2R3Z A;  5EKI A;  4PZ7 A;  1VQ8 A;  3I91 A;  1DOM A;  2ZTE A;  4JPB W;  3H94 A;  2N88 A;  1J5E L;  2MO1 A;  5J3B A;  2HD3 A;  3W5O A;  1PDQ A;  2HDL A;  2I5M X;  2JP1 A;  4R8I A;  5JJK A;  1RJT A;  1W3S A;  2NN6 G;  5M5X H;  3TP8 A;  3J7A F;  4CKC A;  4F88 A;  1KC8 C;  1CT1 D;  2EY2 A;  1C9O A;  3TS0 A;  1XYI A;  3UDF A;  1HNZ L;  1YEZ A;  2PNH A;  2JA8 B;  3SK5 A;  1M4V A;  1D5Z C;  2R92 G;  3CCR A;  5JJL A;  1LM0 A;  4DV5 Q;  2F0I A;  3I4L A;  4B3M Q;  1CQV A;  3CD6 A;  2Z9H A;  2ZM6 L;  1N34 Q;  1EIG A;  3NQT A;  2B2T C;  1TII D;  1PZI D;  2GVA A;  1JWS D;  4FVM A;  3BZC A;  1QOH A;  1ZKO A;  5C4J H;  2K14 A;  3V05 A;  2HQL A;  5C0X H;  1LUZ A;  4KN4 C;  3KJO A;  2A73 B;  4KKT A;  2F0N A;  2B39 A;  4TRD A;  1GHK A;  2PMZ E;  4V0B A;  5E3F A;  4C3H H;  3MHB A;  2CH4 A;  2L55 A;  1HCZ A;  5CV8 A;  5JEA H;  2HCC A;  4NXN Q;  3VR4 A;  4ZCK A;  2B2Y C;  1HUM A;  1DD2 A;  2Q8R E;  1M90 C;  2B2V A;  3K80 C;  1L0X B;  3C46 A;  4DXF A;  2X6L A;  4LF4 Q;  2Z6B A;  3NTK A;  4JG2 A;  1SNP A;  1E2W A; 
#chains in the Genus database with same CATH homology
 1X3E A;  1FVI A;  3RLN A;  1XPR A;  1SE8 A;  2HIV A;  4OWX B;  2YTV A;  5C3E H;  2UUC L;  5JEA J;  5ELN A;  1IZ6 A;  3CCJ A;  1HNX Q;  3CC2 A;  1N32 Q;  1GO3 E;  4X64 Q;  1IXR A;  2I0Q A;  2IX1 A;  2IY5 B;  4C2M H;  2VQF Q;  4BBS G;  2ASB A;  2AHO B;  4LF7 Q;  4X66 Q;  1JJG A;  3F1Z A;  4OWT B;  4DR5 L;  4AQY L;  1W2B A;  4OO1 I;  4A3K G;  1QZG A;  4A3J G;  1H95 A;  1QVF A;  1OXT A;  4LUZ A;  2CKZ B;  4PMW A;  1VQO A;  1YJW A;  1B70 B;  1HZ9 A;  4KHP L;  4WJ3 M;  1SLJ A;  2VQE L;  2ES2 A;  2VS1 A;  1VQG A;  4DUY Q;  3GDE A;  4DV3 L;  1PH8 A;  1IBM Q;  4LF9 L;  1G51 A;  3HOV G;  4DV2 L;  3OW2 A;  2UXB Q;  2XTI A;  5HY6 A;  1YIJ A;  1N8R C;  2UUA Q;  1CKO A;  3CQZ H;  2K5H A;  1L2F A;  2UUB Q;  3ULJ A;  3D0F A;  4A3D G;  1E22 A;  3MXN B;  2KCT A;  1EQQ A;  3KYH C;  3TEH B;  3I56 A;  3PIP A;  4L5Q A;  1VQI A;  4YHH L;  2NN6 I;  4OX9 Q;  3K8A A;  2KHJ A;  1HJP A;  3D31 A;  5GRO A;  4XTC S;  4LUO A;  4BY1 G;  5IP9 G;  3E0E A;  3M85 A;  4X65 Q;  3I4N H;  4K0K Q;  1E1T A;  4HJA A;  4H02 A;  3JC6 6;  4LFA L;  4X62 Q;  4LF5 Q;  5C0X I;  1HNW L;  2VUM H;  1BVS A;  1Q12 A;  1PYS B;  3S1N H;  1Y1W G;  4LF6 Q;  1YIT A;  3A5Z B;  2JJQ A;  2N49 A;  2ZTD A;  2K50 A;  4A3J H;  1KL9 A;  1NJI C;  3I7F A;  3PGZ A;  4OXP A;  1TWC H;  1X3G A;  1WFQ A;  4JI3 Q;  5IWA L;  4KHZ A;  4GN5 A;  1WYD A;  4NXM L;  4P73 A;  4UY8 C;  1VQ9 A;  4Y52 H;  2RHQ B;  2K75 A;  5IYB G;  4A3D H;  3KDF B;  3M3Y H;  3H15 A;  1WCM G;  4Y7N H;  1NBW A;  2ZTC A;  1PH6 A;  1JMC A;  4BY7 G;  1GD7 A;  2KCM A;  5ELO A;  2JA5 H;  4BXX G;  1XNQ L;  2NVT H;  1XMO Q;  1IBL L;  1I50 H;  1NE3 A;  2IT1 A;  3KOJ A;  4LW1 A;  2JA7 G;  4JYA Q;  2VNU D;  3EN2 A;  3A0J A;  1J5E Q;  4A3F H;  4JI8 L;  5IP9 H;  3I4O A;  2Q2I A;  1N9W A;  3Q8D A;  4DPG A;  2B29 A;  1T9H A;  1X54 A;  3CP0 A;  3OYY A;  4JC0 A;  3RN2 A;  3GTP H;  2OQ0 A;  1EIF A;  4DR4 L;  4JI0 Q;  3FKI G;  5FLM H;  2D0O A;  5H1S E;  4DV7 L;  3TS2 A;  4JV5 L;  3HKZ E;  2KBN A;  3K7U C;  2EIF A;  1N36 L;  4DV5 L;  2BA0 A;  1TWF H;  3U4Z A;  4JBK A;  4B3M L;  3HOU G;  4JI5 L;  3PO2 G;  1AE3 A;  2UXD L;  5C44 G;  1PH9 A;  3M4Q A;  1P8L A;  5M5Y H;  4A3E G;  2PI2 A;  4DR1 Q;  4BA2 I;  4GN4 B;  1J6Q A;  1TXY A;  3PUV A;  3PF5 A;  2D62 A;  3CPW A;  3RN5 A;  1HR0 Q;  1K9M C;  1FJG Q;  4B3T L;  4B3S L;  4BY7 H;  4DV0 Q;  3UDG A;  1WOC A;  3CCS A;  1I5F A;  4KLK A;  1EUJ A;  1QZH A;  3PIO A;  1VQH A;  2NZH A;  2JA7 H;  3PF4 A;  3S17 H;  1EQR A;  3KLW A;  4A3I G;  4O0A A;  3S2H H;  5LMU L;  1K73 C;  2B63 G;  1I3Q H;  2RCN A;  1XNR Q;  2K5N A;  2BH2 A;  3T1Y Q;  4LF8 Q;  1CSP A;  1OXU A;  1R9T H;  3PUY A;  1VQ4 A;  1Y14 B;  2UU9 Q;  2ZJP A;  3AQQ A;  1P16 A;  2ID0 A;  4P74 A;  4R4O A;  1PH3 A;  4YY3 Q;  4P75 A;  3CCV A;  2HHH Q;  1N33 L;  1I6H H;  2UXC Q;  2LSS A;  3CAM A;  2EXD A;  1EIY B;  2HIX A;  1X9N A;  2Q2H A;  3HOU H;  3NEL A;  3CC4 A;  1AH9 A;  3PO2 H;  4GOP A;  2VL6 A;  2K4K A;  1OXS C;  4GKJ Q;  2NVY H;  5HGQ A;  3KF8 B;  2OQK A;  5C4X G;  2YYZ A;  5LMN W;  3GTJ H;  1MJE A;  1Q1E A;  4B3R L;  1VQD A;  3G4S A;  1VQA A;  2ZJR A;  3AEV A;  2CWP A;  2KHI A;  3B6Y A;  3HOY G;  5K36 G;  3GO5 A;  3HOX G;  2B63 H;  5JJI A;  4LF4 L;  2E8G A;  2XGT A;  2QEX A;  4HID A;  1Q46 A;  4JBW A;  4JI4 L;  1EYG A;  1KRT A;  2K5V A;  2F4V Q;  3ULP A;  1Q82 C;  4QJF A;  1A62 A;  1CUK A;  1O7I A;  2KEN A;  1HNX L;  4JI7 Q;  1N32 L;  3OTO L;  1Z9F A;  4DUZ Q;  2LXJ A;  1I94 L;  3I4M H;  4RMF A;  3KFU A;  4A3L G;  3K7A H;  3AFP A;  2MNA A;  4GN3 B;  4MZ9 A;  2VQF L;  3H0G G;  4JI2 Q;  3WWV A;  4LF7 L;  5IYD G;  3PUW A;  2MO0 A;  4X66 L;  5FLX c;  2CCZ A;  2E2H H;  1YZ6 A;  4IJL A;  1E24 A;  4GOP B;  4RG1 A;  4QQB X;  2BA1 A;  1X6O A;  4OWW B;  3KDF A;  2JK8 A;  3AYH B;  4UP8 A;  2R6G A;  2WFW A;  1YVC A;  3CPF A;  2D0P A;  1S72 A;  1NMF A;  3W1G A;  4A3C G;  1RIP A;  4JI1 L;  1TWH H;  3RNU A;  1V9P A;  2F52 A;  3CW2 C;  2JEA I;  2UXB L;  3DM3 A;  3PO3 G;  2UUA L;  1FGU A;  2CFM A;  1YBY A;  4YWM A;  4BBR G;  2Q2T A;  2UUB L;  2VY3 A;  1ASZ A;  4J15 A;  4ME3 A;  2MQH A;  4DR2 Q;  2VZA A;  3L2P A;  2JQO A;  3G71 A;  2VQE Q;  4OX9 L;  4DV3 Q;  3T1H Q;  4BBS H;  4K0K L;  4X65 L;  3W1B A;  2WAQ E;  4DR3 Q;  4HIM A;  4HJ9 A;  3H0G H;  4X62 L;  4LF5 L;  4A3K H;  1PYB A;  5IYD H;  2WAQ G;  3BJU A;  4WJ4 A;  5BR8 Q;  4GLV B;  1UE6 A;  4LF6 L;  3STB C;  1S40 A;  3EIV A;  4DKA C;  4XIG S;  3VDY A;  2R93 G;  4YHH Q;  4DV4 Q;  3RLF A;  3BZK A;  4YCV A;  4YWL A;  3GTQ H;  1VQN A;  3HOV H;  2JA6 G;  1QVG A;  4DAY B;  1QUQ B;  3GTO H;  5IP7 G;  4A3C H;  1JT8 A;  1NMG A;  2CWA A;  1XMQ Q;  1GM5 A;  1PH4 A;  3J7Z C;  1K83 H;  1UE7 A;  2WP8 J;  3PO3 H;  1XJV A;  3S15 H;  2A1A A;  2DGY A;  2AWN A;  3K81 C;  4NPS A;  1PH7 A;  4A3G G;  1DGS A;  1VQF A;  4GLA C;  4UPA A;  3CCU A;  1EWI A;  2IX0 A;  4GNX B;  1VQK A;  1D7Q A;  3KF6 A;  3AFQ A;  2WB1 E;  2EQS A;  5IWA Q;  1XMO L;  3S2D H;  3FHW A;  4BY1 H;  4JYA L;  4QY7 A;  2WB1 G;  4HIO A;  1IBK Q;  5IYC G;  5GAD C;  1X56 A;  3M4P A;  3UDI A;  4LFC Q;  2YU9 H;  4UP9 A;  1Y1W H;  4R4Q A;  2R7D A;  4JCV E;  2GVB A;  1S3O A;  5GQO A;  3S14 H;  1GKH A;  4JI0 L;  3SGI A;  3HKZ G;  1XPU A;  1VQ7 A;  2E2J H;  4DV1 L;  2E5L L;  2Z0S A;  4YCW A;  1N34 L;  1IBL Q;  4JI6 Q;  2R93 H;  1EOV A;  2QA4 A;  2HT1 A;  4JI8 Q;  5IP7 H;  1HNZ Q;  4MNO A;  5AJ3 Q;  1BKB A;  5GAG C;  5IYB H;  3NEM A;  3CCE A;  3RZO H;  4A93 G;  1WCM H;  1G6P A;  4DR1 L;  4LFB Q;  2RF4 A;  2AMC B;  4BXX H;  1HR0 L;  3ERS X;  4JV5 Q;  3U58 A;  1CKN A;  2ZM6 Q;  1MKH A;  1SMX A;  3IRB A;  1C7Y A;  1KD1 C;  4C3I H;  3CME A;  1XPO A;  2FXQ A;  2UXD Q;  2I5L X;  3UDX A;  4DR7 Q;  3U50 C;  1SN8 A;  3KF6 B;  3CCQ A;  1XNR L;  2BH8 A;  3J81 c;  2OWO A;  2IHE A;  3TRE A;  3T1Y L;  4LF8 L;  3HOZ G;  1RL2 A;  1KXL A;  3FKI H;  1E7Z A;  1UWV A;  3LGJ A;  4A75 A;  1K8G A;  4B3S Q;  2NZO A;  2YTX A;  3S16 H;  2UXC L;  1SRU A;  3HFZ B;  5M3M G;  1HZB A;  3BU2 A;  3PUZ A;  4YY3 L;  1K8A C;  2HHH L;  1C0A A;  1D8L A;  5C44 H;  2JA8 G;  5LMU Q;  1AE2 A;  3A5U A;  4A3E H;  4GOP C;  4POG A;  4NXN L;  4A3B G;  4DR6 Q;  2K52 A;  2JEB I;  4GKJ L;  2IHF A;  4A3M G;  3GTG H;  3PUX A;  3J80 c;  3M4O H;  3S1Q H;  1L1O A;  5LMN Q;  2DUD A;  5C3E G;  3DLL A;  4DV6 Q;  1N33 Q;  4IFD G;  1OXV A;  1KHI A;  4OON A;  1L1O C;  4A3I H;  3HOW G;  4P71 A;  2B3G A;  2OCE A;  3ZJY C;  4GKK Q;  3G6E A;  1QVC A;  2JA9 A;  4GS3 A;  3ICE A;  1CKN B;  4BA1 I;  1SFO H;  1L0W A;  3S1R H;  4A4I A;  1BBW A;  1Y1V G;  2N78 A;  3GTL H;  1A63 A;  1YNX A;  2F4V L;  3NEN A;  1MIU A;  1X3F A;  4YCU A;  3CXC A;  4APV A;  1K0R A;  2QGQ A;  4X64 L;  4IOA A;  3S24 A;  2E2I H;  4B3R Q;  4JI7 L;  1GVP A;  4ALP A;  4JOI A;  2JA8 H;  1ASY A;  2YTY A;  4DAM A;  2R7Z G;  3HKS A;  3JAM c;  1Q7Y C;  1QUQ A;  4JOI C;  5C4X H;  3CMA A;  4JI2 L;  4JI4 Q;  4HJ5 A;  3S1M H;  2UUC Q;  1KRS A;  3EBE A;  1B8A A;  1PFS A;  2RHS B;  4R4I A;  1EFW A;  1UE1 A;  4DUY L;  4L5T A;  1IBM L;  3HOY H;  1VQL A;  2Z6K A;  1YHA A;  3OTO Q;  3RZD H;  1VQC A;  1KIX A;  1I94 Q;  3HOW H;  1HZC A;  3HOX H;  4GNX A;  1L1O B;  2AWO A;  2NVQ H;  3I4N G;  2Z6K C;  2OTJ A;  4R4C A;  4GNX C;  1WJJ A;  4HJ7 A;  4DR5 Q;  4AQY Q;  1X55 A;  2PI2 E;  4JBJ A;  2VUM G;  2LXK A;  1TWG H;  4PZ6 A;  1Y1V H;  4DK6 C;  2N8N A;  4LUV A;  4PG3 A;  4KHP Q;  1JJC B;  3I2Z A;  1MJC A;  4TVA B;  5DLQ E;  5IE8 A;  3TQY A;  1VCI A;  4DR2 L;  4LF9 Q;  2R7F A;  5EAY A;  4QIW E;  1VQ5 A;  3J81 i;  1PVO A;  4R1J A;  4DV2 Q;  4A3L H;  4DK3 C;  1JJ2 A;  1SRO A;  1SR3 A;  4JI1 Q;  1VQM A;  3T1H L;  1OXX K;  1U5K A;  2V1C C;  3U4V A;  4YWK A;  1UE5 A;  2A19 A;  4EQ5 A;  4IFD J;  1YI2 A;  1G29 1;  4DR3 L;  3F2D A;  1HZA A;  4P72 A;  4JI3 L;  5BR8 L;  3GTK H;  5E7N A;  3F2B A;  3CF5 A;  2Q2U A;  2H5X A;  3STB D;  1YJ9 A;  1WI5 A;  2JA5 G;  4L5S A;  2N3S A;  4DV4 L;  3J81 j;  4LNQ A;  4TQU S;  2R7Z H;  3CCL A;  4JBM A;  1PA6 A;  1PH5 A;  3J7A 5;  3J80 i;  3K0X A;  4LFA Q;  4A3F G;  1NTG A;  1A0I A;  4QGU A;  5M3F G;  1XMQ L;  1HNW Q;  4BBR H;  1B7Y B;  3GD7 A;  2JE6 I;  4OO1 G;  1A8V A;  2CQO A;  1E1O A;  5GAH C;  1Q86 C;  1LYL A;  3TRZ A;  1IYJ B;  1PV4 A;  2A8V A;  3ER0 A;  1Q81 C;  5FLM G;  3GTM H;  1UEB A;  4PZ7 A;  1VQ8 A;  1YJN A;  2ZTE A;  5IY0 A;  2NVX H;  1J5E L;  3PCO B;  4PZ8 A;  4NXM Q;  4IPH A;  4O2D A;  1NY4 A;  2GN5 A;  4MTN A;  1IBK L;  2MO1 A;  5FJ8 G;  2AKW B;  5J3B A;  4LFC L;  1CSQ A;  1VS0 A;  3F2C A;  3W5O A;  1VQE A;  4IPG A;  2I5M X;  1VQP A;  1YHQ A;  3A74 A;  5JJK A;  1PH2 A;  1XNQ Q;  1W3S A;  4C3J H;  1IL2 A;  2NN6 G;  3M9B A;  5M5X H;  1PHJ A;  2JA6 H;  3I55 A;  4AH6 A;  3FP9 A;  4QL5 A;  3JAM i;  1X65 A;  1KC8 C;  4JI6 L;  3TS0 A;  1C9O A;  1JE5 A;  5IT9 c;  3UDF A;  3RR5 A;  4POF A;  4FDB A;  1YEZ A;  5C0X G;  5AJ3 L;  2PNH A;  3NBH B;  5M3F H;  5M5W H;  1HNZ L;  4DR4 Q;  4DV7 Q;  3H3V I;  3MEF A;  1FJG L;  2YV5 A;  4A3G H;  1VQB A;  2L15 A;  4LFB L;  4A76 A;  4DV0 L;  1K3R A;  3ULL A;  4NB3 A;  3UE1 A;  2R92 G;  3CCR A;  4R4T A;  5JJL A;  1LM0 A;  4LWC A;  4DV5 Q;  3CCM A;  4IOC A;  1N36 Q;  4B3M Q;  2E5L Q;  3CD6 A;  4AIM A;  2ZM6 L;  4DV1 Q;  1N34 Q;  4JI5 Q;  3M7N A;  5IYC H;  4L5R C;  4IFD I;  1Q8K A;  4DNI A;  4EX5 A;  3L7Z C;  3CC7 A;  5JEA G;  5FJ8 H;  3KJP A;  4DR7 L;  2GVA A;  5GAE C;  1OTC A;  1VQ6 A;  1HR0 W;  2UU9 L;  2PQA A;  4B3T Q;  1U0L A;  3BZC A;  1XTD A;  1KAW A;  4IO9 A;  1Z47 A;  3UE0 A;  5C4J H;  2C35 B;  2ALY B;  1HH2 P;  2K14 A;  2OTL A;  4A93 H;  4HIK A;  2HQL A;  1JB7 A;  4KI0 A;  2F3I A;  1LUZ A;  4DR6 L;  1CKM A;  3G48 A;  3KJO A;  2R92 H;  4UP7 A;  1PH1 A;  5LMN L;  4DV6 L;  2MFI A;  2PMZ E;  4C3H H;  1YHB A;  2ZJQ A;  1V43 A;  4IPC A;  3F8T A;  3PSI A;  4IJH A;  3I4M G;  1KQS A;  2VW9 A;  2ATW A;  4IPD A;  4GKK L;  3HOZ H;  4NXN Q;  1E3P A;  3E9H A;  3E9I A;  4X6A H;  2I5H A;  3RLO A;  1M90 C;  5C0X J;  5M3M H;  4AYB E;  1BBU A;  4DUZ L;  4HJ8 A;  3K80 C;  1Q1B A;  1V1Q A;  2PQA B;  4AYB G;  2Y0S E;  3PV0 A;  4LF4 Q;  4A3B H;  1VQJ A;  4GLX A;  1FL0 A;  3L0O A;  4JG2 A;  3H3V H;  1LTL A;  2Y0S G;  1TWA H;  4A3M H;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...