5FM8A

Structure of the c-terminally extended domain my4 of human myomesin (space group p65)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm8A01
1FO0A 3HRPA 3PDOB 4P57B 5CEXA 5D8JH 4LCIL 3ULSA 2BVOA 1M7DB 3EJZC 3Q3GA 1A6UL 4C56D 5J0BA 4KVCL 5KVFH 4IMLB 5T3ZE 3STZA 1YEFL 4ZD3H 1DVFD 1GZPB 3MRCB 4FXGB 4X0KB 2RIKA 4PR5B 1N59A 3MRGB 1Q72H 3I6LE 3MJ9A 4POZD 3QEHB 4LSQL 3EYVB 1IBGH 4MLSA 2JIXB 4U1LB 4X8JB 5D1XD 4HJGB 5JDSB 3HE7A 3PL6B 1OGTA 5MEQB 2DRUA 5CMAA 5KSAA 4ZFZA 3SJVE 1ED3A 1RSFA 1CGSH 2I07A 4K7PL 5DJAB 5KSUA 3UBXA 4JO3L 2A73A 1IC5L 3FQRA 1YEKL 4HX1A 4JN1H 3IB4A 3W2DL 2DMCA 3O8XD 1I8LA 4UILL 2BX5A 1ND0A 5INCB 4B50A 1VACA 4JN2B 4OD2B 3U4BL 1F11B 4AEFA 2BOBB 5C0EA 3MV8D 4YWGL 5A16A 4MA3A 2B0SH 4Y16C 2PYEA 4GLRI 4NUGL 5F9WB 2VDRH 4OLUL 2CO7B 4O02H 3H3KA 3GSUA 5LGJA 4PJAB 3MNWA 4JY5L 3RI5K 3BE1H 3VJ6A 4N1HB 3T4AB 1L7IH 5D8JL 3ZZ1A 4L4TB 4QHLB 1R3KB 4FQQA 2C5DC 3NA9H 4P9MH 5KVFL 3HUJE 5IVOA 1YNTB 4ZD3L 2IMNA 3ESUF 4L4JA 4U3HA 3KLAA 3VMNA 5HHPA 1UJ3A 1Q9OB 1F4HA 3CPLA 2EDNA 2JJTC 2ICWB 1Q72L 1MHEA 4X5XA 4NZJA 1FJ1A 1IBGL 4PY8I 5AAMA 3QUYA 4JM2F 4APQC 5LGKA 4Z7VF 5GPRA 1OP3K 1CGSL 5CUSH 3CU1A 2YC1A 1E28A 3UCRA 2NYYD 4HWBA 3QIUA 3T0EA 1ORQA 1EFQA 4JN1L 1J8HE 5CJ5A 3QDAA 2Y5EA 2DM4A 3E6HB 3WHXA 5GGTA 2C9AA 3S35H 3RZCB 2HJFB 3RWCB 2V5TA 1WZKA 5CJQH 3HS0A 2B0SL 2CRMA 4G6AC 5T3XH 2VDRL 1I1FB 3UTSD 3GI9H 5HYQB 2IJ0C 5L0QB 3PL6C 3VFRB 3BE1L 3VD3A 4OI9A 5EN2B 1L7IL 1B3JA 3BUYA 3QXAA 2H8PB 3MPCA 2VLMD 2EIZB 2BMKA 1GGTA 3NA9L 3E8UH 4NN5C 4P9ML 3ZT5A 3X3FH 5GRXG 5BRZA 4WHDA 1QLFA 3I6GB 1OTTC 1X5LA 1KPVA 3JWOH 4YDIL 3QXDB 3V5HA 3MRMA 1EAJA 2GFBA 3FQUA 3SDCD 1YEDA 3SGDH 5GQBA 2VN4A 1U8MB 2QTEA 1ES0B 4BFGA 2B2XH 1YEHH 3T8XB 3BPCB 2YN5A 3FKUS 4FFYH 1Z9LA 1RJYA 3W9EB 4HUVB 3L3OB 1WC7B 1L4IA 5D7KE 1IL1A 3GSWB 4QKXB 1S9YA 3S35L 2W9EH 3C2AH 3D3VA 1B6UA 1MCWM 3FO2B 3KPNB 5C0AD 4C83A 4LLWB 4TVPD 5CJQL 1QKZH 5T3XL 3FQTB 1MLCB 3P30H 4LK4A 1ZHLB 3GI9L 4ONOA 5DR5H 4MJIB 5KAQG 4ZUTA 3D39E 2ATPA 3C8DA 4OAWA 3BMVA 3LY6A 1V3JA 2BNRA 4YHMH 2NX5D 3OF6D 1KPRB 5CP3H 3PV6A 3C60C 1S7WB 2NXYC 2ZNWA 3E8UL 3PGCA 4J4PA 1R3HB 5DC4B 4TUOA 4YBHA 3X3FL 3BEWB 5CINH 5DJXA 3MQIA 4IOSD 1HCFX 4KTEH 3RZCC 3FQXB 3JWOL 3HB3C 4Y4FD 5CKAA 2IH1A 4JFZH 3ARWA 4OB5H 3HNSH 1EVTC 1A9BA 3TVMD 4DCQB 3AVEA 1GC1C 2APTA 2DLGA 3WL9A 4JFFE 1CGXA 2UY7A 3TIEA 4IS6B 4UNVA 3G08A 3RWFB 1YEHL 4V1DA 3CNKA 4XCFH 5E08H 4FFYL 4GKSA 4EDXA 4YPGA 1FZOA 2Q8BH 4LHJB 4TRPH 4Z18A 5JOFB 5D5MF 2W9EL 3CDFA 3C2AL 3MBED 4UBDD 3REVA 1P4IH 1P7QA 3WHE1 4H26A 4NKDB 2BY3A 5HGAB 2H9GA 3B8YA 4HCRA 3HMXH 1QKZL 4WCYH 4DKDC 3IT8D 2Y9RT 3UXFA 3P30L 1OAXH 3V2AR 4JKLA 5HVWA 5DR5L 3QUMB 4ZOEA 4JLRA 1DQQB 4Z77B 4BUHA 3BH9A 1S5HB 4PRNB 2LAAA 5DVOA 4NUJA 4YHML 4ZAKB 1CFSA 1NGZA 5MP6H 5HHQB 4PJXE 3MRPA 5CINL 5D7JD 3FZUC 3TV3H 1EXUA 2XN9D 5FAAA 4KTEL 2EKJA 2CUIA 5HY9B 4JFZL 4ELKA 4OB5L 1G6VK 3HNSL 1KJVA 4MVBC 1HH6A 3LSOB 4BQ8A 2X40A 3W11D 4C54A 4HH8A 2F9BT 3LS5H 4E0RB 1G7IB 1RHHA 4XCFL 5E08L 5D1ZC 1PEWA 3EUUA 4N0FA 3IFOB 2GIYA 3ZO0A 1YYMH 2Q8BL 3WLBA 4L8BB 4TRPL 3P0YH 2GTZB 1J7VR 4NO2B 1P4IL 2R4RH 4XBGB 3KPPB 3HMXL 4WCYL 3ARTA 1C7TA 4LLUA 1FL3B 1OAXL 4MCZB 3B5TA 5EUOE 4RMTA 1A6VH 4XCNA 3OKOA 5DI8B 5GS1C 3UPAA 3IAQA 3DX9A 5MP6L 1W72A 4PREB 2JJSC 5DRWA 3QQ4A 2XKNB 3LHPH 4PV8B 4LHUB 3TV3L 2UVEA 4H25A 5J9PA 2DD8H 1KTRL 3TYFB 2W1NA 3RPKA 2RAMA 1MCSA 4JQXA 5D2NA 4MS8D 1AD9A 1NBVH 2WMPA 3LS5L 5ID0A 1C8PA 3QDGB 4FFWC 1GC1H 3TP4A 3CC5A 4U6TA 1G7JB 1J11A 1YYML 2GJ6E 3ARGC 4CBPA 3P0YL 2H2PC 4KMLB 4ZODA 4N5ED 1A3QA 3BPLC 3MLUH 1BIHA 2EDEA 2VLRA 3IFLH 1YA5A 4PJDA 3KPLB 2ZCLH 3BW9B 2F54D 4OZGA 2X9WA 4YHLH 3F58H 2R15A 4FQ2H 3C6LB 4HG4K 1QTYT 2V2WA 4C56A 4ZNCD 1A6VL 2VLJB 3EYOB 4EKXA 2FHFA 3PWVB 2ID5A 1BJ1H 1DVFA 1FVEB 2R0ZH 3FRUB 3JSSA 1X7QB 5HDBF 1RZJH 4QLRA 5JZ7C 3BKJH 4PJHA 3RTQB 5D1XA 3LHPL 3R8BB 4R0LC 3DIFA 2DD8L 2P45B 1BLNA 4WI9A 3L3KB 1BZ9A 3S96B 4GOSA 2FL5B 1OTSC 1NBVL 1OP3H 4NO3B 1V7MH 2MQ0A 3O8XA 4ESKA 3KPMB 4AEEA 3K8KA 1IJ9A 4S1RH 1WIUA 1GC1L 3DHMA 1TPXB 4R7NA 3MV8A 1XCQA 1QLRA 2NY1D 4NNYA 2V7NA 1JWMB 3NFNA 4PBVC 5TFSH 2OR8A 3MLUL 4MNQD 1JN6A 3IFLL 2ZCLL 3V6FB 4YHLL 2CK2A 5FGCE 4YBLC 3C09B 3F58L 5FF6B 4FQ2L 1CG9B 5FYLD 4OTXH 1ZLWK 1QSEE 2EYTB 1SM3H 3OSKA 4ZXBB 1XT5A 1CGYA 4TSBH 3KXFD 3VW3H 4RRPA 2R0ZL 4R4ND 5FA4B 1JZ4A 2VAAB 4D9RD 3SGEH 5EC2B 2A38A 3BKJL 2O5YH 2R2EB 2Y7QB 3OKMA 4CW1A 1U6AH 1PBYA 4I0CC 2HKHH 1MY5A 4JFXA 1KIQA 2GCYB 2APBA 2CD0A 1JYXA 2PUQT 3G5XA 1HSAA 4JAMB 4KTDH 3C6LC 1ONQB 4X6DB 1V7ML 3GJFA 4OZ4B 3X14A 3FQWA 4WNQB 5IMOA 4S1RL 4Z7VE 1RJZA 4ODUB 2COQA 5C07B 4MNGB 5GGUB 5K9QI 3T4YA 3KLHD 3T0VA 3QUMH 4CVZB 4CRPA 5F9DC 5TFSL 2P24B 4P23B 3UTSA 5IFAH 3QWOB 1KULA 2ZP0T 3O3BA 3PXJA 5IB3A 2GAZA 3CH8A 4JFDD 1UYWH 4OTXL 1SM3L 5ENWB 3S9DB 3S37H 5ILTH 1RZKH 2QR0A 4TSBL 1T7YA 5F89A 3U9PH 5CGYD 3EOAB 1GYAA 3VW3L 1N6VA 4PRDA 4XCYA 1FAKT 3DVNA 2HLAB 1TPXC 3IAPA 2EE3A 25C8H 2O5YL 3SDCA 2YBRB 3FOMA 4LGRB 3FFCE 3H7BA 4XBEH 1U6AL 2ZSWB 3KLDA 3QRFM 2HKHL 1BBJB 1EVUA 1AGDB 4RAHA 5E5UB 2X4TB 2MMXA 3C09C 4KTDL 3LKOA 4XX1E 3S98A 5T1LD 3DRTB 3O45A 1CD9B 4ZXBC 5ECJE 1T1XA 1ZT1B 5C0AA 3Q1SH 1N2RB 3QUML 4FFVD 1T0MB 2HLFC 3DXAD 3LKPB 4AIZB 1T2XA 5CJXA 3OKNB 5IFAL 1ZT4A 2ADJB 3OX8A 1A6TB 1QSVA 1YPZF 3I3EA 2HT2D 4NFBA 2IPUK 2NY5C 1UYWL 1J5OH 4LF3B 2NX5A 3OF6A 5F1IA 3S37L 5ILTL 5EZIH 4Y4HD 1RZKL 2PXYD 4MCYB 5H2BA 4PJ7B 1EEYA 3U9PL 2UZXB 3PXHA 4XAKD 1ZTXH 4Q74A 4JPIB 4Y4FA 4JEGB 1RAMA 4NKOA 5DFTA 3QG6A 2FWOB 4WIQA 3QQNA 25C8L 3TVMA 1ZWIB 2CLZB 4XBEL 2XQYK 4N90D 5FGBA 1GOHA 2XT1B 5SWZE 1VPOH 2AJZA 1ZE3C 5E6ZA 3M8OH 4ACPA 3VXME 1UACH 3G6JB 5J1TC 2X1QA 2OQJA 3RWGB 3BN9C 1TQBB 3HI1B 4PGEA 1VADA 4GW5A 3O6MH 3MBEA 1TZIA 3JBG7 2R0KH 4P2RB 3Q1SL 4GRMB 3RNQB 4LSUH 4KGJA 3HAEB 4KHXH 2DQTH 4CN6A 3EW3B 2EDBA 2D4FA 3G6AB 4PGJA 4OUUA 5D5ME 5IVZA 4QTHB 3PQYB 4JFQB 5E1AB 4OGAC 3WEXB 5ANMA 4JY4B 1S78C 2NR6D 3PGDA 1J5OL 5EZLA 4KI5C 5L8LB 3FB5B 4BM7A 3K80A 2VQ1A 3CFKA 4P2CG 5EZIL 3RDTB 1G7MB 1JWSB 2V9QA 5D7JA 2XN9A 1ZTXL 1U8KB 3KJ6H 4ODVH 3SPVA 1KJ2B 1UB5A 3U48A 2PETA 2BCKA 3ROOB 4X9FA 4O9HL 4D0BB 1R5VB 3A67H 1RZ8B 4R97B 2FJGA 4U1JA 4YGVA 3SO5A 5DRZA 3SGEI 5C0NC 2XWTB 3BP4B 1RU9H 2NY7H 3PHSA 4IM8A 1VPOL 2FH8A 2GQHA 3DUSB 4HS8H 4LHUG 4RWHA 4Q9RH 4LRIC 3M8OL 5IHZB 4NQDB 1UACL 2WBWB 1KJMB 3RU8H 3VXPA 2NNAB 3O6ML 2R0KL 5B3JF 5J3HD 4JPWH 4QXUH 4LSUL 2GTWA 1A2YB 2EDXA 3ARFB 2DQTL 4LLMB 1F2QA 2BZDA 4IIQA 4L4VB 3U4EA 5DQ9B 2RJMA 4QNPF 1NGPH 1FNGA 2VLKB 4QCIB 1F6AA 1TQBC 1R5IA 1HHKB 3QI9B 2D7MA 4C55A 4LVNB 3KJ6L 4ODVL 3ABZA 2QSCH 2DN7A 5HPMA 1L0QA 1S7QA 3IDMA 3A67L 3SE3A 1JUFB 4KDWA 1AP2A 5DRNA 2XWBA 5ELIA 3IU3A 1RU9L 2NY7L 3DSNA 5JPMB 4LARH 4HS8L 4JREC 4Q9RL 1KIRB 2ENSA 4HZLA 1CE6A 5FB8A 2APXA 3SDXF 4F7CA 4JDVA 3RDTC 1J0JA 1F3DH 3AC0A 3RU8L 4CGTA 2NY6B 5BVJA 3MRKA 1RJCA 4JPWL 4QXUL 4ODBD 2F54A 2R8SH 1TTUA 1A47A 3BIBX 3QDJD 2XWJA 1A8JH 1SBBA 4R97C 4E41E 4JJ5A 4PLJD 3VXSD 5A43C 1NGPL 4XHQA 1ZLWH 4AEIH 3HC4H 3LKNA 4QRRE 1JYWA 1NLDH 1IGTB 3SKOB 5HYSB 5IF0A 4LLAA 1X4YA 5JR1H 1Q94B 4OI8A 1EEZB 2CRYA 3BRGC 1NC4B 3QFJE 2F53E 2R23B 4O51A 2QSCL 2NTFA 4P5MB 1PKQB 4TNWK 3ARFC 2XNAB 1S7UA 5HDBE 2OS7A 1R5WB 2MTPA 2UZIH 4GG6A 5EOCH 4U1IB 4LARL 5D7LB 3G5YB 3ULVF 4RSVA 1C16A 2A0LD 5IK3B 1T1ZA 1J8KA 4K8RD 4UAOC 1NPUA 4UQ2B 1NJ9B 2XFXA 4MNQA 1IRAY 3VRIB 2Z93A 4LVNC 2AXFB 4HFWA 4MHHG 4ZO9A 2R8SL 1SYVA 2DBLH 3CAFA 4XP9H 3DTXA 2Y07H 3ZKMC 5ACZB 1O7VA 3BISA 3VXNA 1OF2A 4JCMA 3MV7E 1IKNA 3KXFA 1I4FB 3DURB 4HLZH 4AEIL 3HC4L 1XZ0B 4Q2ZB 4NO5A 1NLDL 4YH6A 6CGTA 3B5GA 1WQVT 3BWAB 4NJ9H 5JR1L 4Z76A 5DFVC 2NY6C 3ECBA 2F5AH 3NN8B 3IXAB 1ZA6A 1QLEH 5FYJH 3GSRB 5J57B 1U8QB 2ADIA 2UZIL 5EOCL 5EU5A 4F9PA 1I7UB 1BOGA 3HAEH 5A2LH 1CQYA 1ZKAA 1I85A 2BY0A 2R2HB 3H9YA 3BESR 1KTDA 3KVQA 1MLBB 4KZDL 4WW2F 1I3RB 4MSWB 8FABA 3WLWC 5I74B 4F37K 3GIVA 5DMGC 2DBLL 1WBZA 4PJ5B 4XP9L 4WGVB 2Y07L 1LEKA 5FUCC 1FNLA 3LEVH 4JFDA 5HHMD 4M7JH 1I9JH 4D9LH 5JO5A 1FFOB 4YX2H 2BNQB 3VFTA 1KJ2H 5I16B 4P48A 3L6FA 3QEQD 5EO1A 4H1LB 2BVTA 3TO4C 1ODAA 5I19H 4LHQB 4WFED 2A6JB 2YSSB 1G7HB 4NJ9L 2EIBA 3BGMA 1MREH 2DIJA 5LKNA 2F5AL 3V0AC 3WO3B 1A6WH 5F7YC 4BQCA 5GGQH 1QLEL 2M8XA 5FYJL 5HHOD 3EYFA 3LN5B 5T1LA 1HQ4A 1A1OA 3R06B 1BD2D 3KPRD 4HLZG 2R1YA 4JFYB 3QIBD 1IAII 5C9KA 1TMCB 4KK9D 2OXGA 3DXAA 3LAFA 1DUZB 4HDIB 1N8ZB 3MJ7B 5IR1A 5DJ2B 4KK6D 5FDWA 5F3HB 4H0GA 5DJCB 2ESVE 1N64H 4FQXD 5KZCB 4CN4A 4WUUD 3N1GC 3LEVL 5C6PB 3VXRE 2OL3B 4M7JL 1I9JL 4D9LL 3HAEG 1KF9B 4YX2L 1KJ2L 4Y4HA 2PXYA 1XIWB 5FKPB 1RPQA 4PLKC 1UB6B 4L3EB 2WWMD 4Y19D 1JNJA 2NY0B 5DMJB 3IDGA 2J2ZA 1YPZE 1Q38A 5I19L 2PW1B 4XWOC 3QIWB 4K9EC 2ZOKB 3OBAA 1MVFA 1MREL 2OJZH 3D0LB 1P4BH 3BQUD 4M7ZB 5I74C 1A6WL 1V7NH 2FO4B 4C57C 5GGQL 4NQSB 1MRCH 1ZS8A 3RX8A 1ZEAH 2P8PB 1AO7D 1I7TB 2PW2A 1WICA 5ICXB 4ZPTA 4BQ6A 3C08H 3RWDA 4IRJB 3BJ91 4JHZA 1OHQA 3EAKA 3LKRB 3U4AA 5L2JA 2CQVA 3D87B 3VA6A 1RHFA 1J0YA 1N64L 3VH8B 3PWLB 2D9QB 1MCDA 2AEPH 4H20H 2XQYG 1AIFB 1JPGB 5E8EA 5FUCE 4PY7B 1QEWA 1NDGB 4YHYC 4K7PY 3SDAD 1RK0B 4M9PA 1XGYH 4OZHE 2X9XA 4PLNC 3HRZB 3MMEB 5F9AC 3DX7A 4BSVA 3OB8A 2OBGA 1FN4B 4ZFOB 4MJ5A 2OJZL 2VL5B 5E8NB 1TITA 3MNZB 2FEDD 1P4BL 1MHCA 1ZLVK 1M7XA 4YGAB 4KY1H 1V7NL 2PYFB 4R2GC 4LAJH 4X6CF 2I9LA 2AJ3B 4P2QD 4LPXA 3CJJA 3Q6GH 1MRCL 1ZEAL 3AS3A 1JGVH 3L3GB 3Q5OA 1LEGB 2EDRA 1B0WA 5KVEH 1TZHA 1T89C 3MLTA 1XIWC 5EU3A 3C08L 3BPNB 4HIEB 3AU1A 4QYOA 3P9MB 3T0AA 3PWNA 1F3RB 3ULVC 5EO0B 5KS9F 1HXMB 2VE6B 4G42A 4U2YA 1BF8A 1F90H 5A2KH 5B3JE 4M7ZC 1ULVA 4MGXA 2AEPL 4P49A 4H20L 1NBZB 4UZGA 1H0DA 2KL6A 3FRPG 1FVCB 1BBDH 3L5WB 1FH5H 3AM8C 5CEXB 3ULSB 2BVOB 4FXLA 4MQ7B 3Q3GB 3D5OF 1NCTA 3ZDZF 2V2TA 3MRBB 4PRPD 2BXZA 1XGYL 4IRJC 3STZB 1B9ZA 4NZRH 1OB1A 1TFHA 3JV6B 2X4SA 2DM2A 4DN4H 3SGJA 3WJJA 4M6AA 4HWUA 3EJYD 4QOKD 4K7FA 3RZWA 1N59B 1T83A 3P4LA 3BI9X 2IH3A 5HYSG 4HGMA 1OGTB 4KY1L 5CMAB 5KSAB 4K9EH 3W0WB 1ED3B 1X4ZA 3Q6GL 2I07B 2XXCB 3UBXB 3UTTE 5KSUB 2WBKA 4RGND 1JGVL 5KVEL 4XVTH 5LVEA 1FG2A 5GZOC 3ARPA 3FB6A 3DV4A 3CSGA 2HT3C 5F97E 3KYOA 2MQCA 1I3GH 1S5IH 2FBOJ 1ZHBA 3MNVA 1D9KD 2J12B 3QDJA 4H1LH 1LNUB 1LO3H 5C0EB 1GH7A 3SDXE 3JTSA 5E6IB 4RFOH 5A16B 4MA3B 4Y89A 3WFHA 4L8CA 1FZMA 2PYEB 3IAGC 4KDTC 4WW2C 3VXSA 1F90L 3L5XH 5T1MA 1DANT 3ZYIA 4WI3A 3GSUB 4HIXH 3MNWB 5GGSY 2EZ0C 5F1KC 3TIDA 3VJ6B 2ENYA 2CKBB 3GM0A 5JHDD 1BBDL 2A9MH 1FH5L 5ISZE 2M26A 1E27A 1OAKH 2OSLA 4A6YA 4PJIA 3UPCA 4FQQB 5C08B 5H94A 2Z0BA 3BPNC 4NZRL 5IMKA 1O7SA 2AAVA 1IEAA 3KLAB 4DN4L 5B21A 1S3KH 1UJ3B 4QRPE 4AMKH 1AY1H 3CPLB 4UIKH 5DD6A 4J3SA 1MOEA 5L88H 1MHEB 2F8VA 1FJ1B 2VJXA 2LVEA 3NFPA 4EI5D 1LD9A 3QUYB 4K9EL 2EO9A 3O2WH 3OMZA 1N7MH 2VWEC 1E28B 4XVTL 4WY7H 4JY6A 3QH3A 3WHXB 1MFCH 2VAJA 1I3GL 1S5IL 2OL3H 1BP3B 3OR6A 1IQWH 2ATKB 1LO3L 4FNLH 5I9QC 4RFOL 4LRNH 5DD3H 1XCTA 2PF6A 3ULVH 1JIBA 3L5XL 1FG9C 3B9EA 4PJBA 5KSAC 4HIXL 5EU6D 1U8OB 3SOBH 5JW4M 5EC1B 5ESAA 1LDPH 2A9ML 2JLLA 1QBMH 3BUYB 3PDGA 3QXAB 5IFJA 1OAKL 4YDLC 4YQXH 1WWCA 4FQIH 5T1KB 5BRZB 5HYFA 4N9GA 4LKCA 4H1LG 4WW1A 2HT4C 1KPVB 1S3KL 4AMKL 5HYJE 3V5HB 1AY1L 3MRMB 4UIKL 4PRIE 3VD4A 5L88L 2GFBB 5E6IC 3FQUB 2GY7B 5E8DH 5IGXH 3OAYK 4UT6H 4HBCH 5DQDH 3RUGA 4PPTA 3UMTA 3O2WL 1JRHI 1KIPA 1QA9A 3F12A 3MUGA 1N7ML 1RZ7H 2DKUA 4KJQC 5F96H 1P84K 3BZ4B 4WY7L 5IBLD 1RJYB 5D72H 5E7FA 4PGBA 2NW3A 2PTTB 5L8KB 1MFCL 1S9YB 3OKEB 2OL3L 5IW3A 1KXQE 5ETUA 1QFPA 5D9SB 4QXTA 1IQWL 2E7BA 2A6IA 5ACMA 4C83B 2HMID 3GHBH 4Z5RB 4FNLL 4BZ2H 1REIA 4LRNL 5DD3L 3ULVL 3QEQA 5FYKU 5T3ZD 1X5JA 4ZPVB 2R9HD 4ZUTB 5L2KE 2ATPB 3PJSB 3SOBL 5DTFA 1LDPL 4ZUWB 2X5PA 1QBML 1HOCB 3TYGH 4YZFF 4YQXL 2E6QA 3SE4A 3F62A 5HYIA 1NEZA 3PV6B 3TWCH 3PGCB 4TUOB 4FQIL 3UJTH 5DJXB 5F3BA 4KAQH 3SY0A 3SJVD 2IH1B 5HHOA 4M93B 5LWYH 1MCRA 4XC1H 5J13C 1BD2A 5E8DL 1FIEA 1A9BB 1HQRA 1HWGB 3KPRA 4UT6L 5IGXL 3QIBA 4HBCL 2VITA 3B2UD 3MTRA 5DQDL 3WL9B 3H9SE 3TIEB 2AKRA 3G08B 5EBGA 4V1DB 5KJRH 1RZ7L 4P5KA 5F96L 2B8OT 4GKSB 5D72L 5GS2H 4EDXB 1G84A 4P4RA 5D93C 4YPGB 1FZOB 2FECL 4HK0A 1KCLA 1A5FH 5DJ6A 3P4OA 4TTDC 4RMVA 4FQXA 3REVB 3IKCA 4QRQA 3Q6FA 4WUUA 2GITA 3GHBL 1KG0B 5IJKC 4BZ2L 1YNKH 2Q86A 1FZJA 4Y19A 3ZHDA 4ZFOL 4X7TA 3MJ9H 3EO1A 1ZAGA 4NUJB 3VH8G 1SQ2N 1CFSB 3TYGL 1OT1A 3TWCL 3MRPB 1X5GA 5JW4R 1B88A 3UJTL 3BQUA 4KAQL 3FFDA 5C71A 4KK8D 1G9MC 3BX7C 3MZGB 4ELKB 1PJ9A 4ZUSA 5LWYL 1KJVB 2GW5A 4HK3J 4XC1L 1AO7A 1HH6B 5I1EH 5BS0E 1ZLVH 2W65A 4JRYE 1P53A 4GRLB 5IW1A 2GSGA 5JXEC 5T3XD 4IEFB 1NCAH 3C5ZD 1H5BA 5KJRL 3MGOA 4TYUA 4K3EH 4TQEH 5DLMH 2F8XC 1HCVA 2NCMA 3RA7H 1T0NA 3WLBB 1A5FL 1K3IA 2CKBH 5DD5H 1A14H 4K3GA 4LCYA 1AFVH 5CIPB 1WSST 4JFOB 3KPTA 1E4XI 4OQ1A 4PTUB 1LO4H 3CX5K 1YNKL 5F7FA 3EJZD 4FQHA 3U7YH 1UVQA 1XF4B 4F7MA 3SDAA 3OKOB 5SWSE 1NFKA 3MJ9L 3IRZA 2ED8A 5JMOC 3DX9B 3MRIA 1ZXQA 2YD6A 4KI1A 4FABH 2YPKA 3E3QE 2A83B 4H25B 4HWBH 5J9PB 4JQVC 3LV3A 2WW8A 4P2QA 3EDKA 5I1LA 1BWWA 3ZDXF 1I1AD 1YQ2A 4I1NB 4XZUA 3ZKNC 3TESA 3QXTA 5I1EL 2VH5H 4GKNA 4BH7A 5D7KD 1AQDA 5F72S 1AD9B 2FATH 1NCAL 4EBQH 3EOBB 4X6CE 3S4SB 3FAWA 4K3EL 4TQEL 2BNUA 5DLML 3DX6A 4I48A 3CC5B 4DEPB 3UBXG 3RA7L 2FR4A 4Y16D 4U6YA 5HDOA 2CKBL 4FP8H 3D39D 4JM4H 1A14L 5DD5L 5DZLA 4E5XA 1AFVL 2VLRB 2D0FA 5KS9E 4DW2H 4OZGB 2GJZA 2APVA 1KYOK 5DJYA 4D9QE 1LO4L 1VB9A 1TJHH 2V2WB 1GGCH 3U7YL 4C56B 4GRLC 2RCSH 4PRPA 3QISA 4PJCA 1DN0A 1YMME 1NC2B 3BPOB 2CDEA 4NP4H 4QOKA 4LSPH 4FABL 1IGJA 2AK4B 4RMWA 4LDLB 4L8SA 4PP2A 4PJHB 3GJFK 5FDYA 5D1XB 1QFHA 3ZDZE 4FZEH 4HWBL 3IJSA 4APQD 1N0XH 4HIIA 4F58H 1BLNB 5KN5A 5ESVB 5ABDE 1BZ9B 3SKMA 1DQLH 2HJKA 5HGGS 2VH5L 4JZOA 2NY2B 2ZCHH 3BXNB 3TJHC 1BM3H 1P1ZA 2FATL 1FL6A 2EKSA 3O8XB 4Y2OA 3WN5A 4EBQL 1D9KA 4KJPC 2O61A 1K5NA 2I25N 4R7NB 3MV8B 2LV4A 3T04D 1XCQB 4G6AD 1QLRB 4NNYB 5IEKB 2V7NB 2JIXD 2ZUYA 4FP8L 4JM4L 3PL6D 4NC0B 3BSZH 1JN6B 4IOFC 4DW2L 3OGCA 2V7HA 4MX7A 4PJGA 5JHDA 1AGCA 1N5AA 5HTSA 1TJHL 3LPGA 3ZYOA 3PNWA 5CSZB 1GGCL 1KC5H 3UPRA 2RCSL 4MLIA 1OTTD 4HK3N 4JG1H 4PBWD 2X4OB 3QJHB 1F4YH 4ENEC 4NP4L 1NH6A 4LSPL 1PYWA 4ZDHA 4UU9B 1E4KC 4EI5A 2EYRB 4FZEL 1N0XL 4XNYH 3T0WA 1A7PH 4F58L 3OKMB 4CW1B 1DQLL 4JHBA 1W0YT 4Y5XA 1KIQB 3OAYH 1HSAB 1MFNA 1BM3L 2PR4H 4KJYA 2SEBB 2O93L 4M1CD 3GJFB 3UP1A 4TNVF 2JB6A 4HCRH 1RJZB 3GMLA 5INDA 2VISA 2YRPA 3EDJA 3BPOC 3T4YB 4FHBD 4LVEA 3QNZB 1J86A 1NBQA 5D1XC 5HI3C 3UTSB 2X70A 3V5DA 3BSZL 1LK2A 2EC9U 3QO0A 3O3BB 5EU6A 4NGHH 5I8OH 4XCCH 1H3TA 3V6OC 5IB3B 4OLVH 2OTWA 2A9NH 2EDJA 4ZNEE 1MUJA 2NY2C 3C60D 2NXYD 1KC5L 1T2QH 4N1EA 1WWAX 3AROA 1NGWA 4JRXE 5F89B 4JG1L 3RZCD 1JNHA 3DMMC 3HB3D 4OF8A 1F4YL 4XCYB 3DVNB 1OT2A 3DBXA 2F74A 1YY9C 4A2LA 1EMTH 1CD8A 2BERA 2P44B 3ETBF 1PAMA 3CMOH 3FOMB 1T7WA 4XNYL 1A7PL 1OWWA 1QSFE 2APFA 1M71A 4O58H 5IESH 2JK5B 2XY1A 3N0PB 2Q6WA 2OTUA 3TT1H 3LKOB 1CQKA 3RHWF 1JGEA 3CDGA 4M8VA 2EE2A 4H5SA 4HCRL 3D6GA 5SX4H 4XH2B 4Y8AA 5JPNB 5CGMA 2VKWA 3O6LH 5BZDA 5C2UB 4JFEE 1NQBA 1FYHB 4C4KO 2NQCA 3OX8B 5E99H 4JHWH 4NGHL 3VG0H 4I0KA 4XCCL 5I8OL 3EGSA 4FXKA 4OLVL 2A9NL 5J89A 5F1IB 4CMMA 4R90H 4V2CB 1T2QL 4MDJA 3FZUD 4PJEB 1EEYB 3SJVA 4NFDA 3KPSE 4Y4FB 4O5LH 2DM3A 4MVBD 1OW0C 4CJ1A 1EMTL 1WAAA 4YZFE 4WHYH 3CMOL 1FFRA 4HJJH 4MJID 2C3GA 1CD0A 4WHTB 3HPLA 3BEVA 4O2CA 4O58L 5IESL 2AJZB 2FO1A 5D1ZD 4GAYA 4MJ6A 3TT1L 2WIMA 4MXWH 5AEAA 4XMLH 2C3VA 1W8OA 5HVFB 4PGEB 5I30H 5D6DA 1CLYH 1KUMA 1VADB 4GW5B 1TZIB 3MBEB 4I4WA 1A21A 2Y06H 4PY8J 3O6LL 3P9LB 4Z7UA 3KS0H 1AC0A 1T6VN 2VDMH 4OD1H 1OARH 4OLWH 5E99L 4OUUB 3FQNA 5IVZB 4JHWL 5ICZB 3VG0L 3TC9A 4IDLA 5I2IA 2YUWA 5ANMB 4TPRH 5IEHA 3PGDB 2NTSP 3GMOA 3NCJH 5EZLB 3MUZ1 2VIRA 3QA3A 3WFCH 4R90L 2VQ1B 2WQRA 3CFKB 3I6KB 4KKCC 3EO9L 4RNRA 5D7JB 5DUPH 2XN9B 4HWZA 4BK5A 1Z0NA 4NPYA 4HH9A 4O5LL 4PJ8D 1UB5B 3I02A 4OZIF 1A0QH 1M6OB 3NPSB 3WKNA 3L7FB 2FJGB 4U1JB 4HJJL 5JIIA 4JM2D 4YGVB 4QRUA 5DRZB 5CLWA 2IPKB 2DYPD 3C5ZA 1LP9F 4FFWD 2XV6B 1G0DA 5MI0B 4MQXC 4MXWL 3SCMC 3ARGD 4XMLL 4PG9A 2H2PD 5I30L 2GUOB 1CLYL 4ETQA 2WINA 3RVVC 2Y06L 2YHGA 1A7OH 5IHBA 1IMHC 2HVJB 4Y4FC 2AJVL 4WHYG 5C09E 2GTWB 2WAHA 1OQXA 2VDML 3MRHA 4OD1L 1DDHA 3S4SG 1OARL 1VEMA 4OLWL 3REWB 4IIQB 1H3VA 3ME0A 2MHAA 5SV4A 3IDYB 3GK8H 1G7LA 4TPRL 5JIKA 4W4OA 3NCJL 1FNGB 3VCLA 5E9DE 3WFCL 1SYSA 1F6AB 2DF3A 5DD1H 1J12A 2YPLE 5DUPL 2H32A 1S7RA 3MBEC 4DZBA 2DL2A 3P4NA 1BFOA 5EU7C 3KYMB 1I1AA 3GJFH 3O0RH 1A0QL 4D3CH 1OGAE 1S7QB 1OPGH 1OTSD 1AP2B 2QLVB 1T7XA 4PBXA 5DRNB 4ODWB 1ZA3B 3IU3B 5HXMA 4NC2B 3ISWA 2DQGH 4K3JH 3ZDXE 4LQ1A 1N5YH 1WFUA 2XTJB 4HZLB 1CE6B 4LSDA 2QSVA 5FB8B 4Y16A 4F7CB 5DURD 4JDVB 1U3YA 4ZYKB 4HV8B 3V4PH 4LHUD 3D39A 4WWID 1X6NA 5D7JC 4Z0XB 5D7IF 1A7OL 1K85A 4JR9H 1CDJA 3MRKB 5BCAA 1AR1D 1DP0A 2F54B 4HPOH 4I5BA 4F7PA 2XWJB 1BGXH 5LXGH 2MWCA 3NPSC 4J3UA 5SX4I 3TZVC 5E4EC 1R3LB 4KGLA 5TF0A 4JJ5B 1NFDF 1BEYH 3GK8L 3TH2T 4FRWA 5FCUH 4XNXH 3LKNB 2JJTA 3GB7A 5CLTA 3FN3A 1L0YA 4LAQH 2HFGH 5DD1L 4Y0GA 4ZSOE 5IF0B 1F45A 3VFUA 4APQA 5SWZD 2HN7A 4O51B 3C9NA 2H6PA 2NTFB 2BJMH 3O0RL 4D3CL 1JJUA 4HKJA 3C6LD 1M7DA 1KOAA 3EYUH 1OPGL 4XXCC 5DSCB 4AQ1B 4GG6B 4H8WC 1Y6MR 5E2TH 4QWWD 1VFMA 2DQGL 3MRCA 4K3JL 2YD7A 4YR6A 1I9EA 1N5YL 4F9LC 1C16B 3MRGA 4FQCH 3RVXC 2NY1B 3EYVA 2JIXA 4X8JA 1ERNA 1HXYA 3V4PL 2XFXB 3PL6A 1WISA 5MEQA 4MNQB 5B39B 2Z93B 4JR9L 2FCBA 3K4DA 1SYVB 4HPOL 3DTXB 1GGUA 1I1YA 3BYYA 5LXGL 1BGXL 5DMIH 2OZ4A 2O5XH 4PJXA 3HCVA 1BEYL 2P43B 5C0BE 3RAJH 4U1MA 4XNXL 4JN2A 4OD2A 5FCUL 3MCKB 1F11A 2BOBA 5EB9A 1BAFH 4IDJH 2XTJC 5IP4A 4LAQL 4G8GE 2HFGL 4YFEA 4Z76B 4NQCE 2HA1A 5HGHA 1CIUA 2EDYA 2LU7A 2BJML 4Y1AE 1ZA6B 2VMFA 3EYUL 4QHLA 3L9RB 1R3KA 5L7XH 3IS0X 4BQBA 4LKXB 4WI7A 4YO0A 1NMAH 1BOGB 5E2TL 5AYQA 4D0DB 1XF2B 2ARJB 4EUPA 2HLFD 1WTLA 4FQCL 3DVGA 3BFOA 4NNXA 1EZVY 4RQQA 4HKZA 3DNKA 2P46B 5EUOA 4Y4KB 1KTDB 2FB4H 8FABB 2R4SH 5ITFA 1WBZB 2OP4H 1LEKB 5DMIL 3OG4B 2O5XL 5D4QA 3C60A 1MFEH 5KSBF 5DC0A 1J0HA 5JO5B 4OCYH 1RMFH 1IM9B 1J0IA 5EO1B 3FB7A 3RAJL 3RZCA 4XHJD 4GKOA 1BAFL 2CR3A 4IDJL 2P8LB 5E1HB 5AZEH 2IFFH 5HYQA 3BGFB 5CWSB 4DTGH 4XPGH 4NBXB 3EDDA 3IS1X 2X7LA 1A6AB 4OM0L 1TVHB 3EYFB 5EIVA 2EIZA 1HQ4B 3MGTA 5L7XL 3FL7A 3BN9D 2R56H 5D1QC 1NFDB 5LG1A 1NMAL 3ILPB 1JZ5A 1BQSA 1IGIH 5LQBH 4F7TA 4Z9KB 3QXDA 3DXAB 2OX5A 2P5WB 5IR1B 1BVLA 1SY6A 4GKZB 4E41D 1EBAA 1U8MA 4H0HB 5LCVH 4MQTB 2FB4L 4OGAD 3GSOB 5EA0H 2R4SL 1LK3H 1T1WB 4HEPG 3BPCA 1S78D 2OP4L 1AXIB 1AXTH 3CZFA 4QRRD 3WS6C 1KXVC 1AGEA 1PG7H 4NHCH 4KI5D 1IZKA 4WFGE 5GRYA 3W9EA 4HUVA 1MFEL 3VRJA 4ZUVA 1MFDH 3TA3B 4MB3A 3MFGB 4OCYL 1RMFL 4Y4HB 2PXYB 2VZUA 4XAWH 1IARB 3JTTB 2RQ8A 4O2FA 2F53D 3IDGB 3IDUA 2B39A 1Y18A 3MV01 4DJMA 5AZEL 2DI7A 3MGAA 1J0KA 3FQTA 1MLCA 2IFFL 3MLVH 4Y4KC 4DTGL 4XPGL 4MJIA 2J8HA 4M61A 5ALCH 5EIIB 2HWZH 5C0ND 3B9KD 5C0GA 5D1ZA 1K4CB 32C2A 5LJYH 1S7WA 1EV2E 5KANG 1R3HA 2PW2B 3BEWA 4Y2DC 1IGIL 1XGTA 2AGJH 2CUHA 5LQBL 3FQXA 4KC3B 3RWDB 3FOLB 2CLVA 3OKYA 2G9HA 4HWNA 1EAPA 4LSRH 1TVBA 3VI3F 4DCQA 3MV7D 4FZ8H 3QCTH 4CJ0A 4TSCH 3BGFC 2D7TH 1VA9A 3BT2H 5LCVL 3RWFA 5EA0L 3CZJA 1MFBH 4DUVA 1LK3L 5BXFA 5GS1A 1AXTL 1TNMA 1PG7L 4NHCL 3V95A 2JJSA 3UTPE 2I5YH 5E8EB 1CXLA 1MFDL 4UUJA 1TTFA 5JOFA 1QEWB 4NQTA 4XAWL 3SDYH 3MA9H 1DZBA 1MRFH 1HH9A 4P2RD 5E95B 3QEUA 4NKDA 4XI5D 4PJ8A 1BVZA 2EIDA 2BRRH 3DX7B 4BFIA 4BSVB 2K1MA 1MH5A 4Z0BH 2A74A 3MLVL 4MJ5B 3CVHB 4HIJA 4JM2A 5ALCL 2HWZL 1DQQA 4Z7VA 4DOHE 1S5HA 2DYPA 3VU2A 4OZIE 2I9LB 4O00A 3ARGA 3FCTB 3TA3C 1TZHB 1ZVSA 2X09A 3I84A 3RDTD 5ICYA 3MLTB 5EU3B 2AGJL 4KXZI 5K93A 1LP9E 2V5SA 2OM5A 1NL0H 4U0QB 4QYOB 5FYLH 1RK1A 3PWNB 3SKNB 4EXPX 3MRDA 4LSRL 1I9IH 2D9CA 3LSOA 4FZ8L 3QCTL 3DSFH 1CWVA 4TSCL 2D7TL 3BT2L 2EXYC 3O4LE 4EVNB 4E0RA 1MFBL 1G7IA 2YKLH 5TDNA 2I5YL 3IFOA 1H0DB 1IGYB 2G2RA 2QBWA 3PWPE 3Q5YA 3SDYL 3MA9L 4NO2A 1MRDH 1MRFL 4R0LA 2KZ1B 2J8UF 5F6HI 4AM0A 3WO4C 3DX8A 5IHLB 2BRRL 1OB1B 5EBLB 3THMH 2DB8A 3K3QA 1JZ8A 1FL3A 4Z0BL 5B8CC 4MCZA 2CXGA 2FEEI 3OPZH 2IH3B 3HC0A 4JHAH 4X99A 4P99A 3EKCA 3X11B 5MENE 1G9EA 3FT4B 4S1SH 2Z31D 4GUPA 3QJFB 1AHWB 4NKMA 2QADC 1K8DB 2XKNA 3K4AA 5F1SA 1WWWX 4BJLA 4OCXH 1FG2B 1J87A 4I2XB 1QBBA 1NMCC 2UV3A 3FB6B 4LHUA 4PV8A 3ZT6A 3DV4B 5FV2A 1NL0L 5FYLL 3TYFA 1ZHBB 3MNVB 1CT8A 4U49A 3VXRD 2P5EE 1I9IL 3QDJB 2W91A 4OV5A 3DSFL 2QEJA 3JTSB 1DBJH 3WFHB 4L8CB 1FZMB 3QQ9C 2VERN 2EICA 3VXSB 1A7QH 2YKLL 3VFSB 5D7IE 5T1MB 1CDUA 4YDKH 5B39G 3TIDB 2Y5TB 3ARBB 3GKZA 5JOPE 1E27B 4U1GB 2OSLB 3VD7A 4A6YB 4PJIB 1MRDL 5DFVD 1ACYH 2NY6D 5H94B 5SWZA 3X3GH 5IMKB 1UA6H 3C8HA 3THML 3N06B 1IEAB 4H0IA 2RGSA 3LEXA 3C6LA 1V3MA 3EBAA 5DD6B 5HGBB 5GRJH 3OPZL 4XGZA 4JHAL 3EYOA 3OKLB 3PWVA 1UM5H 1LD9B 1T21B 3QUXD 4N9OB 3RIFK 3GNMH 4S1SL 3TBSA 3ZE2F 3F8UB 5FYJU 3MUHL 4OCXL 4JY6B 1UADC 1IQDB 2LVCA 3QH3B 5FXCH 1NC4D 3WLWD 4WFFD 5DMGD 1QR4A 5IQ7H 3MRFA 3IDXH 1DBBH 3S8WA 1JGLH 4OCSH 2FL5A 4NQXA 2BY2A 1R6VA 1DBJL 5EFIB 2D0GA 3IRPX 1XCTB 4A2MA 1AR2A 4AG4H 1A7QL 5KVMC 4UINH 4Z7QF 4PJBB 2KUTA 4RGMC 3CXHJ 4YDKL 5D7LD 3TO4D 2MPAH 4G3YH 3ET9F 2YXMA 2W38A 2WM0A 1AHWC 5ESAB 3J8F7 3LVEA 1JWMA 4UMGA 1YC7A 4XNMA 1RZIB 3JUZA 1ACYL 4L1HA 3X3GL 1B0RA 1UA6L 4N9GB 1K2DA 4LKCB 4YJZL 2W9DH 4WW1B 3HA0A 5FF6A 3VGGA 1W0VB 3TGXA 5E70A 5J06A 5GRJL 2Y25A 1RD6A 1BIIA 1UM5L 4PJFF 1MCLA 3RY6A 3GNML 3DGGA 1KIPB 1QA9B 3F12B 3MUGB 4QTIH 3ARBC 3S34H 4AENA 1T2JA 5B4MD 3SDDC 2R2EA 2NW3B 4PGBB 4U05A 5ITBH 1YC8A 3RL1A 3H0TA 2MCG1 3VFGH 1DBAH 4GXUM 4XRCB 5IQ7L 3W5MA 2KBGA 2GCYA 2EEBA 1DBBL 3IDXL 5DHVB 4OKVA 1JGLL 4OCSL 4ONGH 1KTLA 2A6IB 3AY4C 3B6SB 3BMWA 5HHMB 5JQ6H 3W82A 4WI8A 4GRWB 4LCUA 3A6BH 4AG4L 4WNQA 4PLKD 4UINL 4DK3A 4ODUA 1BVKB 1F58H 3BP6B 2BRQA 5H8DA 4MNGA 4G3YL 5GGUA 2YWYA 3CVHH 1OP5K 4XWOD 3QQ3B 3LZFH 4IBLT 1KB9K 4K8RC 5KSBE 3FO0H 1NEZB 2ARJQ 4Z7WB 2YRLA 3E0GA 9CGTA 3SY0B 4PJ5D 2W9DL 3UTTD 1NFIA 1HI6B 5HHOB 5ENWA 4RA0C 3GHEH 1HQRB 3KPRB 2YRZA 3F6LA 3QIBB 5K9KB 4G9FE 1XF5A 2D7QA 4LSTH 2AKRB 4XNZB 2HLAA 3B4NA 4QTIL 3S34L 4PD4K 2XI9A 4E41A 4P4RB 4JKMA 5ITBL 4PUBH 1JYNA 4QHUA 3VFGL 4HK0B 1DBAL 2HTKD 3NCBB 4PRHE 5DJ6B 3L3IA 4RA3A 2YR3A 4FQXB 4QRRA 3IKCB 4PGDB 4QRQB 4ONGL 3U7WH 3RIAF 4FOMA 5JQ6L 5ISZD 2J6EH 3A6BL 5HI4C 2Q86B 4DUWA 2F53A 1CICB 1F58L 1QRNE 1L6XA 3CVHL 1T0MA 1XGUB 4QRPD 3LZFL 4TVSa 1FGNH 5GS0C 3FO0L 3DETD 3B9KA 3FFDB 4R2GD 2YMXH 2I26N 3BHBA 2X1OA 4LF3A 4ZUSB 5CSBA 2XRAH 1AO7B 2ARWA 3GHEL 2Z9TA 3D1MC 4MCYA 4LSTL 2GSGB 4PJDF 3ULVD 1H5BB 2FWOA 5C0CE 2AXGB 3MV7A 1TJGH 3ES6A 5FA3B 2AJSH 1U42A 4PUBL 3QZWB 4YHKH 1BFVH 3DI3B 4LCYB 1MJUH 3U7WL 4XTRC 4Q9QH 2B1AH 4A6YH 5C3LD 2J6EL 3VI3E 3RWGA 1L9MA 1Z2KA 2VZSA 2ADGA 1DCLA 3QPXH 4P2RA 3SDAB 3RIAK 3RNQA 4XNZC 3LD8C 3HAEA 5KVDH 5HYJD 3VMOA 1FGNL 3MRIB 5CS7A 3ZKQD 1F4WH 4DQOH 2FBJH 3S3PA 3G6AA 3PP3K 1IAKA 4UOJA 1CTNA 4QTHA 4NOBA 4YPJA 4K8RH 3GZKA 2YMXL 2IANE 3NIGF 2A2QT 3LV3B 4P2QB 3TBYA 5I1LB 2XRAL 3FB5A 4XZUB 2XA8H 1UJTA 5FGSA 1G7MA 3RDTA 1AQDB 1JWSA 3RGVC 1SJXA 2HT3D 1LO2H 2HRPH 4W4NA 1CICC 2VLLB 5I1IH 5GGRB 3IXTA 1P5UA 2BNUB 3UDWC 4KZEH 1TJGL 1R5VA 2P47B 3DX6B 4I48B 4KQ4H 2AJSL 2FR4B 3D25A 4U6YB 4YHKL 3WJLA 1BFVL 3KJ4B 3BYTA 5L2KD 3DUSA 3GBMH 4YNYB 1MJUL 3SE9H 4Q9QL 1HHHA 2EZ0D 2B1AL 2GI7A 4A6YL 3ZT7A 2B5IB 2GJZB 1CYGA 5DJYB 3RP1A 3WUZA 3AB0C 3CCHB 3QPXL 2DLTA 3TNMB 4PRPB 2E9IA 3UJJH 4PJCB 1DN0B 5KVDL 5IROC 4Z8FH 3AGVA 2CDEB 4DQOL 4QEGA 1F4WL 2YWZA 2CIIA 2FBJL 3VXUE 1IGJB 4L8SB 4PP2B 5IBUB 3UROR 2J8UE 4Y88A 3IJSB 4K8RL 5GS0H 4XPBH 2Z31A 4NCDA 5DEGA 3RQ3A 2XA8L 3T0EE 2VSCA 1U91A 1HWHB 4KROB 1HHKA 1FZKB 5DHVH 1LO2L 4OCLC 2HRPL 2UVFA 1FL6B 2EKSB 3WN5B 5I1IL 2V9TA 2JJVA 1D9KB 1CFNA 3DROA 3VXRA 4GRWH 4KZEL 1K5NB 4KQ4L 4B41A 2QJDA 1FVDA 2FEDC 3D18B 3S3SA 3IJHA 1YPZA 3GBML 3SE9L 2Z92A 1KIRA 3W0WD 4TUKH 3O6FC 1TXKA 2LQRA 2VDQH 2V7HB 4WI4A 2C26A 1AGCB 1N5AB 1D6EB 2NY4B 3QCUH 1JTPA 3UJJL 4GAFB 4KFZC 5CJ8A 4KVNH 4BH8B 4Z8FL 5F1NA 2HT4D 4YE4H 5FO9B 2VXQH 1PYWB 5E6ID 5BVPH 2X9YA 4RFEB 3MO1A 2NW2B 5DWUH 4ZDHB 4JRYD 1M05B 1TCMA 1KEMH 4EI5B 3KJ4C 3QUXA 5GS0L 4XPBL 1IEBA 4X4ME 4KJQD 1ETZB 1IGTA 3SKOA 5HYSA 1OAUH 4EJ1C 4KKNA 5I6XB 3BVNB 5C08D 5MERB 2EIEA 1FNEA 1EEZA 4ZOBA 1NC4A 4LSSH 2JB6B 3K74B 5HVHC 1UH4A 3D3VE 5INDB 3GMLB 4P5MA 3ZE2E 3GSXA 2XNAA 2DQEH 3EJYC 2H1PH 2XXMB 4U1IA 2RFXB 5L8JB 3V5DB 2X70B 3TO4A 1LK2B 5D7LA 3QO0B 5EU6B 3G5YA 4TUKL 1QP1A 4M48H 2VDQL 4O2EA 1EO7A 2BNRE 2OTWB 5IK3A 1KPUB 4KROC 2W0KA 1NJ9A 3QCUL 4GW4B 1KEGH 4Z7QE 1OP5H 3WN5C 3TH4T 4KVNL 2YD4A 4OGZA 1RQ5A 4YE4L 3MOBH 2VXQL 2F74B 3X13B 4X4ZA 5DWUL 3ZSTA 1T1YA 2OLDA 1KEML 1PDKA 2D03H 1I4FA 5I73B 1NEZG 5DVLA 2DQCH 1FC1A 4HKBA 5CD3A 2MSPA 2HP4A 1K6QH 1OAUL 2Q6WB 2OTUB 2XTLA 2NY4C 5CSGA 1PX3A 4NFCA 4OF7A 3SQBA 3QNXA 4LSSL 4PJFE 5T1KD 3W9DA 2DJ4A 3ZYJA 3WXVH 4EN3B 5E2VH 3HR6A 5K9JH 5JW4N 1JZ6A 2DQEL 3LRSA 3IJYB 4D9QD 3GSRA 3WDIA 2H1PL 1RV6X 4M1GH 4AY0A 4GBXC 3T1FA 4M48L 3EGSB 4FXKB 2BXYA 3SEPA 4YLQT 3LKSB 5I6XC 4NHUB 3EJJX 2BVYA 4CMMB 1MLBA 1KEGL 1HHJB 4FG6C 4MDJB 3UTQB 1F13A 3MROB 3SJVB 4M00A 4PJ5A 3UTTA 2O26U 3RBGA 3MOBL 1ZOXA 3QAZC 1DLFH 5I16A 3V7AG 2FHBA 2D03L 5JXED 3VA2C 2DQCL 4NM8H 5JUEH 3BEVB 2NY3B 4O2CB 1CL7H 3HZMA 1K6QL 2YSSA 4MJ6B 4MA8H 3SQOH 1G7HA 5I1JH 2IBZX 1OVZA 4M5YH 2C3VB 1SJEA 2P8MA 1N26A 3RWIB 1KB5A 3F5WB 3WXVL 5E2VL 5E2WH 2DKMA 1B4JH 3TLRA 3LN5A 5ISZA 3FTGA 2KKQA 1CXHA 4KV5F 4M1GL 3OAUH 4L5FH 3HUJB 1LE9A 3TBWB 3FQNB 3TBTB 3LRHA 3QZWG 3L7EA 1DUZA 3GI8H 4QRPA 1Q1JH 5IEHB 3KNBA 3GMOB 1N8ZA 3MJ7A 5GHWH 1GPOH 2VIRB 3IDIA 5IBLC 1A1NA 3H2WA 2X4RA 3KLSA 4PTTA 4NCC2 5HDQH 4RNRB 3RWEB 2OI9C 4HWZB 4NPYB 5IIEB 3KPOA 4HH9B 4EN3C 3LDBB 3PP3H 2HMIC 1GRWA 3ZKND 1DLFL 5DVNA 4K71B 1J8HB 5D2NE 1T89A 5EDXA 3GRWA 4Y7MA 1JF6A 4PJ9B 4DVRH 4POYA 3IFPA 3S3JA 4GG8B 3OHXA 4QRUB 4JG0H 4NM8L 2RBLA 5JUEL 5KTEH 2V5YA 1WEJH 4P5TC 1CL7L 3ARXA 4MA8L 3SQOL 5I1JL 4GXVH 1UCBH 4HS6B 4M5YL 1ZVYA 4P2OC 5EULV 1UZ8A 4ETQB 4Q9CA 2WINB 4PJDE 5E2WL 5CEZE 2FO4A 1F8TH 1SEQH 1B4JL 2BHYA 1HKFA 2BOCB 1BREA 2P8PA 3AM8A 1CVSC 1I7TA 3OAUL 5IJVA 5ICXA 4L5FL 3HI5H 2AVGA 4GRLD 4JRXD 2J4WH 2MHAB 1D5BB 3EFFA 1NCUA 2NY3C 5J1AA 5I18H 3GI8L 1G7LB 5HYJA 1Q1JL 4YK4B 4G7YH 4RMQA 5GHWL 1GPOL 4GSDH 3VCLB 4LP4A 1S8DA 1QUNA 1YECH 2YUXA 2I60H 5HDQL 2YOCA 2H32B 1U3JA 5TDPB 3PWLA 4RDQF 4DZBB 2AJUH 2Q76A 1BFOB 1I1AB 2FSEA 3BP7A 2MFNA 4DVRL 3TJHD 4KKLC 1F02I 4JG0L 1OSPH 3ROLA 1RK0A 1C5CH 5KTEL 1WEJL 3NIGE 1EX0A 1O0VA 4KJPD 3CIQA 4GXVL 4JFED 5EZJA 1UCBL 3KDMA 5EOQH 2VL5A 4Y16B 3MNZA 4ONHA 4KDTA 4WW2A 5FOBA 2EC8A 4F8TA 3D39B 3B3IA 5L2KA 4BZ1H 2PYFA 4IOFD 4MWFA 1F8TL 1SEQL 3AMKA 3L3GA 4I5BB 4K71C 4F7PB 2W0FB 5DA0B 4PJ9C 3HI5L 5ADOH 4MYWB 4YXHH 1YJDH 2AEQH 4HIEA 2J4WL 3P9MA 5I18L 1TIUA 3PIQA 4ZTPH 2VZVA 3CX2A 4G7YL 5I8KH 4ENED 4GSDL 3GB7B 2PO6D 4LIQH 4GMSH 4WUKH 3RRQA 3GGWB 1YECL 2I60L 4JFFB 3VFUB 3H9SA 4M02A 2XZAH 2HN7B 4RMRA 2AJUL 2WK2A 2H6PB 2ZUQC 3ILQC 1FVCA 5BMFH 3L5WA 4HKJB 2AS5M 2IPTH 1IILE 4AL8H 4MQ7A 3QDME 4K3DL 4KPHH 2AW2A 5EIQA 1OSPL 3MRBA 4YDVA 1C5CL 5C70A 4NBZB 1NC2D 4QRSA 3JV6A 2VTFA 4P59H 4N5UA 4YK4C 4YR6B 2F8OA 1FRGH 4W4OC 5T3ZH 3VFMA 4AIOA 5EOQL 4MAUH 2AK4D 4S0TD 4JKWA 3P0VH 5HI3D 1MFAH 1HXYB 4BZ1L 4Q97A 1FYTE 1X9QA 3W0WA 1J88A 2AQ3A 3CLEH 1I1AC 1I1YB 1FBIH 1PG7W 3B83A 5IB5A 2NY2D 1T5XA 2GKIA 4M03A 4PJXB 4X7FC 5JIHA 1F3JA 3HCVB 4P46C 4YXHL 5ADOL 4NN5B 1YJDL 2AEQL 3DO7A 1CFQA 2P49B 1UCTA 3W39A 3DMMD 1R24A 4ZTPL 4U1MB 5I8KL 4NYLA 2MJWA 1WFTA 1LNUA 4W68A 5BS0A 4F7EA 5E6IA 1YY9D 4GMSL 4LIQL 4WUKL 2EDKA 4JRYA 4LDEB 4UOW0 2XZAL 4UQ3A 5DXWA 1CN4A 5HGHB 3LB6C 3L1OH 2CKBA 5BMFL 3DGCR 1T0PB 1FNFA 3DUUA 4AT6B 2XZCH 2IPTL 4AL8L 1R3IH 2ZUSA 5C08A 4KPHL 1J05A 1RZGB 4YO0B 3EFDH 5C0AE 2Q7YA 4P59L 4ZFFA 5C09D 1FRGL 5T3ZL 4YDIH 4TVPE 4EUPB 3JV5A 4MAUL 3DVGB 4KRLB 4NNXB 4RQQB 1MIMH 4HKZB 1NUDA 3P0VL 1MFAL 1IC7H 1MCEA 5EUOB 4R3SB 4NRYA 5LGHH 1NSNH 3CLEL 1NGXA 5ITFB 3PWJA 1FBIL 3H9HB 2NX5E 2UWEF 1CU4H 3C60B 2NXYB 3S7GA 1WCQA 1WIPA 4KU1A 3FB7B 5D71H 2AQ2A 1SVCP 1UXWB 1VDGA 3EHBD 4U2ZA 3QXVA 1FCCA 1GSMA 1QG3A 2ATKA 3NIDF 4M4RA 1OGAD 1HHGA 2V2XB 4CU7A 2W60A 3GM8A 4MB5A 4X6CA 4Z7OE 1U3HD 1U8OA 2X7LB 1CLZH 5DUBB 3L1OL 5EC1A 1KGCE 4HKXA 1JZ7A 2GJ6B 2XZCL 1R3IL 3VD5A 3MGTB 1UH2A 4RIRA 3U46A 5T1KA 5KS9A 3EFDL 4M8QA 2ZG2A 3BAEH 4F7TB 4PG2A 1NCNA 5IJKA 4F15B 2P42B 1U58A 3U2SA 4JO4H 5CJBA 1AJ7H 3VG9B 1MIML 3LKQA 1KLGA 2NZ9C 1IC7L 1BVLB 2Q87A 3P11H 2Z8RA 5LGHL 1NSNL 5IB2A 2VL4A 1S9KC 4Q7DA 3CZFB 3BZ4A 2L7UA 4XWGH 1AGEB 1OY3B 2H32H 1CU4L 3MA7B 3VRJB 2PTTA 4ZUVB 4KKCD 4J8RB 4M1CC 3OKEA 5D71L 4B7LA 4O2FB 5FGRA 2X05A 5B38A 4LCCA 1ZHKA 3CFCH 5D9SA 1J18A 1Y18B 2BDNH 3NBNA 1MI5E 4Z5RA 3I3DA 4I8DA 1GGYA 5IVXF 2I24N 1ADQA 4M61B 4ZPVA 5JXEA 1UZ6E 3PJSA 1CLZL 5GRWA 4M1DL 1I8KA 5C0GB 5D1ZB 4ZUWA 1HOCA 4MQXD 3SCMD 32C2B 5IQ9A 1G9NC 2WBJC 4P2YA 1UQSB 5E94A 1IFHL 3F7YA 1XGTB 3RVVD 4LFHD 3BAEL 5FK9B 2JF1A 2CLVB 5FECB 5FGCB 1CI5A 2CJUH 2G9HB 4TUJA 2Z91B 5FM5M 4JO4L 1EAPB 1YYLH 4MXQC 1AJ7L 2WP3T 1QSEB 1TVBB 3QT2A 4K23H 3H3PH 5F88A 3P11L 3OXSB 3D69B 4HMDA 5BXFB 5I1CH 2IQ9H 2WNGA 5GS1B 1XH3B 3QUZC 1YDPB 4XWGL 4NNPH 3IKKA 4G8GD 5CP7A 4KV5E 3P73A 4UUJB 5C86A 4JQVA 1HH9B 2CO6B 3QEUB 3CFCL 1KBGL 2C4XA 2BDNL 4PJ8B 1KG0A 5DRXA 4F15C 4BFIB 3VG9C 1MH5B 2RHEA 2A74B 4U7KA 3E2HB 4HIJB 4JM2B 3CDYA 4Z7VB 5CZXC 5EWIH 2DYPB 3WFEH 4W6YB 3ARGB 1EFXD 4ZTOH 2WLZA 5F7EH 1ZVSB 3WS3A 1A7NH 5ICYB 3BPLB 3HZKA 3V52L 3GSQB 2OZ4H 4U1NB 3ULUF 1RK1B 2CJUL 5EBWA 5J12C 2AXJA 3BWUC 3MRDB 1JFQH 1YYLL 4K23L 3H3PL 1E6OH 2BC4B 3TZVD 2MKLC 4B7IA 2ICCA 4GRLA 4JRXA 5DHXB 5I1CL 2IQ9L 1V8HA 5TDNB 4NNPL 2LTQB 3T3MF 1SBSH 2HFEB 2FJFB 2G2RB 4LQFH 5HPOA 3FFCB 3EZ8A 4R0LB 5CIPA 4AM0B 1LE5A 4NOFA 4JFOA 3DX8B 1MIEH 4G8IA 3VE0A 4PTUA 3EO0A 4LVOC 1XF4A 4LPVA 4EUPH 3DYPA 3HC0B 5EWIL 1YQVH 2FZ3A 4X99B 4WU5B 1L7TH 1BF2A 3WFEL 4GUPB 4JFEA 1KJ3H 3OL2A 4NKMB 3RVXD 4ZTOL 5F7EL 5DURB 5AYUH 1A7NL 4JB9H 2A83A 4AYFA 1HK6A 2OZ4L 3JUYA 4PJ8C 1NLBH 1CT8B 1BZ7A 4YBLB 5CHNA 1JFQL 3O41B 2AQ1A 1WFOA 1E6OL 1T6WA 4OV5B 2LU3A 5CD5C 2ZZUT 1V05A 5CGTA 5HHNA 3UYRH 3E2HC 5IWLC 4JM2C 1IC4H 2Y1VA 3KXFE 3EOBA 4QO1A 5JLZA 3S4SA 4YXLH 4XVJH 4G80A 3SGDI 1OAZH 1SBSL 4OJFH 2PO6A 2XTJD 1P5VA 1E4KA 4LQFL 1OLZA 4MJ2A 2FD6H 1U8NA 3O2VH 1GHFH 5SWZB 5CBAB 4QXWA 1H15A 2VZ1A 3PV7A 5C8JB 5IB4A 1MIEL 3M07A 1IVLA 3DWTA 1A4JB 5F44A 3VXMB 4R7DB 2DQHH 3LEXB 4XC3L 1H8OA 3U0TA 4XGZB 4XVSH 1YQVL 3P40A 1L7TL 1NC2A 3TBSB 1SY6H 1KJ3L 2LTQC 1FFNA 3MRQA 2CMRH 4LPYA 4N0CD 2AK4A 2PTVA 3PWUB 1OLLA 5AYUL 4JB9L 5D5MB 4WTWA 3MOAH 1JV5A 5I76B 3V6OA 4C58B 3VGEA 5ESVA 1NLBL 3MRFB 4LDOB 3WFZA 3PE9A 3O11A 1TTGA 4JFDE 5C0JB 3BXNA 4NQXB 2W59A 4EUPG 4CU6A 1I8MA 1CLCA 3EZJB 3UYRL 1IC4L 4I13B 4WFHE 3DMMA 4XVJL 4YXLL 1OAZL 5JTWA 4RDQG 3BN3B 4OJFL 4CADA 4F8QA 2EXWC 5IEKA 1Q9LA 2EDWA 2FD6L 2IGFH 3O2VL 4XNMB 1GHFL 3UZVB 1DEEA 5FKAA 1MQKL 1AR1C 1B0RB 3ARDC 1K2DB 3LQAC 1VFUA 3QO1B 1JGUH 2DQHL 5SX5K 4RAUB 1RI8A 5CSZA 4XVSL 5D1QD 2KPNA 1BIIB 1LWRA 2ZUUA 1JMZA 3DGGB 5C09A 1SY6L 2X4OA 3QJHA 2CMRL 1AD0B 1RVFH 4AENB 4UU9A 3OG6B 3MOAL 2EYRA 3O4LD 3RL1B 3H0TB 5F9JA 4WJ5A 4OKVB 3PABB 1KTLB 1N3NA 3F7QA 3PWPD 2ADFH 2N7BA 2SEBA 3V6BR 4LCUB 1UWXK 3PGFH 4P4KB 5J8OA 4QWWC 4YDJA 4WEUD 1M4KA 4Z7NF 3KGRA 3R8QA 1OGAA 1OW0A 1EJOH 3CDCA 2UWEE 3QNZA 3S5LB 2NLJA 1S7VA 2IGFL 4Y4KD 4X6FB 1YN7B 2G75A 5DDHA 2MNUA 3W5NA 1U3HA 5MEND 3GMQA 1TETH 3NIDE 1JGUL 2AV1B 3JWNC 2Z8VC 3O3AB 1WTGT 2C4FU 4N1CA 1NFIB 1DANU 2DLEA 3K7UA 4Y2DD 1IM9D 3GMMB 3MUY1 1XF5B 1MSPA 2ICWI 3VWKB 2HTLC 5EPMB 1RVFL 3DHJA 4PGCB 5ERWA 5I1GH 5LAXB 4E41B 1B0GA 5DK3A 3RWHA 4QHUB 5A3IC 3ULUC 5C2BH 4OLYH 4JFPA 3L3IB 2JK5A 3WE6B 3O2DA 4QRRB 4WGWB 4OFKA 3N50A 5JOPD 4X9GA 2ADFL 3U30B 3MOQA 2I9TA 4AJ0A 1I9RH 3TN0C 1J1XH 3PGFL 3QFJB 5I15H 2F53B 4QRTA 1AXSA 1TLKA 3RY6C 4BFBD 4XH2A 5JPNA 1EJOL 2FX7H 3OQ3B 2P5WD 4PYHA 5F1OB 5TE4H 3B9KB 3QR2A 5AWNH 3QEGH 1TETL 3PHQB 4OFVA 1S7SB 3O3UN 1VKXB 4ETYA 3BHBB 3OKDA 5K33A 3SCMA 1JPFB 3TA3D 4DGVH 5IVXE 2DQDH 1Z9SA 4PJEA 1CDCA 1MJJA 4P4KC 3RVTC 4N0UE 4XHJC 1PG7X 1D5IH 1TNNA 5I1GL 1A6ZA 3MV7B 4O9HH 3ES6B 1DL7H 2EXYD 3KPQB 4WHTA 3BDBA 3H7LA 5C0BA 2BSSB 5C2BL 4OLYL 4YHOH 4BQ9A 3ZL4H 4U33A 3U9UB 3L3DB 4G8GA 2X44D 2VDPH 1I9RL 1U9KA 1J1XL 2Q3ZA 5I15L 2ADGB 4FN0A 4WDIA 4NN7C 5HD8C 3P9LA 4RMSA 1WZLA 2FX7L 1I7ZB 4RX4D 1FE8H 2XPGA 3VWKC 5FFLA 1XEDA 4J1UB 3ZE0F 1IAKB 2QQQA 5TE4L 5BW7C 5ICZA 4LPCA 5AWNL 2QSTA 1IZJA 3QEGL 4JREB 2BHZA 2DIAA 4OZHF 1DLHB 5BZWA 4Q0XH 2YZ1A 3TBYB 2QADD 3LQZA 1T80A 1VGEH 1EFXA 3MUJA 3U30C 4DGVL 2DQDL 3I6KA 4XX1G 3UO1H 4DFIA 4S1QH 3QFDB 4ELMF 1SEBA 1D5IL 3IXTB 3MV9E 4PJGF 1M6OA 3L7FA 3TZVA 5K59F 1DL7L 1MELA 3D25B 4UDTA 3QQ9D 4JO2H 3B9KC 2IPKA 3ULUE 4YHOL 4PFEA 1GL4B 3ZL4L 1Q8MA 1HHHB 1AKJB 3GBNH 2ZG1A 2VDPL 2X10A 3ARRA 3F6IA 4NQEE 1QYGH 2GUOA 3ZHKA 1NAMB 1R0AH 1GOGA 3TPUA 2HVJA 3ZDYF 5GSRA 3INUH 1FE8L 3T3ME 4OF3A 5D2LF 2CIIB 3TBVA 3REWA 4XXCA 2QQLH 1VCAA 3N1QC 3VXOA 4NSKB 1JGDB 5GGVH 1QFWH 2HG5A 5T5NF 4Q0XL 1VENA 5D96C 1WV7T 2Z31B 4F9LA 5DEGB 1MY7A 1VGEL 1MCNA 2RB8A 4E42B 4UAOB 1U91B 1PW3A 3ARZA 2K3TA 3AMLA 3M45A 3UO1L 3BD4A 1PZ5B 2NY5H 4S1QL 1UM6H 2ESVB 4XI5C 5GRZA 1F4AA 3KYMA 5F7WC 3LOWA 1O5DT 1CFNB 1X5KA 3DROB 4UB0H 3VXRB 3BRFA 4UDUA 4EI6A 4JO2L 4OKDA 3FB8A 1FVDB 4ODWA 3WIHA 1ZA3A 3CFIC 2A6KA 3IJHB 1YPZB 2JELH 4WTZG 2Z92B 3O81A 2YK1H 3GBNL 4O4YH 1YN6A 3PP4H 2IG2H 1CE1H 4DZ8A 4ZYKA 4HV8A 1QYGL 4Z0XA 1R0AL 1K3ZA 1CGTA 3OJMB 1MVUA 1X3DA 2PN5A 3MX0A 3INUL 5F1NB 2QQNH 1I75A 4X8XA 4W6WB 2QQLL 3QDHA 4ZFGH 1R3LA 3MO1B 3BP5A 4UOW1 2UY6A 3WJLC 4QHKI 3RUGE 2M1KA 5GGVL 1LVEA 1QFWL 2WWKT 3HG1E 3QUXB 5SX5H 2Q7NA 3CFEB 3WD5H 1IEBB 5C0CD 3ARBD 2W07A 3SDDD 3CSBA 3HZYA 1ORSB 1FNEB 2NY5L 4JZJB 1UM6L 5C0RH 2IAMC 4Z95H 4MJ4A 2X4PA 3GSXB 4UB0L 3L95A 3NCYS 1UG9A 1QVOA 5DGRA 4MZ3A 3OXRA 3QEQE 5DSCA 1PFCA 4OZFB 4N68A 5DJ8A 3T0DA 4JDZB 4M6NH 3HFMH 3TO4B 2JELL 4OZHB 2EE6A 2YK1L 4O4YL 2Z31C 4O2EB 3PP4L 2IG2L 4EIZC 1CE1L 1UWXH 1WAAF 3FO9B 3DV6A 5B39A 4KZDH 2IAND 4OZIA 1C7SA 3CLFH 5AG9A 2D4DA 1WT5C 1BX2B 2QQNL 3NGBB 4U1KA 2P4AB 3QPQC 4WVRA 4ZFGL 1BD2E 1JCKA 5D1QA 1INQA 3K8MA 1T1YB 3S5LG 3WD5L 1AGFA 3BKYH 3MCKA 4NJAH 2HKFH 4HKBB 5CD3B 4Z7UF 8CGTA 5F6HJ 1IGCH 4NWTH 1JYVA 4F3FA 3O4LA 2P1YA 1PQZB 4X4XA 3DVFA 3QNXB 2JCCF 5C0RL 5J11C 5DYOA 4Z95L 3W9DB 2Y36H 3WS6A 4WUUE 4NC1E 3AS0A 3PG2A 3LRSB 4MAYC 2X4QA 3PWPA 3L9RA 1A7BA 4LKXA 5HI4D 5C0IA 4M6NL 1UH3A 4Y19E 1I7RA 3HFML 4CVXB 2IQAA 3QUXC 2DTMH 4D0DA 1XF2A 2ARJA 3T1FB 3VXUD 5GS0D 4S2SA 4Y4KA 5KG9A 4D8PA 5MENA 3KYKH 4JZJC 1FAIH 3CLFL 4Z7NE 1D5MA 3HKFA 4OV6F 3UTTB 4KRPC 2UYLA 4EOWH 1FGVH 2ZCKH 2ZPKH 3NPZB 2AEIT 4Y2DA 1IM9A 5TH2A 2PCPA 4GXUN 1CFTB 3BKYL 4NJAL 3VFOB 2HKFL 1BJ8A 2CLRA 2P8LA 3HZMB 4CDHA 3SDXB 1U95A 4YC2B 1QFWI 1IGCL 4NWTL 5CWSA 3JV4A 5D7IA 3HN3A 7CGTA 1SJEB 2P8MB 2OJEA 1D6VH 2XKSA 1A6AA 2Y36L 1KB5B 4ORGA 4XTRD 2VYRE 2ICEA 3NGBC 1TVHA 1FSKB 1NAKH 1NAMH 5ISZB 3FTGB 1CD1B 4MNHB 1NFDA 5IOPA 3ILPA 4MHHI 1IT9H 4YHYB 3VI4E 1LE9B 2EDQA 2V17H 2DTML 3L7EB 4YHZH 3VWJC 4QRPB 3GKWH 3KNBB 3TPKA 2P5WA 5B4MC 3IDIB 4GKZA 4PIRF 4E9LA 1A1NB 2X4RB 3FHAA 4PTTB 3KYKL 1FAIL 3GSOA 1T1WA 3GFUA 1LDSA 2C3HA 4R2GB 3KPOB 4EOWL 1FGVL 2ZCKL 2ZPKL 3MODH 5JW3H 3TA3A 1Y0LB 1Q0YH 4IJ3C 3WXWH 4CNIB 4KKBC 3RGVD 3IFPB 3UTOA 3JTTA 1CICD 3OHXB 1WBYA 4XP5H 3B9AA 5A2FA 3M17B 3BUTA 4D0CB 5EIIA 1BZQK 1DQJA 1D6VL 1UZ8B 1NAKL 1K4CA 1NAML 4LNVA 3T0BA 3S97C 4CU8A 3IDJA 5IJVB 3KYNA 1IT9L 4HUWA 2BVQA 3WNNA 2V17L 4LEOB 3CFJB 2OYPA 3FOLA 1Q9WB 3EFFB 4YHZL 4C59B 5J1AB 4RX4A 4X83A 5C0DB 5HYJB 5DEFA 3GKWL 4PRIB 4IOIB 4QOKE 4YC2C 4ORZC 2P7TA 5B8CA 1QO3B 3QUKA 3L3HB 5KW9H 1U8LA 4HJ0C 4N8VA 1S8DB 2HTKC 5GGSB 2MCPH 1NBZA 4GLRH 1VGKA 1OSZA 1FSKC 2Q76B 3MODL 4MB4A 4RGNE 5FYKE 5JW3L 2FSEB 4LEXH 3BP7B 3MRLA 3ZE0E 1Q0YL 1T22B 3WXWL 5H37H 1SMOA 1UM4H 5DGQA 5GSVB 5IFHH 1G0YR 2FX8H 4XP5L 2DQUH 3ROLB 1PSKH 2DM7A 5JIPA 5EORH 5DC9B 4OZFH 4OCNC 5EZJB 2NXZC 1G7PA 3KDMB 4FTVE 3CVHA 4MA7H 4DKAA 1WBXB 4ONHB 4WW2B 2ITCA 3DETC 1MJ8H 4IRSC 1EPFA 5FOBB 3B3IB 3EIFA 5L2KB 4OBSA 4ELME 4F33B 4YAQA 1QQDA 4MWFB 4J23A 3O6FD 4KH2A 1A7RH 4PJGE 5JHDE 1MCKA 3DOSA 5KSBA 2L0DA 5K59E 3FCTA 3JXAA 2FYYA 4NCC1 4PJAF 3SKNA 3VFPB 4X4YA 3PIQB 1NCBH 1GZQB 2GEEA 1SJVA 5DMYA 1P9MC 1CTOA 5KW9L 3AREC 2JE8A 4EVNA 1S7TA 4UTBH 3H9SB 5CKGA 4LPWA 2MCPL 4Z6AT 4K55A 4RZCB 4B5EA 3ZDYE 1XAUA 1IGYA 5D2LE 4KQ3H 4LEXL 4BA8A 1UM4L 1MPAH 5IFHL 5CZKA 1XF3A 2FX8L 1X5IA 5DJDA 2J6EA 2DQUL 3F7VA 4YDVB 1PSKL 4LBEA 5EORL 5EBLA 1UC6A 3G9VA 4QRSB 1MCPH 3VFMB 4I0PC 2R69H 4WV1B 5I9QB 4MA7L 1FL5A 1ACZA 2WV3A 4LLYA 3KHOA 5E4IA 1MJ8L 3MACH 3X11A 1TQCC 1JI2A 3FT4A 1GIGH 1XGPA 1A7RL 3QJFA 3KAAA 4NDMA 4S0SD 1AHWA 5H37G 1K8DA 5DFWH 4UI2A 5IB5B 4YDLB 4KROD 1T5XB 4I2XA 1F3JB 3CUPA 4HAGA 3DO7B 4OZFG 1CFQB 4G9DA 4IMKC 3W39B 1NCBL 1R24B 1H3PH 4NYLB 5BS0B 5EH1A 4F7EB 2CIKA 2DQFB 4JRYB 3C6SA 5F93C 4LASH 4UTBL 3VFSA 4UQ3B 4H88H 5C0CA 3RI5F 2Y5TA 2X89D 3ARBA 1DQML 4FS0A 4KQ3L 3SDDA 3P3YA 3BO8B 3DUUB 1MPAL 1KB5H 2NY4D 1J05B 3ZHLA 1X5ZA 5CEZD 4DFHA 2Q7YB 1MCPL 4ZFFB 3AY4A 2R69L 3JWOC 5HGBA 3OKLA 3KYAA 4GBXD 3MACL 1T3FB 1T21A 4NZUH 1AE6H 5HJ3B 1GIGL 5SWSB 4LCWE 4NRYB 3UAJC 1NGXB 1NANH 4DKEH 3PWJB 4X98B 1QFWM 1UT9A 1X4XA 4X5LA 1U8IA 5CJOH 4HWEH 4N0YH 1IQDA 2X2YA 1IKFH 4FG6D 1U2HA 2IANA 3GRWH 2XG5A 4HUMB 1H3PL 5T5NG 1PLGH 1MAMH 3CU7A 3U82B 3UYOD 4AEHH 1WAAE 4WV1C 5EFIA 5J13B 4F2MA 3RJDA 1HHGB 4LASL 3T08A 2J1KA 2W60B 2C3WA 4X6CB 5IMMA 3RFZC 4H88L 1N6UA 5E8OB 3FO1A 4HKXB 3U7AA 4U6VH 1KB5L 4Y5YA 5D93B 3TEUA 1RZIA 4JFHD 4U0RC 4HUXA 4RIRB 1K4DB 3U46B 2VR5A 3V4VH 3NCEB 1U2CA 5KS9B 4M8QB 3V8CA 3JV0A 4MD0A 3VXTA 1W0VA 4Z7UE 1VFAB 2C3XA 5DK0B 1U58B 4QF1B 1SJHA 3U2SB 5DJ0B 2QV2A 3LKQB 4ONFH 1KLGB 5E5RB 3SO3C 5MHSD 4NZUL 1AE6L 1WWBX 2JCCE 3AS2A 1YMMB 2YN3A 4S1DC 2R29H 5IB2B 3LPWA 2WQ8A 1U93A 4DKEL 3BD5A 3VXUA 4F57H 2YPVH 4HWEL 5CJOL 4N0YL 3QBTB 1IKFL 2J8UA 4X7SH 4R96A 4XRCA 4DVBA 2BSRA 3LCYA 3GRWL 4EN3D 5DHVA 1BHGA 1QHOA 1ZHKB 4JDTH 1INEH 4LCCB 4XMKH 5B38B 1PLGL 3B6SA 1MAML 3IETB 2WUBH 5DHYB 4AEHL 2XA3A 1ZGLB 3MCLH 4M6MH 3T2QA 3QDMD 4P9HC 1JZ2A 4ZS6C 1BVKA 3BP6A 5T3XE 3BIAX 3C5SA 4P5TD 4CDGC 5TF1H 1I8KB 3QQ3A 5EBMB 4U6VL 3WMSA 5DF0A 5B3NA 3I6LD 5IQ9B 4P2OD 3E3QC 4O02L 1CDGA 5E94B 4Z7WA 3F7YB 4LSVH 2EDLA 3V4VL 1FYTD 5DJZA 5GISH 3ZYZA 4I18B 4TUJB 1HI6A 1RUPH 4ONFL 2M2DA 2D31B 5K9KA 5F88B 4OF6A 5AAWA 2R29L 2NY3D 1WZ1H 4JGUA 5IMLB 3G04A 5C92A 3CXHK 4F57L 2YPVL 1DSFH 3RX5A 5CP7B 5F9WC 1NMBH 3TF7C 3P73B 4X7SL 1GOFA 5CUSL 3OKKB 4X4MA 5DMKB 4XMKL 4JDTL 4PGDA 1INEL 4LMQI 4PG2C 2WUBL 5DRXB 3WUWG 3MCLL 3TJEH 4M6ML 4KKLD 3RGVA 5CAYB 1I8IA 1CICA 5C3TA 3U83A 1GJIA 3L3JA 5TF1L 2C7UA 1XGUA 3UDWA 4N0RA 1WGOA 1YUHA 2JTDA 5I1DA 3D0VA 3CFBA 4K07A 5IUSA 2OK0H 3WS3B 4LSVL 3HZKB 5GISL 3T2PA 4G6MH 1P2CA 3BH8B 4LCCC 2R1XB 5EBWB 1IGFH 1J8HD 1RUPL 4PJ9D 2ORBH 1CS6A 2L7JA 3FJTA 4JRXB 1WZ1L 5IROA 2E9BA 4WENB 3U1SH 1FV1A 3BZDA 4HGWA 3WBDA 2AXGA 1DSFL 5FA3A 1I1CA 1NMBL 3IDNB 3QZWA 1NANI 5L0QC 3UZQA 2B2XL 3GSVB 4AK1A 2MQ3A 4IRZH 1QSFB 4WWKB 4I18C 5D6CA 1KGCD 4ZS7H 1VSCA 3ILQD 1MF2H 4G8IB 3VE0B 3TJEL 3EO0B 4NO0B 4HHAA 1ZVHA 1D5XA 2XACC 4PJFA 4MZ2A 3MRNB 3VDCA 2FZ3B 3MLYH 5F7DA 5IW6B 4M5ZH 1QZ1A 4P9HH 4JFEB 3OJDA 5JQHC 2OK0L 3FT3A 3TCLB 1RZJC 3JVGC 1EK3A 4G6ML 1JHTA 5EO9B 4HT1H 3O6FA 4N8CH 1BZ7B 1IGFL 5CHNB 2EDFA 4OCMC 4EXKA 2ORBL 4P46D 1CR9H 5HHNB 2VLLA 3ZSSA 3G5ZB 4LNRA 1EHAA 3KR3H 3KPSB 3RKDC 5JLZB 5GGRA 3U1SL 1MI5D 1NUGA 2CH8A 4G80B 5JW5A 2VUOA 5FCSH 2PO6B 4LP5A 4XPAH 1HZHH 1F6LL 1U8NB 4IRZL 3IU4H 4PJAE 3K81A 4WTXA 4YNYA 3BZEA 1H15B 2FECI 1X5YA 3LB6D 4ZS7L 5IB4B 3AAZB 1MF2L 2FH6A 1FC2D 3AS1A 5TGBA 4L4TE 1G1YA 3U0TB 5EOTA 2F19H 3MLZH 3CCHA 3NCCB 4JPKH 3K1KC 4YIQA 1XR9A 3TNMA 3MLYL 1YEGH 4M5ZL 2HFFB 1FLRH 4LLVA 1M7IA 4P9HL 5T5FH 1C5BH 1FFNB 3MRQB 4XNUH 1RUKH 1H9VA 4K2UH 3VRLF 1NGQH 4EDWH 2XG4A 5BQ7B 4X6DF 3P2TA 5F70A 4JFFD 1YEJH 2F58H 1JV5B 4WWKC 2K7PA 4HT1L 1JPST 4OFYD 4N8CL 3O11B 3QWRA 4P0DA 1FZKA 1G9MH 1I8MB 2DWEA 2PTUA 1CR9L 1U41A 1KSRA 2QSQA 1KLUA 3KR3L 1JTTA 2VABB 4U3CA 3DMMB 5GRUH 5CBEB 1ADQH 4CADB 4NT6A 4XPAL 3DLQR 4X7EC 1HZHL 3D2UD 5T1DH 1Q9LB 3D18A 3IU4L 4WO4B 1DEEB 5FKAB 1HKLH 3T65B 2X1WL 2X89A 4ZAKC 3EYQC 3G5VB 4RFNB 2ICES 1D6EA 2F19L 3MLZL 4FQLH 3D85D 4JPKL 3WFBH 2R4RL 4KKAC 1DE4B 4YHPA 4HC1A 3VD9A 3RNKB 1YEGL 4U6XA 5EZOH 3WNMA 4BH8A 1FLRL 1KXTB 1RZKC 3HE6B 5C09B 4WEBH 5FO9A 1C5BL 1ZSDA 2VO5A 4KI5F 5T5FL 5ACLA 5K9QG 4XNUL 1RUKL 4K2UL 4EDWL 1NGQL 2PO6C 4RFEA 4ZMAT 2NW2A 2NZ9D 4PRBA 4HS3B 2KZWA 1M05A 4GBXA 4BSWA 1YEJL 3MRRA 2F58L 4FQPA 4YXKH 1FLTX 1KB9J 2UZYB 5F9JB 4YBQC 3ARQA 3UBXI 4WJ5B 1ETZA 1K9TA 5E9DB 1N3NB 3BVNA 2YXFA 1G9ML 5MERA 2YPLB 3U36B 1NBYA 2ZG3A 3X12A 1JK8A 5GJTH 4YDJB 5FM5O 1C08B 3O9WD 5GRUL 1JTOA 2H26B 1QSZA 1ADQL 4XMPH 1OGAB 4XPFH 2AV7B 5T1DL 5CFHA 1FIGH 2NLJB 5AUMB 1S7VB 2RFXA 4MJIE 3NMEA 4PJ7F 3CH1A 2G75B 4PD4J 1N0LA 5DDHB 1U3HB 1HKLL 2O5ZH