5FLXA

Mammalian 40s hcv-ires complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
LDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 47
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
A PF16122 40S_SA_C 40S ribosomal protein SA C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5flxA01
3HJBA 1G98A 1IBLB 2I2WA 1XNRB 2J6HA 1J5XA 1HR0B 4B3TB 4S1WA 4JI3B 4AMVA 1TK9A 3Q88A 4DV4B 4B3SB 2AMLA 3JAMA 4DV3B 2CB0A 4LF5B 2UXCB 3T1HB 2PGIA 1MOQA 3NBUA 2A3NA 3M5PA 3TBFA 3C3JA 5A2QA 3LJKA 4X65B 1VIVA 5BY2A 4LF9B 4TOIA 1VIMA 1X92A 3J81A 1VI6A 4LF4B 4LF7B 1N8TA 4DR1B 3HBAA 1JIQA 2UUCB 2VQEB 1C7QA 1N34B 1HNWB 1GZDA 1X94A 2CXUA 4LZJA 1M3SA 2PUTA 2PUVA 4JI1B 3UJHA 2HHHB 1HNXB 1J5EB 2F4VB 2O2CA 4JI7B 1C7RA 1N32B 1JXAA 1U0GA 1XNQB 2YVAA 4X62B 1IRIA 2XBLA 3OOJA 4JI4B 4JI0B 3PR3A 4OX9B 4S12A 3G68A 3CVJA 1HNZB 1XTBA 1ZZGA 3BJZA 4DV0B 4IVNA 4LF8B 4DUYB 2UXDB 4DUZB 2CXTA 4EM6A 4B3MB 4LFBB 1X9HA 2UXBB 3SHOA 1VI5A 4JI5B 4M0DA 4JI6B 4LFAB 5IT9A 1I94B 1WIWA 3EUAA 4X66B 1Q50A 2X3YA 5LL6P 1N36B 3J80A 4JI8B 2DECA 4LF6B 2CXRA 1IATA 3T1YB 1HOXA 2UUBB 2DF8A 3J7AC 1T10A 2CXSA 4DV2B 2UUAB 3IFSA 3FF1A 4DV1B 4GKJB 2CXNA 1DQRA 2E5FA 3OTOB 4U6NA 4DR4B 4DR3B 1X9IA 1U0EA 3FJ1A 1IBMB 1KOJA 1JEOA 1MORA 4DR6B 2I22A 4X64B 4JV5B 4GKKB 1N33B 4YY3B 2CXQA 4YHHB 2VF4X 2E5LB 2POCA 1HM5A 2XHZA 3FKJA 4DV6B 4NXNB 2VF5X 5FLXA 4DR5B 3ODPA 3TRJA 1FJGB 1B0ZA 3I0ZA 1NUHA 2PUWA 4DV5B 4KHPB 3KNZA 4DV7B 2CVPA 3Q7IA 4DR7B 2CXPA 4K0KB 1NRIA 1TZCA 3QKIA 4JYAB 4B3RB 1XMQB 3BCHA 1U0FA 2VQFB 3ETNA 4DR2B 4NXMB 3JX9A 1XMOB 1JLHA 3FXAA 1GZVA 5I01A 2ZJ3A 5LMUB 4JI2B 2CXOA 2V4MA 2ZJ4A 2Q8NA 2WU8A 1MOSA 2UU9B 2O2DA 2ZM6B 1TZBA 4LFCB 4AQYB 5LMNB 1IBKB 5BR8B 5IWAB
chains in the Genus database with same CATH superfamily
5LJLA 1EGVB 2V9CA 2P9HA 2Z6VA 3ABRB 5IDWA 2R00C 3P9CA 1EXDA 5HRUA 4XD2A 4Y6SA 2C9BA 1TK9A 3WMGA 4DBVO 4ZO9A 4M1MA 2ZT5A 3R0XA 4HAWA 2XB8A 2XXAA 1LGYA 3WG9A 1G21B 1NM5A 2DPHA 3ORHA 5G1NA 1Q1ZA 4AXXA 4BMPB 1W36B 3AEQB 2HRRA 2C99A 4HLQB 1T3GA 3I4LA 3KYBA 2HF8A 4XX1A 2IQIA 3VTAA 2ZR7A 1D1TA 2XKJE 3CLTD 5CH8A 4HNHA 4ZIRB 3I92A 4HJXA 4IS2A 5DULA 5DVZA 2V7QD 4FLFA 1JHVA 4PSDA 4G0WA 3QWHA 1YR8A 2ZKLA 3HJTA 3ZLTA 5LA6B 4YCJA 4TVSA 3CGGA 1ISHA 1Z8NA 2PUVA 3CR3C 3VR5H 4A6XA 1QV9A 4HAZA 3FLMA 4H3VA 3ETJA 3F5SA 4RZ3A 5DX0A 4UTPA 5A4KA 4ZCPA 2NZYA 1E2PA 2Q3BA 1A4UA 3QWIA 4OBXA 3QKSB 1AF7A 2IHBA 3PNQA 1W2WB 3LHKA 4HFNA 4PVCA 1U0BB 2QAGC 1ECLA 2C2HA 3DD5A 2ADOA 3NNSA 2J48A 4JXJA 3FMGA 1QJ4A 3BH6A 4R0NA 1ZMTA 4DV0B 3JRXA 2QRNA 4M8IA 3WHPA 4B3MB 4NY1A 4CV1A 5AM1A 3NBAA 4KQJA 3I9V1 2BUBA 2ZPUA 4TVBA 4BO4A 1OZGA 1R0XA 2O2EA 3VPAA 2BGGA 1VCNA 3I8OA 3OWHA 3EY4A 2C03A 4GOLD 3GJ8A 5JZSA 1ESZA 4HGPA 5DHAA 1TXGA 4D5EA 5I7AA 4UC0A 1F1BA 3NBKA 4DL9A 3VVMA 1QVWA 1U8TA 4GPD1 4WVLA 4P53A 2V96A 2YMLA 3GJ6A 2VP9A 3BFKA 3KB1A 3QX7A 2EW8A 4A1FA 5A5DA 3L6DA 4YONB 4P7FA 3OF3A 4FWTA 4HPJB 4RSMA 3UWKA 1CUJA 1KBQA 3WLAA 1PUXA 1H42A 2IHKA 2IIPA 3QOWA 1MORA 4JUIA 2FR8C 4K3UA 4YRLA 4E1VA 3I05A 4LNHA 4W7IA 4JQCA 4X8OA 4CNBA 1FP6A 1ZR4A 2EHJA 2I1LA 2V6FA 1E6UA 5DGCA 3GQBB 3D31A 3LBHA 4G65A 1O58A 3SK0A 5IDQA 5F1YA 2V1UA 4LQLA 1IPFA 2EGGA 5B3JC 5L40A 2BEKA 3RC3A 1JS1X 1OIXA 1SU7A 1VIYA 2PMDA 3H9CA 2JAHA 4MROA 4PC7A 3FW1A 4N40A 1RHQA 1G5PA 2XVZA 3TSCA 1GA6A 3RIYA 1O96B 3ZHZA 1FMFA 3PHBE 1BCSA 2JAUA 2JHFA 1EYZA 4WNAB 1N9GB 1FU7A 4RA6B 3S81A 2GK7A 4HS9A 5I9SA 3SEQA 1ZS9A 1E1RD 4MVYA 3RC8A 4TXHA 1NA5A 5J5CA 3Q6IA 4XEHA 3WL3A 2DM6A 1I2ZA 1YI1A 2Z2XA 4M0MA 3I1JA 3K53A 4IV5A 3TVDA 1KDTA 2OAEA 2DFNA 4HFRA 4R1PA 4BLRA 2A1IA 4RORA 5IUJC 3SDZA 1J5PA 3IAS6 3IA7A 2OXTA 1YVRA 1I7QB 2ISSD 2GN4A 4R1NA 2XRMA 5HPYB 4XCXA 1WV0A 1IK4A 3L7JA 4AO7A 2FRVA 3EQ8A 3P52A 4PC6A 3MTQA 5CLLA 1C4OA 3IQXA 2C8VA 3LX8A 2QUAA 1XELA 2XEDA 4M54A 3B70A 4MPRA 1FXSA 2P27A 3TTUA 3U3OA 2BFMA 2WWIA 4V1CB 1CD5A 4P86A 3TNYA 1P2GA 1Y9AA 1ZQ1A 3MTIA 4TV8B 4Q15A 3ER6A 1D07A 1RLTA 5FOSA 3VPGA 1LTQA 2F67A 4Q24A 2BCEA 1U6KA 5IK2A 4Z4IA 3Q4GA 2G1AA 2HBZA 3V8QA 2O8VA 1CR4A 2L19A 3K0SA 3QF4B 5DW0A 4BU0A 1T3ZA 1OFUX 2BGKA 2VQ3A 4J76A 4RE6A 3HL0A 1PFUA 3OTQA 4G5FA 4JLWA 5CDUA 3UMMA 3PA6A 1KAEA 3TO5A 2NXWA 1TI7A 5DGXA 2FU5C 4NYMQ 1R9NA 3JD1A 4OYYA 4PPGA 5P21A 3PRKE 4BVAA 2ZI6A 2ZITA 4I6EA 1AZTA 5GY7A 2PYDA 2Y1WA 5D85A 3GZNB 2OQVA 1PNRA 1U94A 2QS9A 4UPVA 5B12A 4JI4B 1U2DC 2FSHA 2JD2A 3OM0A 3PQ4A 1PQPA 4MGZR 1XMSA 4MIKA 2IUFA 4RNCA 3E9DA 1QAMA 4Z3DA 1BW9A 1Y4SA 1X1RA 1BU8A 4JC0A 1VPEA 2CWDA 2DBYA 4P83A 1MAWA 3TQSA 4XWOA 4TRMA 4IXDA 1ZU4A 5K8UA 1U7OA 4CHGA 4S1VA 1Y8AA 1M0WA 3T6KA 1DHRA 4M0DA 4RPJA 4EAAA 3MJRA 4IHKA 4AG6A 3HWWA 5KTMA 2F3PA 2XIQA 2WUVA 1F8YA 2VIIA 3RNOA 5JYBA 4BTLA 3HDYA 4G5QA 1DFGA 1CJUC 1EWVA 1Q11A 2G63A 4TRJA 1Z82A 2HSJA 2RSLA 2WAXA 3PCTA 3TBHA 4FOTA 3AUJB 4QM7A 3V4FA 4Q9AA 3JD4A 1KZ1A 1QUFA 3UOAB 4WKPA 2PM8A 3A1CA 3OCCA 1UQUA 4ILEA 4Q1CA 3W2IA 4IGKA 4PRZA 3IP6A 3KHUA 4PC2A 3CLSC 1JX6A 1XVVA 2J3JA 2WJVA 4QDUA 4ERNA 5A4AA 2XGOA 4OFZA 5EJ7A 3OZVA 4ZGBA 3VR4D 3QBEA 5CLFA 4DRXB 5DI3A 2CLMB 4D4KA 1S2LA 3QU9A 1DDOA 4Z8XA 1IM2A 1N2HA 2PQ6A 1B6SA 2DFDA 2BKUA 2ONJA 4OGLA 3L0YA 3OF2A 3INTA 3SX2A 1BQ4A 5LP6C 3UATA 1DCFA 4RFVA 5D3KA 3OJWA 5CEEA 1NKTA 2BT4A 4RHEA 4GGOA 3DTVD 1NRXA 3ZIDA 1N75A 1REQA 3QPUA 4B4UA 3PFWO 4KCGA 3VISA 1DT5A 1D2EA 3NHMA 1DJNA 3DKIA 5IBRA 5LB4A 3KKZA 4KDFA 1E2QA 3FB4A 3CLRD 1BTOA 3L1UA 3L8HA 3GLHB 3MJFA 3EG9A 4W5NA 2DWCA 2LR0A 1B93A 1ADFA 3N8HA 4OYLA 3D5QA 4OY3A 2OV2A 5D87A 3BZUA 4E4RA 3F8SA 5FB3A 4C4YA 1XMVA 4HB4A 4RK5A 3NBZC 5G0VA 1YMVA 3KQPA 5TC4A 3THSA 2PRYA 2OECA 4GFDA 5ADVA 1XNRB 2WTEA 2Q0SA 1G64A 4Y0AA 2AFHB 4I3HA 3PGJA 5EZ6B 3U3DA 1AX9A 1WD5A 2ZUFA 2GBGA 2GESA 3V46A 4EHFA 3LIPA 3LW8A 5LQJA 1UZMA 1S3GA 2YV2A 1MO3A 1FE8A 5D51S 3N2YA 3SM9A 4FDMA 2QLMA 1PFYA 1Z7YA 2GYYA 1QYXA 1R64A 2QNBA 3SEAA 1N7JA 2HTEA 4DG8A 5G1PA 3UJCA 3KR9A 2DY1A 3HNOA 5CT4A 4R40A 4OXQA 1D0VA 5BNFA 5AKJA 2XJ4A 3AETA 5CVJA 4M9QA 2WFAA 4YCBA 4UFPA 2HBYA 3R3JA 1PYOA 4WGGA 1M2OB 3PIDA 1D1QA 1Z6GA 3HCOA 3L9WA 5GPBA 3STTA 1CF2O 1EVZA 1HTTA 3FHLA 5KNCH 3RHZA 4DZTA 2OVFA 2IDJA 3GPDG 4Y6OA 1P4HA 3VNAA 1VG9B 2OR3A 3KUCA 4F2WA 4JLSA 2ODPA 1R6BX 2PUCA 2QX7A 2NMVA 1KVQA 1ZD1A 4QREA 2WSYB 4KGDA 1KZHA 1T6XA 3ZY5A 5KNBH 5EKSA 4OHYA 3WGJA 3GK3A 4NZPA 2X2OA 2ZT8A 3UFXA 2H4WA 3MELA 1YCHA 2EU8A 5DU2A 7GPBA 1NYRA 3ADDA 4PZZA 2CNBA 1V1RA 1CY8A 1ESEA 3ZXYA 3ZWBA 5FTMA 1IOZA 3KZ1E 3O75A 1YHNA 1XDDA 2OLJA 1L5HB 1GZ3A 3B7PA 3O1HB 5FA6A 4B48A 4EYGA 2AJLI 4HUTA 4X3CA 2YZMA 2ZRJA 1H4TA 3QSGA 2C7QA 1JVSA 3IUQA 1DTWA 4AJ4A 5F9HA 4BNJA 4J0JA 4N7BA 4NMXB 3ICCA 1E66A 3MMPA 3TD2A 2AMYA 2G5GX 2QROA 2XF8A 3IOMA 3HYSA 5B53A 5TVGA 1T2FA 3UEOA 3AESB 2CXRA 2ZBDA 3K8ZA 2I2FA 2Q4BA 3CN7A 3J7AC 3P45A 3TTTA 5CFNA 1S4QA 2BGRA 2JH3A 2O1EA 4LTMA 4NMLA 1ZXXA 5LYJA 3TSWA 2H2DA 1LSOA 1WSDA 4PZEA 3TI9A 4FSHA 2OB2A 1TIPA 2BFFA 3SP1A 4HNUA 4ARIA 3EMBA 2P6OA 3EXHC 3NT2A 3PQCA 4NHEA 4F9GA 4IHJF 3RK1A 3CSSA 1I4TD 3OFKA 1VHQA 1M34A 5BVHB 1DT3A 4FFLA 4LZWA 4TKMA 1KI3A 2VTKA 1TVKB 4TTJA 4AJNA 3EDCA 1AKRA 5BOSB 3D8UA 2P9QA 3RRMA 3O74A 3G2NA 5AD1A 5AW4A 1A7AA 2WG0A 1B0ZA 2B82A 1G8JA 1QCDA 4QNMA 4D4LA 3CA8A 3LLCA 4QXAA 3KL4A 3ZWCA 1O4WA 2R86A 4RENA 3GLIE 3GOQA 4WLFA 6PFKA 1VB5A 5IJ0B 4LYEA 2ZYHA 3JQPA 4PPQA 2VRCD 4LRTB 5KWSA 3O94A 5AM2A 3SS8A 2X4DA 2XUDA 3V7YA 3DEAA 3AVUA 4H7HA 1NF8A 4IRMA 1UM9A 4AJ9A 3O0TA 3HB7A 5KREA 2ZRAA 4FMPA 3ELDA 4GR9A 4KDEA 1F06A 3B89A 1T5LA 3HYLA 2A1TR 2FE1A 3Q41A 1OBHA 3IVMA 3U2QA 3VHRA 5A4MS 4IDNA 4ZCMA 2FPLA 5JY1A 4JR0A 1LY1A 1YUMA 4LMRA 3DL0A 3N0XA 4E2ZA 3U4MA 1Q1NA 4NCIA 1X14A 5TGZA 1QDUA 2LNDA 1NDQA 4RWEA 1JR3E 1E2NA 1NRWA 2XDAA 3FWZA 5AI8A 2ZAIA 3DZFA 5JCOC 3Q9NA 1O0CA 1NVMB 2YMMA 2L2QA 1ZVKA 4LWQA 3GCXA 3QUQA 2VJMB 4M3NA 3I61A 3I58A 4PZCA 3TVYA 5ED4A 4Q82A 2A94A 4GMDA 2I67A 1LNQA 3KZKA 5K09A 3BIFA 1R66A 2YJ4A 5TQJA 3VJMA 1N6KA 2QVGA 1CG6A 1Z5PA 5IARA 1GILA 5HFJA 1Z37A 2VPIA 2G76A 2XADA 4DYDA 4DYVA 3QVMA 1GO2A 5L3QB 2Z2JA 2Z95A 3W3AH 2E0IA 5FBZA 1C3JA 2YJZA 1W2HA 2I9KA 4QNNA 1RS0A 2FX2A 4QRDA 1F17A 1ISRA 1F6DA 2JFOA 1JHDA 2EFHB 2EZ9A 2BDTA 3ZJ5A 1TEHA 5F78A 3Q2IA 4N01A 4AP5A 5JR3A 3T3PB 4EA9A 4QOGA 4FGWA 4ZMRA 2GGSA 4RM2A 2ZSEA 2C61A 2EKZA 3BWDD 4EF5A 1P18A 2QGFA 3DE7X 2NXCA 3B1KA 4ML3A 2EKPA 2QVCA 3H0KA 3WLJA 4MQMA 4MUKA 3WYCA 1QFXA 3NV9A 5JS8A 2EZUA 3I9NA 4DKJA 1SU4A 2NTNA 2X76A 2FQYA 5CYGA 5L7TA 2GASA 4JYPA 5EIOA 5U9CA 1PTJA 3X1DA 4GT1A 3DLIA 3PNOA 3GEPA 3DE0X 3PF9A 3NM4A 1QIFA 2QUBA 1HDEA 2UUAB 3LZ6A 3Q1LA 5SV2A 1I13A 4JUBA 3HB1A 4K26A 1FS4A 4NIMA 1TW3A 1GAJA 1EM8A 4WZBE 4XR9A 2WBLC 5AVSA 5IN5A 3TLGB 4FTWA 2CK3A 1ZINA 3ICOA 3JR7A 3FYDA 4DMHA 5DBIA 2ZJ2A 1PW5A 2V0CA 3HBMA 1AKYA 4OGGA 3PT5A 1H2WA 1WVIA 2A2ZA 1M0EA 4R2WA 5REQA 1Y42X 3VVLA 1LX7A 2B1QA 3U4GA 4W7SA 4CF5A 1V1MA 2XUGA 4HH0A 3QNMA 1RWQA 1P6QA 3UJ8A 4ENQA 5FTNA 5FTLA 5HM8A 3P71T 4XW2A 2VH2A 2WKWA 5HTKA 1M66A 3FUVA 6ADHA 2YHIB 3FOCA 1NG1A 2BZ1A 3JR3A 1M73E 1Z15A 3PKJA 1NBMD 2CVPA 2F1RA 2Q5FA 4H17A 4LW8A 1NLZA 2XWSA 2IZZA 4BNUA 1HDGO 3BSSA 1IY8A 2BFCB 4UXIA 4YUXA 4MV4A 5D7BA 4ZT6A 4CLRB 3LOPA 1XWIA 4G4SO 3FMVA 3ZZUA 4MKIA 1QIJA 4JJFA 4ZVQA 2VWHA 2XCIA 2J09A 3WXBA 2B37A 2RJ3A 4LBZA 5BQXA 3ZBUA 1C81A 4W5RA 4C2BA 2YWFA 1MO6A 3K4PA 5E7QA 2A3RA 1BQ3A 3C8MA 3JY6A 3TQFA 4BMSA 4HZIA 1NVUQ 5E2AA 1G42A 5FBQB 3RVBA 4ITRC 5LDDC 10MHA 4KK4A 4KL8S 1LBSA 1JP7A 4HVCA 1E1LA 4PYQA 3PQ2A 4KXQA 4EYEA 4G0XA 1DBVO 2QZ9A 2ZBEA 2IEBA 4G56A 2RI6A 4WIAA 2J32A 4E5MA 3S0JA 1XDSA 2YFYA 1PJ8A 3FPEA 5TQ0A 5HVNA 3HJHA 3L0SA 4KFRA 5IP5A 1P9LA 2BFWA 3REFA 2Z9BA 1S8FA 4QICA 5LN1A 3IB3A 4AC9A 2YHBA 4G0NA 3I37X 2P5SA 2PR2A 2VZ0A 1UBHS 2WHEA 1OI3A 3PC8C 1M7BA 1BG6A 2P30A 4JZKA 4F1JA 1N7IA 2X5JO 5CDTA 1VHDA 1J00A 3FGNA 2P4SA 1V7QA 4EHAA 4JX9A 2AZMA 2W8ZA 3D9QX 1W76A 2AC7A 1VE5A 2OFFA 1XVUA 3RWOA 1TLLA 2NU7B 3PUYA 1KZYC 2P5YA 2HXSA 2IF0A 3BMNB 3HDQA 3F71A 1L4YA 2I6UA 1GKUB 2R79A 3FLEA 3NANA 1U3WA 3OJCA 2L42A 4OL9A 4BYGA 5HJ5A 2H63A 3K1JA 4B3HA 1CLEA 2PKQP 1PGQA 2AR9A 4ZO8A 2ZGVA 2WM9B 2WNSA 3OIGA 1KKMA 5FRDA 3N6RA 5JDCC 4D9FA 2OHHA 2BV3A 4TZTA 5JY6A 3GNSA 5UKDA 1U0RA 2C5SA 4F3KA 5AVWA 1BSVA 3AFNA 3T38A 4DJ5X 1E60A 4F96A 1KMMA 4AKSA 2VRBA 1THGA 1W0KD 2BMVA 2ZB2A 3IYLW 5FV7A 5ITZA 4Q9LA 3KSRA 3EAQA 2L69A 2PYZA 3KE8A 5DLQC 1R4MB 1TJ3A 2P41A 3H2SA 4YJ2F 2MJLA 1NZJA 3CJQA 4A8JA 3AGPA 3RVPA 1DRVA 1X7DA 1WMSA 4JX8A 1I3NA 2WSMA 1I3OA 5BWMA 4R2IA 2KE5A 3Q3HA 1NPDA 1AKUA 4OJNA 3TX2A 3X44A 4JR1A 3C15C 1JIJA 3NQ41 4ZK6A 1G7SA 2GXQA 3HCPA 4BLQA 2XUZA 1SQ6A 4DNFA 3OTGA 1P3DA 2FWIA 5HQ3B 1QHGA 2TMDA 2W22A 3EC1A 4RIEA 4D0RA 1I7DA 2IS2A 2X6TA 1ITZA 1TYCA 5E3JA 1P2TA 4JLVA 3FWHA 4U6NA 4GBMA 4G9EA 4MCAA 3NG1A 3EIUA 3WQRA 5JNVA 3RFCA 1WTAA 4GOOD 1G9TA 3T52A 4MZDA 6CHYA 3RUDA 4YP7A 3BHMA 5FJIA 2CBGA 2HLPA 1CUBA 4KREA 2E7ZA 1Z2PX 2Y6UA 2XNSA 3DG9A 3CB2A 2C7BA 4W8HA 3EQ9A 4FFRA 4ND8A 2A84A 3CNHA 3DVAA 3MCAA 2FN4A 3H1PA 4HX9A 3WO0A 4P0TA 3LCMA 1JHZA 1SA0A 4ZRDA 5J9FA 1LDBA 521PA 3V3KA 4LWPA 4AY3A 1KKLA 3UHPA 4WZ6A 5JI3E 1AJEA 2O50A 2HHJA 4RV4A 3I9JA 4WV3A 4J7AA 5HFAA 3AR4A 2ZJAA 2G77B 3RC2A 4EY5A 2O52A 1KJJA 2AQ8A 3R3VA 4OSOA 4UVDA 4YAFA 5FUXA 3VKUA 1ZWLA 3CW8X 1MVOA 1ZKMA 2NVUA 3B1VA 1X7YB 1NJGA 4DJAA 5C8XA 3T7DA 3LLUA 5KC9A 1BFDA 5DHPA 4MQ5A 4Z0TA 1KO1A 5CFQA 1UBLS 1HDIA 3RF6A 1E3SA 4HADA 4BLOA 1B8UA 3O4HA 1GEEA 4PE5B 5B30A 2Q3CA 3FMPB 1UC8A 3LY9A 3OBBA 2R44A 4XSHA 1GUZA 5H68A 2IYEA 3H2GA 1A7JA 4QM6A 1F51E 2YDXA 3FPCA 4R51A 4ZOBA 3RYFB 1O9HA 1YI0A 3GA5A 4FFMA 1E7MA 2CC2A 2WE7A 3N76A 4LJ8A 3PV0A 1RNLA 1U1FA 3HABA 1LBIA 3H42B 3INNA 6REQB 4DZZA 1SKBA 2Q3DA 1IZYA 3CJTA 2CUNA 2RGWA 4JZYA 4LYJA 3OHPA 5HUHA 4WMLA 3NJRA 1FP2A 5EMJA 5HIJA 4AMZA 3AUXA 3GRAA 3A8TA 1Y8ZA 2EBHX 4J3FA 3RVRA 4DMUB 1Z4IA 5M5BA 5EKDA 3I3SR 3LL4A 3BRWA 4JT9A 1Z0UA 2RH5A 1NU8A 3C5HA 2UZ3A 4TLDA 3ND6A 4TRNA 3ETGA 4ZVNA 3C7AA 1FMJA 3O4FA 2IYWA 4PBRA 2EX0A 2J3EA 5TNXA 4JJ8A 4ALKA 4JI0B 2NPIA 3NEAA 2XCUA 3F2IA 3FTCA 3M33A 2OXIA 2CLCX 4Q3DA 1W93A 1FNSA 4Q01A 1CZHA 2B1RA 3DLPX 3I6QA 2WJGA 1U3GA 3FAKA 5HKLA 1N2SA 3TL3A 3ET5A 4EMUA 4OBEA 4PZAA 5EWMB 1LVGA 3PCXA 3NCHA 4LHWA 3FE2A 3TPCA 1QP0A 1AT1A 2O0LA 3DQPA 1PLLA 1GUFA 1SKUA 5AW7A 1U11A 3NAQA 2GCNA 3M3HA 5FKJA 4DLTA 1MFPA 3RS2A 4BKRA 1BHQ1 1XVIA 1ZOOA 4PIMA 1Y6FA 1B2LA 5JRZA 2ZUSA 1SCJA 3ZHVA 5MFPA 4M0PA 2GN6A 3ZD9A 2YVUA 3CNQS 2A9RA 4X44A 4ARUA 4JB0A 2JJMA 4PG7A 1W88A 1V2GA 3D7SA 3U44B 1EHIA 2J3KA 1ZXLA 3SXUB 4G24A 4PIVA 5F7XA 5I4BA 2QT0A 4HWPA 2NPFA 1Y80A 4ZV9A 5K9ZA 1KO8A 1YR2A 3P5SA 3GVPA 3WGYA 2VO1A 1A96A 5AI0A 5H9VA 1PJTA 3L43A 2RGNC 1OLUB 5EE5B 4LJLA 1WXQA 4YASA 1FDVA 5U4QA 1VYUA 2CEAA 3WHIA 3WAKA 3MCVA 1E2BA 5KTYA 2HMAA 1A4RA 5EN4A 2Y27A 4N5MA 2P68A 2X2PA 3RUCA 4YAKA 2A92A 3NRBA 4HAXA 4KLCA 1MENA 4MLDA 2PU5A 3TE6A 4JLPA 4U6QA 1V5IA 2H7CA 1GP2A 2NUTB 4B6RA 5HDQA 1P73A 4MW4A 1DHTA 1L7XA 3BXEA 5T4EA 3WRYA 4JJ4A 5LOVF 2OOKA 3M5WA 2JD0A 1NIJA 1QWOA 3HCNA 1O94D 2HUNA 4HDNB 4BNIA 5JNLA 1P5JA 1VE1A 1CSEE 2QMYA 1UK8A 1XALA 1K7CA 3SZOA 1YJ8A 2D0OB 1C7ZA 2Q6LA 5FOVA 4OHPA 5BSGA 2XMDA 4PF1A 1PYGA 2WJYA 5AHOA 3DO5A 5E6RA 1Z0AA 3PWSA 4MHOA 4OHWA 2CDCA 4XM1A 2XQKA 3ORSA 4D3XA 3AR3A 5L9AA 4FFWA 5DI9A 3ABOB 5FL7D 3T3MB 3S70A 2GSDA 3VBCA 4WBNB 3H83A 3BE5A 5IJWA 1EK1A 3HBNA 1RT9A 1H8HD 3RW9A 5JSKA 2MSLA 3TYXA 4JUFA 5GJCA 4RXUA 3GLTA 4YT8A 3TINA 4JLJA 3HJRA 3V8BA 2QN8A 2HWYA 4UAUA 5C1IA 1UQTA 2AN5A 5ADHA 2Z0MA 4LZJA 1VP3A 4RXMA 4KXFB 1WZEA 2JGIA 3OECA 3X3HA 1UPAA 4IH4A 1KTIA 4JYMA 3VH2A 4K9SA 1DBPA 1XTZA 3U4CA 3EG5A 3SC2A 4Y98A 1J07A 3PB3A 2C8KA 2GK3A 1EK6A 4CF3A 4KSCA 4GXTA 5F4BA 1R16A 3UJ7A 4JQYA 3FWKA 1P6UA 3QVLA 4JCCA 1KAMA 4HZGA 4JJIA 1ZN8A 3CHYA 4LGCA 4PLHA 4CRWB 3MRXA 4CN8A 4E6EA 2FZEA 1KRXA 1FLVA 3EC2A 3N2KB 4YS6A 3V4VB 2OC9A 2FFQA 1ZZGA 4PINA 4RQTA 2CVZA 3EIWA 4O2AA 3VPXA 3LF2A 4LF8B 1SKQA 2Q27A 1E9VA 1UXIA 2Q46A 3QZUA 2FZ4A 4IUBS 1QE5A 4OI4A 1SOWA 4D43A 2A9OA 1QQTA 5JJKA 4J0IA 3IUBA 3B36A 1D4AA 1YT5A 4DABA 2J7KA 3AF0A 4ZOLB 4E03A 1MIOB 4EGCB 4QDKA 3ZDEA 2AUNA 2PVSA 3NP9A 3U5TA 3ML1A 3Q9SA 3BMQB 4QG3A 4EBBA 1WOMA 3T9CA 3WKBA 5JQGA 5G1OA 4ZMBA 3NDIA 4JSTA 1E1KA 2PKEA 3AHCA 1PJLA 2WUEA 621PA 1YDEA 5EY5B 5BV7A 1XTSA 2IU3A 2IY7A 3UV6A 4YECA 5H82A 3HK2A 5AM0A 1W1IA 1X9IA 3PJFA 3E05A 3KUXA 2R48A 3RUIA 4BB6A 1IHOA 3IP7A 3EQ7A 3RFFA 4RHXA 4GI3A 4BQIA 4EARA 4KQGA 4LC0A 1SOVA 4JV5B 4NZMA 3MXTA 4DC1A 2WF9A 1G9XA 1PJ2A 1R8YA 4C20A 1JU4A 2BGIA 2V55B 4AKIA 4CKBB 1LPMA 4M9CA 2CXHA 4XTCS 3WOHA 2JG3A 2GRAA 2PZBA 4Y1RA 1F5NA 3QVTA 1G20A 1D2RA 3BZWA 4I3GA 5BNTA 3QVWA 2CL7X 4RD3A 4XAQA 4GMFA 4EUSA 1ZK0A 2D1RA 2JI9A 3QY9A 1A8QA 4QDTA 1SBIA 5AVQA 2SHKA 1A4XA 3MPUA 1VE9A 5EJEA 1C9NA 3L0DA 5H80A 1RWVA 1JEYA 5K4AA 5A62A 4M98A 3Q8LA 3JQ7A 4DLKA 4Q9NA 2PXXA 4R5HA 2ZJBA 1OLXA 4XJSA 3LLVA 4GP9A 3HUTA 3S2YA 3CX4A 1SHJA 1N5IA 1RI5A 2HO5A 2KPOA 2X9QA 3IRVA 4KLNA 1UBCA 2FPMA 2PZEA 4D0LB 2UVDA 1I0ZA 1P7PA 4LHVA 1GZ7A 4A15A 3TZHA 4L4SA 1UAAA 1GG5A 2HZ7A 4UXJA 5IWAB 2D6FA 1MBZA 4PYNA 4FOLA 2D00A 2FMXA 2O0JA 1P62B 3V8PA 1YTUA 2PSHA 3QXCA 1PR0A 2P4EA 3KAJA 4I3FA 1P0CA 3R5JA 3RSOA 5ALWA 3SHFA 1CUHA 1XVAA 1CXZA 5EEHA 4O02B 4DA0A 4CCSA 4OUKX 1QAQA 2WVAA 4L6AA 3OJ0A 2O8CA 4PX9A 3ER9A 3VNSA 2VAWA 3M0EA 3PE3A 4FC7A 4KITB 3TH5A 4MULA 2X13A 5EP1A 4TV9B 2WSLA 3CO5A 1GM5A 1YDWA 3D7LA 2ZYGA 1II8B 3LLMA 5F52A 1GPLA 1MNQA 1UM8A 2I7XA 3DLBA 3MMXA 2Q3MA 1UXJA 1ZN9A 3COZA 4XFDA 3W3ZB 4MS3A 4J0QA 1NLYA 4BCCA 1WCYA 4AYXA 4YXWD 3O0DA 1CIJA 3WDKA 1K6IA 3KPYA 2NU6A 2HWKA 1OE0A 4TTSA 4WD3A 3ZS8A 2D62A 3T3EA 4AECA 3BHNA 3IKJA 5A7HA 4WEQA 3OPVA 1RZUA 1J97A 1QIDA 1J8QA 1B3RA 3R23A 2VJPA 5EWJB 1GTL1 2FQ1A 1A9YA 3MUOA 1ZN2A 4JLDA 4Q3EA 4RVSA 4GOKA 1NBEA 3BE8A 1B0UA 2UVQA 2AE1A 5G0TA 1HEUA 1ZK4A 3DMFA 3FMFA 4GVPA 4Q93A 4D3DA 4ZDWA 3MTGA 5AJZA 5DXJA 5F64A 1JPJA 3MZ0A 2FUKA 2ZIWB 3HVUA 5KU1A 2UYYA 4HQNA 3SDSA 1MW8X 3QPDA 3QG1A 2DBQA 3TSZA 3OG9A 1KK0A 2X3YA 3QLJA 4EY7A 1F6BA 2JLCA 2I7VA 1IY0A 2A9JA 2GJ8A 2HF7A 3NASA 3W0LB 1T5HX 2BF4A 4IMJB 1G5HA 5CEJA 3IKVA 1T6BY 2J45A 3KTAA 4C0QC 1WAMA 3WOVA 3BL6A 2JBAB 1CEYA 1V8FA 3R0IA 1TVMA 4W9RA 1FPMA 2VJCA 2C2XA 3S5UA 5CDHA 4LWOA 2GHRA 5JS7A 3NTLA 4DGSA 4X6YA 3KSAC 1OFIA 3E27A 4OREX 1ZICA 2VAVA 3CUVA 3WIDA 5JJCA 1A69A 1NWHA 2C3YA 3GMSA 2DEUA 1SHKA 4RULA 3WADA 5HDBB 5EYPB 1TM3E 4YHBA 3TDKA 1E1QD 4JXZA 1RXYA 3REOA 3L1KA 2XCSB 5HUQA 3AEUA 4J43A 3VU0A 1NSTA 3PWTA 1AGYA 1W6RA 1J0BA 2A33A 2KS6A 2WLTA 1R12A 3BFPA 3CINA 4MUGA 2WT8A 1OPXA 2IPNA 3ZD7A 3BZBA 3MN1A 4DR7B 2OORA 1XZAA 4IPTA 1LRJA 4Q16A 3WB9A 3AIOA 2HAEA 2LIVA 3N5KA 2JL1A 2HB6A 3VR5D 1BWQA 3DAPA 2GPWA 3R7DA 1E99A 1H93A 2YN2A 3I73A 3PWZA 5JIBA 1NQOA 1NBIA 1TM1E 1E6EA 1OLSA 1IBSA 2A5GA 3CNNA 3DGFC 4FMDF 4GX1A 4TKLA 3TLXA 5M2QA 4NEQA 3N07A 1IG3A 3QPCA 2IODA 1YC5A 1PSWA 2E89A 3DO6A 3QYPA 4IIXA 4J90A 3I6ZA 5AOVA 4RXTA 3SKXA 1KBZA 2HPAA 5CYOA 4EW3A 4HDSB 1CUCA 3W2HA 4NDAA 4AL4A 3USZA 4NH0A 5JARA 2YHSA 1G5RA 2JZOA 3GVXA 4O4JF 1N5DA 5DM1A 3VSDA 2DBRA 2ECFA 1L5LA 4L4UA 1NQVA 4FZ3A 1JR3D 4GHWA 5FOUA 3HWSA 1I9CA 3DJFA 1W4RA 4R8MA 5BO5A 2XNDD 4UU8A 5JD4A 3O8OB 1QHEA 3BA1A 4LXQA 1SUIA 1VIMA 5KNDA 2EIXA 1F38A 1QGAA 2Q7XA 3CX7A 3ESDA 4YP5A 3KJFA 5SY9A 5F23A 3RYHA 1XEWY 1YRLA 4MGEA 4PBTA 4WRRA 4GBJA 3A1VA 1Z3IX 3AZOA 4LJ7A 1N7HA 3W1EA 1N1EA 4LWZA 3QKRA 1TF7A 4TKVA 2P67A 3CUUA 1QO9A 3FKSD 4KSBA 4DW8A 3LYUA 1U0GA 1Z6AA 2COUA 3LVRE 4K05A 5HBRA 1TJYA 2YXDA 2C2BA 3X1MA 3GELA 4OYRA 4RHTA 2RAPA 2ZWAA 4YJGB 1C8LA 3C24A 3R6TA 3IDZA 4BMXA 4L5YA 2WP8J 4MW2A 4NV0A 1KEPA 3HA5A 1YJ5A 4ZI3A 1YULA 1SCKA 3UH0A 2WNIA 2VT2A 4A0GA 4FZRA 4KBYA 1QFJA 1L8QA 2IUEA 4DUZB 2FPOA 1OILA 1MH1A 2AVDA 3E35A 3WLSA 5FYQA 4FFBA 4TTAA 1THZA 3A1NA 4ZARA 1ZIPA 1F3OA 1NQ5A 4WZAE 4LVNA 3ZGNA 3MAGA 3L7CA 4JI6B 3NHKA 4HQRA 1KMHA 4N6GA 4S2UA 2H7VA 2NPOA 3GDGA 4AUNA 4CM3A 4G25A 4QBHA 1R0YA 2BUCA 3EE6A 4ZRMA 4ZAWA 4D6PA 4AX8A 3BEDA 4ITVA 2X0RA 4QODA 5BT8A 4EUHA 4WY8A 3I5UA 1NULA 4CUZA 1EAYA 1NE2A 1T10A 1U2GA 4GS5A 3M1IA 1E2MA 3VMMA 2BSXA 1DJLA 4TZKA 1N2BA 1IXSB 1G16A 3LT1A 1JE1A 2JLBA 5HIKA 3L8YA 2XB2A 1TM7E 2PS0A 2WU3A 2C5HA 2DT8A 4ZQBA 3JWPA 1IWOA 4ESHA 1Q77A 4U6SA 3DFUA 2PFKA 4RLFA 3NTQA 1JG4A 3I72A 1JI0A 1CJKC 2XTZA 3ZCPA 2VDPB 4DAEA 1DINA 1Z4KA 3BFVA 1GLNA 2RCYA 3B78A 4MR9B 4EJSC 3JQAA 4L75A 2CLDX 2H5IA 3Q9LA 1PFWA 2PGOA 4WCFC 3HRKA 4M0EA 4ER0A 4NZ9A 4KXWA 4M1SA 1XNJA 3SYLA 4WOKA 2PX3A 1QRSA 4TYYA 2HDHA 2O20A 1SRRA 3TQOA 4O4HF 4ALMA 2VQSA 3GLKA 4JY7A 5A3VA 5KYTA 2ZSUA 2BI7A 4DCTA 3U39A 2FLKA 3OCJA 3PFIA 1NF9A 1SIWA 2I8AA 3C4QA 4Z3OA 1XD2B 1CWUA 1DLIA 2QM3A 3P5BA 4E5SA 3DHYA 1G3UA 3BUSA 5GGYA 4EYSA 4KBGA 4BNKA 1U9IA 2DQZA 1CQXA 2UUOA 1DBQA 3I2FA 3VZRA 4BGVA 1V6AA 3DOFA 3AYXB 5IDVA 2DH6A 2X8JA 4FE7A 4MGHA 4U63A 4EUKA 3HB4X 3GDWA 4RMHA 4FEEA 1HH4A 4RAOA 2WPDA 2VXCA 4X3PA 4CUKA 2QV7A 5JU6A 1MRSA 3MINB 4AS1A 1XPRA 2E1RA 4ARAA 4L5AA 4M38A 5IBPA 1G5FA 4DV3B 3GW8A 1JHMA 4YMGA 3ENVA 2ANCA 2R8BA 3NM6B 1QZ3A 2C20A 1G8KA 3IQWA 5G0WA 5A0FA 2JKYA 2OZPA 1RRMA 3MWJA 3NPMA 4P4TA 2R60A 2IOFA 3AF5A 3HP1A 1JG7A 4J0DA 4IDGA 3FSRA 1V6CA 3AJ9A 4IZ6A 4DIBA 3I52A 2NV2B 2BVNA 1TM5E 2C3UA 1G7TA 4HAOA 5IC5A 4TLMB 4UJ5A 1Y98A 1M1UA 2Y4OA 3LHFA 3FNQA 4AYWA 3H75A 4R8VA 4TLBA 3QV1A 2R8OA 4D6XA 1IN1A 2PPVA 4JYBA 1E3QA 2XUPA 2ZJ5A 1D5CA 2VBIA 4PBSA 4NU5A 4UAJA 4WERA 5C3MA 2VT3A 1FXWA 4RJLA 1C1XB 3ZU5A 1T2UA 4R1MA 4UCQA 4OHRA 5U1PA 1XKQA 4ITUA 3UT6A 3VOBA 2YS7A 3IV6A 3JARA 3H1TA 1EFHA 1RCUA 3UFXB 4KN8A 5J3JA 1G2PA 2GCEA 2YYYA 1R5BA 3AL0C 2BELA 2G9RA 4N3NA 4YAIA 3FOFC 4E30A 2VF8A 2IXAA 1X9GA 9MHTA 2B1IA 1HRKA 3R3SA 4MS1B 3ZY3A 4C87A 5KNLA 3EQZA 1CKEA 1GGMA 2AV6A 2GBLA 1OX4A 4RHUA 5E0OA 3WRXA 4U7TB 4BWFB 4JJ6A 4I1PA 1KFEB 1VBFA 4QVKA 1OAOA 2P2YA 2UZ1A 5K2OA 3M6FA 5J2TA 1V9SA 4ZDIA 4G07A 1O3YA 2OK7A 4M7PA 3R7AA 1VKJA 1C5KA 1GU0A 1T5SA 2CWWA 4YAEA 3TLAA 4Q4HA 2H18A 2A59A 3D02A 1ZJ4A 3E22B 4YMUA 1A5AB 3U7FB 4I4TA 1BCRA 3LO8A 1C9KA 3ZZTA 5LNK1 2OCXA 4ZHQA 5ESWA 4UE2A 3HCFA 1DARA 1YKGA 3VKFA 2YOHA 3WQBA 2HZBA 4MXDA 4ICIA 3I04M 4QUIA 4YALA 5IC6A 4DJJA 3HMKA 3K3PA 1PNVA 2O14A 3S2EA 3N6VA 3UCFA 2Z56A 3W05A 4HGRA 3AEYA 3BREA 3I1FA 3GVHA 3S2SA 5KTOA 3QEBZ 4D45A 1TB4A 2B4QA 1F3LA 1U0SY 2PGNA 3RFUA 2WSIA 4JKOA 5GINE 1VJ1A 2DG2A 1JILA 2VNJA 5HF9A 1GLVA 1TTHA 2IHZA 2JNWA 3EF1A 2BEWB 3IJPA 1LX6A 3GT0A 3EISA 3JPWA 1YK0A 1YFZA 4FUQA 4R1OA 1BMQA 3LG2A 1VFPA 3MEQA 4IX9A 1KETA 4L51A 5CBPA 2DQSA 3PYLA 4I5DA 1WW2A 1MJFA 2FEPA 2IYLD 2LRHA 2ZIEA 4CM4A 4CW7A 2ZJOA 4ZYYA 2PJRA 2R6HA 5C5CA 4NPAA 4EMTA 3C3BA 4AJEA 3N74A 1L7MA 4IEFB 2EBFX 1QOZA 3A3YA 3DMHA 4OMCA 4JQSA 2WDPA 1NW8A 5KNCD 4W63A 1SBQA 1C14A 1NJFA 5KHAA 3WGOA 4ZEOA 2ZTLA 1EZ1A 4IYRA 3A9SA 5A2GA 2IE8A 4IHJB 3KXDA 5JJ5A 1FEZA 1FFXB 1NN0A 4Y6GB 5KNBD 3HFSA 3TD6A 3OE7A 4PNZA 3OOEA 3FSGD 2FJUA 4WGFA 5JSZA 3I39X 3OBIA 3BWEA 1GPDG 4J6EA 2BKEA 4K5QA 3LGXA 1TD9A 3WKDA 2OT3B 4PO3X 2YNMD 3VR3A 5AW1A 3PVCA 1MTZA 3R3YA 4NAUA 1MXHA 4U2KA 2Z09A 5D8DA 2JH9A 2WHYA 1JEQB 1QC5A 1W1WA 4NV3A 4X45A 5HX7A 2KBFA 1DL5A 1JEDA 2B8NA 2O3TA 5CB4F 1KORA 2ZZNA 1SUAA 4M9UA 2MSCB 2E5WA 5AI9A 1VL0A 4AUMA 3KKOA 2OSVA 3W4JA 2VWQA 3HZRA 4KJZA 4L3WA 2IOFK 1WZIA 1B6GA 1GNPA 2FNAA 4E32A 1D9XA 2X0IA 3PDWA 4YQEA 5IZCA 1WVGA 5KDDA 5ELLA 5EXDA 3FYTA 3AFHA 1EZ4A 1UBEA 1RKBA 2QUZA 2ZVDA 1N1GA 5AW6A 2B2NA 3LE8A 4WE3A 3LH5A 4PWYA 2C9OA 4CEHB 5F5NA 1QYRA 2IYPA 1AXEA 2Q6TA 1SXQA 2PANA 2GVNA 3CBQA 3WMRA 2PFGA 2MYPA 4GOXA 3JRWA 4ZC1A 2JS7A 1GSOA 4ZTBA 4TYMA 2D8MA 4KTVE 1MAHA 3L5KA 4R41A 2CFOA 2NXEA 4FW9A 1Y8RA 5AJUA 2NW6A 3P8ZA 2G04A 4G67A 2IIQA 3VZPA 5B57C 5F98A 3WS7A 1EFCA 2ZS7A 4MV9A 3DWGA 5FXMA 2O8EB 1BIFA 4MW9A 2YUIA 5JCZA 5JZOA 4FINA 4WKNA 3SHOA 4Z7OB 1ZU5A 3ABZA 5K3FA 4OGKA 1FYVA 4XYMA 4EB6A 5JNWA 2RBGA 3DL4A 5A05A 3GQVA 2V7GA 3A2LA 4RA9B 1J8VA 3DOJA 3ZBPA 2CV2A 2VHEA 2EX1A 2NTEA 3PDJA 5BN5B 3RKUA 3GYBA 3HL4A 3IMCA 4LOHA 1P44A 4NS4A 4QOEA 4CZ2A 1I4OA 2XNJA 2EKBA 1MN6A 2R6R1 2GLUA 2VZLA 3L4BA 2HEIA 3UC5A 3CRVA 4K8OA 4JGGA 3FWPA 1WG8A 5K05A 2ERCA 3AHJA 4GECA 4MMZB 1RVDA 3ZNPA 5EVCA 1SHTX 4JEMA 4LBYA 5EZQA 5JATA 3VTKA 2V3VA 2X5KO 4PPYA 4CCYA 1G1AA 1PJQA 1HYHA 1T43A 2HBQA 2PRZA 2ZRHA 4URYR 5BSEA 1WZNA 3GD5A 1N77A 3UKJA 3SSAA 1BA2A 3HN2A 4GPBA 3SZLA 3S6JA 3JAWB 5KS2A 4OLBA 2MMCA 3GLFA 3ZDDA 3BM5A 1SUPA 2C9YA 3O90A 3NJ8A 1QFMA 2J6CA 2FPXA 4XUEA 4YRCA 5FI1B 2WJ4A 3TKLA 3UV3A 4WEOA 2IPXA 4KJXA 2BGMA 5TPZD 4LOLA 2NSDA 4AVYA 1AK1A 2NQTA 1S9HA 2HDOA 2I5PO 4NENB 3K9GA 3DXZA 4LPSA 3W9SA 1UMBA 4XWAA 4DR2B 3CZ5A 2X8LA 1RVV1 5FHQA 3W3AD 1P1HA 1GIAA 5K6RA 2ZAMA 4ADSG 1AKTA 2PSSA 4E3WA 1QR6A 2WU8A 4Z86A 3K0CC 4RF2A 1X1DA 4UW9A 3RTEA 2CF5A 1TKCA 4HVAA 3ODGA 4ZOEA 7AT1A 1C1DA 3THOA 1Q1EA 1V4NA 3DT8A 3HEBA 3OQPA 2WIKA 3KUDA 3WWPA 3AX6A 4PNPA 4HNTA 4WHMA 2D1TA 3ZQJA 3QJYA 1GTZA 4RW0A 1EDBA 3AU8A 2JFNA 5EXXA 2BI8A 3FGOA 4QG7A 2E1PA 1E4EB 1LC0A 2PWAA 1JFFA 3FLBA 3VNVA 1WMAA 3LT0A 4HG2A 1Y4ZA 1LZKA 1X7GA 3QLVC 2TRSB 1RTTA 5J63A 4A36A 2PCLA 4QDOA 1DIAA 1VHJA 4G4IA 5SZKB 3W8RA 4DSTA 3SICE 3B13B 4GZLA 3L6UA 4G0MA 3I53A 3URKA 2HPZA 3FY4A 3IDFA 3IT0A 4AJIA 2TECE 5KOIA 4F5DA 3RRYA 2XT6A 3I64A 1ISFA 4DM3A 1T2AA 2OD7A 1NJ5A 2O2CA 3ILVA 4QARA 4CFZA 4KQFA 2JLWA 3JXEA 4UU1A 3N0WA 5ICFA 3IEMA 2P2NA 2EWVA 4Z1MA 3L8FA 3N7AA 4G97A 4DYHA 2I03A 3Q15C 3H86A 3HPRA 4Z6KA 4N8DA 3WLNA 1RQLA 1U98A 1MNAA 1LBQA 1XRSB 4NU6A 4Q6WA 4W6ZA 1CETA 3FGZA 3IS3A 2XUQA 3AP2A 3D43A 3IODA 4LHSA 2Q9UA 4OLJA 2AOVA 2Q3EA 3H0CA 3IBCA 1O9GA 3H6GA 5H59A 3WMFA 2XYVA 4A8JB 4AZ0B 3JZIA 2OXRA 4JBHA 1E5QA 2H29A 4YJHB 3U7HB 5FPKA 1RE0A 3ED1A 1T35A 1Y3CE 4GRIA 1JMYA 1I4EB 5KVCA 2J0SA 4N3AA 3A9CA 2IHVA 2A0UA 4AT1A 5CD1A 3G9UA 3FPJA 2IEYA 2ECPA 2PJZA 4BNWA 1Z56C 1S0UA 4MNTA 5TX7A 1V96A 2HIGA 8ADHA 2IU6A 4XPIA 4LVCA 3STXA 4KQMA 4H1VA 3URMA 3JTEA 1PS0A 3RS0A 4EI8A 4ZJZA 2H07A 3CWZA 4XOUA 4RUKA 4I8DA 3NDJA 2EATA 2GVZC 4J49A 2H57A 3E7XA 1GZ4A 1ZK1A 1GQQA 2WWRA 3K09A 4L6CA 1T36A 5TRTA 3WK4A 3WBBA 1XFDA 4EZEA 4QJIA 2Z8YM 2AI2A 2ZQ5A 3E2PA 5ECYA 2QRMA 3OZAA 4BKMA 5JZVA 1SVUA 3AUSA 1GXSB 3RAFC 2KLBA 4ND8B 5FULA 5KJCA 2ON6A 1EUYA 5KDLA 1Q0UA 3CQ9A 4GI2A 1US8A 2PLAA 3AG6A 3E9EA 3FCUB 4JT2A 4YQFA 3OUTA 1HDOA 1I6WA 3DZ8A 4XUDA 2IIBA 4EJFA 2NVBA 1K98A 4JOCA 4XJTA 4AO8A 3BDVA 2VPZA 4X24A 4U7FA 4AMUA 2Z5FA 1R88A 4C4TA 4G1CA 2CLIB 4Y2PA 2X23A 3EDRA 1HYEA 1L4MA 3QOFA 2HLNA 3L6EA 1V43A 3ZLVA 4J2HA 5K8JB 4DMCA 4EJ6A 1NWCA 3AF6A 5FD8A 2OHJA 5LP6F 4X91A 4C7OA 2C2MA 3AIIA 1GKLA 1XLTA 4ZI5A 3I09A 3TVTA 1WHTB 2I7CA 3CB4A 4E07A 4DTCA 4XJXA 3QUSA 3R3XA 3ST7A 4L57A 4IIHA 1TZBA 2OCPA 3MWKA 1GZUA 3ND7A 5DCUA 4YP1A 5TJHA 3ZNQA 4B6GA 3D54D 4BFYA 2OXFA 4NBLA 4NR0A 2EJCA 4OFBA 4EW2A 2ATXA 3FJOA 2FW0A 4C0WA 1L4LA 4IVQA 4RTLA 2FDXA 2B7CA 3RSGA 5ARBA 1E6LA 5EZ5A 4NCJA 5AVTA 2DFVA 2Y0CA 5CR9A 3SR0A 3V6MA 4WBXC 2HJRA 1RPAA 2VK8A 3Q2OA 2AXNA 2VDOB 4RJKA 5FBLB 5IM4A 1ZHHA 4RHYA 2C42A 1Q44A 3PUVA 4HMOA 1ETHA 2QTWB 5JE8A 2YY6A 5D86A 5JNTA 1TVEA 3I23A 5IVKA 4LEIA 4IJMA 1LI5A 4JK3A 4A2CA 1UK9A 3OM1A 4IO0A 4KPUB 4OHKA 2C95A 3L5OA 2QW1A 4TVOA 4FN4A 3U5ZB 1QH1B 4MWZA 1UBJS 4MWEA 4X61A 121PA 1RJDA 1SU6A 3WYDA 3EQ6A 3GFVA 3EEFA 4M4SA 1FJXA 2QTZA 3KS9A 1INLA 4B6PA 1KMCA 4W8GA 5C7OO 2C2GA 2G83A 4DCCA 5BUZA 1O2DA 1J0EA 1L5SA 1MD9A 1NUPA 2EG9A 4HWSA 3WQSB 5DN6D 1CIVA 4PW0A 2CDNA 2ZS8A 2J1LA 4FDTA 4BZPA 2X4GA 1FDSA 2C5GA 3ORQA 2X1VA 1ZR2A 2QBYB 1SG9A 4K46A 1OW3B 2QSYA 1C4WA 4XFKA 2YH2A 2A78A 5KMGB 2XH8A 1M2NA 2W90A 4U9HS 4YJFA 4YTEA 2SBTA 5DOZA 4NF2A 1QRRA 2C4TA 5EXPA 1NNSA 1ZIOA 3F6RA 1HRDA 1GDDA 2X15A 1OBFO 1QVRA 1XCJA 2O2GA 3MF4A 3TRHA 4Q4LA 1O8BA 1SWVA 3IQFA 1Y6GA 1U28A 5FNVA 1M6WA 3GJRA 1T9ZA 2VR1A 4RFSB 3HU3A 1DIHA 1PSZA 1ISPA 1YZTA 1P29A 1SC9A 1NE7A 3PPXA 4HZUB 4L76A 4S1OA 5K0NA 5K8LA 2Z8YA 1ACMA 3IOYA 2PD4A 3LUFA 2Q3JA 3SNKA 4P3NA 2SCUB 3ZCTA 2WRZA 5IKOA 4H31A 2ZATA 2G88A 2JEZA 1U28C 1UL1X 4GMXA 4D3FA 5BW5A 9ABPA 1L5GB 5JAOA 1RI2A 2NVOA 3G59A 3WQHA 5CJPA 2G1UA 2REQB 3B38A 1V8ZA 2RAFA 3IAXA 1JKIA 1JKMA 3AR9A 4PFKA 1IWBB 3B82A 4BO5A 3W8DA 2VHWA 4W9NA 5IFLA 2RGGA 4BO1A 1MX5A 2DPGA 3MJTA 4XGQA 5ENZA 2B99A 3QXGA 4IJ5A 3RRBA 1X3LA 5FA8A 1XJWA 2XODA 3KDSE 1IZ9A 2WA2A 1EFPB 2C07A 1RAFA 2NSJA 1E1DA 2OAQ1 4KXXA 4TS9A 1SBCA 5AJVB 5FLYA 4LY3A 3T7JA 4CKXA 1CY7A 4HX2A 5JRJA 3CNBA 3SYNA 2XF2A 3FN4A 1ULTA 1BN6A 3QFHA 1VDZA 4Y2UA 1Q6YA 1E9DA 5IAJA 1JSZA 2QLJA 4PGGA 5IBQA 4AU1A 5EHXA 1XQ1A 1GJRA 3ACCA 1SPBS 2VDRB 3EIXA 4Q6BA 3UMRA 2IT1A 4BCBA 1VRCA 4K1LA 3FSEA 1IXZA 4YRRA 3VVCA 1TZKA 4L1KA 4EG8A 1OX5A 3I9LA 5DYTA 5H02A 4F21A 3M6VA 4V0OA 2DTDA 3JQFA 1S7CA 1TQ8A 1UBKS 4H2DA 4MCJA 4II2A 2YOFA 4WFJA 4WK2B 4C4ZA 3TZQA 5BMVA 4UTNA 4G5YA 3O8QA 2ZIGA 4UBJA 4BJ1A 3O3MB 2NO0A 2H4JA 4YI5A 3PNKA 5LOVB 4OYHA 2P3LA 4TXMA 3F96A 2W2LA 4NL4H 3ENWA 3TMKA 1N8NA 3E0QA 1H3NA 3N8IA 4IIFA 2UUCB 4OHOA 2R4UA 1YVDA 4C4SA 1IOVA 1LFAA 1KEEA 3F6CA 2O8DB 1WCIA 1T1EA 1XOIA 2I4RA 3N8NA 3UJBA 1DXQA 3NTVA 3G7UA 4FS3A 3SC2B 4QBTA 2IYRA 2P8JA 2OYCA 5DO9A 4A2WA 3WGZA 3BK2A 3NH9A 3Q3CA 2OEPA 2CYBA 3ASZA 2ZSAA 3ANMA 4HLNA 3FVWA 4KACA 4NARA 1ZJWA 1GA1A 2XLCA 1ZL2A 3LAWA 4HB0A 4L8GA 4ZQCB 1P5RA 2VK2A 3PQDA 5BSFA 1AQNA 1P0FA 3TQIA 1GTG1 2K87A 3ZXIA 2N42A 4O2AB 5F9FA 5DHFA 1BWSA 4Y3UA 3JQDA 4M0CA 5LLDA 3N2LA 1N3LA 3RC7A 4DCJA 3HBFA 3ONDA 3HLYA 1UFOA 2HA5A 3HCCA 5DISB 3HHEA 4KZPA 2D7JA 2VFAA 1A5TA 4EB3A 4R0VA 4BDTA 2FPUA 4X8HA 4BC0A 5KPDA 2XUOA 1WU8A 2VATA 3O8LA 4YMIA 3U4QB 3D6TB 1GOTA 4CTNA 5KSYA 4KR7A 3CEPB 4QSMA 1VHWA 3BBPA 3GNLA 3OUZA 4BO0A 5DF1A 3UKOA 5EJ2A 1DV2A 6ABPA 4JT8A 4KMRA 1FDWA 1L8AA 2R6ZA 5G40A 4CKCB 2H1FA 5JAMA 5JD5A 5FPHA 1LRLA 4NS1A 4ER5A 4MVJH 2EKDA 2FVXA 3DNFA 3SBXA 2C9ZA 2WNHA 3OQHA 3OTOB 1L9KA 4XUCA 1YIAA 4G8CA 4HEA1 4NPHA 5ESXA 3WNVA 1B8NA 5L3SA 5C5IA 4NFLA 1OXSC 1W46A 1JEOA 3OTIA 4PGAA 4C7KA 1JEEA 2J31A 5JZ9A 3OMWA 1ZQ9A 2A4KA 4O1MA 4IKEA 4N48A 2OFPA 3L07A 4UVHA 3T9AA 3R7SA 1YZFA 2BGNA 3MA0A 2XHZA 5C1BA 1VA4A 3JWJA 1E5LA 3B3GA 3Q5DA 1POWA 3AM4A 3ENNA 4MRAA 4WZAB 4CI9A 4V0ME 1ECCA 4EECA 1DGQA 3O2SB 1RMQA 3TRJA 5IYZB 4CG2A 1KAQA 3EF3A 1JKJA 4KIUA 3G2OA 2XQJA 4B4OA 1EE9A 3GRZA 3DJYA 1CE8A 5A4JA 3AVWA 2QLNA 3NWJA 1RAGA 2IE0A 4KQWA 4WOCA 2YIVX 3HU2A 4C5BA 3REQA 4I55F 5CG1A 2BMDA 3OZ7A 4UHHA 2ZBGA 1UUFA 5KCZA 1X8LA 4GVXA 1DQSA 3IP3A 1FUKA 1M5UA 1M72A 2ANBA 4R1UA 4TSFD 3NDPA 4JELA 5ALRA 3C1OA 1NR1A 1VLMA 1KC3A 1Z4LA 3KK0A 4HWOA 1K8RA 4RK0A 2H6EA 2IW3A 2ECQA 4FT2A 3OQOA 2C3OA 2GF0A 2HV8A 1SNYA 3DUWA 3PDUA 1JLMA 4ZT3A 4DNOA 3FCSB 2FRDA 1XE3A 5IEJA 4ZZ1A 1UFRA 3CE9A 1OT5A 1NMXA 2JK1A 5FOWA 1MA0A 2PEZA 2DPMA 1PEAA 4Z7NB 4E12A 4QD3A 1CB7A 1PZFA 1GQRA 1TPZA 3VKHA 3DKPA 2FEMA 4KLZA 3BEOA 2A1TS 3PT9A 1CC1S 3EZ7A 3TLKA 2ZB8A 1IZ0A 5I7RA 5KEIA 3HYTA 1EWYA 1U65A 1WB9A 1H1DA 4XB2A 1P80A 5KOJB 2H51A 2PJDA 1C9JA 3NT4A 3QUTA 4GU5A 1GKYA 4QDXA 3WLIA 2IGBA 4EOGA 3VPDA 3KQLA 4MVJF 1JSXA 5IG2A 3SM3A 3R7NA 3NZEA 1O6ZA 4S3MA 4KB5A 5GONF 4O3MA 4B3GA 2ID8A 3B9QA 3CSUA 2PH7A 4B73A 3DWEX 2WTMA 3CRMA 1T8SA 3QOYA 4AB1A 2OCGA 2D3WA 4IWXA 4U2DA 3ONEA 2CNWA 5CGZA 5GJBA 1X80A 3R5TA 2QT9A 1FTWA 2RHMA 4S05A 3F8WA 4L8VA 2ORWA 3Q10A 4R84A 5IAAA 3OEEA 3PCRB 2FY8A 1PV1A 5LZ7A 1HG1A 2QTAA 4G85A 2V6JA 5SYAA 3LT5A 4PSUA 1WLSA 1Y7HA 4BJ6A 1G291 1MA3A 2BFBB 3OH8A 4OHMA 2FZVA 2H48A 3R44A 1JDNA 1KYWA 4IV0A 2BFDB 3V1YA 4BV3A 3ORYA 2VXBA 1XZPA 4ESOA 4V1CI 2FEXA 3V80A 2WVGA 1XC7A 4GWLA 4S24A 5CVUA 4IDFA 1ZCFA 3C41J 1QORA 2RGXA 2MINB 1U0EA 4LNUA 3RS4A 5KYWA 4REQB 2GFHA 3WLTA 1SUCA 1JUDA 3AQ4A 4UM5A 3HJCA 3AFGA 1USIA 1VCOA 4IFEA 4M46A 1U8YA 1NN1A 2R47A 4OEHA 2O54A 1BVUA 4GQIA 1ZNXA 4X20B 3UTDA 1CDZA 3PEYA 1WY7A 4CLEA 3C98A 3EZLA 1I3CA 4DIEA 5KJEA 1SBNE 1AQ6A 2WTXA 3F5DA 4M49A 5J4YA 2AN4A 3NBFA 4P92A 4RKEA 2G4CA 3D1LA 4G81A 4R1SA 5BQ5A 4YRPA 5SY6A 2V8OA 2P3QA 2R25B 1M76A 4WUTA 4X8MA 1WCXA 5CH5A 5JBIA 3LGSA 3MNFA 1Q0ZA 4B74A 5HYVA 2NG1A 3V5NA 4YWJA 2AOWA 4IHQA 3OTWA 4S1NA 5E0KB 5B1EA 1M6VB 4HYYA 5LUBA 2H06A 3FROA 1I2DA 5A3RA 3X2FA 2AC4A 1MUUA 2IEZA 2Y77A 3NHWA 4RETA 1J9GA 2O2IA 3TLMA 1IB6A 5KKCA 3DV2A 1GCOA 3NHBA 4L9RA 4EEXA 2WD9A 3HDHA 5LMNB 2ZRQA 3I5XA 5GZ1A 1L4NA 2Y1GA 4IIEA 3UAGA 3K9FC 3K0FB 4WOPA 2FRXA 1TTPB 2WINI 3IVAA 2CEKA 1G55A 3V2IA 1QV7A 3DAOA 3CV3A 3MCZA 4PZLA 2DRIA 1XCLA 5IJ9B 1NFFA 2JA2A 1NVBA 1P2FA 1JGTA 1PEYA 1Q20A 4OQLA 4RX1A 2H2HA 1N2CE 3IV7A 1LI4A 3TPZA 4ARBA 3VJRA 4DDUA 3TLYA 1XDGA 2GAAA 3WK7A 3OZTA 2VNAA 3K5HA 4RACA 1SKAA 1EZZA 1XN1A 1ECFA 2FETA 2GD2A 4E5DA 3FTDA 5JPCA 1EUDA 2HD4A 3S5JA 1CQJA 4FMDB 1SXJA 1NXWA 5CW1A 3KFXA 3D5TA 4L74A 4W9MC 1FP4B 2IHJA 3KXPA 4TKVB 3KWMA 1AKQA 3VR0A 2IVZA 1JYSA 2B3DA 1SMKA 2AZDA 1XEWX 2NQ2C 3GAZA 4JXKA 4QLAA 4X1KA 3UK1A 3N0RA 2OO7A 1V8PA 3ETLA 3EZ6A 3KJNA 2DPYA 5A7FA 3A7EA 3R3UA 3X1JA 4S35A 1Y1QA 2MSKA 2XVMA 1BJRE 1XR3A 3MIZA 2BFNA 4CLDA 2C4UA 4RVDA 5C53B 4MRNA 2EJTA 1EVQA 1JHQA 1L5OA 1DAEA 1Y63A 3AV3A 1E3JA 3CLUD 3GCZA 5I9LA 3TSOA 3RGWS 1TZ2A 4M8LA 4RYDA 4JYCA 4F5YA 2FX5A 3GRYA 5BWLA 1WXGA 2R751 4NV1A 3GFQA 1N3YA 3E70C 3SEFA 4E09A 4EGAA 1YZKA 1ISGA 1FTQA 4YJKA 2AXQA 2YFQA 1KYZA 1WP9A 1XA4A 4YO8A 2VYFA 5JZMA 1KY5A 5LQNA 5DGDA 3JRNA 5ERYA 3TNDA 2V65A 1NDHA 4Q4JA 2WK1A 1KAGA 3BERA 2O0MA 4US1R 3ZCRA 1ULUA 3W5CA 3CPEA 1VIDA 3ZHCA 4QOSA 4C4OA 1L5YA 3RS7A 3TS1A 4D0NA 2C7GA 4CTKA 2NSYA 4CXMA 5ECDA 5K0EA 1YFJA 1PZNA 2LP4Y 4NTZA 1O08A 2JJ1D 1FVFA 2FG5A 2PIAA 4X1IB 4CDRA 1SOMA 4AJ1A 1ILWA 1EP3B 3PIRA 4QFBA 4MRVA 5JUWA 2PZFA 3U1TA 2ZVJA 1U6IA 2P9TA 4P35A 3KCQA 1JDVA 4GF5A 4YRDA 1P1CA 1D8AA 2FB9A 3EZYA 3MWDB 3KYJB 4EG5A 5BVGA 4TLEA 4F93B 1DG3A 4D3YA 5EIWA 1J2TA 1SXGA 3KOMA 1EJBA 1K8QA 3TF5A 4IMPA 1IMOA 4Z4GA 1KK1A 1TT7A 1UMCB 2BAGA 5DSZA 3WGMA 1SR8A 2W11A 1D6SA 2DH5A 4C0SA 4FNOA 3CUYA 4CF7A 4QUHA 4FGZA 3CIFA 1C3EA 2PG3A 3A6FA 3IOEA 1LF5A 2I4LA 3PPYA 1A8IA 5CB8A 4AMBA 2HQ1A 3EVGA 3CR7A 4MMYB 4C5AA 1RM5A 1TK3A 5BPFA 2AX4A 1F4PA 1E6CA 3LFTA 3Q2KA 3RVDA 4EI2A 5IKEA 5JVDA 3BCUA 2BP7A 2W6IA 4JVOA 2JGLA 5IW8A 2J0QA 1SCUB 1U5BA 3CN9A 2A0YA 3T5GA 4CTOA 2H8GA 2WZDA 3OVMA 3M2PA 4UTRA 5BN3A 1J2EA 3O5AA 1RJGA 1PFQA 2CVOA 4BL5A 4TTRA 3M82A 1V7PC 1AURA 1T3TA 3F7OA 3HJBA 1U2TA 1ZH0A 3OKFA 4UUPA 3RO7A 2AW3A 2BGUA 4RD1A 4WAUA 1EDOA 4BQOA 1JBKA 2AQKA 2CB0A 1K06A 4D9EA 1A9QA 2VYND 1JQLB 2QYOA 1SVLA 3WK9A 1SVWA 4UMFA 3JQ9C 4ZCRA 3F90A 1GFZA 3GBVA 1ZHOA 1JMVA 2OHOA 1T4DA 4O4HB 5CIQA 4Z9BA 2Y0BA 1AV7A 1VIVA 1Y6RA 2R8XA 1PVOA 5J4KA 1FNCA 3IEKA 4UUOA 3NORA 3ZV6A 4ZDKA 1FRZA 2R7MA 2CJPA 1BNCA 4EPRA 5AJYA 5A03A 1KE2A 4WZBA 1K6JA 1BEEA 3LSYA 3N59A 1KY2A 2PZLA 4NBUA 4ZHQF 1J22A 2W6NA 4MVJE 1U8ZA 2JFFA 5JXIA 4L9WA 1RZRA 1JHYA 1F0KA 2W9XA 3EGIA 2YN0A 1U02A 4H1HA 2FR1A 1GQFA 1G3MA 2O7VA 2ZBQA 4MJ3A 3S99A 2Z98A 2H1OA 1EG7A 1WXXA 3E9QA 4WADA 3ZU4A 2XYRA 3JARB 4RPLA 4AZTA 3U4HA 1L3IA 4CM7A 421PA 5HIAA 5TDHA 3HUFA 4OX9B 2GN0A 3JQGB 2XTAA 3T1QA 3KALA 4HDRB 2BH2A 4Y6LA 2QTBA 3N53A 5HKKA 5H7XA 1H1LA 3ACBA 1M1NA 2MWMA 2PZ8A 1WDMA 3AC0A 2G0TA 2PBFA 2C7VA 2XVYA 5B1DA 3T1TA 3G5TA 1J7KA 2C00A 2VUHB 1AA9A 2O1SA 1S2IA 3C3AA 3SXJA 1NQAO 1T9GR 4M7WA 2IBSA 5T6MA 3JZFA 3K2BA 2AMJA 3CX8A 2VNKA 4QE3A 3D3WB 4OBBA 3EZNA 2YHAA 2QJOA 3E3NA 4M9SA 3CC8A 4LN1A 2BIFA 3RTCA 4IF6A 3WYBA 3D0KA 1Z0FA 2DYKA 1Z17A 1IMJA 5BV8A 4ZO4A 3I6YA 4TKZA 1DEAA 1YVEI 2CXNA 2NV6A 1F14A 1XQYA 1HQYE 1GYQA 3EXFA 3OFJA 3OZDA 4FJ0A 5FUQA 3ZJYA 1ICIA 3IEUA 1C3OA 1SIUA 2P2ZA 3FF4A 1BFKA 1BS9A 3KQKA 1RDFA 1XYVA 3U3XA 1JBEA 4XH9B 1EFLA 1AU9A 5BW4A 1CNEA 1TQ6A 1YGPA 4MQEB 4Q05A 5J4VA 4RJ2A 3B7WA 1UPBA 3LPNA 1NNEA 1KPHA 1NGSA 1T5IA 4NKRA 2W2KA 2I99A 1E79A 2ILTA 5E3HA 4YREA 2LCQA 1ZUNA 1KDVA 4CM4B 3KC2A 1Y7TA 5ESRA 1D04A 1ZCZA 5MGNA 3CIOA 2IYTA 1A4IA 1XA0A 3C8HA 4J3JA 3KSDO 5AHKA 3HY6A 4U8HA 1XVTA 1CERA 3G02A 3Q8WA 5DP1A 4TWRA 2X8AA 5JCJA 2O23A 5LXTF 3TTYA 1WZUA 1X1TA 2IEGA 2XB4A 2XD4A 4ID9A 1BHSA 2JGKA 3QNUA 2IUSA 2HJ9A 1QYIA 5CFPA 1Y1RA 1O97C 2X2FA 2CCKA 2GAOA 4H7IA 1VXRA 4O2RA 1Y4DE 2Z9CA 3ZGLA 5CLIA 4Q7JB 5EWLB 1Q2XA 4BO6A 4BAZA 3EODA 5G0SA 3LFUA 1L1EA 4YV0A 4OO3A 1WRBA 1YR9A 4ZPJA 1SXIA 1QF6A 4XM2A 2XW6A 2W43A 2JEYA 3ZE6A 1JJAA 2VSYA 3CE6A 3HY4A 3AR8A 3VGPA 1Z83A 4WESB 4B47A 2XMZA 1O95C 2XNCA 3PD0A 2DWOA 1NW6A 4FBGA 2YN4A 4WY5A 3S2UA 4KR9A 1M6EX 2C4NA 2L0XA 3GB9A 4ESEA 1UT8A 2J9XB 3SKYA 3Q8MA 3FVTA 2IYSA 4ZVRA 5A02A 4B1FA 3NBQA 3EVEA 1PZXA 2G25A 4TLAA 4TOIA 3ZGVA 2PA0A 3KAPA 3KJIA 1VYTA 4X90A 1WPRA 2AI1A 3IX7A 2QWXA 4XVCA 1OHHD 2GD0A 3SFVA 1N8TA 2PJUA 2YZNA 2JCGA 2I3ZA 3EARA 5KSWB 3A4NA 2BM9A 3M4ZA 1FW8A 3C3EA 2VJBA 1RWWA 2YXLA 2CNNA 2XMCA 3GIWA 4NBRA 4AY5A 4S2EA 5LZ2A 3AJ8A 1PTKA 1MRNA 2QE7A 5T57A 3P9NA 2VSNA 1ILEA 1CUVA 1V71A 4YDQA 5J2UA 1A7UA 2C83A 5ERGB 3EGXB 4H3KB 4CBVA 1UINA 3WGQA 2UYCA 4ME6A 4AZ3A 2G9NA 4BQNA 3DDCA 4E21A 2J6BA 4K9LA 4B4WA 3KLMX 4I9UA 3NIGB 3PA8A 3F5MA 2IC5A 5CB4B 1WB5A 2WSSD 2OKCA 1W5EA 3G0GA 4ZGWA 5AVRA 4JITA 1Z38A 2XQGA 3VQTA 5K8TA 1FS5A 3A2MA 4TQ9A 5TV2A 4F4DA 5K0BA 4KN9S 1LRKA 2QMUA 2QTVB 2Y1KA 3KXKA 5FI3A 3Q7EA 5K3FB 4GBED 5SYMA 2XVAA 3T15A 4DUGD 3F6BX 1JAZA 2BRUA 2IYNA 1Q14A 2JF0A 5FR2A 4ZEMA 1P5ZB 4N82A 4UAVA 5K3AA 2ZLBA 2AH5A 4PYKA 3U9SA 3UVEA 1T5OA 4C05A 3QF7A 3DDZX 5F35A 2UYQA 1LS1A 3SS7X 4FYPA 4HS4A 2VOEA 4R8LA 1RBYA 1Z25A 2RH8A 1YR7A 3GY0A 3LK7A 3W78A 1AO0A 3L8CA 2VXOA 1P0MA 2I9PA 2P6RA 3UJ3X 3JATB 4EX6A 3KPUA 3EOAI 4J4TA 2XCOA 3ZBTA 2VPPA 4EYQA 3ZH2A 3PHLA 2LBPA 4WQMA 4DDTA 4EA7A 2QAGB 1I7SB 3W2GA 3H18A 3WGVA 5C5DA 2BJVA 1FTGA 3GLFB 4ND5A 3ENZA 4CTJA 3HI6A 4FXPA 5J47A 4OQEA 4J1TC 4UJ3A 4L78A 2R1UA 2FSFA 3AILA 3WV4A 2ATEA 1OYVA 2LTAA 2QRHA 2GEFA 1V25A 1U0NA 1L8LA 3HGTA 1H5NA 4Q7LA 4ILKA 4Z4FA 4KX5A 2CLFB 1UMBB 2K7FA 4BASA 1Y3FE 1FFDA 3INGA 3A36A 4M0UA 4N47A 1RJEA 3LWBA 3WL6A 1J0XO 2ETVA 1QGYA 3EGDA 4X85A 3DAGA 4E5YA 1SCIA 3JYHA 3K6SA 4ZAGA 3T1OA 2ETXA 2Q8NA 3H2IA 4FDAA 1WLYA 1RRKA 4HP8A 1OWPA 1PDVA 1ZHFA 3O6VA 3PEFA 3EPHA 2QTCA 3F3MA 2GTIA 4DSNA 5CDSA 5H8WA 3G49A 3MS7A 3KU1A 4OFXA 5E7IA 3K9BA 4W5JA 4QELA 2H0QA 3DXYA 4BVGA 4ALNA 2G1KA 1SVSA 4PO1A 4N0EA 2AFRA 3NB0A 3IIIA 1HOTA 2B7BA 2JLAA 3N75A 4RE5A 1DX4A 1GITA 3C3JA 1YNOA 3MD9A 4XJVA 4Y1GA 5DYGA 3VU1A 3EN0A 2BTQA 3A04A 4L28A 4CV0A 7YASA 1YBMA 2H0AA 2QX9A 4GG1A 1GPAA 2GWHA 4RZIA 3X1YA 4DLYA 2Q8QA 2CL5A 5ICCA 2N47A 4HCJA 2ZJFA 3OM9A 4JOBA 1UJ2A 4ZEWA 1JYFA 4DQVA 1C7QA 2MYNA 4FGKA 4JLKA 1FY2A 2ABWA 3PUJA 2R6JA 1UODA 2H3EA 1H8EA 3OQJA 5FI0B 4DJTA 4J75A 3EBLA 1JRLA 2IX3A 2RG1A 4M6WA 4HAYA 5HM6A 3ADBA 3K0AA 1FDRA 2XMRA 1C7RA 4AI6A 2LVBA 5EAIA 2DVMA 2GEBA 4QBFA 3IULA 4M83A 1JHXA 1JHRA 5DFAA 2JIZD 2ODEA 4I9NA 3OZXA 1OU0A 1ZBDA 3RFTA 4N6NA 1IRIA 1NP7A 2W6OA 3I76A 1WDKA 3RVKA 1PKXA 4JYAB 4XLLA 2NO5A 3V3TA 1BXKA 3WIVA 4BB5A 3CVJA 1X1AA 4UCFA 4AWBA 2WMDA 3WYGA 3LC0A 2AF3C 3CF0A 3U3ZA 1Q7GA 2QTLA 4PR0A 3C5VA 3QVXA 4LCBA 1HETA 3R5XA 4XPZA 2DETA 2VDWA 3BILA 3UENA 1MC5A 4MUHA 1DP4A 3TOVA 4BZWA 4E7OA 2YWDA 3C6MA 2QD5A 2C1ZA 2IS1A 2GT1A 3E4DA 2X8BA 3S29A 1DAKA 3UZUA 2P4UA 2WQ7A 2Y1DA 4JMPA 3UPDA 4CLXA 5E6UA 4DJDC 4P7JA 3ZQUA 1G38A 3FNEA 3ZCUA 3CF4A 5IASA 2FPGB 4LF6B 2M32A 1HFWA 1U7ZA 2AR7A 4WNYA 3YASA 1ONPA 3B12A 4LYAA 1GUYA 3M6LA 3C85A 4G0PA 4K6MA 1JFLA 1CZNA 1WHSB 1BWPA 2VBCA 3DEFA 3ZR4B 4H15A 3ESCA 4B17A 3ZUPA 1MDFA 2J67A 3RM3A 2G9UA 3X0DA 2HRBA 4BBPA 2CY0A 1TEXA 2VDMB 4R83A 3P32A 4DA6A 2V0NA 5J40A 2R0QC 2FLVA 1LI7A 1TLTA 2HWXA 2BMEA 3H4MA 3CLSD 4RS4A 1KJWA 2HXGA 2JJ8A 3K9NA 1U0OC 1VMAA 3IQIX 5I8PA 1YZGA 3E3MA 5DV9A 1V1JA 1V41E 2XT9A 4W82A 1K8XB 3IT2A 1HKUA 1O57A 4PLVA 2F00A 4KHPB 3DUFB 4TL6A 4FFSA 1OKKD 3MGAA 3OZGA 3UGJA 5IWCA 4R8SA 2FJPA 1U2ZA 3EDOA 5CMLA 1ORTA 2VPQA 1XMXA 4CYMA 1U7TA 3EXAA 3BMXA 3FA2A 3WIOA 3WFJA 1YZ3A 2AFIE 4NVRA 2EQ5A 1DAIA 1P2DA 1YQGA 2YV5A 3KKLA 4DOMA 3K31A 3ZW8A 1U0JA 1SCBA 4DXDA 5IPFA 3ZV5A 1VGRA 2B98A 4E7PA 1GPWB 2D7CA 2HJGA 1C0PA 2HL6A 2L82A 1T6NA 3R5HA 2PT9A 1NQTA 3E84A 1PT8A 2SKCA 1L7AA 3HPQA 4Z0HO 1DX9A 1N0IA 1GY8A 5JD3A 4JDUA 4AY4A 4HBGA 1XU9A 3L7LA 3EPLA 1R7RA 1XZNA 1YBHA 2WZQA 2UKDA 1VJDA 1JIVA 2PGIA 3NBUA 4GPAA 3UHOA 3UMCA 1QQAA 4TSRA 2D1YA 3MRVA 1ZRMA 3QPVA 1LDEA 1K2VN 1NQXA 3Q0TA 3FDZA 4HAIA 1ZD8A 4IDOA 5LP6B 4LS3A 4YRBA 2W4QA 1E2HA 2WV9A 1IHPA 2DGDA 2XZPA 3VR2A 4P5EA 1N4DA 1ZI6A 3IBTA 4Y6RA 5LD2C 1PVDA 4BJ5A 5AM5A 1RJ9A 3COSA 2OQRA 4S0ZA 2EGHA 8MHTA 1IM5A 4EG4A 2AJBA 4QQNA 4JNKA 5AXBA 1EGHA 2H59A 5A4FS 5G2OA 2WE8A 3JALA 3FHJA 3OWOA 4AJLA 2W48A 1WUHS 2MIIA 3CEAA 4OQXA 2IXBA 4L0MA 2QMZA 1QNLA 4QZVA 1PEDA 1F6WA 2NIPA 5TT1A 1WXDA 4OP2A 4KPEC 1QSGA 2XA9A 1AZLA 1WABA 4R6XA 2FFRA 2XE7A 3SF8A 1NSFA 1XT6A 2PZJA 1IOLA 5CBKA 4F7DA 7MHTA 1BXZA 2Z3ZA 3EA5A 2I3DA 3U60B 2P91A 4MA4A 2EV9A 2DR0A 2ZJ6A 3CG0A 3QFSA 3I8SA 2X9LA 2MTBA 3VTZA 1PCXA 2DQYA 1XQ6A 2GS9A 2AEFA 4KAXA 1NBOA 3MJEA 4E5UA 2W8BA 1YNSA 3CXRA 4DF3A 3FNBA 1GRNA 2J7PA 2J9ZB 2ZPTX 1Y3DE 3HNPA 1Y9JA 4UU7A 1BEUB 5B55A 3UN1A 1KJ8A 3D6JA 3NIWA 4YLYA 4F5WA 3H5VA 1E3WB 4UOZA 4MCHA 1FXWF 2EF0A 3HI4A 3E9YA 3WDMA 2FN8A 4RS3A 5ALMA 1CP2A 1NV9A 1FNNA 2H11A 4IIUA 4HBZA 5BUCA 2HHCA 2GAFA 2IU4A 1DRJA 4NCAA 4X7RA 1ZJYA 1ZZEA 1Z62A 2O3SA 1NHGA 2GQ0A 2HSGA 4D4IA 5ICEA 4GZMA 1TJ5A 1QG0A 2WF8A 2P9CA 1P4RA 1MC8A 9LDBA 1KTVA 4GR5A 5AFSA 2GZAA 4PZ9A 1SVOA 1JN0A 3Q7TA 3AOEC 1GKIA 2CKMA 5ALGA 4BDSA 1YRQA 4RKWA 3ABIA 1J70A 2HIAA 2N46A 4MUIA 3IBSA 3ZEIA 1ND6A 1USGA 1XROA 2PY6A 3OJFA 1LQTA 1K7FB 2X0NA 3BRCA 2F3SA 3NP7A 5CDGA 2O19A 3G1UA 3EXEB 1G21A 3IDSA 4Z9AA 5FWDA 5EMHA 3AEQA 3P0JA 2DKNA 3MSXA 4JEUA 2ZJ0A 5IT0A 4B3RB 5DTQA 1N3IA 1SJ9A 1J2RA 1TE2A 3ROZA 1NJ2A 2GEKA 3WICA 1GR1A 3DOUA 4J16A 1CB0A 1GFSA 3NFRA 4JFRA 4IDPA 4ZIRA 2Y2UA 2BBSA 1CDDA 2V4MA 2VJAA 3DVQX 3FRIA 3OE5A 3PS9A 4LTDA 4NCXA 1JQ5A 1VLHA 2HU8A 4ZT2A 5LA6A 1V35A 1W581 1W5FA 2GWRA 5FFMA 2IKQA 1NXXA 3DBLA 2IZOA 1FC0A 1OTHA 4N7JA 5E4TA 4UOEA 1NVVR 1CJBA 2IUUA 2XGGA 3Q85A 5FV4A 3ZJUA 1LKZA 3QKSA 4NE2A 4R2MA 3RR2A 5CDYA 3EXHB 1SEVA 1OZ0A 3P96A 3CJRA 4AMGA 3VU9B 1I9GA 4MAMA 2FW1A 4NESA 2OFWA 3VNRA 4PCAA 4YJ3F 4FB5A 3BRSA 4EY4A 5B1YA 3EDQA 1QZUA 1ADYA 1QCZA 1VJ0A 2C0PA 3AJDA 1WS6A 4TL7A 1A9OA 1WOYA 5EFOA 3NVKI 2A7XA 1Q91A 3D6AA 3BX1A 5CRIA 3UMBA 4E2WA 4MQUA 2GZ1A 3KP1A 3F6SA 5BY2A 1H2XA 4C6RA 1GGVA 1TMKA 3WMWA 2ESRA 1QLJA 2GD1O 4G36A 2VQEB 3AR5A 3R6LA 2O2YA 1W85B 1TLFA 2J0UB 1KEEB 2V7QA 3A4MA 1DJQA 3KDAA 3NUGA 1K1EA 3JWIA 4GQBA 5IU6A 1CR1A 2GZRA 4O2BB 3TDNA 4HMPA 3ANTA 2I4IA 1RQRA 3JVVA 2CCJA 2VS1A 1W52X 3JVEA 4OKIA 2DTEA 2G82A 1I5EA 8AT1A 1DC3A 4G23A 1B16A 1ZM4A 3KKPA 4R16A 2OCIA 4RKYA 4Z4CA 4OI2A 2V7BA 3ZV3A 3T3NA 4KYIB 2HA7A 4BMZA 3T54A 1BD3A 1G8HA 2X6QA 1N2CB 3KM0A 3BCRA 3STYA 3L4KA 4PZUA 3C8UA 4NDZA 5DHUA 2LUOA 2C04A 4N8EA 4JASB 3RS5A 3GQBA 1FYWA 4UBLA 1YF3A 3OO0A 3EVDA 3F6YA 1T4GA 3IT3A 2PV7A 4JKIA 1ZD5A 1U0TA 1GPBA 2HC9A 3AEZA 4KH0A 4PHTA 3TD9A 3V32A 1I7NA 4BEJA 3Q7QA 2IPOA 4KDCA 1WR8A 2X5XA 3FCOA 3E5HA 3S7TA 3TIXB 1O96A 4IRXA 4ACAA 4BQFA 1FFEA 5HS4A 3ESAA 1XJCA 1VFNA 1ZO8A 3QEMB 1WPQA 4QBKA 1N9GA 2YTZA 2IFTA 1OWOA 4WNAA 4DMFA 2EXXA 2Y92A 1BWRA 4N54A 1T4MA 2LV8A 2OHVA 6NULA 4JOSA 3TWOA