5FLMK

Structure of transcribing mammalian rna polymerase ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5flmK00
2JA7C 4X6AK 4QJVB 4AYBD 1TWFC 1K83K 4OIQA 3PO2K 3I4MC 1TWCC 1TWAK 2R92C 3HOWK 4G7ZA 2A6HA 2Y0SL 3HOUK 4A3GK 3CQZK 2NVTC 2Y0SD 2YU9K 3S15K 5C44C 4A3BK 4XLPA 1TWGC 2NVQC 3PO3K 5IP9C 5IP7K 3GTJK 3GTPK 4GZYA 5D4DA 5C4XK 4XSXA 1TWHC 5M5XK 4BBSC 1I50C 1ZYRA 2CW0A 2PA8L 2WB1L 4C3IK 2JA5C 3GTQC 3S1RK 4C2MK 3S2HC 3HOYC 4BXXK 4Q5SA 3GTMC 3S17C 5IYDC 4A3MC 2NVXK 2B63C 4XSZA 4NOIA 3S1QK 4YFKA 2JA6C 1YNJA 1TWFK 4BY7K 4A3KC 3RZOK 3S1NC 1SMYA 4A3GC 3GTGC 4C3JK 4BBRK 2BE5A 3HOVK 1BDFA 4LK1A 5M3MK 1I6HC 2VUMC 3HOZK 4A3CC 3M3YK 4QIWL 1XPPA 4A3EK 2A6EA 4A3FK 3S16K 4OINA 1Y1WK 2E2JC 4YFNA 2E2HC 3HKZD 1Y1VC 2PA8D 2WB1D 4KMUA 4LLGA 5TMCA 4A3LC 3GTOK 3GTKC 2R93K 3HKZL 5IYBC 4Y7NK 1I3QK 4A3CK 4A93K 5C4JK 4BBRC 1R9TK 3S1MC 3WODA 4YFXA 4C3HK 4LJZA 2JA8K 5FLMK 4A3BC 4ZH4A 1SFOK 2E2IK 4AYBL 1WCMK 4A3EC 3K7AK 2PMZD 5C44K 3H0GC 4A3JC 3RZDK 4A3IC 3GTMK 2E2HK 3GTLK 3PO3C 2B63K 1I50K 3GTQK 4A93C 2NVYC 5C4XC 5IYCC 2JA6K 4BXXC 5FJ8K 2JA5K 5TMFA 4KN7A 5C3EK 4BY7C 3S17K 1IW7A 2NVXC 3S2DC 4MQ9A 2R7ZC 4G7OA 1HQMA 2O5JA 3I4NK 3PO2C 4A3LK 1K83C 4BY1C 4A3DC 3FKIK 1TWCK 5FLMC 2JA7K 4QIWD 2R7ZK 4X6AC 1WCMC 3I4MK 2R92K 3I4NC 4Y52K 1YNNA 4QJVA 3H0GK 3CQZC 3RZDC 2NVTK 3HOXC 2NVQK 3GTLC 3M4OC 5IP7C 1TWAC 4OIPA 4XLNA 3GTPC 3HOWC 2NVYK 3HOUC 5IYCK 5IP9K 4A3FC 3S16C 1Y1VK 2YU9C 3S15C 5M5YK 4OIOA 4OIRA 3S14C 2A69A 2E2JK 3GTOC 2PPBA 3H3VD 4A3MK 4BBSK 5IYDK 2WAQD 3GTJC 4LK0A 3HOYK 3EQLA 5M3FK 3S2HK 4G7HA 2R93C 4BY1K 4A3DK 1I3QC 3GTKK 3RZOC 3S1NK 5M5WK 1R9TC 1SFOC 2E2IC 4Q4ZA 3DXJA 2JA8C 5C4JC 3GTGK 3S1MK 3HOXK 3M4OK 4KN4A 4A3KK 3HOZC 2VUMK 4MEXA 2A68A 4JK1A 3HOVC 4A3IK 3M3YC 3S14K 1I6VA 3K7AC 4MEYA 4A3JK 1I6HK 1TWGK 1Y1WC 2WAQL 1TWHK 5C3EC 5IYBK 2O5IA 3S1RC 3S2DK 3H3VL 4Y7NC 2PMZL 3S1QC 4Y52C 3FKIC 4YG2A
chains in the Genus database with same CATH superfamily
2JA7C 4QJVB 1F93A 1K83K 1TWAK 4KASA 2R92C 1RU0A 5IOSA 5L46A 2Y0SL 3HOUK 2Y0SD 1O28A 1B4AA 5E68A 1TWGC 2NVQC 2RH6A 3AD9C 3GTPK 4XSXA 1ZYRA 3S2HC 2PA8L 3GTQA 4C3IK 2JA5C 2FQTA 4C2MK 2GSOA 3HOYC 4A3MC 4NOIA 5IOTA 3A8JA 1TWFK 3HXAA 1WORA 5JFEA 1VGXA 1KQ4A 4C3JK 3AD8C 3AD7C 4LK1A 5M3MK 2VUMC 1XPPA 4M1XA 1O29A 3FOFA 1Y1WA 1AB4A 3HKZD 1Y1VC 5TMCA 5IORA 3GTOK 4RMFA 4C3HK 2YU9A 4ZH4A 4BLBA 1WQGA 5C44K 3H0GC 4PAAA 3GTLK 3PO3C 1I50K 4C3IC 1BJTA 5C4XC 1SFOA 4C2MC 4BXXC 5FJ8K 3OREA 1G51A 5C3EK 4BY7C 4G0UA 1IW7A 2NVXC 3AQOA 4G7OA 4GTCA 1HQMA 4A3LK 4KMHA 4X6AC 1WOPA 1XZQB 4QJVA 5IP7C 4XLNA 3N3YA 4OIPA 2NVYK 4A3FC 1Y1VA 1WOOA 4GTLA 4OIOA 3GTOC 2PPBA 3HOYK 3A8KA 3EQLA 2Y3PA 4BY1K 5C4JC 5IOQA 3M4OK 1WIHA 5CJ9A 2VUMK 4MEXA 3S14K 3HOVC 1I6VA 3K7AC 4MEYA 4A3JK 4KM9A 1O2AA 3NUHA 4KC6A 2PHCB 3TTGA 2O5IA 1TWGA 2GSUA 2W7VA 4KMAA 2PMZL 2E2HA 3GTMA 4X6AK 3PO2K 1DCPA 4AYBD 3G4CA 1IE0A 2YU9K 3S15K 1ZBSA 3TFIA 1XXAA 4GZYA 1TWHC 5M5XK 1I50C 2WB1L 1UV7A 1IL2A 3AQPA 5IYDC 2V6SA 2B63C 4XSZA 3T01A 3S1QK 4YFKA 1YNJA 1J6XA 2CFAB 3RZOK 3S1NC 1O26A 4P5BA 3HOVK 1BGWA 3M3YK 4P9SA 4A3EK 4A3FK 3BUEA 3SZYA 1BS2A 1VH2A 4G0WA 4O2DA 4KM8A 1PJ6A 2GSNA 1XXCA 5IYBC 2R93A 4Y7NK 1I3QK 3SZZA 4BBRC 4AH6A 3WODA 4LJZA 2GAHC 2V6UA 1EI6A 1SFOK 4DDQA 1IS1A 2PMZD 3GEIA 3GSIA 2B63K 2NVYC 5IYCC 2E2IA 2JA5K 4KN7A 1XZQA 2NVXA 3S2DC 1J6WA 2O5JA 3I4NK 1K83C 3GTOA 4A3DC 1TWCK 1WCMC 1K83A 1USOA 3RZDC 3CQZC 2NVTK 3GTPA 1XXBA 4GTBA 2NVQK 3ADAC 3M4OC 3GEEA 2XCRB 1WSRA 1Y1VK 4KB2A 5M3FK 1DCHA 3OEPA 4P5AA 1I3QC 1SFOC 4C3JC 2JA8C 1ZQ1C 3QX3A 3GTGA 3HOXK 4KN4A 1V5VA 4A3KK 3VA7A 3TFJA 4BLAA 4JK1A 3M3YC 1X31C 1I6HK 1TWGK 1TWHA 2JA6A 3S2DK 3H3VL 4Y7NC 4Q5SA 5FLMK 4A3LC 1TWFC 3I4MC 2A6HA 3FKIA 2R7ZA 3CQZK 2NVTC 1O24A 2ZUFA 1JQWA 5IP7K 4KB4A 1XZPA 1O25A 4KAWX 2P8TA 3G4AA 1I50A 4BXXK 4WJ4A 3S17C 2NVXK 2ZUEA 2JA6C 4A3KC 4A3GC 4KATA 3FHZA 4GT9A 2P5MA 3HOZK 1PJ5A 5TJ3A 1TWFA 4OINA 1PJ7A 4YFNA 2PA8D 4KMUA 3GTKC 2R93K 3HKZL 3GTLA 4A3CK 5C4JK 2RGRA 3S1MC 4YFXA 3IPJA 2JA8K 4KDDA 1HI9A 1YX2A 2E2IK 1TWAA 3K7AK 2ZFZA 4A3JC 1F7UA 2V6TA 4A3IC 1J98A 2E2HK 1O27A 1WCMA 3GTQK 4A93C 4KMDA 2JA6K 1F7VA 1XZPB 3Q3QA 4MQ9A 1VLOA 4BY1C 5FLMC 1B4BA 4LQYA 3I4MK 2FQOA 5HL8A 4Y52K 3H0GK 3HOXC 3GTLC 3CQZA 3GTPC 3HOWC 4PABA 3HOUC 5IP9K 3S16C 5M5YK 4OIRA 3S14C 4BBSK 2A69A 2E2JK 3H3VD 4A3MK 3L4KA 3GTJC 3S2HK 2R93C 3LPXA 2JH3A 3RZOC 3S1NK 5M5WK 1R9TC 1WQFA 2E2IC 2NVYA 3DXJA 2XCQA 3GTGK 3T02A 3V4GA 4C3HC 4FM9A 4BKWA 3GTKA 4GFQA 1WSVA 4A3IK 4J3NA 1EK8A 3BP3A 3ERED 1Y1WC 2WAQL 1TWHK 2EBBA 2XCOA 3AH5A 1WQHA 3N0CA 3LAJA 4A3CC 3S1QC 3FKIC 4YG2A 2R7ZC 3I4NC 4OIQA 2R92A 4KARA 1JOEA 1TWCC 3HOWK 4G7ZA 2JA7A 4GTDA 4A3GK 5C44C 2KWAA 4A3BK 4XLPA 1J6VA 3PO3K 1EQRA 5IP9C 1DD5A 3GTJK 5D4DA 5C4XK 3S0XA 2JA5A 1TWCA 3GTQC 4A93K 2CW0A 3CAGA 4BBSC 3S1RK 3GTMC 5EGHA 4BY7K 1GE9A 3A8IA 4XCHA 1SMYA 4LOWA 3GTGC 1YCLA 2D6FC 4BBRK 2BE5A 3LAPA 1BDFA 1JVIA 3L4JA 1L0WA 1ZVUA 1I3QA 1I6HC 4QIWL 2A6EA 3S16K 4LR2A 1Y1WK 2E2JC 1VJEA 2E2HC 1R9TA 2WB1D 4LLGA 1VRQC 3GDZA 4WILA 3T00A 3GTJA 1R9TK 1O2BA 3GIRA 4A3BC 4ILDA 1ISEA 4FZBA 5CHPA 1EH1A 2CFAA 4GTAA 1WCMK 4AYBL 3N0BA 4A3EC 1C0AA 4C45A 3RZDK 3GEHA 3GTMK 1USMA 1EFWA 4G0VA 5TMFA 3MMLB 3S17K 3JSTA 3PO2C 5JVOA 3FKIK 2R7ZK 2GAGC 2JA7K 4QIWD 3TFHA 2R92K 1YNNA 3OPFA 1TWAC 3BP8C 5IYCK 2YU9C 3S15C 5EGEA 5IYDK 2WAQD 1WOSA 4LK0A 4WJ3M 1IBAA 4G7HA 4A3DK 3GTKK 4Q4ZA 4GTFA 3S1MK 1ZXOA 1INNA 3H0GA 3HOZC 4GTEA 1O2FB 1IQ0A 2VUMA 2A68A 2B63A 5C3EC 1DCOA 1F9NA 5IYBK 3S1RC 3FOEA 4Y52C
chains in the Genus database with same CATH topology
2JA7C 4X6AK 4QJVB 4AYBD 1TWFC 1K83K 4OIQA 3PO2K 3I4MC 1TWCC 1TWAK 2R92C 3HOWK 4G7ZA 2A6HA 2Y0SL 3HOUK 4A3GK 3CQZK 2NVTC 2Y0SD 2YU9K 3S15K 5C44C 4A3BK 4XLPA 1TWGC 2NVQC 3PO3K 5IP9C 5IP7K 3GTJK 3GTPK 4GZYA 5D4DA 5C4XK 4XSXA 1TWHC 5M5XK 4BBSC 1I50C 1ZYRA 2CW0A 2PA8L 2WB1L 4C3IK 2JA5C 3GTQC 3S1RK 4C2MK 3S2HC 3HOYC 4BXXK 4Q5SA 3GTMC 3S17C 5IYDC 4A3MC 2NVXK 2B63C 4XSZA 4NOIA 3S1QK 4YFKA 2JA6C 1YNJA 1TWFK 4BY7K 4A3KC 3RZOK 3S1NC 1SMYA 4A3GC 3GTGC 4C3JK 4BBRK 2BE5A 3HOVK 1BDFA 4LK1A 5M3MK 1I6HC 2VUMC 3HOZK 4A3CC 3M3YK 4QIWL 1XPPA 4A3EK 2A6EA 4A3FK 3S16K 4OINA 1Y1WK 2E2JC 4YFNA 2E2HC 3HKZD 1Y1VC 2PA8D 2WB1D 4KMUA 4LLGA 5TMCA 4A3LC 3GTOK 3GTKC 2R93K 3HKZL 5IYBC 4Y7NK 1I3QK 4A3CK 4A93K 5C4JK 4BBRC 1R9TK 3S1MC 3WODA 4YFXA 4C3HK 4LJZA 2JA8K 5FLMK 4A3BC 4ZH4A 1SFOK 2E2IK 4AYBL 1WCMK 4A3EC 3K7AK 2PMZD 5C44K 3H0GC 4A3JC 3RZDK 4A3IC 3GTMK 2E2HK 3GTLK 3PO3C 2B63K 1I50K 3GTQK 4A93C 2NVYC 5C4XC 5IYCC 2JA6K 4BXXC 5FJ8K 2JA5K 5TMFA 4KN7A 5C3EK 4BY7C 3S17K 1IW7A 2NVXC 3S2DC 4MQ9A 2R7ZC 4G7OA 1HQMA 2O5JA 3I4NK 3PO2C 4A3LK 1K83C 4BY1C 4A3DC 3FKIK 1TWCK 5FLMC 2JA7K 4QIWD 2R7ZK 4X6AC 1WCMC 3I4MK 2R92K 3I4NC 4Y52K 1YNNA 4QJVA 3H0GK 3CQZC 3RZDC 2NVTK 3HOXC 2NVQK 3GTLC 3M4OC 5IP7C 1TWAC 4OIPA 4XLNA 3GTPC 3HOWC 2NVYK 3HOUC 5IYCK 5IP9K 4A3FC 3S16C 1Y1VK 2YU9C 3S15C 5M5YK 4OIOA 4OIRA 3S14C 2A69A 2E2JK 3GTOC 2PPBA 3H3VD 4A3MK 4BBSK 5IYDK 2WAQD 3GTJC 4LK0A 3HOYK 3EQLA 5M3FK 3S2HK 4G7HA 2R93C 4BY1K 4A3DK 1I3QC 3GTKK 3RZOC 3S1NK 5M5WK 1R9TC 1SFOC 2E2IC 4Q4ZA 3DXJA 2JA8C 5C4JC 3GTGK 3S1MK 3HOXK 3M4OK 4KN4A 4A3KK 3HOZC 2VUMK 4MEXA 2A68A 4JK1A 3HOVC 4A3IK 3M3YC 3S14K 1I6VA 3K7AC 4MEYA 4A3JK 1I6HK 1TWGK 1Y1WC 2WAQL 1TWHK 5C3EC 5IYBK 2O5IA 3S1RC 3S2DK 3H3VL 4Y7NC 2PMZL 3S1QC 4Y52C 3FKIC 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 C;  4X6A K;  4QJV B;  4AYB D;  1TWF C;  1K83 K;  4OIQ A;  3PO2 K;  3I4M C;  1TWC C;  1TWA K;  2R92 C;  3HOW K;  4G7Z A;  2A6H A;  2Y0S L;  3HOU K;  4A3G K;  3CQZ K;  2NVT C;  2Y0S D;  2YU9 K;  3S15 K;  5C44 C;  4A3B K;  4XLP A;  1TWG C;  2NVQ C;  3PO3 K;  5IP9 C;  5IP7 K;  3GTJ K;  3GTP K;  4GZY A;  5D4D A;  5C4X K;  4XSX A;  1TWH C;  5M5X K;  4BBS C;  1I50 C;  1ZYR A;  2CW0 A;  2PA8 L;  2WB1 L;  4C3I K;  2JA5 C;  3GTQ C;  3S1R K;  4C2M K;  3S2H C;  3HOY C;  4BXX K;  4Q5S A;  3GTM C;  3S17 C;  5IYD C;  4A3M C;  2NVX K;  2B63 C;  4XSZ A;  4NOI A;  3S1Q K;  4YFK A;  2JA6 C;  1YNJ A;  1TWF K;  4BY7 K;  4A3K C;  3RZO K;  3S1N C;  1SMY A;  4A3G C;  3GTG C;  4C3J K;  4BBR K;  2BE5 A;  3HOV K;  1BDF A;  4LK1 A;  5M3M K;  1I6H C;  2VUM C;  3HOZ K;  4A3C C;  3M3Y K;  4QIW L;  1XPP A;  4A3E K;  2A6E A;  4A3F K;  3S16 K;  4OIN A;  1Y1W K;  2E2J C;  4YFN A;  2E2H C;  3HKZ D;  1Y1V C;  2PA8 D;  2WB1 D;  4KMU A;  4LLG A;  5TMC A;  4A3L C;  3GTO K;  3GTK C;  2R93 K;  3HKZ L;  5IYB C;  4Y7N K;  1I3Q K;  4A3C K;  4A93 K;  5C4J K;  4BBR C;  1R9T K;  3S1M C;  3WOD A;  4YFX A;  4C3H K;  4LJZ A;  2JA8 K;  5FLM K;  4A3B C;  4ZH4 A;  1SFO K;  2E2I K;  4AYB L;  1WCM K;  4A3E C;  3K7A K;  2PMZ D;  5C44 K;  3H0G C;  4A3J C;  3RZD K;  4A3I C;  3GTM K;  2E2H K;  3GTL K;  3PO3 C;  2B63 K;  1I50 K;  3GTQ K;  4A93 C;  2NVY C;  5C4X C;  5IYC C;  2JA6 K;  4BXX C;  5FJ8 K;  2JA5 K;  5TMF A;  4KN7 A;  5C3E K;  4BY7 C;  3S17 K;  1IW7 A;  2NVX C;  3S2D C;  4MQ9 A;  2R7Z C;  4G7O A;  1HQM A;  2O5J A;  3I4N K;  3PO2 C;  4A3L K;  1K83 C;  4BY1 C;  4A3D C;  3FKI K;  1TWC K;  5FLM C;  2JA7 K;  4QIW D;  2R7Z K;  4X6A C;  1WCM C;  3I4M K;  2R92 K;  3I4N C;  4Y52 K;  1YNN A;  4QJV A;  3H0G K;  3CQZ C;  3RZD C;  2NVT K;  3HOX C;  2NVQ K;  3GTL C;  3M4O C;  5IP7 C;  1TWA C;  4OIP A;  4XLN A;  3GTP C;  3HOW C;  2NVY K;  3HOU C;  5IYC K;  5IP9 K;  4A3F C;  3S16 C;  1Y1V K;  2YU9 C;  3S15 C;  5M5Y K;  4OIO A;  4OIR A;  3S14 C;  2A69 A;  2E2J K;  3GTO C;  2PPB A;  3H3V D;  4A3M K;  4BBS K;  5IYD K;  2WAQ D;  3GTJ C;  4LK0 A;  3HOY K;  3EQL A;  5M3F K;  3S2H K;  4G7H A;  2R93 C;  4BY1 K;  4A3D K;  1I3Q C;  3GTK K;  3RZO C;  3S1N K;  5M5W K;  1R9T C;  1SFO C;  2E2I C;  4Q4Z A;  3DXJ A;  2JA8 C;  5C4J C;  3GTG K;  3S1M K;  3HOX K;  3M4O K;  4KN4 A;  4A3K K;  3HOZ C;  2VUM K;  4MEX A;  2A68 A;  4JK1 A;  3HOV C;  4A3I K;  3M3Y C;  3S14 K;  1I6V A;  3K7A C;  4MEY A;  4A3J K;  1I6H K;  1TWG K;  1Y1W C;  2WAQ L;  1TWH K;  5C3E C;  5IYB K;  2O5I A;  3S1R C;  3S2D K;  3H3V L;  4Y7N C;  2PMZ L;  3S1Q C;  4Y52 C;  3FKI C;  4YG2 A; 
#chains in the Genus database with same CATH topology
 2JA7 C;  4QJV B;  1F93 A;  1K83 K;  1TWA K;  4KAS A;  2R92 C;  1RU0 A;  5IOS A;  5L46 A;  2Y0S L;  3HOU K;  2Y0S D;  1O28 A;  1B4A A;  5E68 A;  1TWG C;  2NVQ C;  2RH6 A;  3AD9 C;  3GTP K;  4XSX A;  1ZYR A;  3S2H C;  2PA8 L;  3GTQ A;  4C3I K;  2JA5 C;  2FQT A;  4C2M K;  2GSO A;  3HOY C;  4A3M C;  4NOI A;  5IOT A;  3A8J A;  1TWF K;  3HXA A;  1WOR A;  5JFE A;  1VGX A;  1KQ4 A;  4C3J K;  3AD8 C;  3AD7 C;  4LK1 A;  5M3M K;  2VUM C;  1XPP A;  4M1X A;  1O29 A;  3FOF A;  1Y1W A;  1AB4 A;  3HKZ D;  1Y1V C;  5TMC A;  5IOR A;  3GTO K;  4RMF A;  4C3H K;  2YU9 A;  4ZH4 A;  4BLB A;  1WQG A;  5C44 K;  3H0G C;  4PAA A;  3GTL K;  3PO3 C;  1I50 K;  4C3I C;  1BJT A;  5C4X C;  1SFO A;  4C2M C;  4BXX C;  5FJ8 K;  3ORE A;  1G51 A;  5C3E K;  4BY7 C;  4G0U A;  1IW7 A;  2NVX C;  3AQO A;  4G7O A;  4GTC A;  1HQM A;  4A3L K;  4KMH A;  4X6A C;  1WOP A;  1XZQ B;  4QJV A;  5IP7 C;  4XLN A;  3N3Y A;  4OIP A;  2NVY K;  4A3F C;  1Y1V A;  1WOO A;  4GTL A;  4OIO A;  3GTO C;  2PPB A;  3HOY K;  3A8K A;  3EQL A;  2Y3P A;  4BY1 K;  5C4J C;  5IOQ A;  3M4O K;  1WIH A;  5CJ9 A;  2VUM K;  4MEX A;  3S14 K;  3HOV C;  1I6V A;  3K7A C;  4MEY A;  4A3J K;  4KM9 A;  1O2A A;  3NUH A;  4KC6 A;  2PHC B;  3TTG A;  2O5I A;  1TWG A;  2GSU A;  2W7V A;  4KMA A;  2PMZ L;  2E2H A;  3GTM A;  4X6A K;  3PO2 K;  1DCP A;  4AYB D;  3G4C A;  1IE0 A;  2YU9 K;  3S15 K;  1ZBS A;  3TFI A;  1XXA A;  4GZY A;  1TWH C;  5M5X K;  1I50 C;  2WB1 L;  1UV7 A;  1IL2 A;  3AQP A;  5IYD C;  2V6S A;  2B63 C;  4XSZ A;  3T01 A;  3S1Q K;  4YFK A;  1YNJ A;  1J6X A;  2CFA B;  3RZO K;  3S1N C;  1O26 A;  4P5B A;  3HOV K;  1BGW A;  3M3Y K;  4P9S A;  4A3E K;  4A3F K;  3BUE A;  3SZY A;  1BS2 A;  1VH2 A;  4G0W A;  4O2D A;  4KM8 A;  1PJ6 A;  2GSN A;  1XXC A;  5IYB C;  2R93 A;  4Y7N K;  1I3Q K;  3SZZ A;  4BBR C;  4AH6 A;  3WOD A;  4LJZ A;  2GAH C;  2V6U A;  1EI6 A;  1SFO K;  4DDQ A;  1IS1 A;  2PMZ D;  3GEI A;  3GSI A;  2B63 K;  2NVY C;  5IYC C;  2E2I A;  2JA5 K;  4KN7 A;  1XZQ A;  2NVX A;  3S2D C;  1J6W A;  2O5J A;  3I4N K;  1K83 C;  3GTO A;  4A3D C;  1TWC K;  1WCM C;  1K83 A;  1USO A;  3RZD C;  3CQZ C;  2NVT K;  3GTP A;  1XXB A;  4GTB A;  2NVQ K;  3ADA C;  3M4O C;  3GEE A;  2XCR B;  1WSR A;  1Y1V K;  4KB2 A;  5M3F K;  1DCH A;  3OEP A;  4P5A A;  1I3Q C;  1SFO C;  4C3J C;  2JA8 C;  1ZQ1 C;  3QX3 A;  3GTG A;  3HOX K;  4KN4 A;  1V5V A;  4A3K K;  3VA7 A;  3TFJ A;  4BLA A;  4JK1 A;  3M3Y C;  1X31 C;  1I6H K;  1TWG K;  1TWH A;  2JA6 A;  3S2D K;  3H3V L;  4Y7N C;  4Q5S A;  5FLM K;  4A3L C;  1TWF C;  3I4M C;  2A6H A;  3FKI A;  2R7Z A;  3CQZ K;  2NVT C;  1O24 A;  2ZUF A;  1JQW A;  5IP7 K;  4KB4 A;  1XZP A;  1O25 A;  4KAW X;  2P8T A;  3G4A A;  1I50 A;  4BXX K;  4WJ4 A;  3S17 C;  2NVX K;  2ZUE A;  2JA6 C;  4A3K C;  4A3G C;  4KAT A;  3FHZ A;  4GT9 A;  2P5M A;  3HOZ K;  1PJ5 A;  5TJ3 A;  1TWF A;  4OIN A;  1PJ7 A;  4YFN A;  2PA8 D;  4KMU A;  3GTK C;  2R93 K;  3HKZ L;  3GTL A;  4A3C K;  5C4J K;  2RGR A;  3S1M C;  4YFX A;  3IPJ A;  2JA8 K;  4KDD A;  1HI9 A;  1YX2 A;  2E2I K;  1TWA A;  3K7A K;  2ZFZ A;  4A3J C;  1F7U A;  2V6T A;  4A3I C;  1J98 A;  2E2H K;  1O27 A;  1WCM A;  3GTQ K;  4A93 C;  4KMD A;  2JA6 K;  1F7V A;  1XZP B;  3Q3Q A;  4MQ9 A;  1VLO A;  4BY1 C;  5FLM C;  1B4B A;  4LQY A;  3I4M K;  2FQO A;  5HL8 A;  4Y52 K;  3H0G K;  3HOX C;  3GTL C;  3CQZ A;  3GTP C;  3HOW C;  4PAB A;  3HOU C;  5IP9 K;  3S16 C;  5M5Y K;  4OIR A;  3S14 C;  4BBS K;  2A69 A;  2E2J K;  3H3V D;  4A3M K;  3L4K A;  3GTJ C;  3S2H K;  2R93 C;  3LPX A;  2JH3 A;  3RZO C;  3S1N K;  5M5W K;  1R9T C;  1WQF A;  2E2I C;  2NVY A;  3DXJ A;  2XCQ A;  3GTG K;  3T02 A;  3V4G A;  4C3H C;  4FM9 A;  4BKW A;  3GTK A;  4GFQ A;  1WSV A;  4A3I K;  4J3N A;  1EK8 A;  3BP3 A;  3ERE D;  1Y1W C;  2WAQ L;  1TWH K;  2EBB A;  2XCO A;  3AH5 A;  1WQH A;  3N0C A;  3LAJ A;  4A3C C;  3S1Q C;  3FKI C;  4YG2 A;  2R7Z C;  3I4N C;  4OIQ A;  2R92 A;  4KAR A;  1JOE A;  1TWC C;  3HOW K;  4G7Z A;  2JA7 A;  4GTD A;  4A3G K;  5C44 C;  2KWA A;  4A3B K;  4XLP A;  1J6V A;  3PO3 K;  1EQR A;  5IP9 C;  1DD5 A;  3GTJ K;  5D4D A;  5C4X K;  3S0X A;  2JA5 A;  1TWC A;  3GTQ C;  4A93 K;  2CW0 A;  3CAG A;  4BBS C;  3S1R K;  3GTM C;  5EGH A;  4BY7 K;  1GE9 A;  3A8I A;  4XCH A;  1SMY A;  4LOW A;  3GTG C;  1YCL A;  2D6F C;  4BBR K;  2BE5 A;  3LAP A;  1BDF A;  1JVI A;  3L4J A;  1L0W A;  1ZVU A;  1I3Q A;  1I6H C;  4QIW L;  2A6E A;  3S16 K;  4LR2 A;  1Y1W K;  2E2J C;  1VJE A;  2E2H C;  1R9T A;  2WB1 D;  4LLG A;  1VRQ C;  3GDZ A;  4WIL A;  3T00 A;  3GTJ A;  1R9T K;  1O2B A;  3GIR A;  4A3B C;  4ILD A;  1ISE A;  4FZB A;  5CHP A;  1EH1 A;  2CFA A;  4GTA A;  1WCM K;  4AYB L;  3N0B A;  4A3E C;  1C0A A;  4C45 A;  3RZD K;  3GEH A;  3GTM K;  1USM A;  1EFW A;  4G0V A;  5TMF A;  3MML B;  3S17 K;  3JST A;  3PO2 C;  5JVO A;  3FKI K;  2R7Z K;  2GAG C;  2JA7 K;  4QIW D;  3TFH A;  2R92 K;  1YNN A;  3OPF A;  1TWA C;  3BP8 C;  5IYC K;  2YU9 C;  3S15 C;  5EGE A;  5IYD K;  2WAQ D;  1WOS A;  4LK0 A;  4WJ3 M;  1IBA A;  4G7H A;  4A3D K;  3GTK K;  4Q4Z A;  4GTF A;  3S1M K;  1ZXO A;  1INN A;  3H0G A;  3HOZ C;  4GTE A;  1O2F B;  1IQ0 A;  2VUM A;  2A68 A;  2B63 A;  5C3E C;  1DCO A;  1F9N A;  5IYB K;  3S1R C;  3FOE A;  4Y52 C; 
#chains in the Genus database with same CATH homology
 2JA7 C;  4X6A K;  4QJV B;  4AYB D;  1TWF C;  1K83 K;  4OIQ A;  3PO2 K;  3I4M C;  1TWC C;  1TWA K;  2R92 C;  3HOW K;  4G7Z A;  2A6H A;  2Y0S L;  3HOU K;  4A3G K;  3CQZ K;  2NVT C;  2Y0S D;  2YU9 K;  3S15 K;  5C44 C;  4A3B K;  4XLP A;  1TWG C;  2NVQ C;  3PO3 K;  5IP9 C;  5IP7 K;  3GTJ K;  3GTP K;  4GZY A;  5D4D A;  5C4X K;  4XSX A;  1TWH C;  5M5X K;  4BBS C;  1I50 C;  1ZYR A;  2CW0 A;  2PA8 L;  2WB1 L;  4C3I K;  2JA5 C;  3GTQ C;  3S1R K;  4C2M K;  3S2H C;  3HOY C;  4BXX K;  4Q5S A;  3GTM C;  3S17 C;  5IYD C;  4A3M C;  2NVX K;  2B63 C;  4XSZ A;  4NOI A;  3S1Q K;  4YFK A;  2JA6 C;  1YNJ A;  1TWF K;  4BY7 K;  4A3K C;  3RZO K;  3S1N C;  1SMY A;  4A3G C;  3GTG C;  4C3J K;  4BBR K;  2BE5 A;  3HOV K;  1BDF A;  4LK1 A;  5M3M K;  1I6H C;  2VUM C;  3HOZ K;  4A3C C;  3M3Y K;  4QIW L;  1XPP A;  4A3E K;  2A6E A;  4A3F K;  3S16 K;  4OIN A;  1Y1W K;  2E2J C;  4YFN A;  2E2H C;  3HKZ D;  1Y1V C;  2PA8 D;  2WB1 D;  4KMU A;  4LLG A;  5TMC A;  4A3L C;  3GTO K;  3GTK C;  2R93 K;  3HKZ L;  5IYB C;  4Y7N K;  1I3Q K;  4A3C K;  4A93 K;  5C4J K;  4BBR C;  1R9T K;  3S1M C;  3WOD A;  4YFX A;  4C3H K;  4LJZ A;  2JA8 K;  5FLM K;  4A3B C;  4ZH4 A;  1SFO K;  2E2I K;  4AYB L;  1WCM K;  4A3E C;  3K7A K;  2PMZ D;  5C44 K;  3H0G C;  4A3J C;  3RZD K;  4A3I C;  3GTM K;  2E2H K;  3GTL K;  3PO3 C;  2B63 K;  1I50 K;  3GTQ K;  4A93 C;  2NVY C;  5C4X C;  5IYC C;  2JA6 K;  4BXX C;  5FJ8 K;  2JA5 K;  5TMF A;  4KN7 A;  5C3E K;  4BY7 C;  3S17 K;  1IW7 A;  2NVX C;  3S2D C;  4MQ9 A;  2R7Z C;  4G7O A;  1HQM A;  2O5J A;  3I4N K;  3PO2 C;  4A3L K;  1K83 C;  4BY1 C;  4A3D C;  3FKI K;  1TWC K;  5FLM C;  2JA7 K;  4QIW D;  2R7Z K;  4X6A C;  1WCM C;  3I4M K;  2R92 K;  3I4N C;  4Y52 K;  1YNN A;  4QJV A;  3H0G K;  3CQZ C;  3RZD C;  2NVT K;  3HOX C;  2NVQ K;  3GTL C;  3M4O C;  5IP7 C;  1TWA C;  4OIP A;  4XLN A;  3GTP C;  3HOW C;  2NVY K;  3HOU C;  5IYC K;  5IP9 K;  4A3F C;  3S16 C;  1Y1V K;  2YU9 C;  3S15 C;  5M5Y K;  4OIO A;  4OIR A;  3S14 C;  2A69 A;  2E2J K;  3GTO C;  2PPB A;  3H3V D;  4A3M K;  4BBS K;  5IYD K;  2WAQ D;  3GTJ C;  4LK0 A;  3HOY K;  3EQL A;  5M3F K;  3S2H K;  4G7H A;  2R93 C;  4BY1 K;  4A3D K;  1I3Q C;  3GTK K;  3RZO C;  3S1N K;  5M5W K;  1R9T C;  1SFO C;  2E2I C;  4Q4Z A;  3DXJ A;  2JA8 C;  5C4J C;  3GTG K;  3S1M K;  3HOX K;  3M4O K;  4KN4 A;  4A3K K;  3HOZ C;  2VUM K;  4MEX A;  2A68 A;  4JK1 A;  3HOV C;  4A3I K;  3M3Y C;  3S14 K;  1I6V A;  3K7A C;  4MEY A;  4A3J K;  1I6H K;  1TWG K;  1Y1W C;  2WAQ L;  1TWH K;  5C3E C;  5IYB K;  2O5I A;  3S1R C;  3S2D K;  3H3V L;  4Y7N C;  2PMZ L;  3S1Q C;  4Y52 C;  3FKI C;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...