5FLXA

Mammalian 40s hcv-ires complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
LDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 47
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
A PF16122 40S_SA_C 40S ribosomal protein SA C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5flxA01
2V4MA 1X9IA 2VF5X 4M0DA 2J6HA 1XTBA 5BY2A 4JV5B 5A2QA 5FLXA 1JXAA 2Q8NA 2ZJ4A 3CVJA 4NXMB 3JX9A 4LF5B 4X64B 5BR8B 1I94B 5LMUB 3J81A 1HNWB 1JLHA 1NUHA 4KHPB 1N36B 5IWAB 1U0FA 3BCHA 3OOJA 2I2WA 1VIMA 2CXOA 3UJHA 1XMOB 2F4VB 3HBAA 1HM5A 4DV4B 4DR3B 1N33B 1MOQA 2VF4X 1G98A 4B3SB 3T1YB 4DV0B 1FJGB 1T10A 4B3MB 4X65B 3JAMA 1J5EB 3ETNA 3TRJA 4YY3B 1TZCA 2POCA 1MOSA 4JI3B 1JIQA 4JI2B 1DQRA 2PUVA 4DV5B 3Q88A 1N34B 4LFBB 3NBUA 3ODPA 4X62B 2ZM6B 1IBLB 3FJ1A 3BJZA 1GZVA 4JI1B 4DR6B 1U0GA 2PGIA 2UXBB 1JEOA 2AMLA 4OX9B 1HOXA 1HNZB 1XMQB 4JI0B 4K0KB 1IBMB 2E5FA 2E5LB 2YVAA 4X66B 3SHOA 2CXRA 1C7QA 2UUAB 4DV6B 3M5PA 3TBFA 4NXNB 2CXTA 1MORA 5LL6P 3I0ZA 2XBLA 2VQEB 4DR4B 1J5XA 1C7RA 2UUBB 2UU9B 4LFCB 2A3NA 1B0ZA 3C3JA 1M3SA 1N32B 1Q50A 2VQFB 2CXQA 4B3TB 1IATA 2CVPA 3G68A 5I01A 4DR7B 4DV2B 1VIVA 1NRIA 1VI5A 1XNQB 2WU8A 3IFSA 3LJKA 3Q7IA 4LF7B 1GZDA 4DR5B 1TZBA 2HHHB 3FF1A 1HNXB 4LF9B 1TK9A 4EM6A 1IRIA 4DR1B 4TOIA 5IT9A 2CXNA 2PUWA 4LZJA 2XHZA 3KNZA 4JI8B 4AMVA 1X9HA 2UXDB 2PUTA 4JI7B 2ZJ3A 2DECA 4DV1B 3HJBA 4DV7B 4JI4B 4DV3B 4LFAB 3OTOB 2CXUA 4LF4B 4IVNA 3J80A 3PR3A 2X3YA 4JI5B 3EUAA 4S1WA 4GKKB 1X92A 2UXCB 4DUYB 2CXSA 4AQYB 2O2CA 1XNRB 3FXAA 4LF8B 4YHHB 4JYAB 1HR0B 2CB0A 1KOJA 4JI6B 1IBKB 1VI6A 3QKIA 2CXPA 2O2DA 3T1HB 4DR2B 3J7AC 4S12A 4U6NA 1U0EA 3FKJA 2DF8A 1X94A 4DUZB 5LMNB 1WIWA 2UUCB 4GKJB 1N8TA 4B3RB 4LF6B 2I22A 1ZZGA
chains in the Genus database with same CATH superfamily
1KP9A 2XVZA 4PSCA 2F3SA 3D6HA 4NECA 2OBYA 5I9TA 4JBWA 1GRVA 3KWLA 1Y4AE 1TMGE 1UBKS 1RXSA 2FPOA 1PUIA 3EF0A 3MT8A 4IUBS 1SOMA 4AXXA 4K9NA 2YZ7A 2YWEA 5ALGA 4LF5B 1CFZA 2YZKA 1UJBA 3NH6A 1T3TA 2HBRA 1ORIA 3F5QA 4L75A 1KI4A 1VXRA 4RLSA 2H8GA 4FNOA 1C1HA 4R0VA 3OZAA 3JRNA 4KH0A 1PU2A 7REQA 1ZAYA 2R68A 5JCJD 4BJ5A 2XXAB 1E69A 1PBNA 1MA0A 3SIWA 3FUUA 1WUTA 2GWRA 1WXHA 4V38A 2Z2XA 2BHLA 4S04A 4G07A 2AYZA 3T3OA 4O2RA 3RWOA 1AMOA 2X5KO 2XUZA 4H3SA 1LCIA 2QW8A 3H0EA 1R0YA 3PNQA 2VT2A 2ZJZA 1P5RA 3FFTA 2N47A 4J0IA 2VNIA 5AVOA 2DFLA 5IN5A 2I8LA 2X8JA 4CKYA 5J2TA 2ZI7A 1YQUA 3DT9A 5JRJA 4G86A 4DLTA 1FLVA 4K9RA 2F9MA 2WKRA 2POQX 2JEYA 2FOIA 1ZJ4A 2HF7A 1RKVA 3HBLA 5BV0A 1NBME 2H1VA 1G63A 1U94A 3JQBA 5DX0A 4RDHA 1KMCA 1XZQA 5KQRA 4P3OA 5KWJA 4W5OA 5AK5A 1FIUA 1Q3HA 1ENPA 5ILQA 4CFSA 5LXTF 1MDFA 1CY4A 3BM5A 1VYVA 1DTWB 4HDNA 4KGVA 3O4RA 5G0VA 5EXSA 3EGDA 4CIXA 4O2AB 3ZBUA 3L49A 2A9PA 3FBTA 3DTVB 2XQVA 4M6WA 5H5JA 3IAS1 5ESRA 1N6NA 4FHEA 3E27A 5G4LA 4C6HA 5B4TA 3BXFA 1KHTA 1O5TA 4WK6A 4URFA 3ADKA 1JDNA 2XW6A 3R7AA 2I5PO 5DYNA 1UPCA 3A36A 3ENNA 3G3EA 4M1TA 2X4DA 1Z83A 3H7IA 3KR9A 1R6UA 3LT1A 4PC6A 1OWOA 1ORHA 2BZ0A 3A1TA 3AC0A 3ZE1B 1SULA 1UBTS 4UFPA 3D0QA 5EWMA 4PU0A 4GE0A 2BR4A 2B1JA 3A25A 2C9BA 2O4UX 1U9JA 4BKUA 1Z7WA 5CDGA 3T3HA 4F2DA 5KNDD 1JG7A 1GPAA 3FMGA 3QLTA 2OD7A 3HEMA 4TLCA 4F6RA 3PLRA 4U8HA 5HVNA 4G4SP 4W5WA 3NC0C 2FRDC 5HZKA 1JKMA 1WM1A 2A1UA 2HJVA 4UAVA 3KNZA 3AVYA 4R9NA 4KLNA 4ZZ2A 4ARAA 3PXAA 4DCGA 4HXGA 1Y6FA 3GD7A 2C8LA 3I30X 4LHXA 4G97A 1P0IA 3E61A 1VDZA 4XLLA 3QBTA 3K0CC 3N2KA 3V42A 4B7ZA 2YJ4A 1EWVA 3THXA 1KIFA 3VPFA 5EWLA 5CD1A 1ZK0A 4MS3A 2JC3A 4PG8A 3NTXA 2JCSA 3JQDA 3GG9A 3KJNA 1NU6A 1SRQA 5IKMA 4KQHA 3V4SA 2VJOA 2GPAA 2WIKA 1Z38A 4M49A 3ZE0B 1J25A 1RE1A 2EFCB 2IIBA 3HB0A 2C7BA 1XEFA 1T8WA 3GMIA 2QXTA 2AC7A 3TRKA 2ODBA 4N5LA 5ALHA 1G2OA 3ZV4A 1JU9A 2BMFA 3RYIB 2EDCA 5LMNB 1F7VA 3A32A 3DOFA 1G3MA 3FYUB 4PANA 4A0RA 2MHCA 3PXDA 2ACEA 2OD9A 3ZUGA 4RTSA 2XT6A 1Q84A 1YKSA 3K70C 3BE4A 3KOZA 5HBGA 5DGDA 5DCUA 1FFXA 1E98A 4TTSA 1P4AA 1K68A 2AIRA 4X85A 5LOVB 2X4LA 2X9GA 4C2BA 3W8DA 1U0NA 3CNNA 1KS9A 1WD7A 1HFEL 2O7RA 2P75A 2X6QA 3QKTA 3GEGA 2BP7B 2O2GA 3A1FA 2UKDA 2J7PA 3GF4A 2DUWA 2BM9A 4EB6B 3L41A 4OBBA 3VR3A 3IVAA 1RPJA 1ZJ5A 2OBMA 2O19A 2JD1A 4BMYA 2BKLA 1DE0A 4D3DA 2ZJ5A 4QDJA 1OY1A 5K2OA 4C76A 4YAGA 1YZUA 4HAYA 4IDCA 5EQJB 4IVQA 3DD5A 3MWGA 2IXTA 3RT1A 3ID6C 4GMKA 4KK4A 1J5EB 1Q0LA 1S1CA 2IIQA 3CX7A 2YMQA 2NN3C 4RS3A 2IV2X 3ZHBA 3I6MA 3EGVA 3JXEA 3RHSA 3OX4A 4JI2B 1JW9B 4EKIA 3WLIA 4RORA 4YJ3B 5LQDA 1UMKA 1ZL0A 1Q91A 2CFIA 1BX1A 3ILXA 3SF0A 3TIVA 1JEYA 1DBVO 4P3KA 1T9GS 2FFQA 3VU9A 4EJFA 1ZHHA 5C80A 1C1XB 4YJHA 2FUCA 3U7JA 3ELWA 5HXAA 1SY7A 2ASEA 5KDDA 4XXHA 1WZNA 2PG3A 4JUDX 3G2PA 4NNOA 4KN8A 5ALFA 5CH3A 5E4YA 3ZI4A 3ITNA 3K0AB 2QTWB 4OJYA 3ILSA 2WM8A 1EWQA 2CLLB 4EA7A 1SZCA 4Q9LA 1CUWA 3PHBE 3ZXUB 5DM70 1T9DA 4TYPA 4CV3A 2WIFA 5FD8A 3WLAA 1KBQA 4KVAA 2XVYA 3K0CA 4Z9XA 5NULA 3TN7A 3H2GA 4TRJA 4QSMA 4IG4A 4RX1A 3AY6A 3L8FA 5E6RA 4NBSA 2IEBA 5EMLA 4CLOB 4JLVA 1G60A 1CQIB 1XMPA 2GVDC 4KAAA 4M8LA 4NU6A 4V3CA 3E9NA 4F4IA 4O2BB 1T8UA 1FTSA 4YT2A 4ZOEA 1BVUA 2P2ZA 3NBMA 1J1IA 1Y9EA 4IDQA 2HFKA 1UCFA 2XAUA 2PEZA 4GDMA 1JWAB 3DTNA 4Q3EA 4GZMA 2FW6A 3WYEA 2CJYA 1Q83A 4HEJA 4H1TA 5F4BA 1E1YA 3D3NA 1GLVA 2DLCX 2MSEB 3PEYA 1W76A 4RZ2A 1WW2A 4C21A 4H6XA 3RU9A 2GPSA 3KYBA 4B34A 2CMFA 2XUFA 1TUBA 5K01A 5SYAA 1QTQA 3C6KA 4WBSA 4QLBA 3PFIA 3AB7A 1EZ1A 2PPVA 2R2AA 4UVEA 5ARCA 4ZI2A 1XDBA 4J0HA 1IU9A 3WSTA 3TQRA 1FDWA 1S5PA 5EZ5A 1BCRB 2WWTA 2FF5A 3PR3A 1KRHA 1ZEMA 1FCJA 3T5CA 5TEWA 3JQ6A 2AA3A 5IG2A 4LHYA 2VJBA 1RYMA 1OW3B 5A0FA 4W9RA 4JBXA 1BHSA 3M2PA 2SNIE 3LDAA 4UCQA 5E1MA 4BP8A 4BFZA 4UBMA 3TE7A 3P2OA 1T35A 3U3MA 1VBNA 1SEPA 2J0SA 3HJFA 4NEGA 1U7WA 5EUBA 3HU2A 4LIPD 3F9CA 1FSFA 5JVDA 5F5LA 4V1CI 1XTZA 3WKBA 5JARA 1M1NA 3UJNA 1BOFA 3DDHA 4K6KA 5K8IA 2FOXA 1Y6RA 2GM5A 1JJFA 2B5VA 4C0SA 4GP9A 3K0KA 4TROA 4KR6A 2CLDX 4ALMA 2PQ6A 1KAGA 2QE7D 3P0FA 5H4GA 2HW8A 2RIRA 5EQFA 3ANYB 1L6RA 1TU0A 1A97A 2JH8A 2MDTA 2F64A 2XWPA 3IUMA 5H4HA 1OVMA 3USZA 4HWRA 4MV3A 3C4QA 4YR9A 4I8DA 3VPCA 5KHOC 1UJ4A 2RAUA 2IYOA 4FFDA 2OXRA 4G0NA 4LW8A 1HQYE 1N3IA 3REOA 1G7CA 1CVRA 1ZOOA 4ZMBA 2K7FA 1WUHS 3G8AA 3OX3A 5EERA 3D8BA 3CRZA 2M6KA 2OZVA 2AQHA 3HH8A 2P4QA 2CEKA 4CEJB 3EIFA 4NH4A 3EVDA 1YDHA 1KDPA 1DX4A 5AKXA 3PGJA 2V65A 1QP8A 3LUDA 3DMNA 2CFOA 1RI4A 2QE7A 2QZZA 1NLZA 3HBJA 3NONA 5KYTA 2V5VA 1Y9AA 2BBWA 1JIXA 3D6MA 3V80A 4UJ5A 5E8JA 5JNLA 1ULSA 3OO1A 4CMIB 3QE2A 4YH1A 2JLXA 2YJNA 1QE0A 3HWX1 3K15A 2G28A 3PCXA 1UC4B 3DTVA 1L1QA 4UAUA 5FLYA 1KI3A 1A5TA 4RJTA 3BIFA 4M4SA 1FY2A 3MT9A 1NLUA 2OE2A 1EDBA 1TI7A 2F48A 2CXXA 3KAPA 4YMWA 5HJ2A 3N2YA 2WF7A 4GXRA 3N8NA 3JTMA 1XCLA 3QBJA 4IJ6A 1E1NA 4KDCA 1MEEA 4P81A 1GQQA 3SYMA 4C87A 1QHHB 4Z4HA 4GPD1 1BXGB 3BMNB 1UAGA 1PP4A 2FFAA 3MCTA 4GPAA 2VLBA 5A9SA 1Z25A 5ALUA 2V7VA 3CEMA 4NV1A 1R0SA 4KLZA 2AZMA 3UK6A 3EW7A 1NRIA 1LC0A 5HEKA 3DL0A 1Q5PA 3D7LA 4XX0B 3TR6A 3EUFA 2B69A 4B3BA 2ODWA 3M4YA 1I0IA 2RGUA 3QLUA 3VV3A 3ZTWA 4CFYA 2QV0A 2HHHB 4Q7MB 3LK7A 3G7UA 3AK4A 3JQFC 4KG7A 1UP6A 4J7CA 5B1IA 2NUTA 5CPFA 1PJ2A 3PU6A 4AQ7A 1VYUA 3HJRA 4ZHQF 1RQPA 4Z4QA 4MYDA 1OFUX 4IMIB 2FLWA 4IXTA 4TTPA 4AMVA 1PLKA 1CUSA 3OM1A 4YXFA 5BUQA 3VAAA 4F5ZA 1G7SA 3CCCA 1JE0A 2YX1A 4IDDA 1DO2A 4CKCA 4YGXB 2BKUA 1KJ9A 2FZGA 1XVAA 3MBOA 2YVLA 3ESXA 4F93B 3MJTA 3AVXA 4P84A 1Y7TA 2HMWA 2GK7A 2A5JA 4AQYB 4WA7A 3C0KA 2C9OA 1RJEA 2HLDA 3T4UA 4EFMA 2C84A 2HMUA 1DC8A 1SXPA 3LXXA 2CLSA 2ZOSA 1HWYA 4B32A 2VHEA 3I72A 3OJCA 4KQMA 5L7WA 2GNOA 4KQWA 4MOWA 1XAIA 1U2PA 2HCJB 3MMNA 1E32A 4XSGA 3NYRA 2HRCA 4U6NA 3VPXA 5KOHA 3D64A 3EISA 3I76A 4PZDA 5HOQA 1NVTA 1WZIA 3FMFA 2OCYC 3MZ0A 4LF6B 4BWFB 3DNFA 4BX3A 5D3MA 1L7OA 1W9HA 3CF6R 3E2IA 3M6AA 3B1FA 3UWDA 2C2KA 2O9JA 4BWYA 4LN1A 4J0KA 4W7IA 5ILOA 3WICA 5H3CA 4I3GA 4TTVA 2OXIA 4K28A 3IL2A 4MJ7A 4JELA 5LZ5A 3UHPA 4R83A 2PKWA 1L5QA 5DOZA 4QT0A 3PVZA 3EVAA 1XZIA 3E7FA 2OGWA 2PCJA 3QEMB 1I6WA 3VNAA 4XGIA 4GL4A 4ER6A 4F4CA 3EGXB 4NYJR 3HXPA 3SEFA 5K3OA 2GZ1A 4Y6SA 4M1OA 5DHAA 1KPHA 1N9GA 4XIYA 2IHZA 3MAAC 3X1JA 3AF0A 5CYPA 1T3GA 2WTXA 4AY2A 2G9ZA 1ZWLA 3KD3A 4JYMA 2O4CA 4M7OA 1SXQA 4BJ1A 1C7EA 1GQFA 4MVJF 1SXJE 3C48A 2OAGA 1TUBB 2HRRA 3QLEA 2EV9A 4BJ6A 4BFYA 4DSAA 2H5LA 2XCLA 2PZJA 2MCFA 3FB4A 2M32A 3G88A 1DS6A 2QF7A 3F5SA 5G1NA 3TSAA 3TW0A 4D56A 1QGAA 3O8BA 2ILTA 3QQ5A 4L6AA 3TW8B 4L0CA 5L3SB 4TSFA 5HQ3B 3ND5A 5CDYA 4WOKA 3FVTA 1GNRA 1LBSA 4LJLA 2J9ZB 4TMXA 1BQEA 2VDLB 1GZ4A 1I4EB 3I2FA 3OKCA 2P3LA 2QUZA 3FVRA 1CS0A 2Q6KA 4EPVA 4KGDA 4LZNA 5JQWA 1KMQA 4ZCRA 2V58A 2QYTA 1RXIA 4JU8A 2JFBA 3QX8A 1VA4A 5HK9A 4R41A 1QYIA 2PXHA 5AI0A 2HCFA 2PX4A 2C1EA 1YL7A 4LTNA 1JDZA 1NVWQ 2P1ZA 3C7CB 1CUVA 3QXHA 4HGZA 4YQZA 4F3RA 8ABPA 1EVEA 2PVPA 1E5QA 2HIGA 2EYUA 3DNPA 4XW2A 3X1KA 1EVZA 4FLEA 2Q3LA 4JBYA 1T6YA 4M46A 3QWBA 4RLHA 2FQWA 4WUVA 1UXOA 4Y6RA 3KKNA 2VPIA 5ED4A 4K5QA 1QG4A 5C7IO 5D87A 3TJMA 4MB6A 3QVMA 1SEVA 2X4GA 1FUYB 3SXJA 2PUCA 3ZZUA 1C1DB 2W6ZA 4KWEA 5AVUA 5EP1A 3SZGA 1N6RA 5K0BA 2DQZA 3I23A 1NP7A 5AJXA 3SJ7A 2RJ3A 4P22A 2XLCA 4NJMA 2X5JO 1KI2A 3FNEA 3MEQA 4ENWA 3T5AA 3UG7A 1OYVA 2VDQB 4BS9A 5KNBA 1SUCA 2YWBA 4YLGA 1WUYA 2NOAA 2PR7A 2P67A 3DZDA 5FWDA 3SDSA 2A5GA 5E3HA 1P5HA 5DEIA 4FILA 2V7XA 1ZGGA 2KLBA 1N0IA 2J4FA 1I3NA 3QH4A 3DTVD 4OMFG 4DYHA 2RHRA 4AJIA 1E3DA 1E3QA 1Q11A 3NPAA 3SEAA 5DTQA 5K6AA 3FLBA 3GFGA 4NNPA 4DT1A 3B8HA 3CTPA 4I1UA 5AXCA 4EG3A 5JQGF 4FWTA 4LWQA 3TNJA 4MYTA 1W2WB 3N28A 4G23A 4RK6A 5HQJA 4BQOA 2HHLA 3VDNB 5I47A 1Y63A 5H9VA 1JAIA 3E1SA 4QG3A 3GFSA 3TLKA 2P9QA 4L02A 2ENWA 1X13A 2OV8A 1P60A 1L5FA 5CHYA 3UHJA 3I2JA 5CFZA 4QTXA 4HRVA 5KMGB 1WXEA 2R6CA 3ZYCA 4UNPA 1IULA 2VVTA 4M87A 5AW9A 3DQQA 1ZNWA 1Q7GA 1ZH2A 2K2QB 3E7XA 1V7ZA 4QGHA 4TTRA 1T1JA 1Z3IX 2C9ZA 3OZBA 4HUJA 1MVNA 4L7VA 5I7HA 1EVQA 3UC5A 3RPEA 2I1LA 1LSOA 5EUMA 5JXGA 2LXNA 3Q3CA 1DEXA 4Q18A 5CM2Z 4A03A 1MPTA 1YGYA 2ZE7A 2GBPA 2R85A 5HTKA 3QELB 2QAGC 4HEA1 5EFZA 3LP5A 1R4MA 2D7CA 3TLEA 1B8PA 4RGVA 5A0TA 2OD2A 1KVUA 5HRCA 2FOLA 3EVFA 2PSJA 3AKEA 1KC3A 1X7ZA 2IP4A 4Q3NA 1VIMA 2OYRA 1EFPB 1CETA 1DRUA 1ADFA 3CCBA 3H6KA 4I6JA 2Q2VA 1L7QA 2LE0A 2P40A 2ROQA 3DFIA 3NGLA 4MQUA 1D2AA 3GJ8A 2J3JA 4F5WA 4X92A 3CIFA 1YL5A 4ZQHA 5BWNA 3N2KB 3F97A 2WVHA 4QYWA 3TUIC 4INZA 3OLVA 3FX2A 4S05A 1V0JA 2M2IA 1MQSA 1RXEA 3K5HA 3AI2A 3G5UA 3R40A 5EIWA 5AOAA 5FOWA 4DJ5X 2R60A 4KQKA 4GI2A 3U48A 3OPQA 5JPDA 2Q4RA 1QDEA 1ZK3A 4MO2A 3H99A 2ZSHA 2ONYA 3K8YA 5TMDA 2SCUA 1MA3A 4F6RB 5LOVF 1YFLA 1E3IA 2F3RA 5IFLA 1GN8A 3OOSA 4HSEA 4YRCA 5GOTA 4ENTA 3Q5EA 3HZRA 3MGBA 5FUXA 3LL4A 2VJMB 3VTZA 2P7HA 4MRNA 4A2QA 1AKRA 3F4LA 4CE6A 3RAPR 2ZBFA 3GLHB 1DFGA 2JB9A 3AW9A 2ZI5A 4QBIA 5ALOA 3RIMA 1EUDB 3DQPA 4LMBA 3HZOA 2F8TA 4Q15A 3PQ7A 4JQZA 1B74A 3GFVA 2H06A 1UIMA 1K7YA 2HNBA 4F12A 3W5BA 2ZBRA 2VTVA 1NBMA 2OFXA 2QEQA 5IBPA 2WT4A 2XOKA 3EJ6A 1LTHR 4M2LA 3EG9B 4MUJA 3EDYA 3HKCA 3IDSA 4GGOA 3LX4A 3PFBA 4H1VA 1USVA 4OB6A 4UVHA 1TX4B 3F6CA 3T3GA 3DEAA 3FYUA 5C8VA 1LA2A 1VL8A 1UEXC 2D0PB 2I65A 1H6DA 2RH4A 2JFGA 4DQ0A 1HLPA 2OTCA 3QEMA 3PKJA 3M70A 2LDBA 4LA4A 3LH5A 5HE9A 3QX9A 4FB4A 4U3JA 3ROEA 1PJAA 2AR0A 4Y1GA 2VH2A 3GV0A 3RTDA 3FYCA 4E4RA 3I1YA 3VOTA 2AW3A 3OJEA 2P69A 3N0XA 1XNJA 3OPVA 1J9ZA 4MS3B 4G0ZA 4CNQA 1LGYA 3UKJA 5F1YA 5ECGC 1XQXA 2NTJA 1QR2A 3TINA 2JGNA 3F5DA 4MGEA 4COKA 4RTLA 4RFSA 5CB4B 3TG2A 4RL4A 5ES4B 2QNBA 1M8PA 1PJ3A 3OMXA 3SF8A 3COJA 2VT3A 5EJ7A 2C4VA 2BTOA 4CDMA 3TRHA 3E7WA 4L5BA 1DELA 3OFVA 4C7OB 4YXWD 4P86A 3KE8A 1THTA 3ZWCA 3P9PA 3MLEA 3PRYA 4XWTA 1YL6A 2XQGA 3JQCA 1MO5A 4F92B 4FHZA 2J59A 2HWXA 3GZJA 2VF8A 3TCXB 2CLFB 3PQ8A 5DHUA 2ZBPA 5DYTA 1LPOA 4F9GA 3ZIDA 1P31A 2Z5GA 3MPUA 3U26A 1HDRA 2JIPA 2QTCA 2O8BB 3IOBA 1SK8A 2FPRA 2NU9A 1QVZA 2IWRA 1NVEA 4UU8A 3QPCA 2J6HA 3RSHA 2FI1A 2IVZA 3NAZA 5JTTA 2ZT7A 4B1FA 5TF4A 3TSOA 4B6FA 4D81A 2A9VA 4EW3A 2CMHA 1J4AA 1H0RA 3PFNA 2Y77A 3S2SA 2VQSA 4INAA 5DTIA 1BDJA 3B52X 3KV1A 1LSSA 5EKUA 1KE1A 2GNPA 3F6YA 3I12A 1E0AA 1M2HA 2E4UA 3FPKA 3LC1O 5AVKA 2V7EA 1J97A 3L8YA 2C1ZA 4M98A 1VE7A 3CJQA 2G1AA 4RQAA 4XOIA 4G84A 2VNSA 1H6AA 2X0DA 1YS2X 3CXUA 1ABFA 2ST1A 3HLTA 3P2KA 1GM5A 2I71A 4KTTE 5IC6A 4YRNA 2HD4A 1YI8A 4L51A 4R9RA 4KUHA 3TQOA 5I9SA 1A4RA 4RUKA 1I5RA 2ACWA 1P33A 1KIMA 3PCTA 4HGRA 4JJIA 2R6FA 4BEVA 2WTUA 2P2SA 2BMWA 2W42A 1GNTA 3C8HA 1NIJA 1EK5A 3CNLA 3HUTA 4NAVA 2GXAA 4D0GA 5HUJA 1F38A 2GHIA 1GPJA 3IEMA 3M81A 1I3LA 4EZIA 2BJHA 2IZ1A 4L8YA 1Z2NX 2AG6A 2JFVA 3K09A 3TDKA 4P3PA 1G64A 2YCBA 4D4LA 1S2NA 4W9MC 2Y1LA 4NJOA 1NYRA 1AH2A 1G8HA 4ITUA 4K0RA 2R5NA 2OQVA 4NCXA 2F3TA 1NBEA 3NHJA 3RTGA 5C37A 1OXKB 3JR7A 4BQIA 3OQNA 3GDFA 2CXRA 4PZ0A 5CR9A 1H1TA 5HQTA 1ZI9A 2CL6X 1CSEE 1IQUA 1J5XA 2N1MA 4KLAA 5DXAA 2CHEA 1BQ4A 2BFAA 5JQGB 4V1CA 1P29A 3OCZA 3CPHA 2G6BA 1I80A 1Q1BA 5DYYA 5CEEA 4AI6A 1IB0A 1TGYA 4BB0A 3K16A 5GM1A 5I45A 3ADOA 5FPTA 4I36A 1TKRA 3AX6A 2VTBA 4WINA 3GJRA 3PS9A 2E6KA 5H82A 1GZDA 3HFRA 2IKSA 3F47A 2F3QA 2JK0A 5FKJA 3VZBA 3L0PA 4IZHA 3TLYA 4DR7B 5FUBA 3ORYA 2P9FA 4MQ5A 2A4MA 5C1PA 1YXMA 5C4MA 1CQJA 2VDWB 3THRA 5IT9A 2AUTA 2PUWA 4BQPA 5EGSA 4IF4A 2R8OA 4L50A 4MRPA 3VSCA 1AOXA 1JEQA 5TMPA 5BSMA 1XZLA 3JSXA 3NTRA 1NXWA 2Y0PA 4BZXA 5IT0A 4RPIA 4HKTA 2DKFA 3NRBA 3HZHA 1ZNQO 2Z6AA 4IOKA 1FUKA 3HRIA 2CV2A 3GGCA 3WV4A 4DJDC 1QYRA 1T1EA 2OZLB 3EUAA 4PLFA 4H7JA 1JMYA 2QB5A 3K05A 3AR3A 3CM0A 3FXAA 4IJMA 4YMLA 1TYEB 2I6GA 3PHJA 1E9EA 2WHPB 1SUSA 1FNCA 2WT8A 3GRZA 4NCIA 2CVHA 3UKOA 1IXYA 3UW1A 4JL6A 4ARSA 2Q27A 2WUVA 3AINA 2Y67A 3D8TA 4RZ3A 1W9MA 3Q1LA 2QMOA 1WMEA 3IE0A 2WOOA 3VGJA 4ZMRA 3HJAA 5DEOA 2NV2B 1TVKA 5BR4A 5ENDA 4PIMA 1B43A 5JT1A 4LKOA 1BNCA 3OZXA 2PH5A 2XQJA 1TFUA 3TQFA 4BAGA 1E3WA 3N2NA 1J7JA 4DHWA 1UBUS 3GELA 3FFBA 2PX0A 3G5MA 3OD5A 5TGDA 3K70D 3DR3A 1OBFO 3CVJA 4U2CA 3GLHE 1K0FA 2BFEA 4Q7KA 3HKEB 3M83A 4AKIA 1EE1A 3W7VA 1X7HA 4ZQCB 3OZ7A 3NWOA 4N5HX 3QKSA 1BKDR 4OHCA 1Y89A 4S2UA 1SG9A 2NUBA 2Q3JA 1XQVA 5HG0A 5DI3B 1N4DA 4ZI3A 1PNTA 3JD0A 4EUKA 1EQ2A 2ZVPX 1E9BA 3TS1A 2RHBA 4CUZA 1NZJA 3Q8KA 4XSVA 5GIOE 3ILHA 3EOBI 1YTLA 3PRKE 5JAPA 4D9MA 1BA3A 4INJA 2H1LA 3W6ZA 1P80A 2XADA 4I7EA 4KYUA 3ZY5A 2CFCA 1DHRA 2I7TA 3CUWA 1M83A 5EZYA 1GNSA 3ETCA 3K9CA 4G37A 4MA0A 4JI3B 3U7GA 3AFHA 2C5FA 4ND5A 2J08A 2DZDA 4U7JA 3REQB 2GPYA 5IDVA 4A6XA 1HG0A 1IVYA 2XODA 1MN6A 1PT7A 1CIJA 1RMYA 2DJ5A 1K7FB 4B3GA 1N2CA 4G8JA 4ALKA 4CKWB 3AIOA 4FD2A 4NESA 4KR2A 4IFIA 4P0TA 3O3CA 1SAYA 2DGDA 4GBGA 5H8WA 3LCJA 3B38A 4DIDA 1FDIA 5DNCA 3PITA 4KBFA 3AJRA 4JLUA 4BFWA 2PBFA 4AIRA 4RTQA 3OT4A 1RWVA 4LDZA 2RGWA 2PTGA 3HB7A 3O5AA 4FHGA 2RHOA 3AY7A 2IHNA 2VZLA 1G0NA 2JGIA 3O1JC 2RHGB 3VOBA 2P3SA 2X40A 4ESHA 1CV2A 3N2EA 4C7JA 4DWVA 2ZYHA 2JBAB 4BO1A 2XXJA 3O1HB 4J3NA 2OC9A 1QO7A 5J3JA 2RH8A 3CURA 2WKPA 5IT4A 3AP3A 3DNMA 3DHNA 3I8SA 4NMWA 4OXNA 1HLFA 3NWBA 1V37A 1KSFX 4XLTA 4CCWA 1X15A 1CHNA 4KR7A 3BREA 4CZ2A 3OZCA 4UU1A 5H70A 1FDVA 1JRLA 4TKZA 1MTOA 1HT3A 4MPJA 2H57A 3LZDA 3TPFA 3D6AA 3F1LA 3OURA 2YHAA 3T99A 2DHRA 2I8CA 1SVWA 4NBNA 2DT5A 3R3ZA 1O94C 3DLBA 2JGAA 1SU4A 3G8YA 2COKA 2YJZA 5CG2A 4N0EA 3G2IA 2AEEA 3ZWKA 2Z58A 5A5DA 4FOLA 4GEKA 2JJ2D 1DWUA 1SBNE 3AEUB 3LO5A 4Q19A 3CNEA 5IHPA 1FSPA 2XE4A 4UPDA 2XGGA 1X92A 1OD6A 4P5DA 4FC6A 5DYIA 3K32A 4ACBA 2WPDA 2H00A 2L17A 2ACVA 4QICA 1C1YA 1K08A 1TPZA 1USIA 2XI4A 3B1VA 3IBSA 4FJ2A 4OJTA 3WP1B 1I8TA 1PLJA 1US8B 1ZD2P 1LDGA 1YZLA 2WFLB 3K94A 1CJVC 3GAZA 2O1WA 4Y9RA 3UMMA 1D0VA 1H8ED 1Z47A 2AR7A 4KPGA 4KWHA 5B53A 1FYFA 1KYVA 2HLPA 2QIPA 3HSSA 3LT2A 3C7KA 4TKUB 4BIIA 3W8RA 4CQJA 4L9WA 4PZUA 1UZUA 4PO1A 5HILA 1I10A 1LW6E 5TF0A 4B3CA 4YJKA 3UK2A 2WZDA 1PS0A 3SLRA 3V1UA 4EPXA 3E8XA 3FUXA 2QT9A 1P91A 1XL1A 1JXAA 3TQSA 2NPOA 1O6BA 1E9CA 1EM8A 2XGOA 3H3XA 5DBIA 3PZBA 2IHBA 1KQ3A 2CLKB 1JAXA 1YBFA 4L3WA 4PTLA 3AZQA 1QPGA 1U5BA 5EE9A 5TQ2B 4EATA 1L4FA 2QZPA 5JJKA 3B20A 1QF6A 2JGLA 1ORTA 2PTHA 3BH6A 3MIZA 4JGGA 4UPVA 4KFSA 1NE2A 1REQB 5EUQB 1DKOA 2WI8A 4OH1A 2OXTA 3VBEA 3MT0A 3W77A 1QZZA 1RRVA 1YAJA 1XVLA 2IPXA 4UDNA 1LH0A 1PJLA 3MTEA 3QWAA 3AP1A 2NTEA 2EU8A 1QTNA 4JITA 4NEHB 3PQEA 4BMCA 1MUUA 3ICVA 1PT9A 3K9WA 4O33A 2J0UA 2QQ0A 1D6MA 4EENA 3BIJA 1DBWA 1PVVA 2JL1A 2YWFA 3DAHA 2LWIA 3VR4A 4LFBB 1GAWA 1NZDA 2DYKA 1XYVA 3GQBB 1OA1A 3H2HA 2VP9A 4U7TB 4BJ3A 1NW7A 4J29A 1WVGA 2CMDA 3DBHB 4EY5A 4F60A 2XWSA 2FLVA 1GCUA 3K0AA 1AS2A 2O8NA 2QLTA 4TT3D 1KEKA 5UKDA 3INNA 3PLNA 3KLPX 2QSJA 4OQ4A 4EARA 4O4JA 2NQ8A 1YIDA 2WYOA 2XX3A 1GTL1 1A2QA 4RSGA 3LQ2A 2WWRA 3VU9B 1WXQA 2NADA 4WK2B 5F78A 4AL4A 2D59A 5BT8A 2R5WA 1WR8A 1E9FA 3FHCB 1M2JA 2BRUC 1E9DA 1OGJA 1VLJA 2A2ZA 1ZU5A 1Y81A 4NG4A 1EGAA 1Y37A 3ZD8A 2HZBA 4DLXA 4YO8A 3FPBA 2ZIXA 5FR1A 1T5OA 4MUYA 4C7VA 3U0BA 4MW0A 1IBCA 1N9ZA 3RBXA 1MV5A 4RQBA 1JL3A 3IVCA 2YZNA 1G17A 1XAJA 4NYIQ 1GUZA 4MCHA 4WH0A 1WZ2A 1B26A 2PJDA 4QEKA 2OHOA 1OE0A 3SYTA 4DEYA 1EEHA 5IT5A 5BNIA 2HHCA 4F38A 3ANXA 2YHIB 4JYCA 2HR1A 4BNVA 1ZQ9A 1BGXT 3Q9SA 2R1UA 4DMKA 1QO9A 1TK9A 1Z28A 2R6GA 2VKQA 1ONNA 1TGVA 3KZKA 2IOFK 2I6FA 3GFOA 2FUG6 3IPCA 3PICA 1D2EA 4FDUA 4PLTA 1W2GA 4XCVA 1CVLA 4A0QA 1H2HA 2HSWA 1VLLA 1CY0A 4OQDA 3TLMA 1JKJA 1DAHA 3QWHA 4AF7A 1BMDA 1DOAA 3AKZA 2GEFA 3BWBA 1RYBA 2BI7A 5COQA 4FFNA 4PAGA 3H2KA 4YTEA 1D09A 1RR6A 2CZGA 3RHZA 3W2HA 3EZ9A 3UXMA 4MUHA 2W4IA 3Q7TA 4A82A 4KOEC 5AM2A 3ZZMA 4Q4HB 3HSYA 1D07A 5BSHA 3JD4A 2UYGA 4ENUA 1W36B 3ISTA 4IBOA 3TSWA 3QKIA 2HRDA 3W5IA 3H5LA 2KWIA 3MXOA 1APBA 2C5LA 3D4BA 5FNVB 4DJEC 4XWAA 4ZVRA 3I58A 3SR3A 4QATA 3VZDA 4X6UA 1ODKA 5JAIA 3KJQA 1LXCA 4J3JA 4P7GA 1SC9A 2WWVD 3A05A 2RHJA 3M5DA 4IXWA 5EHZA 4DUZB 2BFOA 2MINB 2ZGVA 4KZKA 1YRQA 3NJ4A 1ODIA 3IPRA 4YP1A 1FS5A 2JFXA 3E4CA 4XYBA 1YQEA 3GT0A 4GX1A 4B6GA 3QX3A 2G08A 3IUSA 3TOCA 3L0OA 1N7IA 3NIDB 1U1DA 4HLUC 4IV0A 5LZ9A 3OQBA 3FOZA 4YLEA 3ZWYA 4H1WA 3EOZA 2H9AA 2HJHA 1YNOA 3GZTB 2IDKA 3LDFA 5H7XA 3ROXA 4FYVA 2VNAA 3NNSA 3ZDFA 1ZVVA 3Q7SA 3QJYA 1X14A 4YXWA 4L4YA 2I6UA 2ZBUA 5I5GA 4OHZA 5J1SB 1V1MB 3ZVKA 1YJ5A 5EZ6B 4A6PA 3GIWA 2PFGA 2B4RO 1II0A 1JKFA 1QSGA 2NQ2C 1XAHA 4H7DA 1ECBA 1Z0DA 4H7PA 5B1HA 3ZH9B 4TYWA 1AU9A 2R1TA 4A6EA 1L6IA 3MGGA 5B2EA 3H05A 5HQ3A 4TMYA 3M2TA 4OSEA 4XWKA 2RGXA 3AOEA 4I1YA 1JPVA 1XGKA 1I0ZA 4YYZA 4BQQA 1P2SA 3M3DA 1UMCB 3Q7QA 3WYAA 2QIOA 5D84A 4MGYR 1Z4OA 2GMWA 4OMDA 2W6QA 3A1SA 2GB4A 1E18A 1K6IA 1ZAKA 2PLNA 3R3WA 4GI3A 4JODA 4H4CA 2Z3ZA 2IF0A 1U0JA 1XQ1A 1U0GA 1LRJA 2V7QA 1OPRA 3EPPA 4BNTA 2X1MA 4EQ6A 3HDYA 4MO9A 1CZNA 2NT3A 5EJFA 2Q62A 2RC6A 5ALPA 4ASUD 1H9CA 3K9HA 4H7HA 3LLVA 1QONA 4QOSA 4EABA 4N5NA 3VDXA 2GH1A 4WBXC 5FUWA 2VAMA 5IULC 4Q37A 2RB4A 1NM5A 5JD3A 2ES4A 3LKBA 4J0GA 4PZLA 5EEGA 2O8DB 1SIUA 5FRDA 4JFAA 1DNPA 3SYNA 3TR5A 4RIGA 9LDTA 3WSVA 5JASA 5AUQA 1NN1A 1AKUA 1OLUA 2J3EA 1QJ4A 3JZFA 2KS6A 4QUGA 3W78A 4C4RA 1EM6A 1PN3A 2ECFA 4PNEA 3HXQA 3H9GA 2BUAA 1T24A 3HI6A 4GRAA 3A70A 4HGQA 4QT4A 5D8DA 5FUMA 1K06A 3CT6A 4WNYA 3K1ZA 3P0JA 3UJDA 1DFIA 2WWXA 2Z43A 4MJ3A 2ADMA 4UASA 2PWYA 5AW3A 1YDFA 4YT8A 3UUWA 3BTSA 1GTRA 1R3DA 1RRPA 4DUGA 4JNCA 4QYSA 5FI3A 5HFNA 2Y9PB 3U7IA 4QSHA 4DLRA 3T9EA 2PS1A 1H3NA 4E2ZA 1E1CB 1R16A 2XUPA 5KVSA 1Y3BE 1K2VN 3I04M 4I9UA 2FCRA 3EQ7A 1F6BA 4TWRA 1VG8A 4XYGA 5TXGA 1NBAA 2JIMA 2CN1A 5KUTA 1EEXB 3LA6A 1A8PA 3AEXA 4MRVA 3L3BA 4RVDA 1TCUA 4C3ZA 1XO1A 4R2HA 1XTPA 3IOYA 2IYWA 2HTFA 1K1EA 2IX9A 4ITVA 5DOVA 5HF8A 2AS0A 1EB8A 1WCIB 1U6JA 2CB0A 4YRJA 4BLOA 4L1KA 1U9YA 2AQ8A 3SBDA 2XTNA 4C22A 5B6IA 1M9NA 3SY8A 2H5IA 3WA6A 1TE2A 3BOSA 3AR4A 2CCKA 3U3DA 4JZKA 1COWD 1XZBA 3FKJA 3UHOA 2QTMA 4CQNA 4LBYA 5E6UB 2QE6A 3H8JA 4ZI5A 2I99A 3L7IA 2G67A 5KYUA 2PFKA 3UMFA 2JCVA 4FD3A 1OI2A 1I51A 1PJRA 2PLWA 4MIEA 1PE0A 1QDUA 3S55A 1Z0ZA 3WLRA 4EY3A 4KRFA 3UGTA 4QEZA 1YE5A 4ER0A 3ZV5A 3AEKB 1WJGA 3QZUA 2C96A 2FX2A 4FBMA 3TVTA 4H7IA 3FMIA 1ZFNA 5BO5A 1P2UA 1COZA 4BO8A 3E9YA 4CHTA 4GX5A 3RRFA 1FUIA 4JYBA 3D3KA 4BB5A 3OZEA 4M76B 1K4MA 1BA2A 4ZARA 1I1HA 1NT4A 221PA 3LS2A 2WWGA 3M0EA 1MOQA 3I4LA 4LDRA 1WHSA 3N8KA 3WLFA 3R9IA 2HSZA 3DR5A 4UVIA 1B6TA 4NOMA 1ZH0A 1CJMA 2YY6A 3OBBA 3VSBA 4OM7A 1U2ZA 2JEOA 1UQRA 1VL2A 4NR0A 4Q93A 2NZYA 4QECA 4Y18A 2Z0MA 1SURA 3SX2A 5IARA 4WN9B 6REQA 3PVCA 2EG5A 2H2GA 2PUVA 3HKDA 4X90A 4AKSA 4E88A 2QUHA 3I2KA 3OE7D 4I99A 4EJ2A 4X62B 2Q1SA 4UEWA 3GDGA 1JDUA 4P35A 2ZUDA 4KR9A 4AZ3A 1RAHA 4TWIA 4UPEA 4BE4A 1WUKS 1PTJA 1SGWA 2VUSA 1HV8A 3EEOA 1ZJWA 3PHGA 1N2XA 1O8BA 2X9NA 1NBIA 3HHEA 5IAEA 1DO8A 4RA6B 5DX8A 5BWMA 4XWYA 1EA5A 5KJFA 3AHGA 3NUZA 1ZD3A 1V8ZA 1WRBA 2AFRA 2AFIA 1C5KA 2WTMA 2HDWA 4M1WA 5G4KB 1ES9A 3NO4A 2DWCA 2JFOA 2HA0A 4FTWA 3SWWA 1NJ5A 4WDRA 1E7WA 3U31A 5H83A 5MN4A 2IYYA 4BNWA 1ZOPA 3EPJA 1M1NB 1QYVA 3KKEA 3NBKA 1MJHA 2RCYA 3E0XA 2JLYA 4OYHA 1TM7E 4KPEC 1GAQA 3ON5A 4FUQA 4HWTA 2BFFB 5DRTA 3E5HA 2O8CB 1JSXA 1UMBB 3GLTA 3OAAA 2QNRA 1TJYA 4L72A 1E59A 3HY4A 3WL8A 5BVHA 5E8RA 1DIHA 3KLNA 2AUMA 1N1DA 3RRJA 1PGJA 3V2UA 3RVLA 2J30A 1OYWA 3AHEA 5EPUA 5DM1A 4RWZA 3DEYX 5HGXA 1PQWA 4CF3A 1KJWA 1P2BA 2VP3A 1TJ3A 3B6KA 1X8KA 3RJZA 4BUZA 3U19A 1U7HA 1GYQA 2QAGA 1SQSA 3BRCA 2QPAA 3MELA 2FN4A 4I6EA 4LRXA 4TXNA 3PHCA 3L84A 4FK8A 5BQFA 4PWZA 4GICA 2YN2A 4LZOA 2W2MA 4OUKX 1QH0A 3LXUX 3IJPA 4IOJA 2G8LA 5B2ZA 1DEKA 1JFFA 1V5IA 3T7TA 1JPUA 3V4OA 4OUDB 2J87A 1CYEA 3LUBA 5BT9A 1G6HA 1NVUQ 1BC5A 5ILGA 5CB0A 3IVXA 4ZV9A 3DO8A 4O2BA 3GEDA 2X9VA 3OOEA 5CM9C 4UHHA 3VC3A 4KO8A 3H4VA 1I7DA 1UDCA 1Z4IA 4YRAA 2W6OA 1KGSA 1LX7A 1UJ5A 2BW0A 2JHCA 4OFBA 3LCRA 3H3FA 4P92A 2ZUBA 1HPLA 4QO7A 5I5EA 1E0DA 1SBTA 1GFIA 3EFBA 3EC2A 1ZHFA 4WMLA 3W2TA 1TUIA 3CZAA 3HC7A 2Q9BA 2VRCA 1R2QA 3QPUA 3ABIA 1Q22A 3JD2A 4G63A 4DEXA 4YPVA 4R8RA 3THYB 1DRJA 3ROKA 1J2TA 1IAVA 2X6TA 1IOZA 2JF0A 2QLJA 4IDBA 2AYXA 2XNHA 4CU2A 4KQXA 8MHTA 3QF4A 3D43A 1RQRA 4HCJA 4R5HA 4YJGB 4DIFA 4MUFA 2OZPA 1TYBE 2BKAA 4YPFA 5J58A 1G20E 3C6BA 5FWXB 5MHTA 4LRUA 4Z9BA 1BMQA 1G5TA 1RWXA 4BMDA 5CLFA 4ZI7F 4YJDA 3I32A 4J3FA 4NV0A 5KAPA 3JWHA 5A04A 5CA1F 1QNFA 2TMGA 2P9TA 7ABPA 3QSYA 3WMFA 1FVOA 5ENZA 3GUYA 4PPYA 5CA0A 4C08A 2UYOA 4Q9NA 4LXXA 2WSMA 1D4OA 2D1TA 3UUFA 4MQFB 1RYDA 1UBJS 2JJQA 3P9SA 3E3NA 1NOIA 3H97A 3KXIA 4MKIA 4DY4A 1GRCA 5F23A 2R4TA 1AQ6A 1CUZA 2FRXA 1BAPA 4HNVA 3T8YA 2DR2A 3KR1A 1C9MA 3A6JA 3TLGA 1WA5A 2ZYRA 3MN1A 1D2NA 1WVMA 2CHQA 3BWEA 5BYAA 5EMMA 5JYCA 2SHKA 3VX3A 4OX9Y 1SXIA 2WM9B 2Q9CA 4I6GA 1YBHA 2YBDA 1PK8A 1VMKA 1DJMA 4X8HA 2IV3A 3RV4A 3W8EA 1UBGA 1CEQA 3DOJA 3NOXA 4MI3A 5DHFA 4CCYA 2IXEA 4DY6A 3HM9A 2BCJQ 1F0PA 2FZ4A 1UBNA 4P54A 4C7KA 1W2HA 1QHXA 2Q2WA 3FPHA 1ZKMA 3RGGA 2NT4A 3ZNNA 4B3DA 3F90A 3E48A 1ZINA 2NO0A 2YXLA 3FR8A 3GHHA 4N3CA 2NO4A 4B0PA 5AW7A 2BGMA 2RJOA 4ZV4A 2ZYGA 3NM6B 3THYA 4OSOA 2WF8A 4L9SA 4KHZA 2GRUA 2XYGA 2VAVA 1LD3A 1UDRA 4RPGA 2FUEA 1SPBS 3CPJB 3ASVA 3G5TA 1G4HA 3GRFA 3R3VA 1AKVA 1VZ2A 6LDHA 3DAOA 3GU3A 1CULC 2VXOA 3AOGA 3RRYA 3C98A 4LX0A 5B2FA 3FOAA 5FULA 2WAMA 5C52B 3CIOA 2Q1UA 1QQ7A 3MHPA 4B17A 4KBYA 1V16B 2NYRA 3GLGB 3B70A 1RYYA 5CNKA 1FLDA 1T36B 1U80A 2G9UA 3N70A 3PFCA 4L2IA 4D45A 3JARB 1HBJA 1T15A 1C4XA 3DZFA 2EKLA 4H0NA 5IVIA 4NZOA 1OAOA 4JKOA 3EMDA 3VR0A 4A8JC 4F2WA 4QUIA 1G8PA 5G3YA 2PZKA 4FIZA 3JVEA 4M9ZA 4PIVA 3O3OB 4V39A 4F86A 2FEAA 3TSYA 1WSAA 1KH1A 5TPZA 3IA2A 1YZVA 3VU3A 4MJLA 4Z99A 3KO8A 5FNVF 1KWKA 3WL7A 3WG9A 4AICA 3BSYA 1LKZA 1D04A 1X77A 2VRBA 5DZSA 3OTHA 5JADA 4XVHA 2XMDA 3G9QA 2O0LA 5ESWA 2GYVA 1XPOA 1CY7A 1PIWA 1R8XA 5FBZA 4AAYA 3B12A 3FDZA 3KBBA 2V98A 1A2KC 3FCOA 5GP1A 4TZ0A 1XYGA 1ITZA 4CL8A 5K0TA 2DETA 5EIAA 1Y8RB 3DE5X 1MAWA 4LPKA 4ALJA 2WA1A 5CVDA 4B5LA 1OC2A 4QU0A 3D2AA 3WRVA 5JJLA 2G9QA 3QIAA 3BGDA 4OAPA 4HDRB 4CMJA 2WV9A 4Y6GB 4CCAA 1ZRSA 2IITA 2ZAMA 3C16C 4J9UE 1ISGA 1AS0A 1D6JA 1W1UA 2CHVA 2WUDA 2ZB4A 3OCYA 4E46A 1WDKA 5KC9A 3GLIA 1CD5A 2QK4A 2YQZA 4JCOA 3WIVA 4TXJA 2ZI3A 5IABA 2HYIC 1E9RA 3GD5A 3M9LA 3VSEA 1EKXA 1WV0A 2UVPB 4EQ6B 1T5HX 4KQEA 3K31A 2AMVA 2IOQA 3AETA 3IYLW 3GUVA 3LDHA 4OTZA 2O14A 2P2CA 3R5XA 1GQOA 5FTJA 3RSLA 5C5DA 1SHLA 2RHTA 3G2HA 2AN1A 3QXSA 1T8TA 3GRAA 4HTAA 4LHZA 4F9FA 3AVVA 3AJDA 1QFJA 5KYYB 2E55A 2REOA 3CZ9A 1ICEA 2HF9A 4QXPA 5A71A 3QVSA 5B7QA 3KOUA 1UKEA 1SOUA 3JQ8A 1TQ2A 4HD8A 4K86A 3BQMB 2NXJA 1XZNA 1CS4C 1S3GA 2OGUA 3DV0B 1BDMA 3KQQA 5M3BA 5DXFA 4W5QA 3W4KA 3QYAA 4KQIA 2GZRA 3LFUA 2PSFA 1WHSB 3D7NA 5IYZB 3CW9A 4QZVA 2XRFA 3F78A 4HPXB 1VHJA 1P17A 4JVNA 3AF3A 3D5TA 1ZUNB 3CUVA 1DG3A 2F9LA 3KWJA 1X9GA 3E4DA 5KCZA 1AKYA 1GL9B 1Q3TA 1SQGA 1WZUA 4DM4A 1J24A 1NVGA 1E6EA 2O2XA 3KQUA 5KX5A 3E22A 5DBEX 3AI7A 3JAKA 1N0UA 4RM3A 4TWBA 1RSZA 2OZLA 2XOKD 3HVJA 3NX4A 4RCVA 4MJXA 1J7KA 1RXCA 2WF6A 4N0QA 3J80A 2PKQO 3D8HA 4PSVA 2XT9A 2IUYA 1Y1PA 2NUAB 4WXEA 4HDSA 4JKYA 3VPGA 2KBFA 4X3CA 5MN5A 3PEEA 4PO8A 4KN9S 4R2LA 4ENRA 3R5JA 4IPTA 4LNUB 1XCOA 2MR5A 1E7RA 2SBTA 4EECA 3A9TA 4B4OA 3F8SA 1QQBA 1RQXA 2NSJA 1TF2A 4BATA 4GOMD 1U4OA 3SZRA 1DOHA 4G4SO 1XV5A 3IMEA 2Y99A 4NEQA 4PS1A 4YDRA 5DWVA 4JROA 3G2NA 5AK4A 1TC2A 4XR4A 5WRFA 1IB6A 3H13A 3Q6MA 3ER9A 1G19A 4URUR 2BGNA 3SQNA 3DLAA 3SG0A 1C0LA 1ESEA 4P82A 4DC0A 3WSWA 3GLQA 4KXMA 4MLPA 2PRZA 1E9VA 4OLBA 3O1IC 4U7PB 4G5FA 2HQBA 1V1RB 3C3DA 4LJYA 4EW6A 1Y82A 5DKFA 3EPKA 1F3LA 3GJ3A 4K3UA 1EK0A 1KIAA 3C8MA 3X1WA 4V2UA 1OI7A 4FKMA 4EVSA 2AK2A 1HDCA 1XVUA 2KHZA 4R1NA 1LTKA 1HDYA 2YIDA 3BA6A 4II3A 1MAUA 1PDWA 2LRHA 3H5RA 3PFWO 3TRJA 4ZI7A 2XUAA 3H1AA 1KYXA 1T0JB 4XGQA 4Z0NA 4BO6A 2X6RA 2PM8A 2UZAA 2IV7A 4Z54A 1RCFA 1LBTA 5CGZA 5G0SA 4KO4S 5IZCA 3WMRA 4DLVA 1XROA 3FUTA 3NTOA 1WNFA 4FM9A 3FUWA 1MX5A 5CXXA 3FH0A 5CVEA 3QLJA 3WGJA 4H6VA 1JDBB 1TM1E 1L5RA 3DZIA 4WCVA 5CHEA 4RGBA 5ALSA 3F3YA 1GPUA 1VJCA 1NQTA 2CHUA 1VIDA 3HJNA 3O0TA 4KO3S 3IB3A 4ZIRB 1BMFA 1KL7A 3HCCA 3AETB 3IQXA 5HS6A 1GSOA 5TJ9A 1S2DA 5FFNA 1UM8A 2EX1A 4A7PA 3IP3A 3PTZA 3RLFA 3VH4A 2QPTA 4BNMA 1VL0A 1XTUA 5L3VA 4QU5A 2Q6OA 2R11A 3C5CA 3OM8A 4JSRA 4XYMA 3BCRA 3MCZA 3ZDXB 4EOGA 1HNZB 4BYGA 1TO2E 3ND6A 2X77A 4LY6A 3EGEA 4Z53A 1NBOA 1JNYA 2I2CA 2YXBA 3K4PA 3AOEC 3ITKA 4QPPA 2JGRA 2ID8A 2OSBA 3D4PA 3OOWA 4MQ6A 1C7QA 4QVKA 3TMAA 4BO2A 1PV2A 3DFZA 2H48A 3ZHTA 3TIIA 4ZQIA 4AJOA 4PGMA 4K9LA 3RB8A 1E2GA 1YB2A 2PZBA 2B6NA 3QG5A 1TECE 4ZVQA 5JSQA 4JOSA 3Q6NA 4WERA 1BCSB 3T06B 1REQA 3ZZNA 2A1IA 5A3VA 4QYIA 1XF9A 2P2YA 3W0LB 5CNMA 4D98A 5LQRA 3C43A 1YDWA 2GUWA 1LDBA 1RXVA 1KPGA 1BTOA 1XRQA 1F17A 1ZMRA 2I4LA 3MCVA 4QAQA 2OOSA 3VTFA 4RGQA 2BH2A 4X7PA 1FJHA 4GPTA 4N5MA 4HB3A 4P3XA 1T34A 3DC2A 4JUCA 5DCWA 3SZUA 1GA1A 4JQSA 3WZMA 3ZY6A 5JNTA 1HT0A 3LDUA 4NENB 1DIRA 4BYMA 1CUXA 1DO0A 4PXYA 5DRYA 3RTAA 1WSBA 5A9TA 4PLCA 2QUBA 2VC2B 1Z7YA 1A7JA 2LR0A 4LOJA 3UYLA 2C5HA 2A57A 3AU9A 2LGJA 4MVCA 5FPYA 3SC2B 3TTYA 5I4CA 1VZ3A 3C3KA 2R48A 2GASA 2VDUE 5JCZA 3AUKA 1RYFA 2FX3A 1Z5OA 5CEFA 4X7RA 1QU2A 5J4YA 5F76A 1M10A 5FBLB 1RZRA 4V0MA 4HRYA 3FCEA 4ZZ1A 2CC2A 4DR2B 5JHHB 3NH9A 4EYOA 2JLSA 2BEJA 3DE1X 5BV1A 4GVXA 4MAMA 3GUZA 2XYPA 2ZJ1A 3WK6A 4IX9A 2CD9A 3NANA 4Q4HA 2QRUA 5E4FA 2Q5JA 2XA2A 5JO9A 3WDKA 2Q7XA 4JEUA 2LVBA 4I1PA 4J43A 4B2YA 2Q6LA 4HGYA 3ZHOA 1UQTA 4CMGA 4CKEB 2GYUA 3DDUA 2VK2A 4QXOA 2FHPA 3B6EA 2RGRA 4LVOA 1O5IA 2XCRB 4BMPB 4HX2A 1ZQ1A 1NVBA 1T4CB 1KZHA 4A27A 3CGWA 2I4MA 4ZGGA 1CZHA 2HEIA 4TL6A 2XBUA 4XDZA 4JZYA 3TLGB 2OVFA 4U9IS 2W2XA 1BFDA 2PLAA 5DK6A 1EDEA 1T4GA 3WLOA 1X1QA 3QOXA 3QU7A 4UTRA 5CEJA 3PDIB 4B7XA 3IQGX 3QEJA 1KZ1A 4QUJA 5AKGA 3NYIA 2FRVA 2XOXA 4C0WA 3FWNA 1IN6A 1QAOA 1SXJB 4Y6PA 2G83A 3FFWA 3DEFA 2WJPA 1HURA 5FA5A 3SBOA 2ZULA 3D3EA 4LE2A 3VR5A 2EBUA 3X0DA 3B51X 1ATZA 5TVKA 5I7SA 2PBRA 4N8EA 3ZGZA 4FFVA 3Q41A 3OSZA 5IVKA 1S3FA 3PB3A 1J0EA 2V0NA 3TFOA 3I5XA 5FQOA 4QLOA 2OMKA 4OXQA 3PF9A 4ONEA 5ECWA 1LK5A 1X7YB 4TLLB 3RYFA 5M7EA 2R751 4MW6A 5LUBA 3CLSC 2HCBA 3NHFA 1K7XB 2Q41A 4C14A 4JP2A 5BN4B 4LK2A 1AB5A 2QPOA 3AUYA 4UUBA 1DDGA 2QSYA 1GU1A 2IL1A 2WMDA 1YB1A 2ZTVA 3NU1A 1TMYA 4L4SA 5IVHA 1X7DA 1YR3A 2XYHA 2YFYA 4DCMA 4I4LA 4YAEA 4CHGA 1GEEA 4FS3A 2NU7B 4BC1A 2CK3D 10MHA 2A3NA 3I6YA 2ECOA 4JI7B 2IE8A 3EPRA 3MS4A 1TK3A 4YRDA 2JGFA 1USKA 2O3SA 3HWSA 4IIUA 5JMPA 3ZHCA 2FPIA 4D3XA 1UZNA 3LQQA 2A6PA 3P9XA 4HNHA 2HFJA 3QGMA 3FWZA 4RDXA 3UV7A 1I2AA 3VYRB 3KKKA 2W2LD 2V7PA 2VQ3A 2X2FA 3KZCA 4U3JB 3TGLA 2DAPA 5B37A 1Y5NA 1CERA 2FK7A 5A3RA 1AKNA 2Z2YA 3H6GA 3HU5A 3VKUA 2YYZA 2VA9A 2FPXA 1WXDA 4MI9A 4UUAA 4EB6A 4U2EA 1NOJA 4M1SA 4BQRA 4I50B 1YZGA 4XKJA 4NI5A 2OILA 1U0RA 2H3EA 2ZJ8A 4HN4B 4Q3BA 1WE2A 4MKZA 5EJMA 2JFWA 2XNSA 3B60A 5C9ZA 3IEVA 2VDMB 5G2OA 3RVNA 4WSOA 3ZDQA 1PFWA 1UP7A 1ZMTA 4K6FA 4B9EA 4LFAB 2UUOA 2HO4A 4Y2SA 3RH0A 1P2DA 1GGHA 1JI3A 1CUHA 3NHSA 1G5PA 1K4KA 4K6GA 2WILA 4LBWA 1MRZA 2J0VA 1ZCFA 1JFFB 3O9ZA 3ELUA 2IYXA 2WYUA 4GR4A 4Q1DA 4RPLA 3RYIA 3IXQA 3ZV6A 4F4HA 3ZD6A 2CY0A 3OE5A 2EJWA 2DPMA 2WZCA 1VPDA 3U37A 2YOGA 4DBVO 3D7RA 3BILA 4LTDA 4GFDA 2RGYA 2XTJA 3AM5A 1IY2A 1NULA 4H16A 1DGQA 5H0IA 3S6JA 1QGUB 4R3NA 1E7MA 3IR5A 2I3ZA 1TT5A 1VYHA 2ZSUA 1WG8A 4GNKA 1Y0BA 4AJ4A 4IEIA 2ZTMA 1GUFA 5CK5A 2N0SA 5AKJA 1JT2A 2VK4A 2LTAA 3NUQA 4MITA 4MIKA 5EE0A 1LS1A 1E96A 4GLOA 2WIJA 3SC6A 3QJ5A 1EP9A 5EP4A 2G0NA 2YJ5A 1JYFA 4TL7A 2DFNA 3EWNA 4OP3A 5ALQA 3OZWA 5I9BA 4RCYA 1L3CA 1VI2A 4JJAA 4ARZA 5TY0A 1DBPA 3MD0A 4ENVA 4GUDA 1XDUA 1R5NA 1A77A 4JP5A 3A06A 2N42A 2JGEA 3W4IA 2JAUA 3A4MA 3H9BA 5CFRA 4V2IA 2HQSA 4PICA 5AVRA 3HKBB 1ZCJA 3M34A 3SZMA 1ODCA 1O95C 4Z0TA 5LSAA 1JHRA 4NBLA 4QYMA 3KB2A 1NJ1A 1U3TA 5J9FA 1YUBA 4GIBA 2Z9BA 3GARA 3LIIA 5AKEA 1QPZA 1GPMA 3IULA 4EHDA 2VBFA 3OZFA 2YL2A 4I4NA 1TEHA 2IK8A 4C3UA 1RACA 1ZH4A 1RIIA 3U40A 1N0HA 3B53X 2Q5LA 1KZ6A 2SKCA 3A10A 5BN3B 4LDNA 5IWCA 5J47A 1SCQA 1YS4A 5EIOA 3UK0A 1SKMA 1EFAA 5KIAA 2F1IA 1A8UA 1NXPA 3BDVA 3BJZA 1RHJA 3H8VA 4RGYA 4Y2JA 5CTJA 1DLJA 1JYSA 3C39A 4MV4A 4W7HA 3HV0A 2QTVA 4C05A 5KC8A 2P7IA 1KORA 2ZVDA 1JALA 3VKGA 2QLMA 1WKVA 2ZUTA 4IYJA 2MSCB 2QVYX 5EYPB 4BMSA 3ONEA 4I3HA 4HX5A 1XK7A 4UHCA 4W1PA 3H4IA 4OHXA 3OIDA 1FTNA 1PVDA 1WABA 3B3GA 3LWBA 1G59A 4AQDA 2VHTA 1M2KA 2JA1A 5P21A 1AHPA 1C3EA 1PEKE 1F06A 3PGVA 4IWXA 1EB9A 4JVMA 5DLEA 1DAEA 4WBNA 1L4EA 2JGMA 3B2NA 5J1TB 4CKEA 1XTTA 2H08A 5CA0F 4GZ6A 1EINA 4R2IA 4NOJA 5I4BA 1XDDA 1LZKA 1MQ8B 2XTMA 4GSLA 3LUAA 4DABA 5JDIC 3R3JA 3IDZA 4MHOA 3LY5A 1IY8A 1OF1A 2AC2A 5EPOA 5LYYA 3TNFA 2GEDA 1Q19A 4HAUA 1NDQA 4QXMA 1U31A 2VSYA 1Y98A 1ODLA 3CEJA 4JA0A 4OK6A 4PYMA 4XGKA 1ZJYA 4WACA 1DV2A 2N1BA 2AKYA 3O4HA 4MWOA 2Z1DA 2P5SA 4BFLA 4F72A 5JAOA 3WLJA 3DHWC 3DZBA 3LPLA 5EJIA 2BGWA 3F3SA 1UOOA 1SVSA 4WOBA 4X20B 5KNDH 4HADA 3HCFA 4C5CA 3KDPA 3PJRA 2WYWA 1PWZA 1AHNA 1CRWG 4CKCB 1GL7A 3OCUA 3ZQ4A 1JHPA 4NJEB 4WADA 2JRCA 5KVAA 5IEJA 1UPXA 1QC5B 5AESA 3KQPA 4GR9A 4IGFA 4KV9A 3ZCRA 1L0BA 4FMDB 3DLHA 1UC5B 3JARA 4KB5A 3ZCXA 4WCFA 1YQWA 3R7LA 2D06A 3P2IA 2G9VA 4JLKA 1UKBA 1OGYA 3HJUA 2VAXA 4O2BF 3E3MA 1RYEA 1KZ9A 2XA9A 4HH4A 4NSNA 5AIAA 1PWXA 1K89A 2WSYB 4JQYA 4NCJA 4YREA 2DHQA 1KI1A 1PWEA 1W48A 3OM0A 3JQ8B 5EXEA 1VLVA 4ZEWA 2FF7A 2PMWB 3K9BA 1B0AA 1GKKA 3HM2A 4HQFA 5A3QA 4MDYA 1OCEA 4Q9JA 4L78A 4YDHB 2NO6A 2BZSA 4TV8F 1RPTA 5L4NA 2R4UA 5K3CA 1E94E 2R8ZA 2XUGA 3A1EA 4ND8A 4ZT4A 1OLSB 2GRJA 1NF3A 3OQ6A 1XLTC 2JI8A 3CYFA 1P6XA 4YRKA 1E4VA 4GXTA 2I62A 1C3JA 4AWAA 3NIGB 2VDRB 1OI3A 3BCHA 1U3WA 4N18A 5FF9A 3TJRA 4QPDA 3EFHA 5FOUA 4BGEA 2H2HA 3WFIA 3WGOA 2IYZA 2C2BA 1HM5A 2VBIA 1QOZA 2A30A 2XQFA 1Q12A 2WUWE 4J1QA 5E38A 3SZ3A 2YV4A 4ZCPA 3OTIA 4FFLA 3PXEA 1KWGA 2HBQA 4FE3A 1BWQA 3P94A 4RBNA 1JH9A 2I3GA 4YAUA 2EWWA 2XUJA 2B25A 5LZ4A 5AHKA 4N3NA 3WAJA 3DONA 2XKKA 5JAZA 2FWJA 4FCCA 1HYGA 1EDOA 3V8MA 2FFJA 2WB4A 3F5MA 4Y1RA 3ER6A 5A3SA 4BLVA 4K7JA 1CUDA 1GNQA 3HYTA 1YJXA 1FFHA 4G4JA 3FGPA 2OEPA 4D0SA 1XXLA 1FP6A 1JEOA 1DUSA 1D8AA 3ED5A 3FTNA 1YCGA 3EPLA 4ABYA 5T8KC 1Z63A 1T9KA 5FUVA 3QEKA 1QHNA 1IJEA 1STOA 1TO6A 1M2VB 3WLSA 4RACA 1NBHA 4OSPA 4QDXA 4AK9A 1EIWA 4BVFA 1PR1A 2ILVA 3FWYA 1HH4A 2E49A 1C4KA 2VSNA 2TMDA 4AKHA 1KJJA 4LG1A 1XVIA 2GLUA 4IGEA 5CP8A 2CE2X 4ZHSA 4RTRA 2O2IA 2OO5C 4ZCSA 1IFXA 1ORVA 5EMJA 1KO5A 3VHQA 2HK6A 3HADA 1Y5RA 3PG5A 3QUBA 3CE6A 3ORSA 5I01A 3SE7A 1UFVA 5AJWA 5DLDA 5A5GA 1VI5A 2H51A 5KJCA 4I4TF 5EMHA 3WGMA 4DLZA 2DVMA 2Z8YM 3QI7A 5ALTA 1XTRA 5DHTA 3WWDA 5KYWB 1J21A 3A4YA 1XJQA 3Q9UA 3V2GA 1S0UA 2GKGA 5KJEA 4ZAWA 4FC7A 4GZ3A 1CQWA 5I7AA 3MS7A 1HMPA 1SVKA 1V47A 1TADA 4FCTA 2XSZA 1YIOA 3BMXA 3HYSA 1V25A 4JJ6A 4PIPA 5JYBA 3OQOA 2J5KA 4ZOCA 1DTSA 2I9PA 4UM8B 1AZLA 4YAFA 1IUOA 1MX9A 2BL4A 1BWRA 3GP5A 3WLPA 4M54A 2Y6VA 2RGDA 1ONBA 1TT7A 3NBFA 3TB4A 3AERB 3R9WA 2ZS7A 3PKIA 1TAGA 1MQAA 2NZVG 1XSEA 1XUOA 1FX1A 4JP8A 1DRWA 1M54A 1JS1X 3WLLA 1NMYA 4DAOA 1PL8A 4I50A 4LSZA 4YB8A 2GS9A 1R88A 3PXBA 4ZQEA 4XRGA 3L4BC 2QMHA 3DYBA 4ICIA 1CJUC 1OGIA 2X9QA 3ABZA 4EPWA 5TMBA 4I5EA 3UYKA 3RVDA 3TMKA 4CIDA 2ZYUX 3GLRA 1ANKA 1KJIA 3PR1A 121PA 1CP3A 3L1IA 4DREA 1AQNA 4PHGA 5KNLA 1GO2A 2GTIA 4IDFA 3UAZA 1RDFA 3V8NA 1TK2A 2IEAA 3ACDA 1DC4A 1H8HD 1LK7A 3DH0A 2Q8NA 2HC9A 3G6KA 4FFBA 4KRGA 4Y9UA 3RS9A 3IBYA 2IEIA 4UMDA 4ENPA 1PG0A 1QKJA 3TZCA 1FMJA 5BQXA 2VYFA 2Y1OA 1JBKA 1N9KA 4HV4A 4HAWA 5C3MA 1SC6A 3AWDA 3JQBC 4JB8A 1LPBB 1XPRA 3HE3A 5HP4A 4DANA 4EBFA 3AF1A 3VNBA 1RZRD 2W22A 3K20A 4REQA 3KTOA 3EE6A 5DBFA 4BO9A 5ABPA 5M5BA 1S3IA 2FMFA 3BD6A 4ZQBA 4HATA 2WU1A 2NU7A 3PE4A 2E1PA 4FOTA 4ZVNA 3W7AA 4XA8A 2XZOA 3ESYA 4RNCA 2EQBA 2NUPB 4TV9B 5H3HA 2QQEA 3R7WB 5IAAA 1YCDA 4U2FA 4PZPA 1IC6A 4JEIA 1SZPA 5BN5B 1RQNA 2G5CA 3FRJA 3EXEB 4ZOBA 4CKZA 1PD1A 3VOSA 1MV8A 1V6AA 3IMKA 1CY2A 1WPRA 3H2SA 1VE3A 4M60A 4D1YA 4QKQA 3R6LA 1FVXA 2PT9A 5JD4A 4JJKA 2H2WA 2PGOA 2ZYVX 3KL4A 3ZZ1A 4MCJA 4DF3A 4E30A 3CVVA 2B7CA 2QP9X 1EVLA 1O4WA 1Z4QA 3F4KA 1FU8A 4DCSA 4EGFA 3L4KA 4DG8A 4B5KA 3LC7O 1G41A 1FB5A 4HWGA 4CDGA 3OIWA 1U0LA 3GPBA 2CB9A 4QIHA 4B2PA 5LPNA 4OHUA 1GTJ1 3WDLA 2A9RA 5KNCA 4GHWA 1P9LA 4CGZA 1AS3A 3H2YA 4IQGA 2OECA 4ILKA 3O4IA 1P74A 3BWVA 2ZBDA 3DE0X 3VO2A 1ETUA 2VYCA 3MB5A 1NW6A 1YACA 4WLNA 5SICE 1F0KA 1M1XB 1K8YB 2IDZA 1YI0A 3WQHA 4RL6A 1DCTA 1AJEA 1W35A 3OPXA 5I4KA 1I6LA 4QDUA 1YUMA 4H7FA 3GI1A 1J06A 4GPZA 3STUA 1IJFA 2QJRA 4LI3X 5J5CA 3OIYA 2DQYA 1V8DA 3KTAB 1H3FA 1FFSA 3THXB 2X0IA 1WLSA 3BF8A 3ESRA 3GJYA 3RWBA 2OP0A 3K73O 1A72A 4NBVA 1OXXK 1NMEA 3SJAA 1X2EA 2MYNA 1PYOA 1QO0A 3OCWA 4MWEA 2F1OA 4A23A 1NMXA 1UODA 3Q0IA 5F9HA 1JF8A 4ARVA 3G8BA 4LE0A 3F7TA 1Z12A 3MOSA 2ZZKA 1MRNA 1C1DA 1FA9A 2BFEB 1OVGA 4TXLA 5EPEA 2VSOA 4HLQB 4RK4A 3PHIA 2IIPA 3CINA 2E7ZA 3H9QA 3ZHRA 1DMRA 2XJ4A 3G49A 4XFJA 1TQ8A 5BSUA 1KP3A 2XAAA 3TGWA 3EC7A 4FQ7A 3H0CA 1D4FA 3HB9A 5EA2A 3AERA 1RLIA 1EP3B 3H42B 1X9IA 2B4AA 2P62A 2DCUA 3LKZA 3NEAA 5EN4A 3CO0S 2BHSA 1M72A 2AX3A 1LFAA 5M29A 2A67A 2IDJA 4HPJB 3TIFA 5ITZB 4YACA 3LUKA 2FCAA 1L8AA 2BFCA 4EGQA 1KVSA 1EX6A 4BGDA 4UZSA 3O8OB 3DDCA 1U8YA 3IGFA 3LX8A 1CFJA 2CXHA 3INYA 4XX0A 2CE7A 4ZANA 1O4VA 3ROQA 1B8OA 2V7GA 2QR3A 2GJSA 3GW8A 5BQ5A 4G8DA 5INTA 1SKAA 2YVKA 4GOKA 2WAOA 4Y8VA 5JS6A 2UDPA 3A2KA 1NUUA 4GMDA 4ZCTA 2GZ3A 3T0FA 1PZHA 2NYAA 3AF4A 1UM9A 3V8PA 1FDTA 4FYYA 2HMSA 5D86A 4YUVA 5JI2E 3DMYA 4P6VF 4ZIRA 1AUQA 2FYTA 1FP4A 1U28A 4Q1AA 2B8WA 1C8KA 2ISQA 3OJ0A 3WGIA 4FE4A 5DHQA 5FWXA 2FPSA 5BRJA 4NIMA 5KJ1A 1THGA 4G89A 4CIBA 3JATA 2YS7A 3U39A 5KOIA 3GEPA 5L7YA 3IQFA 3MD9A 4JI1B 5HPYB 2VJQA 4BQEA 4GXQA 4IDAA 1E60A 1SPXA 3BFKA 4AJ2A 4G5RA 3DLTA 2HDHA 4AT1A 5D6NA 4HDAA 3TNDA 4GWLA 3AEKA 3Q7EA 1YQTA 4LHVA 4YS6A 1XQ6A 3FJOA 5IZ4A 4D9IA 1XJCA 5BYKA 1E4EA 3RVJA 5L3SA 1YCHA 1XZGA 3B78A 3LTEA 3DFUA 3KWMA 5JSFA 3I9OA 2WTNA 3EW9A 2NU6B 4GZ5A 1O58A 1R66A 3DE3X 3KSMA 3ZLUA 1MAHA 3SI7A 1A4UA 4B9AA 3BQ9A 4ILEA 4QFCA 5AT1A 4ZEXA 4C4YA 2BMEA 2DC1A 2C2OA 2PWZA 4O4HF 4PAWA 3F4BA 1HE2A 2EKDA 3VNRA 4URVR 3AJ9A 1KPIA 4QBGB 2FSHA 3B7WA 4PQRA 4RKFA 4UNNA 2I3AA 4LCEA 2MMGA 3ZJTA 5CJ2A 2AD5A 1L4MA 2LBPA 1DKQA 4PYIA 2QRLA 5EC8A 3PNOA 2LNDA 1O96B 1IK4A 1UM9B 4DIUA 4V0QA 1L7BA 2PGDA 3VMMA 2X5XA 3MCAA 4N65A 4NZZA 3UJCA 4CIAA 2BRUA 4WV3A 1WW3A 2N3ZA 1CDOA 4BUCA 2RGEA 4K6HA 3W2GA 4LE1A 1EAMA 2QRGA 621PA 1OASA 1EUCA 3PQFA 2R86A 3RFUA 1N3BA 5LB4A 3DMPA 2I76A 2IQIA 1WU7A 3KJFA 3ENWA 3NNDA 1RQGA 2QORA 3O83A 4J76A 1RRCA 4D0NA 1Z62A 3AR5A 2HN9A 2WR8A 5HCUA 3UMSA 4DCOA 5AVXA 4M0FA 1QBGA 1L5HB 3EZYA 4QRHA 5HIIA 3VYVA 3ZIUA 1XWWA 5A06A 3C7TA 1R0CA 3SVLA 4UTXA 1GQ2A 3G6WA 1QHHA 2V4MA 2G76A 1XRRA 2W00A 1ZM3A 4RKEA 1XK6A 1TAUA 2GK4A 5FORA 3ZBPA 5COAA 3EIOA 5U1PA 1BEUB 2L18A 4FW8A 1Y8QB 1ZN7A 4FZRA 4L6CA 1F1BA 4B2IA 2GEBA 3SN6A 4CR8A 1SCNE 4FSHA 4PHCA 3GEMA 1DOZA 4DWJA 1KY3A 5AVJA 3TOXA 5B4UA 1A1VA 3OD1A 5AHRA 3DMHA 4RHUA 5BMVB 1DQNA 2CK3A 1NUTA 2GYYA 2HHJA 2OO3A 1XI2A 2Y27A 4M9UA 3L8HA 1V4VA 1G5QA 1H22A 2DOKA 3CKMA 3HGMA 3KJGA 4O63O 4A4DA 3OEED 3QKSB 4J75A 4KQJA 1M2FA 4DV0B 3T4PA 4KQGA 2NAPA 4XD2A 3GLVA 3P96A 5ICEA 3DF7A 1IHUA 2MMCA 2H31A 3TQCA 1UBLS 3GA0A 3QWIA 4YROA 3O4FA 5JSUA 3M5CA 2R1TB 2XNKA 4I5FA 1RKQA 3OEHA 5CT8A 4HUTA 1GCOA 1IM2A 5HUQA 1AZTA 2M6LA 2W70A 4FXOA 4BGIA 1BD3A 3A1NA 2BF4A 1WULS 4G0PA 2EEPA 2Y1EA 3GAMA 4HNRA 4II2A 5ALWA 2DUMA 3DZGA 6GPBA 4XIJA 4MHSA 2P2GA 4M7RA 4ZALA 4DMGA 2NW6A 4YC7A 1B42A 1TD9A 3WR5A 3DZKA 5BSEA 1LI4A 4DVGA 3O8DA 4J8PA 3WA7A 4I19A 1YT5A 4LWPA 3EQ8A 1RJ9B 3LCCA 2WHPA 3I05A 3FFXA 2QS9A 4LTMA 2YVAA 4D3FA 3CA8A 4TLBA 3JYLA 3NBYC 3RNOA 5KYNA 2RHDA 1PT5A 3RS0A 3RUIA 4XQ9A 1P9RA 5JDCC 4R71A 5LJLA 3GRKA 4JU9A 1R8QA 2ONKA 3BB3A 2D5LA 1CIPA 4IY1A 2CXQA 3HVIA 3OMLA 2Z2IA 4IH4A 2AHRA 4PZCA 2O8BA 4YALA 1W94A 2QOEA 5HRAA 4Z9FA 1HETA 2PSSA 3LLSA 2B92A 4XIGS 5ALMA 2LZ0A 5LM3A 2WPDD 3UB3A 3WNVA 3KEGA 3S8MA 3BICA 3O8QA 4JLDA 5L3ZA 1AVTA 1M2WA 3BCUA 4RIIA 4CIYA 4NONA 1IK6A 1ZGHA 2GN0A 2NVOA 1OHHD 3BWCA 5EY5B 3UANA 4BO4A 4DIEA 1BCRA 4U2KA 5JDCA 1X39A 4JY7A 1TA4A 3KZVA 4UHDA 4QQKA 3IAS6 1UKAA 4I4TB 2NU6A 4F9TA 4ROSA 4YJGA 4E6EA 2J9FB 4A2CA 4YT4A 4RF3A 4HT3B 4U02A 4ALLA 1L4NA 4WXPA 2H18A 1CUFA 4OK5A 2J6IA 2HLHA 4FLMA 4LUCA 3T9DA 4MKFA 1ZMOA 1AB6A 1M34E 2R47A 2QLNA 5KYXB 1DFHA 1O08A 1ZM7A 4OHFA 3F71A 3FVVA 2F1RA 2V96A 1WQ3A 2Q45A 3LOPA 4QXAA 4ZFNA 2OG2A 1OHHA 1KYQA 5CLHA 3T9AA 3BWXA 1PFQA 3BL5A 4Q82A 4X7MA 1W5AA 3GRUA 1XZAA 1U28C 4D44A 1AGPA 3JRXA 1JBEA 3L2OB 4COOA 1J0AA 3L1JA 2Z6QA 3K96A 4ZCLA 5B7NA 2AXPA 2AZDA 4HQLA 4ISBA 1UBOS 3RIXA 3T5DA 4BAUA 3O2SB 2X1HA 1H2XA 2ZUEA 1O6FA 3E03A 2W6MA 4UE2A 5JROA 3BK1A 1FP4B 1M75A 3VZRA 3FNQA 2RD2A 1Z0KA 3U44A 3EC1A 2G5PA 5KINB 4EO7A 2IYFA 1Q77A 4KC0A 4E7PA 5B7GA 3KETA 1VSUA 2VQDA 3ZLVA 4BNXA 5LIPA 4BY9E 2W6ID 3CLTC 1N2CE 1Z5NA 2GAOA 1W73A 2CCJA 3B1WA 2OESA 5E95A 2JEZA 1W5FA 4EHLA 1RHRA 4XGNA 1E0KA 2VRNA 4HP8A 2FWRA 2GEUA 1XMSA 2YDYA 3EXHB 3IPAA 3SQOA 5B30A 4HWSA 4MRSA 4X71A 3NM4A 5KSPA 1VHDA 3C7AA 3JCZA 1EFKA 2I29A 5FWNA 1OTYA 1H5UA 5DT9A 3FOEC 1XDGA 2WSIA 1HE8B 3BMQB 5F9MA 4BLSA 2A0YA 3ZWXA 4EO4A 4YUXA 2AVNA 4UJ3A 2O8VA 3R8CA 5K6RA 1ND6A 4JB3A 4RXMA 3HBMA 2Q8PA 4YMVA 4ER5A 1SZJG 1WB5A 2P6OA 3BG5A 4L28A 3UUGA 4BLWA 7GPBA 1WOMA 5D2CA 3TB6A 3D7MA 5FI5A 1Y5LA 4UKDA 1H69A 4RVHA 2UXBB 4EYQA 4ZO8A 1CY6A 4EH1A 1SRRA 2BUBA 5IP5A 3O21A 5A4AA 1CJSA 1AX9A 1SU6A 4BZQA 1Q0ZA 3MRXA 2HA5A 4AS1A 4FYWA 2NIPA 3COPA 5LOVA 1Z39A 5HMMA 4DAEA 2C77A 3FDJA 2ORVA 4XD7D 3D5QA 1WKBA 2HREA 4E1BA 3LCUA 2DT8A 1FFAA 1PCXA 1QHFA 3ER8A 1C7RA 1AO0A 1M2NA 4X94A 1MIOA 3LHKA 1JG1A 5FCDA 2G71A 4AG5A 2EYQA 4BQFA 1EG2A 1FTYA 2D0IA 2C4NA 1QP0A 2QSZA 2PWBA 1L8OA 1NX6A 3BEOA 3LOUA 5LQMA 3MERA 5IVPA 2RGCA 4ML3A 3JS5A 1WCXA 1I4LD 3N7TA 4Q1EA 4TUYF 3RRNA 2P0EA 5CFLA 1SELA 3KJIA 5AM0A 1PWHA 2MJLA 4QU8A 2CVOA 5AWFC 5JS2A 5I7WA 3RUPA 2Q5QA 1U3CA 4LAFA 3CR3C 1ZD9A 4A10A 5MGBA 4UTNA 1QQ6A 3P5SA 3K71B 3VXKA 1DC3A 3ISVA 1KS2A 3V6MA 2AE2A 5F33A 2WWHA 4PE5B 1ZKDA 3GA7A 1QH8A 1WDWB 2DECA 2EARA 2OV1A 4UHJA 5DW3A 4DSNA 1ECCA 1QNLA 5TARA 3T61A 1N2SA 1EGMB 2JA2A 3PJFA 5ICFA 4QULA 1VG1A 1A9TA 1YE8A 2LV8A 4C4XA 4DIBA 3ORFA 1E20A 4MCAA 1NNLA 4NZMA 5GOZA 1MXFA 3UB4A 1RU3A 1NDHA 4NX2A 4OYRA 4YRIA 1VQ1A 1XVVA 4QHSA 4ROTA 4PG4A 3NHAA 2JHFA 4AXBA 2HWKA 1ZM9A 3FE2A 1KJZA 4MXDA 1EVJA 2D2FA 4RETA 1BJTA 1WP4A 1OXUA 5B4VA 1DLIA 3BGVA 2WNSA 3F46A 3ABSB 4X6XA 3ADBA 4ZDIA 1N8TA 1C81A 3KBOA 2PPLA 3GT7A 6PFKA 2SCUB 1U9CA 2ZUCA 4EL5A 1VJ0A 4MW5A 3PUJA 3FSJX 2QTGA 4U2DA 3NZEA 4FNGA 3EFEA 2I6TA 2ZFUA 5JNRA 4M6WB 1U3UA 3Q3JB 2I1VB 1OILA 1E8MA 3NEYA 1LV8A 1I94B 1LJUA 4BVKA 3T34A 4FEEA 2V74B 1AQYA 1X2BA 3IS3A 4N8DA 2P5YA 1Z75A 1AHHA 2VTBB 3LVFO 3OEHD 4C1NA 2WNIA 1MCZA 1VKZA 3MVEA 3PYXA 4N7MA 5EQTA 4FGWA 3MWLA 2Z2JA 5T5QA 1V4NA 3TXXA 1XYYA 1GU7A 2FMUA 1TJPB 2HA6A 2O3TA 2Z6VA 2VHZA 4QHYA 2WWFA 3QU4A 4JOQA 3DEJA 4G2TA 4DMLA 4ARUA 1ADBA 2QJTA 1Y3CE 1GGFA 2X3FA 3EIEA 5JJIA 1E2MA 2WAYA 4YI5A 4BRZA 4JAVC 4FVTA 3FN4A 4B46A 1I30A 4UHBA 5B1SA 1VC2A 3U60B 3R6DA 3DS8A 3WGUA 3IALA 5KNBH 3O4VA 1IAQA 3I3SR 1RI5A 4NYMQ 1PD0A 4LGMA 1TVMA 2ZWAA 2OK7A 3LAWA 3MTJA 1GHTA 3ONFA 4UUOA 4G0UA 3KB8A 1P5JA 5KMGA 1HY3A 1V5GA 2B1QA 3ONDA 3AUAA 4CKWA 4RULA 5EWJB 1D9XA 3PR2B 1SKYB 2BHRA 3O2NA 2V3WA 4KUEA 1DQYA 1E1LA 2IUTA 1KI9A 1K8XB 2OHVA 3TPZA 2HF2A 4MUAA 1CY1A 2C2XA 3I0ZA 1OIXA 1HEYA 2O8DA 1WCYA 2C4UA 4MRAA 2VZ8A