5FLMK

Structure of transcribing mammalian rna polymerase ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5flmK00
1HQMA 3S1NK 5C44K 5TMCA 2R93K 4YFKA 5IYCK 5IYBK 2YU9C 2JA7K 1IW7A 4GZYA 1TWAK 3HOWC 4A3CC 4XSZA 3H0GK 3EQLA 3S2HC 5IP9K 2NVXK 3S1RC 1TWGK 1YNJA 1TWCC 4BBSC 4KN4A 1XPPA 4YFXA 2R7ZK 3GTOK 3HOYK 3M3YC 3S1MK 4C3HK 5C3EK 3S14K 4A3IK 2NVQC 3S2DC 4BXXC 4JK1A 4XLNA 4A3JK 1K83K 4Y7NK 2E2IC 3HOVK 2Y0SD 3I4NC 3HOZC 2VUMC 2NVTK 4XLPA 3S17C 4A3BK 4MEXA 3GTKK 3I4MK 2B63K 3FKIC 4QIWD 3GTJK 2A69A 4A3MK 2A6HA 4AYBD 3PO2K 4QIWL 1R9TK 2JA5C 4A3EC 3GTPK 4BBRK 4QJVA 1TWFK 4KMUA 4A3DK 3HKZD 5FLMK 3RZOK 1Y1VC 4A3LK 2A68A 4G7HA 2JA6C 2R92K 1WCMK 2WAQL 4A93C 5IYDK 4OIQA 2WAQD 5C44C 2R93C 3GTGC 3GTQK 2JA7C 4BY1C 4OIRA 3HOUC 5M5YK 1SFOC 5FJ8K 3HOXK 1YNNA 4BY7K 5IP9C 3K7AC 1TWGC 4C3JK 3M4OK 5M5WK 4G7OA 1ZYRA 1TWHK 5C4XC 3DXJA 2R7ZC 3GTOC 3HOYC 5C4JC 1BDFA 5IYCC 4A3GC 3GTLC 2BE5A 2NVQK 3S15K 4LJZA 4A3JC 3H3VL 3GTMK 1Y1WC 3PO3K 3HOZK 1I3QK 2PA8L 4A3KC 3S1QK 3CQZC 1TWCK 4BBSK 4X6AC 4A3FK 2E2JC 4Y52C 4XSXA 3GTKC 2NVYK 4QJVB 3I4MC 3S16C 2A6EA 3S1NC 4OINA 3RZDC 4A3IC 2E2HC 3H3VD 5IP7K 4A3EK 1I6HC 2E2IK 5IYBC 2YU9K 3HOVC 1TWFC 2PMZD 2VUMK 1I50C 2JA8K 2NVTC 3S17K 2WB1D 3S2HK 4Q4ZA 3FKIK 3GTJC 3PO2C 4OIOA 5M3MK 5IYDC 2JA6K 4MEYA 2R92C 3GTPC 4A93K 2Y0SL 2PMZL 4G7ZA 4C3IK 3S1MC 5C3EC 1TWAC 3GTGK 3GTQC 3HOWK 3S14C 4A3CK 3H0GC 5TMFA 1K83C 4Y7NC 3RZOC 2NVXC 3S1RK 1Y1VK 4A3LC 4LLGA 5M3FK 5M5XK 2CW0A 4MQ9A 2B63C 3M3YK 4C2MK 4A3MC 3S2DK 4BXXK 5C4JK 3HKZL 3HOUK 1SFOK 5D4DA 4YG2A 3S15C 4BBRC 3I4NK 1SMYA 2O5IA 4LK1A 3HOXC 4BY7C 4A3DC 3K7AK 3PO3C 4ZH4A 5FLMC 1I3QC 4A3KK 4A3BC 3S1QC 3CQZK 5C4XK 2PPBA 3S16K 4Y52K 4NOIA 2NVYC 2WB1L 4YFNA 4A3GK 1R9TC 2JA5K 4LK0A 3GTLK 3WODA 2O5JA 1I6HK 5IP7C 4BY1K 3GTMC 2PA8D 1Y1WK 1I50K 2JA8C 4Q5SA 4A3FC 4X6AK 1I6VA 2E2JK 4KN7A 4OIPA 1WCMC 3M4OC 4AYBL 3RZDK 1TWHC 2E2HK
chains in the Genus database with same CATH superfamily
4LOWA 2R93K 3BP3A 3G4CA 2YU9C 3H0GK 3S2HC 3S1RC 1YNJA 1EFWA 1TWCC 4O2DA 2R7ZK 3AD8C 1ZVUA 4KMAA 3GTOK 3S1MK 4C3IC 3S14K 2NVQC 1WSVA 1USOA 4XLNA 1ZQ1C 3V4GA 2E2IC 1SFOA 2VUMC 4MEXA 3GTKK 5IOQA 4QIWD 4AYBD 2CFAB 3OEPA 2E2HA 2ZUEA 1EH1A 1XZQB 4KMHA 4A3DK 3HKZD 1INNA 1J6VA 1WORA 2A68A 3T02A 4M1XA 1Y1WA 4ILDA 2R92K 4OIQA 1C0AA 3GTOA 2VUMA 5M5YK 1SFOC 1VJEA 4GTFA 4KB2A 5FJ8K 1V5VA 1WOOA 4BKWA 1TWGC 4C45A 4G7OA 4C3JC 3DXJA 3FHZA 3GTOC 1BDFA 3GTKA 3HXAA 4LJZA 4KDDA 4A3JC 1Y1WC 1I3QA 1WQGA 1O26A 4P5BA 3GTLA 4Y52C 1EQRA 4OINA 3RZDC 3GEHA 2E2HC 5IP7K 4A3EK 2B63A 3HOVC 5IYBC 3TTGA 3GDZA 4BLAA 4BLBA 3S2HK 1WOSA 2JA7A 2R93A 3GTJC 2GAHC 3CAGA 1BS2A 4A93K 3S1MC 2RGRA 3GTGK 3BP8C 3RZOC 1TWFA 5M5XK 2GSNA 4MQ9A 3M3YK 4C2MK 3S2DK 4BXXK 5C4JK 1O24A 4LQYA 1SFOK 2O5IA 4LK1A 3HOXC 4BY7C 5IORA 4A3DC 3K7AK 1F9NA 3OPFA 4A3KK 3S1QC 5C4XK 4Y52K 4FZBA 1B4BA 3L4KA 3LPXA 1WSRA 3GTMC 1Y1WK 1XXAA 1I6VA 4KN7A 3S1NK 5C44K 3SZZA 4YFKA 4GZYA 1IW7A 5EGHA 3EQLA 3MMLB 1TWGK 4KN4A 4GTDA 2R7ZA 2XCOA 3T00A 3GTQA 3LAPA 1WIHA 2KWAA 4JK1A 1PJ7A 2Y0SD 4GTLA 1EK8A 3BUEA 4XLPA 3GTGA 3I4MK 3GIRA 4KMDA 4C2MC 3GTJK 2A69A 1IQ0A 4A3EC 1Y1VA 5JVOA 1TWFK 4KMUA 4KM8A 1K83A 3AQOA 3H0GA 4A3LK 2R92A 3N0CA 1G51A 4BY1C 4WJ3M 3HOXK 4BY7K 4PABA 4GT9A 3M4OK 4WILA 1XZPB 4A3GC 2BE5A 3S15K 1DD5A 3H3VL 1I3QK 1YX2A 2FQOA 2PA8L 1O27A 4A3KC 3S1QK 4A3FK 3I4MC 2GSOA 4C3HC 4A3IC 3H3VD 1TWFC 3FOFA 2VUMK 1I50C 3S17K 1IL2A 4OIOA 2R92C 4MEYA 3GTPC 4G7ZA 4PAAA 3S14C 3H0GC 3GTJA 1K83C 2EBBA 4Y7NC 2NVXC 1Y1VK 1UV7A 5CJ9A 5L46A 2B63C 4A3MC 2XCQA 3HKZL 1TWHA 3GSIA 4BBRC 3LAJA 1KQ4A 1USMA 3PO3C 1O29A 1I3QC 4KM9A 3CQZK 2NVYC 2WB1L 4LK0A 3ADAC 1I6HK 3IPJA 1DCPA 1JOEA 3A8KA 1TWGA 1WOPA 1I50K 1AB4A 4X6AK 4A3FC 4OIPA 1VGXA 1WCMC 4C3JK 1GE9A 1HQMA 5TMCA 3OREA 3TFHA 5IYBK 5CHPA 4A3CC 4XSZA 4GTBA 4GFQA 2W7VA 1XPPA 3HOYK 3M3YC 4C3HK 5C3EK 1XZPA 1O2BA 1K83K 4Y7NK 3HOVK 1ZXOA 3HOZC 1F7UA 1JQWA 2NVTK 3S17C 4A3BK 3VA7A 2B63K 4FM9A 3PO2K 4A3MK 1R9TK 4KAWX 3GTPK 4QJVA 4DDQA 1TWCA 5FLMK 3TFJA 1YCLA 4XCHA 4G7HA 5IYDK 1WCMK 4KASA 2YU9A 1ZBSA 2WAQD 5C44C 2R93C 3GTQK 2JA7C 3HOUC 4KARA 2FQTA 1F93A 1YNNA 3K7AC 1O2AA 1IE0A 5M5WK 1ZYRA 5C4XC 3HOYC 3GTLC 2GSUA 1WQFA 1TWCK 3S16C 4XSXA 3GTKC 2NVYK 4QJVB 3AH5A 4GTCA 2XCRB 5IOTA 1BJTA 2E2IK 2YU9K 2PMZD 2NVTC 1HI9A 1X31C 1O25A 4Q4ZA 2D6FC 3FKIK 4GTAA 5IOSA 2Y3PA 2NVYA 1J6WA 3S1NC 2Y0SL 2PMZL 1TWAC 3HOWK 4WJ4A 2GAGC 3AQPA 5M3FK 1L0WA 2CW0A 4RMFA 3T01A 3FOEA 5D4DA 3S15C 1DCHA 2NVXA 1WCMA 1SMYA 2E2IA 4ZH4A 4A3BC 3JSTA 3GTPA 3S16K 4NOIA 4YFNA 1JVIA 2JA5K 2ZFZA 3GEIA 4P9SA 5IP7C 3A8IA 3A8JA 4BY1K 1IBAA 5EGEA 4Q5SA 2E2JK 1TWHC 2E2HK 2JA7K 5IYCK 1TWAK 2ZUFA 3HOWC 2JA6A 3TFIA 3QX3A 1XZQA 5IP9K 4KATA 5JFEA 2NVXK 4AH6A 4BBSC 4YFXA 1R9TA 1XXBA 3S2DC 4A3IK 4BXXC 4KB4A 3FKIA 4A3JK 3I4NC 4G0UA 1I50A 3FKIC 2A6HA 4QIWL 2JA5C 4BBRK 4G0VA 1O28A 2PHCB 3S0XA 3RZOK 1VH2A 4GTEA 1Y1VC 1XXCA 2JA6C 2WAQL 4A93C 2JH3A 1VLOA 3GEEA 3GTGC 4OIRA 1O2FB 5IP9C 3AD7C 2V6UA 1TWHK 3L4JA 4G0WA 2R7ZC 1B4AA 5C4JC 5IYCC 1BGWA 1F7VA 2NVQK 3CQZA 5HL8A 3GTMK 3PO3K 3HOZK 3CQZC 3NUHA 4BBSK 4X6AC 2CFAA 2E2JC 4KC6A 2A6EA 2V6TA 1VRQC 3SZYA 1I6HC 2JA8K 3GTMA 2WB1D 3N0BA 1PJ6A 3G4AA 3PO2C 1TWAA 5M3MK 5IYDC 2JA6K 1IS1A 4C3IK 5C3EC 4A3CK 3Q3QA 3GTQC 5TMFA 3S1RK 4A3LC 3ERED 4LLGA 2P8TA 2JA5A 1J6XA 1RU0A 2RH6A 3N3YA 3HOUK 1EI6A 4YG2A 1PJ5A 2V6SA 3I4NK 1WQHA 5FLMC 3AD9C 2PPBA 5TJ3A 4LR2A 4A3GK 1J98A 1R9TC 3GTLK 4P5AA 3WODA 1DCOA 2O5JA 5E68A 2PA8D 1ISEA 2JA8C 2P5MA 4J3NA 3M4OC 4AYBL 3RZDK
chains in the Genus database with same CATH topology
1HQMA 3S1NK 5C44K 5TMCA 2R93K 4YFKA 5IYCK 5IYBK 2YU9C 2JA7K 1IW7A 4GZYA 1TWAK 3HOWC 4A3CC 4XSZA 3H0GK 3EQLA 3S2HC 5IP9K 2NVXK 3S1RC 1TWGK 1YNJA 1TWCC 4BBSC 4KN4A 1XPPA 4YFXA 2R7ZK 3GTOK 3HOYK 3M3YC 3S1MK 4C3HK 5C3EK 3S14K 4A3IK 2NVQC 3S2DC 4BXXC 4JK1A 4XLNA 4A3JK 1K83K 4Y7NK 2E2IC 3HOVK 2Y0SD 3I4NC 3HOZC 2VUMC 2NVTK 4XLPA 3S17C 4A3BK 4MEXA 3GTKK 3I4MK 2B63K 3FKIC 4QIWD 3GTJK 2A69A 4A3MK 2A6HA 4AYBD 3PO2K 4QIWL 1R9TK 2JA5C 4A3EC 3GTPK 4BBRK 4QJVA 1TWFK 4KMUA 4A3DK 3HKZD 5FLMK 3RZOK 1Y1VC 4A3LK 2A68A 4G7HA 2JA6C 2R92K 1WCMK 2WAQL 4A93C 5IYDK 4OIQA 2WAQD 5C44C 2R93C 3GTGC 3GTQK 2JA7C 4BY1C 4OIRA 3HOUC 5M5YK 1SFOC 5FJ8K 3HOXK 1YNNA 4BY7K 5IP9C 3K7AC 1TWGC 4C3JK 3M4OK 5M5WK 4G7OA 1ZYRA 1TWHK 5C4XC 3DXJA 2R7ZC 3GTOC 3HOYC 5C4JC 1BDFA 5IYCC 4A3GC 3GTLC 2BE5A 2NVQK 3S15K 4LJZA 4A3JC 3H3VL 3GTMK 1Y1WC 3PO3K 3HOZK 1I3QK 2PA8L 4A3KC 3S1QK 3CQZC 1TWCK 4BBSK 4X6AC 4A3FK 2E2JC 4Y52C 4XSXA 3GTKC 2NVYK 4QJVB 3I4MC 3S16C 2A6EA 3S1NC 4OINA 3RZDC 4A3IC 2E2HC 3H3VD 5IP7K 4A3EK 1I6HC 2E2IK 5IYBC 2YU9K 3HOVC 1TWFC 2PMZD 2VUMK 1I50C 2JA8K 2NVTC 3S17K 2WB1D 3S2HK 4Q4ZA 3FKIK 3GTJC 3PO2C 4OIOA 5M3MK 5IYDC 2JA6K 4MEYA 2R92C 3GTPC 4A93K 2Y0SL 2PMZL 4G7ZA 4C3IK 3S1MC 5C3EC 1TWAC 3GTGK 3GTQC 3HOWK 3S14C 4A3CK 3H0GC 5TMFA 1K83C 4Y7NC 3RZOC 2NVXC 3S1RK 1Y1VK 4A3LC 4LLGA 5M3FK 5M5XK 2CW0A 4MQ9A 2B63C 3M3YK 4C2MK 4A3MC 3S2DK 4BXXK 5C4JK 3HKZL 3HOUK 1SFOK 5D4DA 4YG2A 3S15C 4BBRC 3I4NK 1SMYA 2O5IA 4LK1A 3HOXC 4BY7C 4A3DC 3K7AK 3PO3C 4ZH4A 5FLMC 1I3QC 4A3KK 4A3BC 3S1QC 3CQZK 5C4XK 2PPBA 3S16K 4Y52K 4NOIA 2NVYC 2WB1L 4YFNA 4A3GK 1R9TC 2JA5K 4LK0A 3GTLK 3WODA 2O5JA 1I6HK 5IP7C 4BY1K 3GTMC 2PA8D 1Y1WK 1I50K 2JA8C 4Q5SA 4A3FC 4X6AK 1I6VA 2E2JK 4KN7A 4OIPA 1WCMC 3M4OC 4AYBL 3RZDK 1TWHC 2E2HK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  3S1N K;  5C44 K;  5TMC A;  2R93 K;  4YFK A;  5IYC K;  5IYB K;  2YU9 C;  2JA7 K;  1IW7 A;  4GZY A;  1TWA K;  3HOW C;  4A3C C;  4XSZ A;  3H0G K;  3EQL A;  3S2H C;  5IP9 K;  2NVX K;  3S1R C;  1TWG K;  1YNJ A;  1TWC C;  4BBS C;  4KN4 A;  1XPP A;  4YFX A;  2R7Z K;  3GTO K;  3HOY K;  3M3Y C;  3S1M K;  4C3H K;  5C3E K;  3S14 K;  4A3I K;  2NVQ C;  3S2D C;  4BXX C;  4JK1 A;  4XLN A;  4A3J K;  1K83 K;  4Y7N K;  2E2I C;  3HOV K;  2Y0S D;  3I4N C;  3HOZ C;  2VUM C;  2NVT K;  4XLP A;  3S17 C;  4A3B K;  4MEX A;  3GTK K;  3I4M K;  2B63 K;  3FKI C;  4QIW D;  3GTJ K;  2A69 A;  4A3M K;  2A6H A;  4AYB D;  3PO2 K;  4QIW L;  1R9T K;  2JA5 C;  4A3E C;  3GTP K;  4BBR K;  4QJV A;  1TWF K;  4KMU A;  4A3D K;  3HKZ D;  5FLM K;  3RZO K;  1Y1V C;  4A3L K;  2A68 A;  4G7H A;  2JA6 C;  2R92 K;  1WCM K;  2WAQ L;  4A93 C;  5IYD K;  4OIQ A;  2WAQ D;  5C44 C;  2R93 C;  3GTG C;  3GTQ K;  2JA7 C;  4BY1 C;  4OIR A;  3HOU C;  5M5Y K;  1SFO C;  5FJ8 K;  3HOX K;  1YNN A;  4BY7 K;  5IP9 C;  3K7A C;  1TWG C;  4C3J K;  3M4O K;  5M5W K;  4G7O A;  1ZYR A;  1TWH K;  5C4X C;  3DXJ A;  2R7Z C;  3GTO C;  3HOY C;  5C4J C;  1BDF A;  5IYC C;  4A3G C;  3GTL C;  2BE5 A;  2NVQ K;  3S15 K;  4LJZ A;  4A3J C;  3H3V L;  3GTM K;  1Y1W C;  3PO3 K;  3HOZ K;  1I3Q K;  2PA8 L;  4A3K C;  3S1Q K;  3CQZ C;  1TWC K;  4BBS K;  4X6A C;  4A3F K;  2E2J C;  4Y52 C;  4XSX A;  3GTK C;  2NVY K;  4QJV B;  3I4M C;  3S16 C;  2A6E A;  3S1N C;  4OIN A;  3RZD C;  4A3I C;  2E2H C;  3H3V D;  5IP7 K;  4A3E K;  1I6H C;  2E2I K;  5IYB C;  2YU9 K;  3HOV C;  1TWF C;  2PMZ D;  2VUM K;  1I50 C;  2JA8 K;  2NVT C;  3S17 K;  2WB1 D;  3S2H K;  4Q4Z A;  3FKI K;  3GTJ C;  3PO2 C;  4OIO A;  5M3M K;  5IYD C;  2JA6 K;  4MEY A;  2R92 C;  3GTP C;  4A93 K;  2Y0S L;  2PMZ L;  4G7Z A;  4C3I K;  3S1M C;  5C3E C;  1TWA C;  3GTG K;  3GTQ C;  3HOW K;  3S14 C;  4A3C K;  3H0G C;  5TMF A;  1K83 C;  4Y7N C;  3RZO C;  2NVX C;  3S1R K;  1Y1V K;  4A3L C;  4LLG A;  5M3F K;  5M5X K;  2CW0 A;  4MQ9 A;  2B63 C;  3M3Y K;  4C2M K;  4A3M C;  3S2D K;  4BXX K;  5C4J K;  3HKZ L;  3HOU K;  1SFO K;  5D4D A;  4YG2 A;  3S15 C;  4BBR C;  3I4N K;  1SMY A;  2O5I A;  4LK1 A;  3HOX C;  4BY7 C;  4A3D C;  3K7A K;  3PO3 C;  4ZH4 A;  5FLM C;  1I3Q C;  4A3K K;  4A3B C;  3S1Q C;  3CQZ K;  5C4X K;  2PPB A;  3S16 K;  4Y52 K;  4NOI A;  2NVY C;  2WB1 L;  4YFN A;  4A3G K;  1R9T C;  2JA5 K;  4LK0 A;  3GTL K;  3WOD A;  2O5J A;  1I6H K;  5IP7 C;  4BY1 K;  3GTM C;  2PA8 D;  1Y1W K;  1I50 K;  2JA8 C;  4Q5S A;  4A3F C;  4X6A K;  1I6V A;  2E2J K;  4KN7 A;  4OIP A;  1WCM C;  3M4O C;  4AYB L;  3RZD K;  1TWH C;  2E2H K; 
#chains in the Genus database with same CATH topology
 4LOW A;  2R93 K;  3BP3 A;  3G4C A;  2YU9 C;  3H0G K;  3S2H C;  3S1R C;  1YNJ A;  1EFW A;  1TWC C;  4O2D A;  2R7Z K;  3AD8 C;  1ZVU A;  4KMA A;  3GTO K;  3S1M K;  4C3I C;  3S14 K;  2NVQ C;  1WSV A;  1USO A;  4XLN A;  1ZQ1 C;  3V4G A;  2E2I C;  1SFO A;  2VUM C;  4MEX A;  3GTK K;  5IOQ A;  4QIW D;  4AYB D;  2CFA B;  3OEP A;  2E2H A;  2ZUE A;  1EH1 A;  1XZQ B;  4KMH A;  4A3D K;  3HKZ D;  1INN A;  1J6V A;  1WOR A;  2A68 A;  3T02 A;  4M1X A;  1Y1W A;  4ILD A;  2R92 K;  4OIQ A;  1C0A A;  3GTO A;  2VUM A;  5M5Y K;  1SFO C;  1VJE A;  4GTF A;  4KB2 A;  5FJ8 K;  1V5V A;  1WOO A;  4BKW A;  1TWG C;  4C45 A;  4G7O A;  4C3J C;  3DXJ A;  3FHZ A;  3GTO C;  1BDF A;  3GTK A;  3HXA A;  4LJZ A;  4KDD A;  4A3J C;  1Y1W C;  1I3Q A;  1WQG A;  1O26 A;  4P5B A;  3GTL A;  4Y52 C;  1EQR A;  4OIN A;  3RZD C;  3GEH A;  2E2H C;  5IP7 K;  4A3E K;  2B63 A;  3HOV C;  5IYB C;  3TTG A;  3GDZ A;  4BLA A;  4BLB A;  3S2H K;  1WOS A;  2JA7 A;  2R93 A;  3GTJ C;  2GAH C;  3CAG A;  1BS2 A;  4A93 K;  3S1M C;  2RGR A;  3GTG K;  3BP8 C;  3RZO C;  1TWF A;  5M5X K;  2GSN A;  4MQ9 A;  3M3Y K;  4C2M K;  3S2D K;  4BXX K;  5C4J K;  1O24 A;  4LQY A;  1SFO K;  2O5I A;  4LK1 A;  3HOX C;  4BY7 C;  5IOR A;  4A3D C;  3K7A K;  1F9N A;  3OPF A;  4A3K K;  3S1Q C;  5C4X K;  4Y52 K;  4FZB A;  1B4B A;  3L4K A;  3LPX A;  1WSR A;  3GTM C;  1Y1W K;  1XXA A;  1I6V A;  4KN7 A;  3S1N K;  5C44 K;  3SZZ A;  4YFK A;  4GZY A;  1IW7 A;  5EGH A;  3EQL A;  3MML B;  1TWG K;  4KN4 A;  4GTD A;  2R7Z A;  2XCO A;  3T00 A;  3GTQ A;  3LAP A;  1WIH A;  2KWA A;  4JK1 A;  1PJ7 A;  2Y0S D;  4GTL A;  1EK8 A;  3BUE A;  4XLP A;  3GTG A;  3I4M K;  3GIR A;  4KMD A;  4C2M C;  3GTJ K;  2A69 A;  1IQ0 A;  4A3E C;  1Y1V A;  5JVO A;  1TWF K;  4KMU A;  4KM8 A;  1K83 A;  3AQO A;  3H0G A;  4A3L K;  2R92 A;  3N0C A;  1G51 A;  4BY1 C;  4WJ3 M;  3HOX K;  4BY7 K;  4PAB A;  4GT9 A;  3M4O K;  4WIL A;  1XZP B;  4A3G C;  2BE5 A;  3S15 K;  1DD5 A;  3H3V L;  1I3Q K;  1YX2 A;  2FQO A;  2PA8 L;  1O27 A;  4A3K C;  3S1Q K;  4A3F K;  3I4M C;  2GSO A;  4C3H C;  4A3I C;  3H3V D;  1TWF C;  3FOF A;  2VUM K;  1I50 C;  3S17 K;  1IL2 A;  4OIO A;  2R92 C;  4MEY A;  3GTP C;  4G7Z A;  4PAA A;  3S14 C;  3H0G C;  3GTJ A;  1K83 C;  2EBB A;  4Y7N C;  2NVX C;  1Y1V K;  1UV7 A;  5CJ9 A;  5L46 A;  2B63 C;  4A3M C;  2XCQ A;  3HKZ L;  1TWH A;  3GSI A;  4BBR C;  3LAJ A;  1KQ4 A;  1USM A;  3PO3 C;  1O29 A;  1I3Q C;  4KM9 A;  3CQZ K;  2NVY C;  2WB1 L;  4LK0 A;  3ADA C;  1I6H K;  3IPJ A;  1DCP A;  1JOE A;  3A8K A;  1TWG A;  1WOP A;  1I50 K;  1AB4 A;  4X6A K;  4A3F C;  4OIP A;  1VGX A;  1WCM C;  4C3J K;  1GE9 A;  1HQM A;  5TMC A;  3ORE A;  3TFH A;  5IYB K;  5CHP A;  4A3C C;  4XSZ A;  4GTB A;  4GFQ A;  2W7V A;  1XPP A;  3HOY K;  3M3Y C;  4C3H K;  5C3E K;  1XZP A;  1O2B A;  1K83 K;  4Y7N K;  3HOV K;  1ZXO A;  3HOZ C;  1F7U A;  1JQW A;  2NVT K;  3S17 C;  4A3B K;  3VA7 A;  2B63 K;  4FM9 A;  3PO2 K;  4A3M K;  1R9T K;  4KAW X;  3GTP K;  4QJV A;  4DDQ A;  1TWC A;  5FLM K;  3TFJ A;  1YCL A;  4XCH A;  4G7H A;  5IYD K;  1WCM K;  4KAS A;  2YU9 A;  1ZBS A;  2WAQ D;  5C44 C;  2R93 C;  3GTQ K;  2JA7 C;  3HOU C;  4KAR A;  2FQT A;  1F93 A;  1YNN A;  3K7A C;  1O2A A;  1IE0 A;  5M5W K;  1ZYR A;  5C4X C;  3HOY C;  3GTL C;  2GSU A;  1WQF A;  1TWC K;  3S16 C;  4XSX A;  3GTK C;  2NVY K;  4QJV B;  3AH5 A;  4GTC A;  2XCR B;  5IOT A;  1BJT A;  2E2I K;  2YU9 K;  2PMZ D;  2NVT C;  1HI9 A;  1X31 C;  1O25 A;  4Q4Z A;  2D6F C;  3FKI K;  4GTA A;  5IOS A;  2Y3P A;  2NVY A;  1J6W A;  3S1N C;  2Y0S L;  2PMZ L;  1TWA C;  3HOW K;  4WJ4 A;  2GAG C;  3AQP A;  5M3F K;  1L0W A;  2CW0 A;  4RMF A;  3T01 A;  3FOE A;  5D4D A;  3S15 C;  1DCH A;  2NVX A;  1WCM A;  1SMY A;  2E2I A;  4ZH4 A;  4A3B C;  3JST A;  3GTP A;  3S16 K;  4NOI A;  4YFN A;  1JVI A;  2JA5 K;  2ZFZ A;  3GEI A;  4P9S A;  5IP7 C;  3A8I A;  3A8J A;  4BY1 K;  1IBA A;  5EGE A;  4Q5S A;  2E2J K;  1TWH C;  2E2H K;  2JA7 K;  5IYC K;  1TWA K;  2ZUF A;  3HOW C;  2JA6 A;  3TFI A;  3QX3 A;  1XZQ A;  5IP9 K;  4KAT A;  5JFE A;  2NVX K;  4AH6 A;  4BBS C;  4YFX A;  1R9T A;  1XXB A;  3S2D C;  4A3I K;  4BXX C;  4KB4 A;  3FKI A;  4A3J K;  3I4N C;  4G0U A;  1I50 A;  3FKI C;  2A6H A;  4QIW L;  2JA5 C;  4BBR K;  4G0V A;  1O28 A;  2PHC B;  3S0X A;  3RZO K;  1VH2 A;  4GTE A;  1Y1V C;  1XXC A;  2JA6 C;  2WAQ L;  4A93 C;  2JH3 A;  1VLO A;  3GEE A;  3GTG C;  4OIR A;  1O2F B;  5IP9 C;  3AD7 C;  2V6U A;  1TWH K;  3L4J A;  4G0W A;  2R7Z C;  1B4A A;  5C4J C;  5IYC C;  1BGW A;  1F7V A;  2NVQ K;  3CQZ A;  5HL8 A;  3GTM K;  3PO3 K;  3HOZ K;  3CQZ C;  3NUH A;  4BBS K;  4X6A C;  2CFA A;  2E2J C;  4KC6 A;  2A6E A;  2V6T A;  1VRQ C;  3SZY A;  1I6H C;  2JA8 K;  3GTM A;  2WB1 D;  3N0B A;  1PJ6 A;  3G4A A;  3PO2 C;  1TWA A;  5M3M K;  5IYD C;  2JA6 K;  1IS1 A;  4C3I K;  5C3E C;  4A3C K;  3Q3Q A;  3GTQ C;  5TMF A;  3S1R K;  4A3L C;  3ERE D;  4LLG A;  2P8T A;  2JA5 A;  1J6X A;  1RU0 A;  2RH6 A;  3N3Y A;  3HOU K;  1EI6 A;  4YG2 A;  1PJ5 A;  2V6S A;  3I4N K;  1WQH A;  5FLM C;  3AD9 C;  2PPB A;  5TJ3 A;  4LR2 A;  4A3G K;  1J98 A;  1R9T C;  3GTL K;  4P5A A;  3WOD A;  1DCO A;  2O5J A;  5E68 A;  2PA8 D;  1ISE A;  2JA8 C;  2P5M A;  4J3N A;  3M4O C;  4AYB L;  3RZD K; 
#chains in the Genus database with same CATH homology
 1HQM A;  3S1N K;  5C44 K;  5TMC A;  2R93 K;  4YFK A;  5IYC K;  5IYB K;  2YU9 C;  2JA7 K;  1IW7 A;  4GZY A;  1TWA K;  3HOW C;  4A3C C;  4XSZ A;  3H0G K;  3EQL A;  3S2H C;  5IP9 K;  2NVX K;  3S1R C;  1TWG K;  1YNJ A;  1TWC C;  4BBS C;  4KN4 A;  1XPP A;  4YFX A;  2R7Z K;  3GTO K;  3HOY K;  3M3Y C;  3S1M K;  4C3H K;  5C3E K;  3S14 K;  4A3I K;  2NVQ C;  3S2D C;  4BXX C;  4JK1 A;  4XLN A;  4A3J K;  1K83 K;  4Y7N K;  2E2I C;  3HOV K;  2Y0S D;  3I4N C;  3HOZ C;  2VUM C;  2NVT K;  4XLP A;  3S17 C;  4A3B K;  4MEX A;  3GTK K;  3I4M K;  2B63 K;  3FKI C;  4QIW D;  3GTJ K;  2A69 A;  4A3M K;  2A6H A;  4AYB D;  3PO2 K;  4QIW L;  1R9T K;  2JA5 C;  4A3E C;  3GTP K;  4BBR K;  4QJV A;  1TWF K;  4KMU A;  4A3D K;  3HKZ D;  5FLM K;  3RZO K;  1Y1V C;  4A3L K;  2A68 A;  4G7H A;  2JA6 C;  2R92 K;  1WCM K;  2WAQ L;  4A93 C;  5IYD K;  4OIQ A;  2WAQ D;  5C44 C;  2R93 C;  3GTG C;  3GTQ K;  2JA7 C;  4BY1 C;  4OIR A;  3HOU C;  5M5Y K;  1SFO C;  5FJ8 K;  3HOX K;  1YNN A;  4BY7 K;  5IP9 C;  3K7A C;  1TWG C;  4C3J K;  3M4O K;  5M5W K;  4G7O A;  1ZYR A;  1TWH K;  5C4X C;  3DXJ A;  2R7Z C;  3GTO C;  3HOY C;  5C4J C;  1BDF A;  5IYC C;  4A3G C;  3GTL C;  2BE5 A;  2NVQ K;  3S15 K;  4LJZ A;  4A3J C;  3H3V L;  3GTM K;  1Y1W C;  3PO3 K;  3HOZ K;  1I3Q K;  2PA8 L;  4A3K C;  3S1Q K;  3CQZ C;  1TWC K;  4BBS K;  4X6A C;  4A3F K;  2E2J C;  4Y52 C;  4XSX A;  3GTK C;  2NVY K;  4QJV B;  3I4M C;  3S16 C;  2A6E A;  3S1N C;  4OIN A;  3RZD C;  4A3I C;  2E2H C;  3H3V D;  5IP7 K;  4A3E K;  1I6H C;  2E2I K;  5IYB C;  2YU9 K;  3HOV C;  1TWF C;  2PMZ D;  2VUM K;  1I50 C;  2JA8 K;  2NVT C;  3S17 K;  2WB1 D;  3S2H K;  4Q4Z A;  3FKI K;  3GTJ C;  3PO2 C;  4OIO A;  5M3M K;  5IYD C;  2JA6 K;  4MEY A;  2R92 C;  3GTP C;  4A93 K;  2Y0S L;  2PMZ L;  4G7Z A;  4C3I K;  3S1M C;  5C3E C;  1TWA C;  3GTG K;  3GTQ C;  3HOW K;  3S14 C;  4A3C K;  3H0G C;  5TMF A;  1K83 C;  4Y7N C;  3RZO C;  2NVX C;  3S1R K;  1Y1V K;  4A3L C;  4LLG A;  5M3F K;  5M5X K;  2CW0 A;  4MQ9 A;  2B63 C;  3M3Y K;  4C2M K;  4A3M C;  3S2D K;  4BXX K;  5C4J K;  3HKZ L;  3HOU K;  1SFO K;  5D4D A;  4YG2 A;  3S15 C;  4BBR C;  3I4N K;  1SMY A;  2O5I A;  4LK1 A;  3HOX C;  4BY7 C;  4A3D C;  3K7A K;  3PO3 C;  4ZH4 A;  5FLM C;  1I3Q C;  4A3K K;  4A3B C;  3S1Q C;  3CQZ K;  5C4X K;  2PPB A;  3S16 K;  4Y52 K;  4NOI A;  2NVY C;  2WB1 L;  4YFN A;  4A3G K;  1R9T C;  2JA5 K;  4LK0 A;  3GTL K;  3WOD A;  2O5J A;  1I6H K;  5IP7 C;  4BY1 K;  3GTM C;  2PA8 D;  1Y1W K;  1I50 K;  2JA8 C;  4Q5S A;  4A3F C;  4X6A K;  1I6V A;  2E2J K;  4KN7 A;  4OIP A;  1WCM C;  3M4O C;  4AYB L;  3RZD K;  1TWH C;  2E2H K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...