5FLMK

Structure of transcribing mammalian rna polymerase ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5flmK00
4G7ZA 3PO2C 2R7ZC 3HOWC 4MEYA 3I4MC 4OINA 3GTOK 5FJ8K 4XLPA 3CQZC 4C3JK 4C3IK 1TWCC 4XSZA 3S1RC 2R92K 3HOUK 3S16K 4BY7C 4LK0A 3H3VD 2PMZD 5FLMC 3S1QK 4YFKA 3FKIK 3HOXK 5M5WK 1SMYA 1SFOK 4A3JC 2JA7K 2JA8C 3H3VL 4C2MK 4YFXA 4GZYA 5IYBK 3GTJK 2Y0SD 2Y0SL 4A3CK 1Y1VK 3S2HK 4KMUA 3S2DK 2NVYC 1YNNA 1I6HC 4LLGA 2R93K 3S1NK 3GTGC 5IYDC 3HOYC 4A3BC 5IP9K 4G7OA 4A3KK 3S17K 2B63C 4Q4ZA 3RZOK 2A69A 4BBRC 4A3EK 2E2HK 1TWAC 3DXJA 5C44C 1TWFC 3GTLK 3GTQK 5C4XC 1I3QC 4A3MK 3H0GC 4Y7NK 2WB1D 2WB1L 3K7AC 3M3YK 1TWGK 1TWHK 4QJVA 3HOZK 3HKZD 4A3GK 3HKZL 3S1MK 4C3HK 4LK1A 3M4OK 2NVQC 1WCMK 4BBSC 1K83K 2VUMK 3PO2K 2YU9K 4XLNA 3I4MK 2NVTK 2E2IC 2BE5A 3GTMK 2PA8D 2PMZL 1BDFA 1I50K 2PA8L 3CQZK 1TWCK 3S1RK 4X6AC 4JK1A 4AYBD 4A3IC 2A6EA 3GTPC 5FLMK 3RZDK 2JA5K 5C4JK 4A3JK 2JA8K 4A3LC 4Q5SA 4OIRA 4A3DC 1IW7A 1I6HK 5M3FK 2O5IA 4BY1K 4A3FC 3HOYK 4A3BK 3S1QC 3FKIC 3HOXC 1SFOC 1R9TC 2E2JK 2B63K 2NVXC 4BBRK 3S15K 3I4NC 4A93C 3GTKC 1TWAK 5C44K 1Y1WK 2A68A 4NOIA 3GTJC 4LJZA 5C3EC 1I3QK 3HOVK 4A3CC 3H0GK 1Y1VC 4Y52C 3S2HC 3S2DC 4BXXC 4YFNA 5M5XK 3HOWK 2R7ZK 3S14C 5IYCC 4QIWD 5IP9C 5IP7C 2NVQK 4QIWL 3RZOC 4BY7K 2CW0A 2JA6C 2E2HC 2O5JA 3PO3C 4AYBL 5TMFA 1I6VA 2WAQD 4KN4A 2WAQL 4Y7NC 4OIPA 1YNJA 3M3YC 1TWHC 5D4DA 1ZYRA 4YG2A 3M4OC 3GTPK 3S1MC 3GTOC 4OIOA 1WCMC 4QJVB 4MQ9A 2R92C 2VUMC 2NVYK 2YU9C 3HOUC 3S16C 4MEXA 2NVTC 3GTGK 4A3LK 5M5YK 3GTMC 5IYDK 1I50C 3EQLA 4A3DK 2JA7C 5M3MK 5C4XK 1TWFK 5IYBC 4A3FK 5TMCA 3RZDC 2JA5C 1XPPA 5C4JC 1R9TK 3I4NK 3K7AK 2NVXK 4A93K 4KN7A 3GTKK 2PPBA 2R93C 3S1NC 5C3EK 3WODA 4A3KC 3S17C 4Y52K 4BBSK 4BXXK 4A3EC 2A6HA 3GTQC 1HQMA 4OIQA 3GTLC 4BY1C 3S14K 5IYCK 4XSXA 2E2IK 4A3MC 5IP7K 3S15C 2E2JC 4X6AK 2JA6K 1TWGC 4ZH4A 1Y1WC 3HOZC 4A3IK 3PO3K 4A3GC 3HOVC 4G7HA 1K83C
chains in the Genus database with same CATH superfamily
3HOWC 3MMLB 3GTOK 3VA7A 3QX3A 3BP3A 1TWGA 1VJEA 4C3JK 3H3VD 1KQ4A 3S1QK 4YFKA 1SFOK 3T00A 4A3JC 3GTMA 4YFXA 4GZYA 3CQZA 5IYBK 3GTJK 1VH2A 1PJ5A 1X31C 3V4GA 3L4JA 4KMDA 2FQOA 1WSVA 1USMA 3S2DK 1WSRA 5IORA 2R93K 4XCHA 3S1NK 5CJ9A 3HOYC 4G7OA 3S17K 4KM9A 4Q4ZA 2P5MA 4BBRC 4KASA 1DCPA 5C4XC 1TWFC 3FOEA 3M3YK 1TWHK 4A3GK 4GTEA 2FQTA 1J98A 2NVQC 1Y1WA 2VUMK 1I3QA 3NUHA 2E2IC 1ISEA 2PA8D 1TWCK 2XCOA 3AQPA 1ZXOA 1TWCA 1B4BA 5FLMK 3A8JA 5E68A 4KARA 3GTPA 1IW7A 1I6HK 3S1QC 1SFOC 2B63K 1EH1A 5C44K 2A68A 3GTJC 5IOTA 1O28A 3S2DC 3ERED 1F7UA 3S14C 4BY7K 2CW0A 4ILDA 4AYBL 2WAQD 2EBBA 4BLAA 1O2BA 3M3YC 1IL2A 1TWHC 5D4DA 2ZFZA 1UV7A 4OIOA 4QJVB 1F7VA 4PABA 2VUMC 3LAPA 4MEXA 3JSTA 3GTGK 4GT9A 5IYDK 1O27A 2JA7C 2XCQA 2W7VA 5M3MK 4M1XA 4A3FK 4A93K 4KN7A 4G0UA 3GTKK 1WOSA 3FKIA 5C3EK 2GSNA 4A3KC 1J6VA 1WOPA 4BXXK 1USOA 2A6HA 3GDZA 5IP7K 4X6AK 1VRQC 3HXAA 3AD9C 4ZH4A 3LPXA 4A3IK 2CFAA 4C3HC 3OREA 4FM9A 1ZVUA 4G0VA 2E2HA 3N0CA 4G7HA 1K83C 3PO2C 1IS1A 4MEYA 3I4MC 4OINA 1XZPB 4C3IK 3S1RC 2R92K 4BY7C 3HOUK 3S16K 4J3NA 2YU9A 5M5WK 4C2MK 1I50A 2Y0SD 4A3CK 1JOEA 3S2HK 4KMHA 1VGXA 1YNNA 4LLGA 3GTGC 5IYDC 4A3BC 3RZOK 3GTQK 3DXJA 3GTLK 3FHZA 4A3MK 3H0GC 1J6WA 2WB1D 3GTQA 3GTLA 3IPJA 2GAHC 1TWGK 1O25A 3HOZK 3HKZD 3SZZA 1V5VA 2NVTK 2BE5A 3GTMK 2R7ZA 3CQZK 1BDFA 4X6AC 4AYBD 4A3IC 2P8TA 1GE9A 2GSUA 3GEIA 2JA8K 3TFHA 4KB2A 4WJ3M 2ZUEA 4A3DC 4O2DA 5M3FK 4BY1K 5CHPA 2NVYA 3S15K 1R9TC 2NVXC 3GSIA 1TWAK 1Y1WK 4KAWX 4LJZA 4A3CC 1I3QK 1TWAA 3S2HC 3AQOA 3AH5A 1F9NA 1IE0A 1O26A 4QIWL 3RZOC 5EGHA 1PJ6A 1WORA 2V6TA 2JA6C 3PO3C 1I6VA 4OIPA 5HL8A 3GEHA 1VLOA 1JQWA 3ADAC 3GTOC 3GTPK 1WIHA 4C3JC 1YCLA 1L0WA 4LOWA 2NVTC 4A3LK 5M5YK 3GTMC 4BLBA 3S0XA 2KWAA 1XXBA 4KDDA 5IYBC 4GTDA 3L4KA 3K7AK 3I4NK 5JVOA 1ZQ1C 2R93C 1EQRA 3S1NC 1F93A 2JA7A 3WODA 3TFIA 3S17C 4Y52K 3T01A 1HQMA 1Y1VA 4KC6A 4BY1C 1XZQB 4OIQA 5IYCK 4XSXA 3S15C 1BS2A 4A3GC 1Y1WC 4GTFA 4KATA 1TWCC 1WCMA 1K83A 5FLMC 4LR2A 3FKIK 3H3VL 4DDQA 4KMUA 1I6HC 5IOSA 2JA5A 2RH6A 1YX2A 2B63C 1XXCA 4A3EK 3AD7C 2E2HK 5C44C 5EGEA 1RU0A 4Y7NK 1EFWA 3BUEA 3K7AC 4QJVA 3S1MK 3M4OK 3OPFA 1XXAA 4P5AA 2YU9K 3H0GA 2PMZL 1I50K 2PA8L 4P5BA 4BKWA 1DCHA 2A6EA 3RZDK 4A3JK 1B4AA 3FOFA 5IOQA 1G51A 1C0AA 1PJ7A 2O5IA 4P9SA 4A3FC 3HOYK 1EK8A 3FKIC 4AH6A 4A93C 1IQ0A 4BBRK 3T02A 3GTKC 5C3EC 3HOVK 1BJTA 1TWFA 4WJ4A 4BXXC 1XZPA 2R7ZK 1R9TA 2NVXA 5IP7C 2NVQK 3N0BA 2E2HC 2GAGC 3GIRA 4GTCA 5TMFA 1J6XA 3A8IA 4KN4A 2WAQL 4Y7NC 3SZYA 2E2IA 1ZYRA 2V6SA 4YG2A 3M4OC 3S1MC 2RGRA 2JA6A 4C3IC 3A8KA 4MQ9A 2R92C 3HOUC 2NVYK 2YU9C 3S16C 3TFJA 4GTLA 1I50C 3GTOA 1HI9A 4KMAA 4C2MC 5L46A 3RZDC 1IBAA 1SFOA 4BBSK 3GTJA 3GTQC 3GTLC 4PAAA 3S14K 4A3MC 2R93A 1BGWA 1TWGC 3G4AA 3HOZC 2PHCB 3HOVC 4G7ZA 2R7ZC 1ZBSA 5FJ8K 4XLPA 1TWHA 3CQZC 3OEPA 4XSZA 3TTGA 4LK0A 2PMZD 2VUMA 3HOXK 1SMYA 2JA7K 2JA8C 2Y0SL 1WQHA 1Y1VK 2NVYC 2D6FC 1O29A 4G0WA 5IP9K 4A3KK 2A69A 3Q3QA 1TWAC 1I3QC 2WB1L 4RMFA 5TJ3A 3HKZL 2B63A 4C3HK 4LK1A 1WCMK 4BBSC 1K83K 3PO2K 4XLNA 4KM8A 3I4MK 3N3YA 3S1RK 2JH3A 1WQGA 4JK1A 3GTPC 2JA5K 5C4JK 1O2AA 2CFAB 4A3LC 4Q5SA 4WILA 3G4CA 4OIRA 1XZQA 4C45A 4A3BK 3HOXC 2E2JK 3I4NC 1O2FB 2Y3PA 1DD5A 3GTGA 5JFEA 4NOIA 1DCOA 3H0GK 1JVIA 1Y1VC 4Y52C 2GSOA 4YFNA 5M5XK 3HOWK 3AD8C 5IYCC 2ZUFA 4QIWD 5IP9C 3GTKA 4FZBA 4GTBA 2O5JA 3CAGA 1YNJA 3LAJA 1WCMC 2V6UA 1EI6A 3EQLA 4A3DK 5C4XK 1TWFK 2R92A 5TMCA 2JA5C 1XPPA 1O24A 5C4JC 4KB4A 1R9TK 2NVXK 2XCRB 2PPBA 4LQYA 3BP8C 1AB4A 4A3EC 1INNA 2E2IK 2E2JC 4GFQA 2JA6K 3GEEA 4GTAA 3PO3K 1WOOA 1WQFA
chains in the Genus database with same CATH topology
4G7ZA 3PO2C 2R7ZC 3HOWC 4MEYA 3I4MC 4OINA 3GTOK 5FJ8K 4XLPA 3CQZC 4C3JK 4C3IK 1TWCC 4XSZA 3S1RC 2R92K 3HOUK 3S16K 4BY7C 4LK0A 3H3VD 2PMZD 5FLMC 3S1QK 4YFKA 3FKIK 3HOXK 5M5WK 1SMYA 1SFOK 4A3JC 2JA7K 2JA8C 3H3VL 4C2MK 4YFXA 4GZYA 5IYBK 3GTJK 2Y0SD 2Y0SL 4A3CK 1Y1VK 3S2HK 4KMUA 3S2DK 2NVYC 1YNNA 1I6HC 4LLGA 2R93K 3S1NK 3GTGC 5IYDC 3HOYC 4A3BC 5IP9K 4G7OA 4A3KK 3S17K 2B63C 4Q4ZA 3RZOK 2A69A 4BBRC 4A3EK 2E2HK 1TWAC 3DXJA 5C44C 1TWFC 3GTLK 3GTQK 5C4XC 1I3QC 4A3MK 3H0GC 4Y7NK 2WB1D 2WB1L 3K7AC 3M3YK 1TWGK 1TWHK 4QJVA 3HOZK 3HKZD 4A3GK 3HKZL 3S1MK 4C3HK 4LK1A 3M4OK 2NVQC 1WCMK 4BBSC 1K83K 2VUMK 3PO2K 2YU9K 4XLNA 3I4MK 2NVTK 2E2IC 2BE5A 3GTMK 2PA8D 2PMZL 1BDFA 1I50K 2PA8L 3CQZK 1TWCK 3S1RK 4X6AC 4JK1A 4AYBD 4A3IC 2A6EA 3GTPC 5FLMK 3RZDK 2JA5K 5C4JK 4A3JK 2JA8K 4A3LC 4Q5SA 4OIRA 4A3DC 1IW7A 1I6HK 5M3FK 2O5IA 4BY1K 4A3FC 3HOYK 4A3BK 3S1QC 3FKIC 3HOXC 1SFOC 1R9TC 2E2JK 2B63K 2NVXC 4BBRK 3S15K 3I4NC 4A93C 3GTKC 1TWAK 5C44K 1Y1WK 2A68A 4NOIA 3GTJC 4LJZA 5C3EC 1I3QK 3HOVK 4A3CC 3H0GK 1Y1VC 4Y52C 3S2HC 3S2DC 4BXXC 4YFNA 5M5XK 3HOWK 2R7ZK 3S14C 5IYCC 4QIWD 5IP9C 5IP7C 2NVQK 4QIWL 3RZOC 4BY7K 2CW0A 2JA6C 2E2HC 2O5JA 3PO3C 4AYBL 5TMFA 1I6VA 2WAQD 4KN4A 2WAQL 4Y7NC 4OIPA 1YNJA 3M3YC 1TWHC 5D4DA 1ZYRA 4YG2A 3M4OC 3GTPK 3S1MC 3GTOC 4OIOA 1WCMC 4QJVB 4MQ9A 2R92C 2VUMC 2NVYK 2YU9C 3HOUC 3S16C 4MEXA 2NVTC 3GTGK 4A3LK 5M5YK 3GTMC 5IYDK 1I50C 3EQLA 4A3DK 2JA7C 5M3MK 5C4XK 1TWFK 5IYBC 4A3FK 5TMCA 3RZDC 2JA5C 1XPPA 5C4JC 1R9TK 3I4NK 3K7AK 2NVXK 4A93K 4KN7A 3GTKK 2PPBA 2R93C 3S1NC 5C3EK 3WODA 4A3KC 3S17C 4Y52K 4BBSK 4BXXK 4A3EC 2A6HA 3GTQC 1HQMA 4OIQA 3GTLC 4BY1C 3S14K 5IYCK 4XSXA 2E2IK 4A3MC 5IP7K 3S15C 2E2JC 4X6AK 2JA6K 1TWGC 4ZH4A 1Y1WC 3HOZC 4A3IK 3PO3K 4A3GC 3HOVC 4G7HA 1K83C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z A;  3PO2 C;  2R7Z C;  3HOW C;  4MEY A;  3I4M C;  4OIN A;  3GTO K;  5FJ8 K;  4XLP A;  3CQZ C;  4C3J K;  4C3I K;  1TWC C;  4XSZ A;  3S1R C;  2R92 K;  3HOU K;  3S16 K;  4BY7 C;  4LK0 A;  3H3V D;  2PMZ D;  5FLM C;  3S1Q K;  4YFK A;  3FKI K;  3HOX K;  5M5W K;  1SMY A;  1SFO K;  4A3J C;  2JA7 K;  2JA8 C;  3H3V L;  4C2M K;  4YFX A;  4GZY A;  5IYB K;  3GTJ K;  2Y0S D;  2Y0S L;  4A3C K;  1Y1V K;  3S2H K;  4KMU A;  3S2D K;  2NVY C;  1YNN A;  1I6H C;  4LLG A;  2R93 K;  3S1N K;  3GTG C;  5IYD C;  3HOY C;  4A3B C;  5IP9 K;  4G7O A;  4A3K K;  3S17 K;  2B63 C;  4Q4Z A;  3RZO K;  2A69 A;  4BBR C;  4A3E K;  2E2H K;  1TWA C;  3DXJ A;  5C44 C;  1TWF C;  3GTL K;  3GTQ K;  5C4X C;  1I3Q C;  4A3M K;  3H0G C;  4Y7N K;  2WB1 D;  2WB1 L;  3K7A C;  3M3Y K;  1TWG K;  1TWH K;  4QJV A;  3HOZ K;  3HKZ D;  4A3G K;  3HKZ L;  3S1M K;  4C3H K;  4LK1 A;  3M4O K;  2NVQ C;  1WCM K;  4BBS C;  1K83 K;  2VUM K;  3PO2 K;  2YU9 K;  4XLN A;  3I4M K;  2NVT K;  2E2I C;  2BE5 A;  3GTM K;  2PA8 D;  2PMZ L;  1BDF A;  1I50 K;  2PA8 L;  3CQZ K;  1TWC K;  3S1R K;  4X6A C;  4JK1 A;  4AYB D;  4A3I C;  2A6E A;  3GTP C;  5FLM K;  3RZD K;  2JA5 K;  5C4J K;  4A3J K;  2JA8 K;  4A3L C;  4Q5S A;  4OIR A;  4A3D C;  1IW7 A;  1I6H K;  5M3F K;  2O5I A;  4BY1 K;  4A3F C;  3HOY K;  4A3B K;  3S1Q C;  3FKI C;  3HOX C;  1SFO C;  1R9T C;  2E2J K;  2B63 K;  2NVX C;  4BBR K;  3S15 K;  3I4N C;  4A93 C;  3GTK C;  1TWA K;  5C44 K;  1Y1W K;  2A68 A;  4NOI A;  3GTJ C;  4LJZ A;  5C3E C;  1I3Q K;  3HOV K;  4A3C C;  3H0G K;  1Y1V C;  4Y52 C;  3S2H C;  3S2D C;  4BXX C;  4YFN A;  5M5X K;  3HOW K;  2R7Z K;  3S14 C;  5IYC C;  4QIW D;  5IP9 C;  5IP7 C;  2NVQ K;  4QIW L;  3RZO C;  4BY7 K;  2CW0 A;  2JA6 C;  2E2H C;  2O5J A;  3PO3 C;  4AYB L;  5TMF A;  1I6V A;  2WAQ D;  4KN4 A;  2WAQ L;  4Y7N C;  4OIP A;  1YNJ A;  3M3Y C;  1TWH C;  5D4D A;  1ZYR A;  4YG2 A;  3M4O C;  3GTP K;  3S1M C;  3GTO C;  4OIO A;  1WCM C;  4QJV B;  4MQ9 A;  2R92 C;  2VUM C;  2NVY K;  2YU9 C;  3HOU C;  3S16 C;  4MEX A;  2NVT C;  3GTG K;  4A3L K;  5M5Y K;  3GTM C;  5IYD K;  1I50 C;  3EQL A;  4A3D K;  2JA7 C;  5M3M K;  5C4X K;  1TWF K;  5IYB C;  4A3F K;  5TMC A;  3RZD C;  2JA5 C;  1XPP A;  5C4J C;  1R9T K;  3I4N K;  3K7A K;  2NVX K;  4A93 K;  4KN7 A;  3GTK K;  2PPB A;  2R93 C;  3S1N C;  5C3E K;  3WOD A;  4A3K C;  3S17 C;  4Y52 K;  4BBS K;  4BXX K;  4A3E C;  2A6H A;  3GTQ C;  1HQM A;  4OIQ A;  3GTL C;  4BY1 C;  3S14 K;  5IYC K;  4XSX A;  2E2I K;  4A3M C;  5IP7 K;  3S15 C;  2E2J C;  4X6A K;  2JA6 K;  1TWG C;  4ZH4 A;  1Y1W C;  3HOZ C;  4A3I K;  3PO3 K;  4A3G C;  3HOV C;  4G7H A;  1K83 C; 
#chains in the Genus database with same CATH topology
 3HOW C;  3MML B;  3GTO K;  3VA7 A;  3QX3 A;  3BP3 A;  1TWG A;  1VJE A;  4C3J K;  3H3V D;  1KQ4 A;  3S1Q K;  4YFK A;  1SFO K;  3T00 A;  4A3J C;  3GTM A;  4YFX A;  4GZY A;  3CQZ A;  5IYB K;  3GTJ K;  1VH2 A;  1PJ5 A;  1X31 C;  3V4G A;  3L4J A;  4KMD A;  2FQO A;  1WSV A;  1USM A;  3S2D K;  1WSR A;  5IOR A;  2R93 K;  4XCH A;  3S1N K;  5CJ9 A;  3HOY C;  4G7O A;  3S17 K;  4KM9 A;  4Q4Z A;  2P5M A;  4BBR C;  4KAS A;  1DCP A;  5C4X C;  1TWF C;  3FOE A;  3M3Y K;  1TWH K;  4A3G K;  4GTE A;  2FQT A;  1J98 A;  2NVQ C;  1Y1W A;  2VUM K;  1I3Q A;  3NUH A;  2E2I C;  1ISE A;  2PA8 D;  1TWC K;  2XCO A;  3AQP A;  1ZXO A;  1TWC A;  1B4B A;  5FLM K;  3A8J A;  5E68 A;  4KAR A;  3GTP A;  1IW7 A;  1I6H K;  3S1Q C;  1SFO C;  2B63 K;  1EH1 A;  5C44 K;  2A68 A;  3GTJ C;  5IOT A;  1O28 A;  3S2D C;  3ERE D;  1F7U A;  3S14 C;  4BY7 K;  2CW0 A;  4ILD A;  4AYB L;  2WAQ D;  2EBB A;  4BLA A;  1O2B A;  3M3Y C;  1IL2 A;  1TWH C;  5D4D A;  2ZFZ A;  1UV7 A;  4OIO A;  4QJV B;  1F7V A;  4PAB A;  2VUM C;  3LAP A;  4MEX A;  3JST A;  3GTG K;  4GT9 A;  5IYD K;  1O27 A;  2JA7 C;  2XCQ A;  2W7V A;  5M3M K;  4M1X A;  4A3F K;  4A93 K;  4KN7 A;  4G0U A;  3GTK K;  1WOS A;  3FKI A;  5C3E K;  2GSN A;  4A3K C;  1J6V A;  1WOP A;  4BXX K;  1USO A;  2A6H A;  3GDZ A;  5IP7 K;  4X6A K;  1VRQ C;  3HXA A;  3AD9 C;  4ZH4 A;  3LPX A;  4A3I K;  2CFA A;  4C3H C;  3ORE A;  4FM9 A;  1ZVU A;  4G0V A;  2E2H A;  3N0C A;  4G7H A;  1K83 C;  3PO2 C;  1IS1 A;  4MEY A;  3I4M C;  4OIN A;  1XZP B;  4C3I K;  3S1R C;  2R92 K;  4BY7 C;  3HOU K;  3S16 K;  4J3N A;  2YU9 A;  5M5W K;  4C2M K;  1I50 A;  2Y0S D;  4A3C K;  1JOE A;  3S2H K;  4KMH A;  1VGX A;  1YNN A;  4LLG A;  3GTG C;  5IYD C;  4A3B C;  3RZO K;  3GTQ K;  3DXJ A;  3GTL K;  3FHZ A;  4A3M K;  3H0G C;  1J6W A;  2WB1 D;  3GTQ A;  3GTL A;  3IPJ A;  2GAH C;  1TWG K;  1O25 A;  3HOZ K;  3HKZ D;  3SZZ A;  1V5V A;  2NVT K;  2BE5 A;  3GTM K;  2R7Z A;  3CQZ K;  1BDF A;  4X6A C;  4AYB D;  4A3I C;  2P8T A;  1GE9 A;  2GSU A;  3GEI A;  2JA8 K;  3TFH A;  4KB2 A;  4WJ3 M;  2ZUE A;  4A3D C;  4O2D A;  5M3F K;  4BY1 K;  5CHP A;  2NVY A;  3S15 K;  1R9T C;  2NVX C;  3GSI A;  1TWA K;  1Y1W K;  4KAW X;  4LJZ A;  4A3C C;  1I3Q K;  1TWA A;  3S2H C;  3AQO A;  3AH5 A;  1F9N A;  1IE0 A;  1O26 A;  4QIW L;  3RZO C;  5EGH A;  1PJ6 A;  1WOR A;  2V6T A;  2JA6 C;  3PO3 C;  1I6V A;  4OIP A;  5HL8 A;  3GEH A;  1VLO A;  1JQW A;  3ADA C;  3GTO C;  3GTP K;  1WIH A;  4C3J C;  1YCL A;  1L0W A;  4LOW A;  2NVT C;  4A3L K;  5M5Y K;  3GTM C;  4BLB A;  3S0X A;  2KWA A;  1XXB A;  4KDD A;  5IYB C;  4GTD A;  3L4K A;  3K7A K;  3I4N K;  5JVO A;  1ZQ1 C;  2R93 C;  1EQR A;  3S1N C;  1F93 A;  2JA7 A;  3WOD A;  3TFI A;  3S17 C;  4Y52 K;  3T01 A;  1HQM A;  1Y1V A;  4KC6 A;  4BY1 C;  1XZQ B;  4OIQ A;  5IYC K;  4XSX A;  3S15 C;  1BS2 A;  4A3G C;  1Y1W C;  4GTF A;  4KAT A;  1TWC C;  1WCM A;  1K83 A;  5FLM C;  4LR2 A;  3FKI K;  3H3V L;  4DDQ A;  4KMU A;  1I6H C;  5IOS A;  2JA5 A;  2RH6 A;  1YX2 A;  2B63 C;  1XXC A;  4A3E K;  3AD7 C;  2E2H K;  5C44 C;  5EGE A;  1RU0 A;  4Y7N K;  1EFW A;  3BUE A;  3K7A C;  4QJV A;  3S1M K;  3M4O K;  3OPF A;  1XXA A;  4P5A A;  2YU9 K;  3H0G A;  2PMZ L;  1I50 K;  2PA8 L;  4P5B A;  4BKW A;  1DCH A;  2A6E A;  3RZD K;  4A3J K;  1B4A A;  3FOF A;  5IOQ A;  1G51 A;  1C0A A;  1PJ7 A;  2O5I A;  4P9S A;  4A3F C;  3HOY K;  1EK8 A;  3FKI C;  4AH6 A;  4A93 C;  1IQ0 A;  4BBR K;  3T02 A;  3GTK C;  5C3E C;  3HOV K;  1BJT A;  1TWF A;  4WJ4 A;  4BXX C;  1XZP A;  2R7Z K;  1R9T A;  2NVX A;  5IP7 C;  2NVQ K;  3N0B A;  2E2H C;  2GAG C;  3GIR A;  4GTC A;  5TMF A;  1J6X A;  3A8I A;  4KN4 A;  2WAQ L;  4Y7N C;  3SZY A;  2E2I A;  1ZYR A;  2V6S A;  4YG2 A;  3M4O C;  3S1M C;  2RGR A;  2JA6 A;  4C3I C;  3A8K A;  4MQ9 A;  2R92 C;  3HOU C;  2NVY K;  2YU9 C;  3S16 C;  3TFJ A;  4GTL A;  1I50 C;  3GTO A;  1HI9 A;  4KMA A;  4C2M C;  5L46 A;  3RZD C;  1IBA A;  1SFO A;  4BBS K;  3GTJ A;  3GTQ C;  3GTL C;  4PAA A;  3S14 K;  4A3M C;  2R93 A;  1BGW A;  1TWG C;  3G4A A;  3HOZ C;  2PHC B;  3HOV C;  4G7Z A;  2R7Z C;  1ZBS A;  5FJ8 K;  4XLP A;  1TWH A;  3CQZ C;  3OEP A;  4XSZ A;  3TTG A;  4LK0 A;  2PMZ D;  2VUM A;  3HOX K;  1SMY A;  2JA7 K;  2JA8 C;  2Y0S L;  1WQH A;  1Y1V K;  2NVY C;  2D6F C;  1O29 A;  4G0W A;  5IP9 K;  4A3K K;  2A69 A;  3Q3Q A;  1TWA C;  1I3Q C;  2WB1 L;  4RMF A;  5TJ3 A;  3HKZ L;  2B63 A;  4C3H K;  4LK1 A;  1WCM K;  4BBS C;  1K83 K;  3PO2 K;  4XLN A;  4KM8 A;  3I4M K;  3N3Y A;  3S1R K;  2JH3 A;  1WQG A;  4JK1 A;  3GTP C;  2JA5 K;  5C4J K;  1O2A A;  2CFA B;  4A3L C;  4Q5S A;  4WIL A;  3G4C A;  4OIR A;  1XZQ A;  4C45 A;  4A3B K;  3HOX C;  2E2J K;  3I4N C;  1O2F B;  2Y3P A;  1DD5 A;  3GTG A;  5JFE A;  4NOI A;  1DCO A;  3H0G K;  1JVI A;  1Y1V C;  4Y52 C;  2GSO A;  4YFN A;  5M5X K;  3HOW K;  3AD8 C;  5IYC C;  2ZUF A;  4QIW D;  5IP9 C;  3GTK A;  4FZB A;  4GTB A;  2O5J A;  3CAG A;  1YNJ A;  3LAJ A;  1WCM C;  2V6U A;  1EI6 A;  3EQL A;  4A3D K;  5C4X K;  1TWF K;  2R92 A;  5TMC A;  2JA5 C;  1XPP A;  1O24 A;  5C4J C;  4KB4 A;  1R9T K;  2NVX K;  2XCR B;  2PPB A;  4LQY A;  3BP8 C;  1AB4 A;  4A3E C;  1INN A;  2E2I K;  2E2J C;  4GFQ A;  2JA6 K;  3GEE A;  4GTA A;  3PO3 K;  1WOO A;  1WQF A; 
#chains in the Genus database with same CATH homology
 4G7Z A;  3PO2 C;  2R7Z C;  3HOW C;  4MEY A;  3I4M C;  4OIN A;  3GTO K;  5FJ8 K;  4XLP A;  3CQZ C;  4C3J K;  4C3I K;  1TWC C;  4XSZ A;  3S1R C;  2R92 K;  3HOU K;  3S16 K;  4BY7 C;  4LK0 A;  3H3V D;  2PMZ D;  5FLM C;  3S1Q K;  4YFK A;  3FKI K;  3HOX K;  5M5W K;  1SMY A;  1SFO K;  4A3J C;  2JA7 K;  2JA8 C;  3H3V L;  4C2M K;  4YFX A;  4GZY A;  5IYB K;  3GTJ K;  2Y0S D;  2Y0S L;  4A3C K;  1Y1V K;  3S2H K;  4KMU A;  3S2D K;  2NVY C;  1YNN A;  1I6H C;  4LLG A;  2R93 K;  3S1N K;  3GTG C;  5IYD C;  3HOY C;  4A3B C;  5IP9 K;  4G7O A;  4A3K K;  3S17 K;  2B63 C;  4Q4Z A;  3RZO K;  2A69 A;  4BBR C;  4A3E K;  2E2H K;  1TWA C;  3DXJ A;  5C44 C;  1TWF C;  3GTL K;  3GTQ K;  5C4X C;  1I3Q C;  4A3M K;  3H0G C;  4Y7N K;  2WB1 D;  2WB1 L;  3K7A C;  3M3Y K;  1TWG K;  1TWH K;  4QJV A;  3HOZ K;  3HKZ D;  4A3G K;  3HKZ L;  3S1M K;  4C3H K;  4LK1 A;  3M4O K;  2NVQ C;  1WCM K;  4BBS C;  1K83 K;  2VUM K;  3PO2 K;  2YU9 K;  4XLN A;  3I4M K;  2NVT K;  2E2I C;  2BE5 A;  3GTM K;  2PA8 D;  2PMZ L;  1BDF A;  1I50 K;  2PA8 L;  3CQZ K;  1TWC K;  3S1R K;  4X6A C;  4JK1 A;  4AYB D;  4A3I C;  2A6E A;  3GTP C;  5FLM K;  3RZD K;  2JA5 K;  5C4J K;  4A3J K;  2JA8 K;  4A3L C;  4Q5S A;  4OIR A;  4A3D C;  1IW7 A;  1I6H K;  5M3F K;  2O5I A;  4BY1 K;  4A3F C;  3HOY K;  4A3B K;  3S1Q C;  3FKI C;  3HOX C;  1SFO C;  1R9T C;  2E2J K;  2B63 K;  2NVX C;  4BBR K;  3S15 K;  3I4N C;  4A93 C;  3GTK C;  1TWA K;  5C44 K;  1Y1W K;  2A68 A;  4NOI A;  3GTJ C;  4LJZ A;  5C3E C;  1I3Q K;  3HOV K;  4A3C C;  3H0G K;  1Y1V C;  4Y52 C;  3S2H C;  3S2D C;  4BXX C;  4YFN A;  5M5X K;  3HOW K;  2R7Z K;  3S14 C;  5IYC C;  4QIW D;  5IP9 C;  5IP7 C;  2NVQ K;  4QIW L;  3RZO C;  4BY7 K;  2CW0 A;  2JA6 C;  2E2H C;  2O5J A;  3PO3 C;  4AYB L;  5TMF A;  1I6V A;  2WAQ D;  4KN4 A;  2WAQ L;  4Y7N C;  4OIP A;  1YNJ A;  3M3Y C;  1TWH C;  5D4D A;  1ZYR A;  4YG2 A;  3M4O C;  3GTP K;  3S1M C;  3GTO C;  4OIO A;  1WCM C;  4QJV B;  4MQ9 A;  2R92 C;  2VUM C;  2NVY K;  2YU9 C;  3HOU C;  3S16 C;  4MEX A;  2NVT C;  3GTG K;  4A3L K;  5M5Y K;  3GTM C;  5IYD K;  1I50 C;  3EQL A;  4A3D K;  2JA7 C;  5M3M K;  5C4X K;  1TWF K;  5IYB C;  4A3F K;  5TMC A;  3RZD C;  2JA5 C;  1XPP A;  5C4J C;  1R9T K;  3I4N K;  3K7A K;  2NVX K;  4A93 K;  4KN7 A;  3GTK K;  2PPB A;  2R93 C;  3S1N C;  5C3E K;  3WOD A;  4A3K C;  3S17 C;  4Y52 K;  4BBS K;  4BXX K;  4A3E C;  2A6H A;  3GTQ C;  1HQM A;  4OIQ A;  3GTL C;  4BY1 C;  3S14 K;  5IYC K;  4XSX A;  2E2I K;  4A3M C;  5IP7 K;  3S15 C;  2E2J C;  4X6A K;  2JA6 K;  1TWG C;  4ZH4 A;  1Y1W C;  3HOZ C;  4A3I K;  3PO3 K;  4A3G C;  3HOV C;  4G7H A;  1K83 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...