5FLMK

Structure of transcribing mammalian rna polymerase ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
b'MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5flmK00
2VUMK 4A93C 4JK1A 2CW0A 3HOZK 4BY7K 4XSZA 2WAQD 3HOXK 3S2HC 2PMZD 2E2IK 4AYBD 3GTJK 5IP9K 4BXXK 3HOXC 3M4OK 5IYDC 2R93K 5M3FK 1ZYRA 3H3VD 3GTMK 4LK1A 5IYCK 1TWHK 5IP9C 4YFXA 4BXXC 4G7ZA 3M4OC 2R93C 1Y1WK 3GTMC 2WAQL 1TWFK 1TWHC 2PMZL 3S1RK 4A3LK 4QJVB 4YFNA 5TMCA 3GTOK 4AYBL 4QJVA 2B63C 4BY1C 4Q4ZA 5C3EK 1I6HK 1TWFC 1R9TC 3GTGK 2E2HC 1WCMC 4LLGA 3S1RC 3H3VL 5IYBC 3GTOC 3GTKK 4A3LC 3H0GC 3GTLC 2NVXK 3I4NK 3DXJA 2WB1D 3CQZK 5C44K 4OIPA 5C3EC 2A68A 5TMFA 4OINA 3HOWK 3HOVK 3GTKC 1Y1VK 1YNJA 5C4XC 3RZDK 4XLPA 3I4NC 4A3MC 3S17C 2R92K 3CQZC 4MEYA 4A3FK 2YU9K 2VUMC 1HQMA 3S15K 4G7HA 3HOZC 4BY7C 4C3JK 3RZDC 4LJZA 5M5WK 4MQ9A 2R92C 4NOIA 2YU9C 4LK0A 4Y7NK 2E2IC 3GTJC 3FKIK 1TWCK 3RZOK 3S16K 2E2JK 2JA8K 2NVQK 4A3CK 2BE5A 1XPPA 2O5JA 5IYCC 5FJ8K 2JA7K 5FLMK 2JA5K 1I3QK 2A6HA 2NVYK 3HKZD 5M3MK 2JA8C 1Y1WC 2NVQC 3S2DK 1SMYA 4OIOA 5FLMC 2JA5C 2Y0SD 2PA8D 1IW7A 3S1MK 2JA6K 3PO2K 4OIRA 1I6HC 4QIWD 3GTGC 4MEXA 3S14K 1SFOK 4GZYA 4A3JK 3S1MC 2NVXC 4A3KK 4YG2A 3PO2C 1TWGK 5C44C 3HOVC 3HKZL 4ZH4A 1K83K 5M5XK 3HOWC 4KN4A 4BBRK 3S14C 1Y1VC 4C3HK 4X6AK 1SFOC 3S17K 5M5YK 2NVTK 5C4JK 5D4DA 2Y0SL 4YFKA 2PA8L 4XLNA 2A6EA 4A3FC 3S15C 1K83C 4BBRC 4A3EK 2WB1L 4X6AC 4KMUA 4QIWL 3PO3K 2NVTC 5C4JC 3S1NK 4A93K 3S1QK 4Y7NC 3K7AK 3FKIC 1TWCC 3RZOC 3S16C 3WODA 3S2HK 2E2JC 4A3CC 5IP7K 3S1QC 2JA7C 3K7AC 4C3IK 3I4MK 1I3QC 3HOYK 2NVYC 5IYDK 3GTPK 3S2DC 5IP7C 3GTQK 1TWAK 4A3BK 4Y52K 4Q5SA 4OIQA 3I4MC 3HOYC 2A69A 3GTPC 2JA6C 3HOUK 4C2MK 3GTQC 4KN7A 1TWAC 4Y52C 4A3BC 2PPBA 2O5IA 3M3YK 4A3GK 4G7OA 4A3JC 2B63K 4BY1K 3HOUC 4A3KC 1TWGC 2R7ZC 4A3IK 1R9TK 4A3DK 4BBSK 2E2HK 1WCMK 1I50K 5IYBK 3M3YC 4A3GC 3H0GK 3GTLK 2R7ZK 1YNNA 4XSXA 4A3IC 4A3DC 4BBSC 4A3EC 1I6VA 1I50C 5C4XK 3PO3C 3EQLA 4A3MK 3S1NC 1BDFA
chains in the Genus database with same CATH superfamily
4A93C 3N3YA 1XXAA 4JK1A 2PMZD 4KM8A 4GTDA 4AYBD 5IYDC 3MMLB 3H3VD 3GTMK 3GEIA 4YFXA 4BXXC 2R93C 3TFJA 1DD5A 1O27A 1XZPA 3BUEA 1TWHC 3VA7A 4G0WA 5E68A 1ZXOA 4QJVA 2ZFZA 5C3EK 1TWFC 1R9TC 1XXBA 4LLGA 4A3LC 5IYBC 3GTOC 1ZBSA 5C44K 4OIPA 1BJTA 4GTAA 5JVOA 1Y1VK 3GTKC 3I4NC 3OPFA 3T00A 2R92K 1HQMA 4G7HA 1F9NA 3RZDC 5M5WK 1WIHA 1TWCK 1O2BA 1XPPA 5FJ8K 5FLMK 4G0VA 1I3QK 2NVQC 3QX3A 2JA5C 2Y0SD 3SZYA 4QIWD 1O26A 1L0WA 4KMDA 3N0BA 4A3KK 3PO2C 5C44C 4ZH4A 1ISEA 1Y1VC 1SFOC 1WSRA 4GTEA 5D4DA 4XLNA 1UV7A 2E2IA 2NVTC 5C4JC 1BS2A 3AQOA 1O2FB 1WQFA 2R93A 4KATA 3AD9C 1G51A 4BKWA 1TWCC 4J3NA 2D6FC 3S2HK 1TWHA 3K7AC 1I3QC 1TWFA 1R9TA 2ZUEA 3GTOA 5IP7C 1YX2A 4OIQA 1J6WA 5IOSA 3GTKA 3FHZA 3GTQC 1KQ4A 1TWAC 4WILA 4A3BC 1PJ5A 4A3KC 3T02A 2GSUA 4A3DK 3AD7C 2E2HK 3GEHA 4KMAA 1DCHA 4XSXA 1I6VA 1I50C 1WOPA 2P8TA 5C4XK 2W7VA 1O2AA 4PABA 1BGWA 2CW0A 2XCQA 3HOZK 3S2HC 2GSNA 2JA5A 2E2IK 3GTJK 4BXXK 1O28A 2R93K 3LAPA 3HXAA 5M3FK 4LK1A 5EGHA 1TWHK 5IP9C 5IORA 3M4OC 1WQGA 2WAQL 1SFOA 1TWFK 4KB2A 4A3LK 3GTOK 5TMCA 4Q4ZA 4P5BA 2E2HC 4AH6A 3GTKK 1WOSA 1XXCA 3I4NK 2NVXK 1TWCA 2WB1D 2A68A 5C4XC 3RZDK 1IBAA 3CQZC 4MEYA 1I3QA 4A3FK 3S15K 1B4BA 3HOZC 1USOA 4LJZA 1O25A 3GDZA 3A8JA 2E2IC 4Y7NK 3GTJC 3FKIK 3GTQA 1TWAA 2NVQK 1O29A 2RGRA 2JA7K 2V6TA 2JA5K 2JA8C 4C45A 1J98A 2JH3A 3GEEA 3T01A 3PO2K 1I50A 3GTLA 4WJ4A 3V4GA 1SFOK 4A3JK 3S1MC 2NVXC 4YG2A 5M5XK 3S14C 4C3HK 5M5YK 2NVTK 5C4JK 4YFKA 2PA8L 4A3FC 2A6EA 3S15C 1K83C 4BBRC 4A3EK 2WB1L 4KMUA 3PO3K 4Y7NC 3K7AK 3FKIC 3AD8C 5IP7K 2JA7C 2E2HA 4GTFA 3GTQK 1TWAK 2P5MA 3FOEA 2CFAB 4A3BK 4KMHA 3I4MC 3HOYC 3A8KA 3GTPC 5CHPA 5IOTA 4Y52C 1USMA 3CQZA 4A3JC 4C2MC 4DDQA 1F7VA 1I50K 4GT9A 1HI9A 4C3HC 3G4CA 4A3GC 3H0GK 3GTLK 3GTJA 1F7UA 4KASA 4A3IC 4BBSC 1ZVUA 4A3EC 4KM9A 5HL8A 3PO3C 3S17K 5IOQA 1EH1A 1ZQ1C 1IE0A 4XSZA 2WAQD 4KAWX 4KARA 4KC6A 1V5VA 3GIRA 5IP9K 3HOXC 3M4OK 3CAGA 1ZYRA 2RH6A 5IYCK 2NVXA 4G7ZA 1XZPB 1Y1WK 1DCOA 1WSVA 3S0XA 4QJVB 4P5AA 4GTCA 4YFNA 1K83A 3BP3A 3GTGK 3S1RC 1PJ7A 3H0GC 3GTLC 3FKIA 1JQWA 3CQZK 3DXJA 3HOVK 3OEPA 5TMFA 1RU0A 4GTBA 4OINA 2V6UA 2Y3PA 3HOWK 1YNJA 2XCRB 4XLPA 4KB4A 2JA7A 3S17C 3ADAC 1IL2A 2V6SA 3FOFA 1WOOA 1XZQB 4MQ9A 4NOIA 2YU9C 1INNA 3GTPA 4C3JC 3RZOK 1EI6A 3LAJA 2E2JK 2JA8K 1EQRA 2BE5A 5IYCC 4FZBA 2A6HA 2NVYK 1VGXA 4XCHA 1Y1WC 5L46A 4OIOA 2PA8D 4P9SA 2JA6K 3S1MK 3TTGA 4OIRA 3GTGC 3S14K 3HOVC 1EFWA 1IQ0A 3HKZL 1K83K 3HOWC 4KN4A 4BBRK 2KWAA 2ZUFA 1JVIA 4X6AC 1C0AA 2FQTA 3A8IA 1WQHA 5TJ3A 1J6XA 3RZOC 2E2JC 1VJEA 3S1QC 2XCOA 3I4MK 3HOYK 2NVYC 3GTPK 3H0GA 4C3IC 4Y52K 4Q5SA 2A69A 2JA6C 4C2MK 3AQPA 4KN7A 2PPBA 2O5IA 3NUHA 4A3GK 2B63K 4BY1K 3HOUC 3GSIA 3OREA 4A3IK 4BBSK 1WCMK 4BLBA 3M3YC 2YU9A 1WORA 1YCLA 3AH5A 4A3MK 2R7ZC 1BDFA 2VUMK 4LR2A 1Y1WA 4BY7K 1PJ6A 3HOXK 4PAAA 4GTLA 3GTGA 1XZQA 5EGEA 1VH2A 4WJ3M 3GTMC 3ERED 2PMZL 3S1RK 1TWGA 1B4AA 4AYBL 1O24A 2B63C 4BY1C 2FQOA 1I6HK 1EK8A 1WCMC 3H3VL 4BLAA 1DCPA 5C3EC 3L4KA 3L4JA 4A3MC 2YU9K 2NVYA 2VUMC 2GSOA 2GAHC 4BY7C 4C3JK 2R92C 4RMFA 3G4AA 4LK0A 2JA6A 4ILDA 3S16K 3JSTA 4A3CK 2O5JA 3BP8C 3HKZD 5M3MK 3IPJA 2EBBA 3S2DK 1SMYA 5FLMC 3LPXA 1IW7A 1I6HC 4O2DA 3SZZA 2R7ZA 4MEXA 4GZYA 1TWGK 1JOEA 4GFQA 4X6AK 2PHCB 5CJ9A 1VLOA 4LQYA 2Y0SL 4QIWL 3S1NK 4A93K 3S1QK 2GAGC 3GTMA 3S16C 1VRQC 3Q3QA 3WODA 3TFIA 1X31C 4A3CC 2B63A 5JFEA 4C3IK 4LOWA 4G0UA 5IYDK 1WCMA 3S2DC 3TFHA 1F93A 2CFAA 3HOUK 1J6VA 3N0CA 3M3YK 2VUMA 4M1XA 4G7OA 1Y1VA 1TWGC 4FM9A 1R9TK 1AB4A 5IYBK 2R92A 2R7ZK 1GE9A 1YNNA 4A3DC 4KDDA 1IS1A 3EQLA 3S1NC
chains in the Genus database with same CATH topology
2VUMK 4A93C 4JK1A 2CW0A 3HOZK 4BY7K 4XSZA 2WAQD 3HOXK 3S2HC 2PMZD 2E2IK 4AYBD 3GTJK 5IP9K 4BXXK 3HOXC 3M4OK 5IYDC 2R93K 5M3FK 1ZYRA 3H3VD 3GTMK 4LK1A 5IYCK 1TWHK 5IP9C 4YFXA 4BXXC 4G7ZA 3M4OC 2R93C 1Y1WK 3GTMC 2WAQL 1TWFK 1TWHC 2PMZL 3S1RK 4A3LK 4QJVB 4YFNA 5TMCA 3GTOK 4AYBL 4QJVA 2B63C 4BY1C 4Q4ZA 5C3EK 1I6HK 1TWFC 1R9TC 3GTGK 2E2HC 1WCMC 4LLGA 3S1RC 3H3VL 5IYBC 3GTOC 3GTKK 4A3LC 3H0GC 3GTLC 2NVXK 3I4NK 3DXJA 2WB1D 3CQZK 5C44K 4OIPA 5C3EC 2A68A 5TMFA 4OINA 3HOWK 3HOVK 3GTKC 1Y1VK 1YNJA 5C4XC 3RZDK 4XLPA 3I4NC 4A3MC 3S17C 2R92K 3CQZC 4MEYA 4A3FK 2YU9K 2VUMC 1HQMA 3S15K 4G7HA 3HOZC 4BY7C 4C3JK 3RZDC 4LJZA 5M5WK 4MQ9A 2R92C 4NOIA 2YU9C 4LK0A 4Y7NK 2E2IC 3GTJC 3FKIK 1TWCK 3RZOK 3S16K 2E2JK 2JA8K 2NVQK 4A3CK 2BE5A 1XPPA 2O5JA 5IYCC 5FJ8K 2JA7K 5FLMK 2JA5K 1I3QK 2A6HA 2NVYK 3HKZD 5M3MK 2JA8C 1Y1WC 2NVQC 3S2DK 1SMYA 4OIOA 5FLMC 2JA5C 2Y0SD 2PA8D 1IW7A 3S1MK 2JA6K 3PO2K 4OIRA 1I6HC 4QIWD 3GTGC 4MEXA 3S14K 1SFOK 4GZYA 4A3JK 3S1MC 2NVXC 4A3KK 4YG2A 3PO2C 1TWGK 5C44C 3HOVC 3HKZL 4ZH4A 1K83K 5M5XK 3HOWC 4KN4A 4BBRK 3S14C 1Y1VC 4C3HK 4X6AK 1SFOC 3S17K 5M5YK 2NVTK 5C4JK 5D4DA 2Y0SL 4YFKA 2PA8L 4XLNA 2A6EA 4A3FC 3S15C 1K83C 4BBRC 4A3EK 2WB1L 4X6AC 4KMUA 4QIWL 3PO3K 2NVTC 5C4JC 3S1NK 4A93K 3S1QK 4Y7NC 3K7AK 3FKIC 1TWCC 3RZOC 3S16C 3WODA 3S2HK 2E2JC 4A3CC 5IP7K 3S1QC 2JA7C 3K7AC 4C3IK 3I4MK 1I3QC 3HOYK 2NVYC 5IYDK 3GTPK 3S2DC 5IP7C 3GTQK 1TWAK 4A3BK 4Y52K 4Q5SA 4OIQA 3I4MC 3HOYC 2A69A 3GTPC 2JA6C 3HOUK 4C2MK 3GTQC 4KN7A 1TWAC 4Y52C 4A3BC 2PPBA 2O5IA 3M3YK 4A3GK 4G7OA 4A3JC 2B63K 4BY1K 3HOUC 4A3KC 1TWGC 2R7ZC 4A3IK 1R9TK 4A3DK 4BBSK 2E2HK 1WCMK 1I50K 5IYBK 3M3YC 4A3GC 3H0GK 3GTLK 2R7ZK 1YNNA 4XSXA 4A3IC 4A3DC 4BBSC 4A3EC 1I6VA 1I50C 5C4XK 3PO3C 3EQLA 4A3MK 3S1NC 1BDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM K;  4A93 C;  4JK1 A;  2CW0 A;  3HOZ K;  4BY7 K;  4XSZ A;  2WAQ D;  3HOX K;  3S2H C;  2PMZ D;  2E2I K;  4AYB D;  3GTJ K;  5IP9 K;  4BXX K;  3HOX C;  3M4O K;  5IYD C;  2R93 K;  5M3F K;  1ZYR A;  3H3V D;  3GTM K;  4LK1 A;  5IYC K;  1TWH K;  5IP9 C;  4YFX A;  4BXX C;  4G7Z A;  3M4O C;  2R93 C;  1Y1W K;  3GTM C;  2WAQ L;  1TWF K;  1TWH C;  2PMZ L;  3S1R K;  4A3L K;  4QJV B;  4YFN A;  5TMC A;  3GTO K;  4AYB L;  4QJV A;  2B63 C;  4BY1 C;  4Q4Z A;  5C3E K;  1I6H K;  1TWF C;  1R9T C;  3GTG K;  2E2H C;  1WCM C;  4LLG A;  3S1R C;  3H3V L;  5IYB C;  3GTO C;  3GTK K;  4A3L C;  3H0G C;  3GTL C;  2NVX K;  3I4N K;  3DXJ A;  2WB1 D;  3CQZ K;  5C44 K;  4OIP A;  5C3E C;  2A68 A;  5TMF A;  4OIN A;  3HOW K;  3HOV K;  3GTK C;  1Y1V K;  1YNJ A;  5C4X C;  3RZD K;  4XLP A;  3I4N C;  4A3M C;  3S17 C;  2R92 K;  3CQZ C;  4MEY A;  4A3F K;  2YU9 K;  2VUM C;  1HQM A;  3S15 K;  4G7H A;  3HOZ C;  4BY7 C;  4C3J K;  3RZD C;  4LJZ A;  5M5W K;  4MQ9 A;  2R92 C;  4NOI A;  2YU9 C;  4LK0 A;  4Y7N K;  2E2I C;  3GTJ C;  3FKI K;  1TWC K;  3RZO K;  3S16 K;  2E2J K;  2JA8 K;  2NVQ K;  4A3C K;  2BE5 A;  1XPP A;  2O5J A;  5IYC C;  5FJ8 K;  2JA7 K;  5FLM K;  2JA5 K;  1I3Q K;  2A6H A;  2NVY K;  3HKZ D;  5M3M K;  2JA8 C;  1Y1W C;  2NVQ C;  3S2D K;  1SMY A;  4OIO A;  5FLM C;  2JA5 C;  2Y0S D;  2PA8 D;  1IW7 A;  3S1M K;  2JA6 K;  3PO2 K;  4OIR A;  1I6H C;  4QIW D;  3GTG C;  4MEX A;  3S14 K;  1SFO K;  4GZY A;  4A3J K;  3S1M C;  2NVX C;  4A3K K;  4YG2 A;  3PO2 C;  1TWG K;  5C44 C;  3HOV C;  3HKZ L;  4ZH4 A;  1K83 K;  5M5X K;  3HOW C;  4KN4 A;  4BBR K;  3S14 C;  1Y1V C;  4C3H K;  4X6A K;  1SFO C;  3S17 K;  5M5Y K;  2NVT K;  5C4J K;  5D4D A;  2Y0S L;  4YFK A;  2PA8 L;  4XLN A;  2A6E A;  4A3F C;  3S15 C;  1K83 C;  4BBR C;  4A3E K;  2WB1 L;  4X6A C;  4KMU A;  4QIW L;  3PO3 K;  2NVT C;  5C4J C;  3S1N K;  4A93 K;  3S1Q K;  4Y7N C;  3K7A K;  3FKI C;  1TWC C;  3RZO C;  3S16 C;  3WOD A;  3S2H K;  2E2J C;  4A3C C;  5IP7 K;  3S1Q C;  2JA7 C;  3K7A C;  4C3I K;  3I4M K;  1I3Q C;  3HOY K;  2NVY C;  5IYD K;  3GTP K;  3S2D C;  5IP7 C;  3GTQ K;  1TWA K;  4A3B K;  4Y52 K;  4Q5S A;  4OIQ A;  3I4M C;  3HOY C;  2A69 A;  3GTP C;  2JA6 C;  3HOU K;  4C2M K;  3GTQ C;  4KN7 A;  1TWA C;  4Y52 C;  4A3B C;  2PPB A;  2O5I A;  3M3Y K;  4A3G K;  4G7O A;  4A3J C;  2B63 K;  4BY1 K;  3HOU C;  4A3K C;  1TWG C;  2R7Z C;  4A3I K;  1R9T K;  4A3D K;  4BBS K;  2E2H K;  1WCM K;  1I50 K;  5IYB K;  3M3Y C;  4A3G C;  3H0G K;  3GTL K;  2R7Z K;  1YNN A;  4XSX A;  4A3I C;  4A3D C;  4BBS C;  4A3E C;  1I6V A;  1I50 C;  5C4X K;  3PO3 C;  3EQL A;  4A3M K;  3S1N C;  1BDF A; 
#chains in the Genus database with same CATH topology
 4A93 C;  3N3Y A;  1XXA A;  4JK1 A;  2PMZ D;  4KM8 A;  4GTD A;  4AYB D;  5IYD C;  3MML B;  3H3V D;  3GTM K;  3GEI A;  4YFX A;  4BXX C;  2R93 C;  3TFJ A;  1DD5 A;  1O27 A;  1XZP A;  3BUE A;  1TWH C;  3VA7 A;  4G0W A;  5E68 A;  1ZXO A;  4QJV A;  2ZFZ A;  5C3E K;  1TWF C;  1R9T C;  1XXB A;  4LLG A;  4A3L C;  5IYB C;  3GTO C;  1ZBS A;  5C44 K;  4OIP A;  1BJT A;  4GTA A;  5JVO A;  1Y1V K;  3GTK C;  3I4N C;  3OPF A;  3T00 A;  2R92 K;  1HQM A;  4G7H A;  1F9N A;  3RZD C;  5M5W K;  1WIH A;  1TWC K;  1O2B A;  1XPP A;  5FJ8 K;  5FLM K;  4G0V A;  1I3Q K;  2NVQ C;  3QX3 A;  2JA5 C;  2Y0S D;  3SZY A;  4QIW D;  1O26 A;  1L0W A;  4KMD A;  3N0B A;  4A3K K;  3PO2 C;  5C44 C;  4ZH4 A;  1ISE A;  1Y1V C;  1SFO C;  1WSR A;  4GTE A;  5D4D A;  4XLN A;  1UV7 A;  2E2I A;  2NVT C;  5C4J C;  1BS2 A;  3AQO A;  1O2F B;  1WQF A;  2R93 A;  4KAT A;  3AD9 C;  1G51 A;  4BKW A;  1TWC C;  4J3N A;  2D6F C;  3S2H K;  1TWH A;  3K7A C;  1I3Q C;  1TWF A;  1R9T A;  2ZUE A;  3GTO A;  5IP7 C;  1YX2 A;  4OIQ A;  1J6W A;  5IOS A;  3GTK A;  3FHZ A;  3GTQ C;  1KQ4 A;  1TWA C;  4WIL A;  4A3B C;  1PJ5 A;  4A3K C;  3T02 A;  2GSU A;  4A3D K;  3AD7 C;  2E2H K;  3GEH A;  4KMA A;  1DCH A;  4XSX A;  1I6V A;  1I50 C;  1WOP A;  2P8T A;  5C4X K;  2W7V A;  1O2A A;  4PAB A;  1BGW A;  2CW0 A;  2XCQ A;  3HOZ K;  3S2H C;  2GSN A;  2JA5 A;  2E2I K;  3GTJ K;  4BXX K;  1O28 A;  2R93 K;  3LAP A;  3HXA A;  5M3F K;  4LK1 A;  5EGH A;  1TWH K;  5IP9 C;  5IOR A;  3M4O C;  1WQG A;  2WAQ L;  1SFO A;  1TWF K;  4KB2 A;  4A3L K;  3GTO K;  5TMC A;  4Q4Z A;  4P5B A;  2E2H C;  4AH6 A;  3GTK K;  1WOS A;  1XXC A;  3I4N K;  2NVX K;  1TWC A;  2WB1 D;  2A68 A;  5C4X C;  3RZD K;  1IBA A;  3CQZ C;  4MEY A;  1I3Q A;  4A3F K;  3S15 K;  1B4B A;  3HOZ C;  1USO A;  4LJZ A;  1O25 A;  3GDZ A;  3A8J A;  2E2I C;  4Y7N K;  3GTJ C;  3FKI K;  3GTQ A;  1TWA A;  2NVQ K;  1O29 A;  2RGR A;  2JA7 K;  2V6T A;  2JA5 K;  2JA8 C;  4C45 A;  1J98 A;  2JH3 A;  3GEE A;  3T01 A;  3PO2 K;  1I50 A;  3GTL A;  4WJ4 A;  3V4G A;  1SFO K;  4A3J K;  3S1M C;  2NVX C;  4YG2 A;  5M5X K;  3S14 C;  4C3H K;  5M5Y K;  2NVT K;  5C4J K;  4YFK A;  2PA8 L;  4A3F C;  2A6E A;  3S15 C;  1K83 C;  4BBR C;  4A3E K;  2WB1 L;  4KMU A;  3PO3 K;  4Y7N C;  3K7A K;  3FKI C;  3AD8 C;  5IP7 K;  2JA7 C;  2E2H A;  4GTF A;  3GTQ K;  1TWA K;  2P5M A;  3FOE A;  2CFA B;  4A3B K;  4KMH A;  3I4M C;  3HOY C;  3A8K A;  3GTP C;  5CHP A;  5IOT A;  4Y52 C;  1USM A;  3CQZ A;  4A3J C;  4C2M C;  4DDQ A;  1F7V A;  1I50 K;  4GT9 A;  1HI9 A;  4C3H C;  3G4C A;  4A3G C;  3H0G K;  3GTL K;  3GTJ A;  1F7U A;  4KAS A;  4A3I C;  4BBS C;  1ZVU A;  4A3E C;  4KM9 A;  5HL8 A;  3PO3 C;  3S17 K;  5IOQ A;  1EH1 A;  1ZQ1 C;  1IE0 A;  4XSZ A;  2WAQ D;  4KAW X;  4KAR A;  4KC6 A;  1V5V A;  3GIR A;  5IP9 K;  3HOX C;  3M4O K;  3CAG A;  1ZYR A;  2RH6 A;  5IYC K;  2NVX A;  4G7Z A;  1XZP B;  1Y1W K;  1DCO A;  1WSV A;  3S0X A;  4QJV B;  4P5A A;  4GTC A;  4YFN A;  1K83 A;  3BP3 A;  3GTG K;  3S1R C;  1PJ7 A;  3H0G C;  3GTL C;  3FKI A;  1JQW A;  3CQZ K;  3DXJ A;  3HOV K;  3OEP A;  5TMF A;  1RU0 A;  4GTB A;  4OIN A;  2V6U A;  2Y3P A;  3HOW K;  1YNJ A;  2XCR B;  4XLP A;  4KB4 A;  2JA7 A;  3S17 C;  3ADA C;  1IL2 A;  2V6S A;  3FOF A;  1WOO A;  1XZQ B;  4MQ9 A;  4NOI A;  2YU9 C;  1INN A;  3GTP A;  4C3J C;  3RZO K;  1EI6 A;  3LAJ A;  2E2J K;  2JA8 K;  1EQR A;  2BE5 A;  5IYC C;  4FZB A;  2A6H A;  2NVY K;  1VGX A;  4XCH A;  1Y1W C;  5L46 A;  4OIO A;  2PA8 D;  4P9S A;  2JA6 K;  3S1M K;  3TTG A;  4OIR A;  3GTG C;  3S14 K;  3HOV C;  1EFW A;  1IQ0 A;  3HKZ L;  1K83 K;  3HOW C;  4KN4 A;  4BBR K;  2KWA A;  2ZUF A;  1JVI A;  4X6A C;  1C0A A;  2FQT A;  3A8I A;  1WQH A;  5TJ3 A;  1J6X A;  3RZO C;  2E2J C;  1VJE A;  3S1Q C;  2XCO A;  3I4M K;  3HOY K;  2NVY C;  3GTP K;  3H0G A;  4C3I C;  4Y52 K;  4Q5S A;  2A69 A;  2JA6 C;  4C2M K;  3AQP A;  4KN7 A;  2PPB A;  2O5I A;  3NUH A;  4A3G K;  2B63 K;  4BY1 K;  3HOU C;  3GSI A;  3ORE A;  4A3I K;  4BBS K;  1WCM K;  4BLB A;  3M3Y C;  2YU9 A;  1WOR A;  1YCL A;  3AH5 A;  4A3M K;  2R7Z C;  1BDF A;  2VUM K;  4LR2 A;  1Y1W A;  4BY7 K;  1PJ6 A;  3HOX K;  4PAA A;  4GTL A;  3GTG A;  1XZQ A;  5EGE A;  1VH2 A;  4WJ3 M;  3GTM C;  3ERE D;  2PMZ L;  3S1R K;  1TWG A;  1B4A A;  4AYB L;  1O24 A;  2B63 C;  4BY1 C;  2FQO A;  1I6H K;  1EK8 A;  1WCM C;  3H3V L;  4BLA A;  1DCP A;  5C3E C;  3L4K A;  3L4J A;  4A3M C;  2YU9 K;  2NVY A;  2VUM C;  2GSO A;  2GAH C;  4BY7 C;  4C3J K;  2R92 C;  4RMF A;  3G4A A;  4LK0 A;  2JA6 A;  4ILD A;  3S16 K;  3JST A;  4A3C K;  2O5J A;  3BP8 C;  3HKZ D;  5M3M K;  3IPJ A;  2EBB A;  3S2D K;  1SMY A;  5FLM C;  3LPX A;  1IW7 A;  1I6H C;  4O2D A;  3SZZ A;  2R7Z A;  4MEX A;  4GZY A;  1TWG K;  1JOE A;  4GFQ A;  4X6A K;  2PHC B;  5CJ9 A;  1VLO A;  4LQY A;  2Y0S L;  4QIW L;  3S1N K;  4A93 K;  3S1Q K;  2GAG C;  3GTM A;  3S16 C;  1VRQ C;  3Q3Q A;  3WOD A;  3TFI A;  1X31 C;  4A3C C;  2B63 A;  5JFE A;  4C3I K;  4LOW A;  4G0U A;  5IYD K;  1WCM A;  3S2D C;  3TFH A;  1F93 A;  2CFA A;  3HOU K;  1J6V A;  3N0C A;  3M3Y K;  2VUM A;  4M1X A;  4G7O A;  1Y1V A;  1TWG C;  4FM9 A;  1R9T K;  1AB4 A;  5IYB K;  2R92 A;  2R7Z K;  1GE9 A;  1YNN A;  4A3D C;  4KDD A;  1IS1 A;  3EQL A;  3S1N C; 
#chains in the Genus database with same CATH homology
 2VUM K;  4A93 C;  4JK1 A;  2CW0 A;  3HOZ K;  4BY7 K;  4XSZ A;  2WAQ D;  3HOX K;  3S2H C;  2PMZ D;  2E2I K;  4AYB D;  3GTJ K;  5IP9 K;  4BXX K;  3HOX C;  3M4O K;  5IYD C;  2R93 K;  5M3F K;  1ZYR A;  3H3V D;  3GTM K;  4LK1 A;  5IYC K;  1TWH K;  5IP9 C;  4YFX A;  4BXX C;  4G7Z A;  3M4O C;  2R93 C;  1Y1W K;  3GTM C;  2WAQ L;  1TWF K;  1TWH C;  2PMZ L;  3S1R K;  4A3L K;  4QJV B;  4YFN A;  5TMC A;  3GTO K;  4AYB L;  4QJV A;  2B63 C;  4BY1 C;  4Q4Z A;  5C3E K;  1I6H K;  1TWF C;  1R9T C;  3GTG K;  2E2H C;  1WCM C;  4LLG A;  3S1R C;  3H3V L;  5IYB C;  3GTO C;  3GTK K;  4A3L C;  3H0G C;  3GTL C;  2NVX K;  3I4N K;  3DXJ A;  2WB1 D;  3CQZ K;  5C44 K;  4OIP A;  5C3E C;  2A68 A;  5TMF A;  4OIN A;  3HOW K;  3HOV K;  3GTK C;  1Y1V K;  1YNJ A;  5C4X C;  3RZD K;  4XLP A;  3I4N C;  4A3M C;  3S17 C;  2R92 K;  3CQZ C;  4MEY A;  4A3F K;  2YU9 K;  2VUM C;  1HQM A;  3S15 K;  4G7H A;  3HOZ C;  4BY7 C;  4C3J K;  3RZD C;  4LJZ A;  5M5W K;  4MQ9 A;  2R92 C;  4NOI A;  2YU9 C;  4LK0 A;  4Y7N K;  2E2I C;  3GTJ C;  3FKI K;  1TWC K;  3RZO K;  3S16 K;  2E2J K;  2JA8 K;  2NVQ K;  4A3C K;  2BE5 A;  1XPP A;  2O5J A;  5IYC C;  5FJ8 K;  2JA7 K;  5FLM K;  2JA5 K;  1I3Q K;  2A6H A;  2NVY K;  3HKZ D;  5M3M K;  2JA8 C;  1Y1W C;  2NVQ C;  3S2D K;  1SMY A;  4OIO A;  5FLM C;  2JA5 C;  2Y0S D;  2PA8 D;  1IW7 A;  3S1M K;  2JA6 K;  3PO2 K;  4OIR A;  1I6H C;  4QIW D;  3GTG C;  4MEX A;  3S14 K;  1SFO K;  4GZY A;  4A3J K;  3S1M C;  2NVX C;  4A3K K;  4YG2 A;  3PO2 C;  1TWG K;  5C44 C;  3HOV C;  3HKZ L;  4ZH4 A;  1K83 K;  5M5X K;  3HOW C;  4KN4 A;  4BBR K;  3S14 C;  1Y1V C;  4C3H K;  4X6A K;  1SFO C;  3S17 K;  5M5Y K;  2NVT K;  5C4J K;  5D4D A;  2Y0S L;  4YFK A;  2PA8 L;  4XLN A;  2A6E A;  4A3F C;  3S15 C;  1K83 C;  4BBR C;  4A3E K;  2WB1 L;  4X6A C;  4KMU A;  4QIW L;  3PO3 K;  2NVT C;  5C4J C;  3S1N K;  4A93 K;  3S1Q K;  4Y7N C;  3K7A K;  3FKI C;  1TWC C;  3RZO C;  3S16 C;  3WOD A;  3S2H K;  2E2J C;  4A3C C;  5IP7 K;  3S1Q C;  2JA7 C;  3K7A C;  4C3I K;  3I4M K;  1I3Q C;  3HOY K;  2NVY C;  5IYD K;  3GTP K;  3S2D C;  5IP7 C;  3GTQ K;  1TWA K;  4A3B K;  4Y52 K;  4Q5S A;  4OIQ A;  3I4M C;  3HOY C;  2A69 A;  3GTP C;  2JA6 C;  3HOU K;  4C2M K;  3GTQ C;  4KN7 A;  1TWA C;  4Y52 C;  4A3B C;  2PPB A;  2O5I A;  3M3Y K;  4A3G K;  4G7O A;  4A3J C;  2B63 K;  4BY1 K;  3HOU C;  4A3K C;  1TWG C;  2R7Z C;  4A3I K;  1R9T K;  4A3D K;  4BBS K;  2E2H K;  1WCM K;  1I50 K;  5IYB K;  3M3Y C;  4A3G C;  3H0G K;  3GTL K;  2R7Z K;  1YNN A;  4XSX A;  4A3I C;  4A3D C;  4BBS C;  4A3E C;  1I6V A;  1I50 C;  5C4X K;  3PO3 C;  3EQL A;  4A3M K;  3S1N C;  1BDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...