5FM8A

Structure of the c-terminally extended domain my4 of human myomesin (space group p65)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
b'STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm8A01
4BSVA 4LPXA 5C0CD 5FYJL 1AXSB 1F3JA 4JY5L 5FYLE 3CFDB 3B5HA 5IT2H 4RAHA 3OHXB 1TMCB 4O5LH 2ATKA 3O8XA 2EXYD 1OAKL 4JCMA 3T8XB 3GRWL 3KJ6L 4KY1L 3VFPB 2EE3A 2BNRA 4DW2H 3K4ZA 2R69L 4HUKB 4LNVA 4WI9A 4YBQC 1LP9A 4O9HH 4KZDH 2AXGB 1LILA 5SWSA 3KPMB 4KRLB 4LVNC 3RRQA 5JIIA 1MI5A 2HLAB 1I3VA 4ONOA 1UB6A 5DGQA 4XMPL 1FCCA 3PV6A 3GSOB 5MP6L 4KI5D 3BFOA 2DIAA 3A6BH 1DTUA 4M43L 3LAFA 4U6VL 3TBTB 4DOHE 4L8SB 5DK3A 4FFVD 5F7EH 5KVDH 4Y1AD 3QJFA 1IGIL 3V4PH 3TVMB 2QADD 4DVBA 1SYSB 3FB5A 4I9WD 3Q6GH 2UY7A 3C2SA 1KENH 1DANT 2AAVA 3HRZA 2D9QB 1EBPA 5F3HB 5H37G 3LKSB 2AK4E 1T89C 1WBYB 2VDNL 3EDEA 3RPIA 4B7LA 1NC2B 1PEZA 4V2CB 4GRWE 4P57B 3IVKA 4P23A 2OXHA 5E03A 3TT3L 3GMLA 1T21A 1RVFH 3RVWC 3BKYL 1FNEA 4OTXL 3ROLB 2QEJA 2VXQL 5I2IA 5JNYA 1KCKA 2JJSA 2NX5E 3ARXA 1I9IH 3KJ4C 1KBGH 3SGDH 3ETBF 3WFCH 2AERT 3NIGE 4PRHB 5M7QA 4Q9QL 2CGRL 1FAIL 4OCXL 4Y4KD 4RGOH 4JN1L 4NHCH 1YEFH 3G6JB 4IRZH 5T1DH 2NXYD 4EBQH 4JQIL 1PG7L 5F7WC 3GIVB 3MRJB 3RIFK 3BDXA 1IBGH 3CU1A 5HVGB 1BD2A 3NCFB 1QBLL 4M93B 1JNJA 25C8H 1FBIH 4AEIH 1N0LA 3O45A 5E4IA 2VMFA 3MA7B 2AP2A 4KTDH 4PP2B 4FQHB 3FCTA 4YDIL 3MREA 3MOBL 4MJ6B 3MROB 4ZAKA 5KANI 5GRJL 1FSKB 4H88L 1HHGB 1MAJA 4PUBH 1QZ1A 5I18H 4MA7H 5D7SH 4NN5B 3R8QA 3WDIA 2M8XA 2IPTH 5CBAA 1S5HB 4PRNA 4M7LH 4ELMB 2ZWLT 4OKVA 4GRLC 2A6KB 3QUMH 1CF8H 2I9TA 3TLRA 3VDBA 4P2QD 4V1DA 5CIPB 5C0CA 3GMRA 3G5YA 3ZYOA 1A6PA 4HXBH 2NY4B 3BSZH 4JM4H 4H8WL 1IAKA 3OKLB 4NO2B 5D9SB 2KPNA 2ZUTA 4HC1L 4RFOH 4FXGA 4CN6A 1IRAY 2A0LC 1BOYA 3VXTB 3QRFM 3PWJA 5I1DA 3BZDA 4GT7A 3QWOA 2SEBB 4Y7MA 3MYZA 1KJ2B 1SJVA 3GB7B 4NRYB 2WWKT 4RGND 5C2BH 1JGDA 3QUYA 3SJVD 1YNTA 3I75B 1DVFD 4PS4L 4IBLT 5DT1H 3RJQB 3VFOB 1MCKA 1HNFA 5C2UB 1I1AD 4Y19A 3D25A 3GNML 1ITCA 2B4CC 5DDHA 4LLYB 3U0TB 1UYWL 5HBBA 2CKNA 2V2XB 3JWNC 4E5XB 2FHBA 4KDVA 1TQBB 4OZIE 5FECA 3INUH 3IFPB 5DD0L 5DQ9A 4P3DB 1TVHA 4NBXB 1YQVH 3C8DA 2X4PB 5MEPB 5TDPA 1MJUH 1A7OL 1SJHB 4IRSD 3RWEB 2OZ4H 5L2JB 4KU1A 2FWOB 4NZTH 1A0QH 2F53E 2RB8A 3EOBA 1F2QA 3DETC 3RX7A 1KB9K 3NCCB 1DBJH 3JWDC 3QIUC 4WFFE 2J8UE 1V5JA 4DAGH 2W92A 2PTTB 4OM1H 5D71H 3SCMB 4DUWA 1F97A 4YXKH 5T1KD 3FQRB 4NFCA 2A6DB 4I0PA 5HDBE 5JXED 4QTHA 3CPLB 2ADGB 5FKPB 5FDWB 1ACYH 1VGKB 5FO7A 4Y4KA 5E8OA 2VDOH 5J56B 1AXTH 1XF3B 5C0AB 2W9DH 4X98B 1SJEB 1MWAB 4PY7A 4PGEB 4PJDB 3UROR 4OUUB 2IALA 3KNBA 4H5SA 3LDBB 4KK6C 3D3VB 3QO1B 2E9IA 4FQXD 2FL5B 1ZT4A 3TJHD 2MWCA 2FATH 4LP4A 3U6RA 3DX7A 1WBXB 3AM8A 5I1EH 2X7LB 2E9BA 4GW1B 3F62A 4RQQB 1ZLVK 3SDXF 3U9PL 3NIDF 4LOUD 4G6ML 1S3KL 3SHSA 3FO2A 4KQ4L 3EAKA 5BV7C 5FDYA 1K3ZA 1RAMA 3B9EA 3ILQD 4TSAH 1DBKL 3H3KA 1KN2H 4UDUA 4GFTB 3VXQA 3HI6H 2FDBP 1T2JA 4PUBL 4YGVB 2BVQB 4JO4H 5HPMB 3BD3A 1AFVH 1UG9A 4UTAH 3C5ZA 3GSQB 5HD8C 4J1UB 4D0DA 2AKRA 1HHKB 4JPWL 4XCYB 3C87A 1OB1B 4Y5YB 3ULUD 2B4CH 3MV7D 3MO1A 3TBWB 1JRHH 2LFGA 3EJYC 2JK5B 2FD6L 1MH5A 4HXBL 4HKJB 4TULH 3RFZC 3RHWF 4I3SH 3O4LA 5JDJA 3SJVA 1UH3A 1Q94B 2HMIC 3H6JA 4WO4C 4XCNA 4M7ZC 5L0QB 3UMTA 5DUBA 2WP3O 5ABDE 4JFOA 2CPCA 3Q5YA 1DVFA 1NBZA 2NY2D 1MFBL 1X5HA 5FO8A 4N0YL 4UBDC 5EC2B 4J8RA 4LLUB 5ESAA 5KVFH 2AV1B 3WFBL 2EYTB 2P8LA 5C3TA 3JWDH 1BREA 3T3PF 4NJAH 4PJBB 1A3RH 3KXFB 3WJJA 3OKOB 3BPCB 1GAFL 5E00B 5EUOF 4HAGA 2K9UA 8CGTA 4L3CB 2ZJSH 1N26A 3QAZB 3HPLA 4XTRC 3T0EA 2AJ3B 4IRSA 1H3PL 2LABA 2ADJA 1BX2B 1S8DB 4MD0A 2J4WL 1QSFA 4XZUB 5I1LB 4L5FH 3H3BC 2JELH 5GSVA 4BQCA 5F1SA 4B50A 4KDTC 1GJIA 1UWEH 4ZFOL 4J4PD 3SE3C 3IU4L 3AREB 4LCCB 1N3NA 4EI6A 4YHYB 3A6CL 3GJFK 1FO0H 3I2CH 2M1KA 3NA4A 1MCWM 3NCYP 3CZFB 3LV3B 3REVA 1MRCH 4R7NB 3MLWL 3R06A 4DQOH 4NZTL 2YPVH 3PHSA 2OSLB 3OG6B 4LLWA 5T1KA 4BSVB 3UJJL 1F3JB 5EOCH 1KIQA 3NTCH 5JXEA 4ZDHA 4GAJH 4KV5F 1WZ1L 2YKLL 4QY8B 3ZE0E 3HS0A 1NFKA 1G7PA 1W72H 4X6DE 1PZ5A 5BV7H 3LZFH 2DM7A 3DLQR 1A4KA 3BKJL 1ZV5A 1LP9B 4NJ9L 1DQQA 5SWSB 1SVZA 2EH7L 3G6DH 1PFCA 1MI5B 3HNVL 1HHJA 4CVXA 4FQXA 5IESL 3NCEB 3HG1D 4M48H 3VFMB 2XKSA 3SE9L 3AGVA 4R8WL 3PGCA 3VFSA 4GXVH 1I85C 3Q0HA 4K2UL 4G80A 2PNDA 4YHLL 3C9NA 5C8JA 4M62H 3SE4C 4O00A 3RBSA 4JZNA 2DQJL 1PLGH 3IKCA 3KYKL 3MRGA 4PLJD 5CJXC 4KMQA 2V5YA 1V7NH 2Z91A 2X9XA 1ED3A 2XZQL 3WEXA 1AC6A 3QH3A 2WANA 1NAMA 4H25A 1FHGA 4KJWD 3W81A 4Y8DC 2YD2A 5EU4A 1FG2A 4BSWA 2Y06H 4OCMC 3BE1H 4OLZL 1HHHA 3GK8L 3OKKA 3RPIB 4AJ0A 3PWPE 3UTPE 1OF2A 1J05A 3SPVB 2YD1A 3QPXL 1HCVA 4P23B 3AU1A 1I7UA 3GMLB 1T21B 4QF1A 4JFZH 5L7XH 2FEDC 3QHFH 4I2XE 4JM2C 5CSGA 1FNEB 1NMCC 5JNYB 1EUTA 1OP5K 3CFEB 3ROOA 3NAAL 4XX1E 4K8RC 3MBEC 3ULVE 5DFWH 3KPRD 2V17H 4IM8A 4YHKL 4WFFD 1WZMA 4L8DA 4LEXL 4GS7B 4D9QD 1EUUA 4PBXA 2EC9T 1NL0H 1QFUH 4QGYA 3VFVA 4OCWL 1TDQA 4HK3N 3AS2A 2BY3A 3KGRA 3B9KB 4HIJA 3R0MA 5K59E 3EFFA 1P7QA 3N85H 4KXZH 1DLHA 1YEHL 3O45B 4NN6C 3F7RA 3HR6A 2P4AB 4YDKL 3FCTB 4PJGA 3MREB 2DM2A 1F13A 2IQAA 4ZAKB 1E4XH 3MRDA 3ARSA 1HIMH 5E5MA 1A3RL 1Q38A 4LF3A 1CZ8L 3CXDL 4OV5A 3F6LA 4ODXB 4PJHF 4AEEA 2W65A 4PRNB 1F3DJ 4KPHH 1U58A 2BOCA 4OKVB 4O4YL 4BQ8A 1SBSH 1VDGA 2C3VB 3G5ZB 3E2HC 4LSPH 3BN9C 4H20H 1W2KT 4L5FL 1CD0A 3ORJA 4FQJL 4RZCB 5C0CB 4YEFA 3G5YB 3DVGB 4K3JH 1UWEL 1HHIA 4RAUA 4DGYH 5HHOB 1IAKB 4IRJC 3PE9A 1RJLA 3I2CL 1S7RB 4FXGB 2X2YA 3PWJB 1CGXA 4RDQF 5I1DB 3NTCL 1XF1A 3OR7A 3RWJA 4HS6B 3VCLB 3VXOA 1JGDB 4HWUA 3QUYB 2FR4A 1YNTB 3FHAA 4OZGE 5F6IC 3F65A 3ZO0A 4ESKA 3J7HA 1CFBA 3MLSH 4OGXH 3GSNH 3DO7A 1FDLH 2WWMC 5J1SC 4UNVA 1C12A 4LHUD 1YEIL 4Y19B 1MUJA 2P5WE 3S37L 2YD4A 5DDHB 5GS3A 1B2WL 5I30H 4GXVL 4LEOA 5E2UH 5CILL 1SEBB 5FECB 3PWNB 4JPIA 3KDMB 1JTPA 1TVHB 4K8RH 1KTKE 1J0IA 5E99H 5IJKC 5B3JE 2APFA 2YXMA 5TDPB 1Q8MA 4MLIA 1RJZA 4FTVE 4DEPC 3HZYA 4X6CE 2WINA 4XVTH 3IJSA 4M8QA 4U49A 3TM6A 1U3ZA 4R0LA 4PD4K 3EOBB 3MLYL 1RUQL 5AUMA 1AKJD 2APTA 5F93C 4PJCA 1YYML 4WWKA 1NPUA 1OM3H 4MB3A 4OFYA 2F53A 4NO3B 2QHRL 3QEUA 4JG0H 3K8LA 4ETYA 3V95A 4MHHI 3S3SA 2J8UA 4I0PB 4PJ8C 5CWSB 3F58L 4E0RB 4HWEH 1KJ3L 2ZSVB 3O4OB 1B0GA 5C0BD 1J1PL 2NNAB 4OI7A 5IKCA 3PHQA 3PDGA 4HV8A 5IV2A 1YEJL 2XKUA 1E4WH 1SJXA 4MJIB 3UJTH 3VGHA 4PY7B 5D1XD 5LGJA 2IALB 4YC2C 5GISL 3RGVC 1OW0C 3KNBB 3VRJA 4H5SB 5I16A 4X6EA 4OV6F 5IROC 1KIRB 5DD1L 5HI4D 1ZT4B 3MUGA 3EGSA 4AG4L 4I77L 3U6RB 2XZAL 1JNNH 1Y6MR 3N9GH 1U8HA 2WUCL 1F3RB 4XXCC 3QUXD 1WZKA 5CEYA 2B5IC 2XACC 4R2GD 3MLZL 3O3BA 4XWOD 1FL5A 5I8OL 3B8SA 1RK0A 2FX9H 5B3NA 2I9LA 5HYIA 1UJ3A 4UDUB 5GIRA 3VXQB 3BH9A 3BP5A 3BHBA 4KHTL 3I50L 3SDAD 4ONGH 3QFJE 3C5ZB 2E6JA 2NY3B 2FLRT 4RA3A 3NPSB 4D0DB 3FQNA 1R3IH 2AKRB 4B53A 2HWZL 3BT2L 1SBSL 4Z7WB 5DD6A 3MO1B 3RVTC 1RJYA 1MY5A 5HHQA 4EN3A 1S9KC 4F9LA 4XVJL 4XHJC 3KPSB 1DLFH 1MH5B 3RWHA 1QPXA 1YYLH 5L8JB 4DGYL 5SX4I 5A1AA 3RTQD 1DBBH 4FQ2H 3O4LB 3IYLW 3SJVB 3UTSD 4XCNB 2YPKA 3QQ9D 5DUBB 1QYGL 4MA1C 4MAYD 5FGSA 2HLFC 5E8EA 1SM3L 4JFOB 1DVFB 1NBZB 2BNUA 4LVOB 4NQCB 5FO8B 4WEMB 2AABH 3QCUL 2HT3C 4FFYH 5FYKL 3BPOB 2AJVH 3SDDA 1A6WL 4LHUA 4P2OC 4J8RB 5DJ0A 2CDGA 2P8PA 3STBA 2CIIB 3K1KC 4RMRA 1S9VA 1L0QA 4M1GH 3SQOH 1QR4A 1IAIM 5JHDE 1UCBH 4M1DL 5ALCH 1FL6A 4HGWA 5DLML 5F9WC 1EFXB 3PL6C 5C0ND 3C60D 4JHBA 1FH5H 4Q0XH 2R2CA 2Q3AA 2EC8A 3HPLB 4I13B 3T0EB 1H0DA 2R2BA 2VLRE 4IRSB 1BJ1J 4RNRA 1OY3B 2ADJB 3VFUA 3EYFB 1QSFB 3O2DH 5GSVB 4G43B 4X4YA 5ANMA 1PJ9A 2ZUWA 1WFNA 5IW6A 2NY6B 1N64H 2EZ0C 4EI6B 3OAYK 1U92B 3BDYL 3REVB 5I0ZA 1C1EL 4QOKE 1H8SA 3R06B 4OGYH 3NN8A 5LBSL 2BSRA 1HKLL 4CVZB 4LLWB 1AY1L 1T7YA 4GKOA 2PR4H 4W81A 1MSPA 1KIQB 2CMRL 1K4DA 3W5NA 3FOLB 3HS0B 3WIFA 1QBML 3X12A 2NXZC 5C0BA 4P5TC 2WUBH 3O0RL 1PZ5B 4LCIH 4UQ3A 1I4FB 1N59A 2LAAA 4KVNL 2E6PA 2IWGA 1A4KB 5CJOH 3U79A 4DKEH 5D96C 5IOPA 4J3WA 3DPBA 3RHWK 1IGMH 1PY4A 4AEFA 4X6DA 5AYUL 5EO0B 4CVXB 3DARA 5DMIL 4M7JH 1QRNE 3PGCB 3VFSB 1XGYL 3WJLC 1C8PA 5ISZD 3RI5F 2IBZY 4G80B 4M5ZH 5FYJE 3C9NB 3ARFC 1G1CA 4K3DL 1A14L 4HFWA 4OIBA 5D2LE 3QUXA 3IKCB 3MRGB 4PJ5E 1CFSA 4BFBD 3H7LA 3VE0A 3QPQD 2R0WH 2X1XR 2Z91B 4KK9D 4ZS6D 1ED3B 3WEXB 3LQZB 4AM0B 1P4BL 1WWCA 3QH3B 3TPKA 3U4BL 4R90H 1IFHL 4DOHB 2Z31C 3SDYH 2Y5TA 2VUOA 4H25B 5EU4B 5CD3A 1FNSH 1FG2B 2FX9L 3HPJA 3M1BA 1UACL 3QXVA 4BSWB 1C08A 4G8IA 1HHHB 2XZCH 3S5LA 5EZLB 3CCHA 1WWAX 12E8H 4KRNA 1LO3H 1OF2B 5D8JL 1J05B 2YD6A 1ZEAH 2VZ3A 3EDJA 5J7CC 3AU1B 4JRYE 1UWXH 3WDHA 1LWRA 3S37X 4AMKH 3P9WB 4UAOB 3PWPA 3RTQA 4OZ4B 1VPOL 4GRWB 3G5VA 1XMWA 2Q3ZA 5GRYA 3ROOB 4JFPB 2DI8A 3W2DL 4IOIB 4I2XA 4ZTOL 3WFDH 4JZJA 4XWGL 1G9EA 3TCLA 1FYTD 1NEZA 4N0UE 2NX5B 3O81A 3EOTL 3BJLA 4ZUVA 1L0XA 2XTJE 5HYQA 1X7QA 2RR3A 4G42B 4WHYH 2ORBH 4KJQD 3VFVB 5E70A 1A02N 4AH2B 4N5UA 4G9DA 3B5GA 4HIJB 3EFFB 4PGBA 1CLOL 1P7QB 2AJXH 3C60A 4YZFF 2FCBA 4YNYA 3VGEA 2ESVD 1TTGA 3LEYH 3MPCA 3PQYE 5AWNL 4BUHA 3MRDB 4FHBD 3LKOB 2QSQA 2VWEC 3CDGA 2JLLA 4LF3B 4ZO7A 5E5MB 5KVEL 4CU7A 2BJML 4OV5B 1JGEA 5ETUA 5ALCL 1R0AL 2OI9B 4U7KA 1ADQH 4GKZA 1OCWH 1I7RB 2RGSA 3VDCA 3RVXD 1D9KD 2W65B 4JFED 3GIZH 1EEZB 1TZIA 1U58B 2BOCB 5TE6L 3PNWA 5DRNB 5TJWK 2Q7NA 3V8CA 5CHNA 4FS0A 1H3WM 1BEYL 1YN6A 2XWTA 2WBJD 5J9PA 1HHIB 4OLVH 1IKFL 4RAUB 1VFAA 1C5CH 2BVOA 2R1WB 3V0WL 1RJLB 2EIBA 4U33A 2R1YA 5KSBE 5ICYA 5I17A 3P4LA 3UX9B 1A22B 4ZO9A 4L8SC 2PR4L 3MC0A 3BESR 3JZ7A 5F8QC 3T2QA 3OR7B 5F44A 3RWJB 1HSAA 2J88H 3VXOB 3KYAA 1SMAA 3CDCA 3HNSH 3TVMC 2FR4B 3MUZ1 4LGSB 4AIOA 5ISZA 4FFWC 1RHHA 1LEGA 4V2BA 3BI9X 3MNVA 3DO7B 5K33A 5CCKH 4WU5A 3DBXB 1C12B 4ORZC 5EOQH 4OZGA 5I1KH 4KUZH 1F8TL 4GQ9L 1ZGLM 1N7ML 1D6VH 4HWBH 1RPQA 2VXTH 1IAMA 3ARVA 4MXVF 4WU7B 3SKJL 4LEOB 1JGUL 2X70A 5TPWH 4HIHB 2DD8H 4MDJB 1DCLA 1YECL 4JPIB 2P5WA 4HKZB 2NY0D 1EGJL 5L8KB 1D6EA 1UEMA 4U2YA 5HSFA 3B43A 3ALXA 4OZIB 1WLHA 4EI5A 3CFJA 3HZYB 3UYPA 4Z0XA 2WINB 1IEHA 4MX7A 4PG9A 2C4FT 3RIAF 4YQXH 2FBJL 3S36L 1UM5H 4NYLA 1SYVA 3B6SA 1IM9B 1OLLA 1IAIL 1WEJL 2E5EA 2OP4H 3UC0L 2XY1A 4WWKB 3UYRH 5M94B 2F53B 4M6AA 4XNYL 1OTSD 2PN5A 1Q72L 4M93C 1QSEE 4RX4D 4KTEL 2J8UB 5T1MB 1T5XA 3RVUD 4XI5C 3QIWD 3BUYA 3MLUH 1IGYA 3QULB 1B0GB 4N5EC 3IDMA 5IKCB 1V8HA 1FSKC 3PHQB 5IV2B 3TESA 3DYOA 3X13B 1MJJA 4Z7VF 1U6AL 3T08A 1T20A 5JQ6H 3CSPA 5D7JD 4P48A 3VRJB 4NN5C 5I16B 4G6KH 5CEXA 5FOJA 5KVGL 5E1HB 3MUGB 3EGSB 1RURL 5FM4A 3T3MF 2ESVA 3MFFB 2VDPL 5C9JB 1EHLL 2M26A 1U8HB 5F6HJ 1RULL 4L8CA 4BQBA 2H32B 5KN5A 2NY4C 5DRXB 4QHLB 5CEYB 4G7YL 4KZEH 2IMMA 1PKQE 1FL5B 5MEOA 4YDVB 4NKDA 2I9LB 1XGTA 1J8KA 2MKLC 2CJUL 1UJ3B 4Y2OA 2P48B 4S11A 3LB6C 2P5ED 5EO1A 3BH9B 3BP5B 5I66A 3BHBB 2J8HA 2VO5A 3TBSA 3V4VL 5LAXA 2XQYK 5D6CA 2WBJA 1CXFA 1TENA 1CCZA 1A21A 2YS4A 5I1AB 2OK0H 1IAOA 2H1PH 2HN7A 4LPVA 4NZUL 4WUKH 1RJYB 4JGUA 4LHUG 5DD6B 5HGDA 1DR9A 3QFJA 4LNRA 2HKHL 5HHQB 3S4SA 4W4OC 1NGZA 4EN3B 1HOCA 1B4JL 1PVHA 3RWHB 3GBML 1NUDA 5EIIA 4LSUL 2IBBA 2NTFA 1TQBC 4ENEC 5GGSA 1Y6NR 2Q86B 5E8EB 2BNUB 2V7HA 5H37H 2ID5A 2DIBA 1BVKA 3SDDB 5DWUL 1GH7A 4LHUB 3CLEH 4XPTL 5DJ0B 4PRBB 3HNSL 2XA3A 2CDGB 2P8PB 5K9QI 1UXWA 2QQNL 5AZEL 3U1SH 3STZB 4HGWB 4W6XB 3L5XH 4APQB 3ARZA 2E27L 3SCMC 5I1HH 1H0DB 2R2BB 5E24E 1U8JA 2DOCA 3LMJH 1YUHA 2UWEF 2VJXA 3X11B 5FFLA 4X4YB 5ANMB 2VLRA 5IW6B 1E6OL 4TQEL 4XPBH 5CGYC 3P30H 1VFMA 5I75B 4HULB 3NN8B 3PV7A 3QQ4A 2BSRB 3QQ3A 4F8TA 3K0WA 3LDBC 4JHAH 3IU3A 5CIPH 1HSBB 2XFXA 1K4DB 3QIWA 4QOKA 3FO0H 5TQ0H 3BVNA 3PDDA 4D0BA 1NSNL 3X12B 2OR9L 4LSSL 4JG1L 5E2WH 5FGCE 4UQ3B 5T3ZL 1KCVL 1EH9A 1XGRA 1SEQL 5IOPB 1IC1A 5JR1L 5D7JA 1MJ7H 4OQTH 1CGYA 3MJ9H 5I76A 5J6HA 1KJ2H 3GO1L 1R24A 3FQUA 4PGCA 4X6DB 1BWMA 2NY1D 1G0DA 2XWBA 3IDXL 2VDQH 4MVBC 2WLYA 4WV1B 4HQQH 3B4NA 2HRLA 4YLQT 5J4MA 5KBNC 5JQ6L 2AQ2A 4HFWB 3S5LG 3QUXB 2BSSB 1QG3A 1QRNA 1CFSB 5ESQA 1R3KA 4HX1A 2EDKA 4Y5YC 3VE0B 1R5VA 3Q1SH 2E7CA 5GJSL 1HDMA 1LMKA 1DQMH 1UWGH 4QRPE 5D2LA 4JGMA 3QXWA 4YUEH 3HMXL 1ZLWH 2FEEL 3OPZH 3BDBA 4HKXA 4TTDC 5D1ZA 5HI3C 2C26A 2Y36H 5EH1A 5MI0B 1UCTA 1S7SA 2LV4A 5CBEA 3ABZA 5DJZB 1A9BA 5CD3B 4XBPA 5KANG 3M1BB 1KELH 4TOYH 1KOAA 1C08B 4G8IB 4HF5H 3KS0H 5L0QC 3S5LB 1NEZG 3CCHB 4YWGL 4M3KB 5ID0B 4LRNL 1KIUA 4XX1G 3GSVA 4BELD 4OD3H 3FB7A 4FNLL 4MZ2A 1A6UL 4ODBD 5DZOA 2IH3B 4PBWD 1VADA 3T0WA 2NZ9C 5J6GA 3PWPB 1LVEA 3CLFH 5DFVD 5JOFB 3G5VB 5A3ID 1TJHL 4HUUA 4JVUA 4OT1L 3U0WH 1A8JH 1G6RL 4JRYA 1RIHH 1TJIH 4I2XB 3VFTA 3P73A 4JZJB 3TCLB 6FABL 2H41A 3LEVL 1NEZB 3QAZC 4X9GA 2GCYA 3PIQA 5D7KD 4ZUVB 1WF5A 1K8DA 5HYQB 4DGVH 4ZOBA 5JLZB 1X7QB 1Y0LA 3P2TA 1JJUA 1BQHG 3DX9A 4BFEA 3QXDA 1RZFH 5IFAH 1WUNT 3EO1A 4N0UA 5EIQA 4XMKL 1MWAH 3DJ9A 4G9DB 4TPRH 3I9GL 3RWCA 3S36X 5I1GH 3HFML 4WW2F 3FONA 4WHTB 4PGBB 3SDXE 1YEKL 3MV9D 2OX5A 3NIDE 3AREC 1NUFA 4LCCC 4PRID 5J3HD 4J3VA 4YHYC 3NPZB 4YHNA 4YNYB 2IADB 1FORL 1GC1C 1DL7H 4QHUA 4X8XA 3V5DA 3RWDA 3CDGB 4KFZC 1JPFB 5T3XH 1JGEB 4HKBA 5ETUB 4NBZB 2VABA 1D5IH 1JWUA 3O11A 1GIGL 2PYFA 1BQHB 3O8XC 3PQYA 2P45B 4JDTL 2D7TL 2GJ6D 1P1ZA 4JRXD 1AHWA 5IB3A 1TZIB 3GJFA 1ONQA 2VLME 1S5IL 4OSUH 4ZUTA 5BW7C 4OCNC 5CHNB 1Y6KR 4MD4A 1A1OA 2QLVB 2XWTB 2E8YA 4HSQA 3T2OA 5J9PB 1VFAB 2BVOB 5EBMA 4ZD3H 4FQCH 1AC0A 4XC1L 4XPBL 3P30L 2R1YB 4J3XA 5DUPH 5ICYB 4TNWF 5I17B 1V05A 2R0ZH 3MLXL 1MHPL 1B3JA 4YPGB 1FNAA 3FN0H 4YDLB 3DMMA 1AGFA 5JUEL 2PW2A 4G6JL 2CKBL 4JPKH 1Z5LA 1EV2E 2EYRA 3VXNA 3S88H 2FJFB 1Z0MA 5ISZB 5E1AA 1A7BA 4JFHE 1RHHB 1LEGB 3T3PE 2DKUA 1UKSA 1F2XK 4B7IA 1UA6L 3MNVB 3P77B 4N1CA 1VFUA 4WU5B 4OZGB 1IEAA 3MRPB 3FO9A 4HJGA 3VH8A 3ECBA 3VGAB 4QRSA 3P0YL 3QJHA 4P23C 2X70B 4IIQA 4XC3H 2P5WB 1J0ZA 3VXSE 2VKXA 1D6EB 2WM0A 2E8ZA 5E6ID 3VFGH 5HI5D 3D6GA 1KTDB 3U36B 1MFDH 4XXDB 3A6OA 3CFJB 4EEEA 4EI5B 4KUCD 1MFNA 5AZ2H 1EHXA 1XGPA 4LKCA 4Z0XB 4MX7B 4PG9B 5EBGA 5GS2H 4OB5L 3Q2CA 4R26L 1N4XH 4MDIA 1BVZA 1MIEH 4Z95H 4GS7C 1KTRL 1SYVB 3B6SB 3K2UL 3QDMD 5JPNB 4KV5E 3TEUA 1KACB 3TYGH 5ICZA 4GW5A 3IDNA 1EO5A 1G0XA 1GC1H 4BH8A 2K7QA 4NP4H 1LK3L 2ITDA 2R4RL 2DLTA 3TO4A 4OCLC 5FUZL 1JHTA 5DS8B 2UV3A 4MMZC 3V4UL 2DS4A 4FQLH 5KTEH 4ZAKC 3IDMB 4OLXL 5DD5L 1MJJB 1AR2A 1RIHL 4G5ZH 3H9YA 3TH4T 3WSQH 1T20B 5CEZL 2HRPH 5ESVA 1QLEL 2YA0A 5TQ2L 1GCFA 3GFUA 1T2XA 4FG6C 3BKML 2DMBA 5EZOH 3MLPA 1N2RA 3WNNA 4Z8FL 1L4IA 2FLBT 4Y4FA 4CJ0A 4TPRL 4U1MA 5C1MB 5KN5B 3UEZA 2QJDA 4CMHB 2DJ4A 3IFLH 3KYNA 2EXYC 4N90D 5MEOB 4UT9H 3S4SG 4NKDB 4QTIH 2GJ6A 4UUJA 1XGTB 1X5FA 4PB9L 2DQGH 5HVFB 2XOTA 5E8PA 1S7UB 1CVSC 4PY8I 1PKQA 4HHAA 5I66B 1UZ8A 1NEUA 3I85A 2OR8A 2WQ8A 1P7HL 3TBSB 5LAXB 2GUOB 2XY2A 3EYUL 3QUYC 4ODWA 5D6CB 5K9JL 2ZNWA 4CVWA 1IAII 2P49B 3LQAC 3RIAK 1KYOK 1IAOB 2HN7B 3VXPB 5JHLL 1CXEA 5HGDB 3QFJB 4XCFL 4LNRB 3S4SB 4IOFC 5DUMH 1NGZB 4RAVB 4WUUE 4FABL 5DR5H 5HGHA 3PP3H 3DNKA 1OOAA 2EDOA 4OLEA 1H15A 3KPPB 4IHOA 5DRWA 1MCEA 5EIIB 2LU7A 4ZD3L 1CGTA 4KKCD 5D7LE 3IXAA 2NTFB 1WWBX 4K9EC 3O6FA 3TFKD 1MNUL 3D9AH 4X5WA 5DQDL 5GGSB 1PSKL 3CMGA 1YJDL 2V7HB 1D3CA 5BRZE 1BVKB 2YUZA 1FN4B 4Q7DA 3WKML 4AL8H 2Y4SA 4UILH 4JPKL 4F58L 5CMAA 1LO4H 1UXWB 1DN2A 1GPOH 2P44B 1BP3B 2RCSH 5J57B 1TPXB 2XIDA 2W9EH 4LAQL 1AJ7L 4PLOB 2X4OB 4FXKA 5ALBH 3RAJL 3ZKMD 4PJHE 4HFUH 5JHDB 2YZ8A 5EOCJ 3GBNL 1U8JB 1KEML 1YUHB 3RX5A 1LO2H 4MNQE 4I0PC 5GRWA 1UJTA 5FYKE 2R0LH 5I9QB 1CGWA 3O4OC 4TRPL 2VLRB 4ODTH 1GGBH 4RISH 1XIWA 2LU3A 3X3FL 1J5OL 3ES6A 1BHGA 3O2VL 1I75A 1KXVC 5IEHB 2CK0L 3QQ4B 1N4XL 5IMMA 1GHFH 3DUUA 5F72S 2NYYD 2XFXB 4M6MH 3HR5B 3QIWB 4QOKB 4XNMA 2VDRH 3BVNB 5E2TH 5CZKA 5HY9A 3AM8C 4D0BB 4KI5F 1D5ZA 4ZNEE 1X6LA 2V9QA 1IGCL 1EJOL 3F5WA 3V52L 1NGQH 3WNMA 2Q76A 2Y6SD 4L8BA 5E2VL 1NFDF 5I76B 5SWZD 1R24B 3FQUB 4PGCB 4UIKL 4FQLL 2IANE 2XWBB 4BA8A 3CNKA 1DBAH 2FO4A 3KR3L 3MLTB 3VD7A 5F7HA 3QUZA 5DURB 4ZFOA 3LQAH 4Z18A 1KB5L 2GITA 2DIJA 4X7DC 2APXA 1ORSB 3C5ZC 5IGXL 3BZEA 3OKMA 3QYCA 4OIIH 3NPSC 3GKWH 3BZ4A 1QRNB 1R3KB 3KLAA 4HX1B 5DMKB 3QA3A 3I6GA 1R5VB 1YEGH 1CG9A 1HDMB 3ZL4L 5D2LB 4PJ5B 4K9EH 3EO9H 4RFEA 4XP5L 1BM3H 3EYSH 3QUKA 3OB0K 5D1ZB 2XN9D 2OJEA 5B38A 4HZLA 1S7SB 2GAZA 5CBEB 5HHXH 1A9BB 4QRPA 4XBPB 3OZ9H 4OKDA 4NBYB 1UADC 3FQTA 2DQGL 1CI5A 3B2UD 1DVFC 4LVOC 3K3QA 3QI9D 1T80A 4IDJH 4EDWL 1JGVH 2DN7A 4PJ7F 4MJ5A 3BPOC 3FB7B 1ND0A 4ODUB 2VDKL 4Q97A 4PRDA 1VADB 1J11A 4OJFH 5J6GB 2D0GA 3MCLL 1WAAA 1DE4A 1ZHLB 3KWWA 1CICA 1GGIH 1EAPA 1YMME 4HUUB 3H9SD 2YN5A 3EOYG 4JRYB 3RWFB 3K80A 3VFTB 5DR5L 4OFIA 5F9OL 1QKZL 2GCYB 3PIQB 1QP1A 1YEDA 2HT2D 3T0EC 2ZP0T 4IRSC 1R3JA 3F7QA 1XZ0A 1Y0LB 2Q6WA 3CVHL 3DX9B 1JFQL 4YIQA 4S1SH 5BMFH 3QXDB 4XBEH 3EO1B 4N0UB 3RWCB 2NPLX 1X5JA 4X4ZA 1CK0H 2J6EH 3FONB 1WT5A 2XTJB 2Z8RA 2JIXB 2NY6C 4WENB 3UCRA 1NCNA 4D0CB 1H5BA 2H45A 4YHNB 1WIUA 1ZVHA 2A77H 5F1NB 3SDXA 3V5DB 5IG7A 5DYOA 4MGXA 1HWGB 5BVPL 3MLRL 4JFDD 5JXEC 4HKBB 1CS6A 3C08L 1OAXL 3RU8H 4N9GA 2FEEI 2PXYD 1QD0A 1XF2A 3PQYB 4HK0A 4WDIA 4EJ1C 1OSPH 4K3HA 5B8CA 5IB3B 1ZA6A 3MXVL 4PB0H 3GJFB 1ONQB 1II4E 4ZUTB 1EEUA 4RBPH 1I3GL 4MD4B 3BP6B 4Z0BL 4S0TD 3ARBA 4WI8A 5L2KE 2NW2A 2QSCH 3TJHC 1GGBL 1IT9H 3P40A 4XP1H 5D93B 5EBMB 3Q48A 1J88A 2UUDK 2C5DC 3BRFA 1IEBB 4BZYA 4D9LL 4UT6L 1ZTXH 2YD7A 3VH8G 1UM4H 4H0GA 1BIIB 4XNXH 3QG6A 5FYJU 4ZUWA 1GYAA 3HC3H 4MQSB 3FMGH 3DMMB 1CD8A 4LHJB 3NCBB 3QG7L 1Z5LB 3ARUA 4P9ML 2EYRB 4LSQL 3VXNB 4Z77A 1BZ9B 4MHHG 4BKLB 5E1AB 1XAUA 1BWWA 1Q1JH 4PBVC 4JO1L 4X7TA 2PYED 4ZSOE 3DHJA 5BZWA 2IMNA 3CVIL 4DTGL 4HT1L 1IEAB 3I6LD 3FO9B 4C4KT 5KS9E 3VH8B 3ECBB 1IZKA 3B2VL 2JCCF 1CL7I 4L4TE 2BRRL 3QBTB 4QRSB 2A73A 3SEPA 1B6UA 5EUOA 4IIQB 1S7TA 3MR9B 3RVVD 4UAOC 2VQUA 3PWVA 4I18A 4NQDE 1EO8L 2CDEB 2ZCHH 4XCEA 3LS4H 1XGPB 3VXSA 5CAYB 2NY2C 3LHPL 3QI9A 1NMAH 1J0KA 1ZOXA 4MDIB 5D1QD 3C6LB 3CC5A 1VFOA 1JYXA 2V5SA 1MPAH 1GOHA 2VXVH 2DRUA 4X6BB 5ICZB 3IDNB 3DYMA 5CGTA 5TFSH 1G0YR 4OZFA 4BH8B 3GSWA 1O0VA 1TZGH 2ITDB 3ME0A 1MRFH 3TO4B 2YA1A 3OKYA 5ITBH 1UVQA 3SO3B 4LPUA 5D72H 3GSXA 5GGVH 1EIBA 3JV6A 4HAFA 1OAYH 2DQCH 2OMBA 4ZODA 3TJEL 5E4EB 1QSEB 4UDTA 5CSZA 5JO5A 1DQDH 2BNQE 2UYLA 5FYLH 5JA8B 2DICA 2ZUQB 1REIA 4HCRA 4P4RA 4P2RD 2OI9C 4AYFA 5DJ6A 3IFOA 3W0WD 3WO3B 1IC5L 1AGDA 5F9JA 2WBKA 2DLFL 5ESVB 5CP7A 6CGTA 2DBLH 1DDHA 3LRHA 5IHZA 5GGTA 1A7QH 1JI2A 1A7RL 2PTUA 4JVPA 3TZVD 4QRRD 2D3VA 2LVEA 1BFVH 4LDLB 4OD1L 2CR6A 4Y4FB 3ARGD 4U1MB 1OAZH 2FX7L 1T2QH 3TH3T 4XP9H 4MAUL 3P3YA 3KYNB 3ULUF 4WY7H 1I8MA 3DX6A 2BHUA 4MXQD 4UUJB 3VWJA 4RMQA 3GGWA 2IG2H 3UBXI 2IH1B 3U7WL 2DKSA 2EDQA 5E8PB 4I0CC 1PKQB 4HHAB 2ENSA 1Y18B 1UZ8B 4FXLA 4YDJA 1F90L 4NO0A 5DSCA 2AK1L 4ODWB 2X42A 2F9BT 4X6FA 2EDXA 1L6XA 1IGFL 5EOTA 4G8EA 1JHKL 4KDWA 1ETZA 1RHFA 3UAJD 2AJYL 4YE4H 1KCUL 1YA5A 2DQFA 5HGHB 2VSCA 1H15B 4O58H 4XP1L 1JZ7A 4C83A 3VRLF 1JGLH 1PBYA 3IXAB 4GRWH 3O6FB 2GY5A 1OGAD 4X5WB 1NCBH 1L7TH 2VZOA 4M6OH 3FN3A 2BFVL 3ZT7A 3BWAA 4W4NA 5D7LA 4PJGF 4QHKJ 4U1NA 1KIPB 1U2HA 1JNHA 3VFRA 3RL1A 3ZTNH 3HUJF 2CLRA 5CMAB 4R0LC 5BRZA 3RWGB 4NUGL 4JDVA 1CLYL 4UTBH 4XPHL 4WWKC 4P5KB 3D0VB 4JB9L 4G9FE 4FXKB 4NQXA 5B4MC 5C0DB 1HXMA 1P5UA 4JANA 4M5YL 4LSVL 4M4RA 1OPGL 2P43B 5HDQL 5DC9B 3TPUA 1KGCD 1KCSH 1ZMYA 5D1QA 4YXHL 5T5FL 3L7EA 2M2DA 4PJHA 3VMNA 5C0RL 1XIWB 3T2NL 4MNQA 3V7AE 2A6IA 4EDXA 1MVUB 4CUCA 2W0PA 3DUUB 1D5BA 2DBJA 1NANH 3BH8B 4HPYH 4RWYL 2OR7A 4O2CB 5TE4H 3LH2H 3RKPA 4YX2H 3UZVB 4UINL 4XNMB 2R4SH 4JLRB 5HY9B 5EU7E 3MRNA 1DEEA 5ADOL 2G5RA 5C07D 4QHMA 3F5WB 1OL0A 2Q76B 4ZTPH 1B6DA 4LCUA 3W0WA 4RRPA 5F96L 1F5WA 5GGVL 5FGCB 4ONFL 1J87A 3MOAL 1UJ3C 2VZTA 2FO4B 5BJTB 5B38G 3TZVA 4QRRA 3HE6A 3QUZB 4MXVE 4ZFOB 2N56A 4K7PH 2GITB 2Y72A 2CLVA 3FFCE 3ARGA 3QIBD 5JTWA 5JMOC 4K94C 1FVEA 1NBVH 3BZ4B 1J8HE 4BK4A 1A9EA 3QA3B 4URTB 5T3ZE 4NC1E 3WO4B 4U1HA 1CG9B 5HGBA 5GJTL 4EN3C 2D0HA 1G9ML 2X9WA 1OT1A 4F9LC 4ORGA 1FIGL 1T2QL 2V5TA 5CUSH 5F1IA 3QUKB 4ALAL 5EA0H 5B38B 4XCCL 3LKQA 4HZLB 4U1KA 3MRMA 2GAZB 1PX3A 4QRPB 3G08A 4WY7L 4WFEE 4M3JA 2VLKD 3FQTB 5IBLC 1B88A 3CFCH 1YY9C 2C3GA 5FF6B 3L5JA 4WI3A 5JDSA 1HEZA 4MJ5B 2D7MA 2CIKB 1XEDA 3SDDC 1ND0B 1KLUA 1NAML 2D7OA 1JZ2A 2YA2A 4PRDB 4UB0H 4F7TA 1CWVA 1M05A 2C4XA 1DE4B 3IS1X 3KWWB 1CICB 1EAPB 3ULUL 1OGAA 4Z7VE 1JUFA 2ZCKH 4APQC 3HC4L 2BHZA 3U9UA 5KSUA 4LP5A 1CXKA 1YMMA 3ARDD 1FJ1B 1YEDB 1FCGA 2ZNXA 4NT6A 1R3JB 2QTEA 3T0XA 1XZ0B 5T1LA 1IL1A 1NGXA 2IJ0C 2Q6WB 3HI1B 5IBUG 3QZWA 1MEXL 1P9MC 1NCBL 4QXUL 2CUIA 5J13B 4ZG1A 1CR9H 2JJUA 4M6OL 1NC4A 2FECL 1JPSH 1H5BB 3LS5L 4MA3B 1T7ZA 2BSTB 1N6VA 2ICWI 5I75C 1RZKC 1C5DA 1IKNC 3STLA 4GG6E 1GOGA 1RU9L 1JBJA 3SDXB 5IG7B 2QR0A 4XH2A 5DYOB 4BZ2H 5FHAH 2BVTA 2EDRA 2H32H 4XRCA 3SGKA 3QP3A 1XF2B 4HK0B 4WDIB 2X1QA 4PRPD 1MCQA 4MJ2A 4O2EB 3UTTD 5B8CB 3AVEA 1ZA6B 4JPVH 1LK2A 1U42A 4GAGH 2Q8BL 5E08H 4TNVF 5FAAA 4X80H 5D2NE 3JV4A 4HPOH 2DLEA 3ARBB 2NW2B 4C59B 5ICXA 1AGEA 4K94H 1CYGA 3VMOA 3MZTA 2PO6D 4MLSA 3O6MH 1G7LA 5C07A 5IVXF 3RA7H 5I8KL 2X4NA 3WL9A 5L2KA 3QUXC 2HP4A 1MLCB 4XWOC 2V2WA 3AMLA 3QG6B 1AQKH 5I73B 4OD2A 4HIEB 4C56D 1JP5A 1U3HD 2BZDA 3MRKA 4PV8A 2W0KA 3MXWH 4Z77B 5BS0D 3IFNH 2JB6A 3CXHJ 4JFFD 5MI0C 3O3EA 4ZTPL 2XRAH 1BLNA 3QHZH 4HUMB 4X7TB 4HIXL 4I5BA 3AAZB 5EG6C 4KKNA 3UPCA 1WCQA 5GXBB 5CZVL 1JNLH 2R0KL 3S3JA 1RUMH 2X4SA 4QRTA 1BAFH 3P4NB 2A73B 3CIQA 1MFCH 5HYFA 5EUOB 4G6FB 2UWEE 1GOFA 2DQDH 2E7LA 2BDNH 4L4TA 4OZFG 4LSRL 2X89A 4XCEB 1IC7L 2HH0H 3VXSB 5LGHH 1HZHH 4JZJC 4OLYL 5D6DA 1J9CT 4L4VD 3C8KB 5LVEA 3ELAT 2VN7A 4NQVA 4F9PA 3CC5B 3ULVC 3VW3H 3SGJA 1T6VN 5CGMA 2AQ1A 4MA8L 1RZKH 5FUOL 4OZFB 3GSWB 4DN4H 3NFNA 1T6WA 3UZEA 1T03H 5LXGH 1KPRA 1NCDH 4PJ9D 1UVQB 4LCWD 1KJVA 3ARDA 3GSXB 3CX5K 3VJ6A 3JV6B 1EGJA 3BGMA 5EWIH 1DN0A 2JKXA 5AYQA 4UDTB 5JO5B 2UYLB 4KK8D 3IDJA 1MCJA 4P4RB 4HBCH 2DJUA 3K4AA 5IFHL 1U41A 2UVFA 3IFOB 5DJ6B 1AGDB 1J7VR 5F9JB 4S1RL 3T0AA 1A1MA 3WKNA 3W5MA 3I6KA 5CP7B 2MCG1 5IHZB 2YRPA 3IETA 3GHEL 3LPFA 2VDMH 3OMZA 4KWUA 2W60A 4JO3L 1CR9L 1ZT1A 3WIIL 5GZOD 1RUAL 3IGAA 1HQRA 4RIRA 1I1CA 5IQ7L 1Q0YH 4YHMH 4JHWH 5K9QG 4G7VL 3EHBD 3DX6B 3ZZ1A 4G8FA 3VWJB 4FN0A 3GGWB 2JB5H 5CEZE 1MREH 5HHNB 4PJAA 1ZLSH 2VSDA 3VFNA 1MAKA 4YDJB 4JQVC 4EZMA 4OF3A 1AI1H 1AR1D 2MPAL 4NO0B 5DSCB 4AEHH 4NM4L 4ODVL 1M7DA 1U93A 4U1LA 5D70H 2FGWL 2H2PD 2YMXL 4ODHH 4XPGL 2PO6A 4R4FL 1GRWA 3JTSB 2B20A 2I60L 5EOTB 4G8EB 4S1QL 3LIZL 3DV6A 1NGWA 2EKSA 3HE7D 3WFHA 4P0DA 3CK0L 1D5MA 4XPFH 2RBLA 3W82A 4LLMA 1ZVSA 4KK9C 4ZS6C 2X05A 2WBWB 5MEND 4P2CG 4C83B 1I7TA 2A83A 5K9OA 3VGAC 4C56A 2GJZA 1U3HA 4WUUB 3NMEA 4LQFH 3V0VA 3W9EA 1L7IH 2EDYA 4TSCL 5LQBL 5IM7A 1L9NA 3DGGA 3BWAB 5D7LB 4U1NB 4EI5C 4KKLD 1JNHB 3VFRB 3RL1B 3EYQC 1MCOL 4OQ1A 3TA3B 4YO0A 3ULVH 4YHOL 1A4JA 3D69B 1VSCA 3JWOL 5BRZB 1RZ7L 1M6OA 5C3LD 4JDVB 3M8OH 5IWLA 5TDNB 2WMPA 5KJRL 4NKIH 5FGBA 1ZANL 2HT4D 5C6TL 4FZEH 4NQXB 4L9LA 1VEMA 4XP6H 4JANB 5E7FA 4R96A 1RZJH 1P6FA 4Q2ZA 1FGVH 3TPUB 3V6ZA 4QXGL 4G9FA 4L4VA 2WQRA 3OG4B 3SBWA 5B22A 4RDQG 4PJHB 2YWZA 4AK1A 1QFWH 2B39A 1OD9A 1I9JL 2KZWA 1AE6H 2F58H 2IEPA 4Y16D 4NQTA 3NZ8A 4MNQB 4WFHD 3MACH 4BM7A 2A6IB 2GY7B 4HWZA 4XPAL 4AY0A 2WK2A 1D5BB 2XZZA 2VH5L 2X5PA 2Q8AH 4PJ9A 1ZSDA 2B1AH 4D9RD 2GFBA 1KPUB 4NRXB 1DEEB 4GMTL 2EDBA 4HLZG 4GAYA 2J12B 2DM3A 3LSOA 1IE5A 1KN4H 4CMHC 3D1MC 1FL3B 4LCUB 3D48R 5DF0A 3RVXC 5FHBL 1A6VH 2VL5B 3ZTJG 2O5ZL 3V5HA 5EU6E 1BQLH 1HYRC 4OGAD 2XQYG 4QRRB 3HE6B 3UP1A 4RMVA 2CLVB 3B9DA 1KXTB 3ARGB 1OTUD 2IANB 3TN0D 5DK2B 2WBJC 1FVEB 4QRQB 1T66C 1A9EB 1Q9LA 4TN9A 3O6KH 2P24A 2VN4A 4M1CC 3EFDL 2QQLH 3FFCA 1ZXQA 1Q0XH 1UQSB 1NFIA 4U1HB 5HVHB 5IVZA 3C5SA 5JW5B 3JVGA 1J8HA 4HIIA 5F1IB 5ACZA 3FAWA 3JSSA 4U1KB 3MRMB 4S1DD 3CJJA 2B0SH 1MJ8H 2DM4A 3UO1H 3K81A 4XVUC 2BNRE 3ZKNC 4OLWH 3O9WD 4DWHA 1OAQL 4WI7A 3QWRD 3C2AH 1HEZB 4XMLL 2LU4A 1KLUB 1PQZA 1UZ6F 1NCUA 1MHCA 1NCCL 3QZWG 4XB7A 5GS1A 1AQDA 1MCPH 3K1DA 1B0RA 1M05B 2ADFL 4TSBL 1FZKA 2BC4A 3PWUA 2VITA 5GZND 1OGAB 4K7PX 1UC6A 4UV4L 1TPXC 4HS8H 1BZ7A 2LVCA 1CXIA 1QNZL 3I3EA 1YMMB 3KPLA 5C0FA 2F74A 4NT6B 3HMWH 2RQ8A 3AUVA 5T1LB 1IL1B 1TQCB 1VFBA 2VC2H 3QZWB 1L7IL 5I9QC 3V79C 1R3LB 5E9DD 1NC4B 1ZGLA 4GO6B 5SV3A 3ZYJA 3X14A 5FYKU 1CDIA 3IAQA 1RUPH 1NBQA 1SY6L 2VXSL 1Z6JT 1N0XL 1F42A 4NOBA 5FCUL 4YBQD 3QCTL 1WC7A 4U1JA 1BZQK 2QR0B 4XH2B 2YPLE 4HH9A 4GOSA 4LLQB 2J8OA 4NKIL 1N5YL 2EXWD 3QIWC 5D5MF 4XRCB 1MQKH 1G6RA 2MHAA 4Y16A 4PTUA 4GKSA 3ZE2F 1WISA 5T33L 4NWTL 4PJIA 1FGVL 5FM8A 1A6TA 3V5KA 5D7JC 1UM6L 3JV4B 1NAKH 4FZ8H 4QHKI 4QLRA 2Y1VA 5I19H 5ICXB 1RUKH 2MQCA 5GGUA 2OM5A 2F54E 4F7MA 5D2NA 5E5RB 2VLJE 4L4JA 1INEH 1ZHNB 1OTTC 2X4NB 4G8GD 3WL9B 1E6JL 5L2KB 1BD2E 4AZ8A 4I1NB 1OQXA 1QLRA 3OQ3B 2V2WB 3EUUA 3BKCL 5E56A 5GRXG 1VEPA 4OD2B 5JOPE 4YHPA 3MV8E 2F5AL 3MRKB 4PV8B 3FRUA 1JHLL 2JB6B 4PJ8B 4F15B 1F4YL 5D1ZC 1M7IB 3U7AA 3O3EB 2GSIA 3RVWD 1FV1A 2ZKHH 2AGJH 2FECI 5EO9A 1MRDH 4DVRH 5EFIA 5I1CL 4E9LA 5TE7L 2DL2A 2D03L 4UOW1 3T77A 2X4SB 3L3GA 5J11B 4N0RA 4QRTB 4V1DE 5C0CE 3OBAA 2FB4H 3CXHK 1RIUL 4HZAA 3QRGH 1UH2A 4JR9H 4WEBL 5KZCD 4KHXL 4K3EL 1H3GA 5KS9B 1Q9OA 4L3ED 4L4TB 5T5NF 4ZPVA 1PDKA 2NR6C 3B5TA 4TUJB 4IEFB 1RMFL 3F7PC 3EIFA 3M17A 5LG1A 3NH7L 2IAMA 4Z7OF 5I0DA 3QWRA 2CKBA 5E8DH 3FT2A 5KVMC 2DL9A 3ZKXC 4EIGB 4FQQB 2KQNA 1PW3A 4KI5E 1I3RA 2YD3A 2XTJC 1P2CA 1FE8H 4F7EA 1ZVYA 5GHWH 4WTZA 2R23A 3UTQA 1NFDE 2Z8WC 4Y1AE 1NCAL 2F19H 3ARDB 3VJ6B 3L5HA 4GRLD 2ATPA 3BGMB 3MUHL 2DQIH 3L3OA 5INDA 1EO7A 2DQEL 4I9WE 3GM8A 1A2YB 4MQ7B 3UBXA 3IDJB 4HS8L 4LFHD 1Z9OA 3H2WA 5E9DA 4DGIL 1LO5B 3GI8H 4U1SA 3MBXH 3QFDA 3I6KB 2H3NA 2AJZB 3OGCA 4NNPL 2BNQB 2A0LD 3BZFA 1I1RA 2DB8A 4YHZL 5C6PB 5EDXA 2W60B 1ZT1B 4YBHA 1CBVH 1ZLVH 3PGFH 5EU6D 2BY0A 3HTLX 3L6FA 2ICEA 4RIRB 5D93C 4HDIA 4UT7L 3CMOH 2I25N 5FYJH 4JY5H 3G04B 1MCSA 4KAQL 3MRRA 3MODH 3NCJL 1EERB 1OAKH 3VFNB 1QR1A 3GRWH 3KJ6H 4KY1H 2LE9A 1C16A 3DMMC 4DFHA 4KKBD 3BOVA 1M7DB 1U93B 2GKIA 2PO6B 5L9DL 3N1GC 1RIVL 3NIFF 5CINL 2C1OA 2EIZA 3DV6B 1NGWB 2EKSB 3AS0A 4P5MA 3WFHB 4XMPH 1D5MB 4EKXA 5TGBA 3QNXA 4LLMB 5MP6H 1ZVSB 2VXUL 5GGQL 1QEWB 2I27N 2A83B 5K9OB 1U3HB 4M43H 4U6VH 4IIQC 3S96A 1MCBA 4PTTA 1CXHA 3S9DB 3DETD 3L3IA 4OUOA 5IM7B 3QSKB 3FQXA 1IGIH 3QIUD 5H8DA 1ERNA 4YO0B 3OWEA 5D96B 1A4JB 2HTLC 2YWYA 4P2QE 4XB8A 3C6LC 3B9AA 1M6OB 2XWJA 2VDNH 4KRPB 1LEKA 1JK8A 2OZ4A 2BXYA 2OTUA 2A1WL 5ELIA 5F7DB 2IFFL 4L9LB 5A3IC 3T1WA 2A9NL 3TT3H 4R96B 3DV4A 4F8QA 2Q7YA 3BKYH 1MAML 1T0NA 2AEPL 3KPNA 4Q2ZB 3V7AG 4OTXH 1X5IA 2F8VA 2VXQH 3TO4C 3V6ZB 4JR9L 4G9FB 3VXUD 2BVPA 1ZHBA 2WWKO 4KK6D 3SO3C 1LHZA 1VA9A 3D2UA 2LAGB 4PP1C 4RGNE 3L3DB 3TYFB 3R8BB 2K7PA 2UY6A 3TV3L 3WD5L 2ZUQC 3NA9L 3GJFH 5EORH 4Q9QH 2CGRH 1FAIH 2D31B 4OCXH 5IVNA 1CTNA 4HWZB 4JN1H 5J3HC 5HYSA 3O3UN 4ONHB 2AXHA 2Y9RT 1IQWL 2A2QT 4PJ9B 4JQIH 5EU3A 1PG7H 2X40A 3EO0A 1PAMA 2GFBB 1F4HA 3QDHA 1AGBA 1EAJA 1QBLH 4Y4FC 1KULA 1J12A 3LPGA 4BJLA 3DRQB 4GAYB 3LSOB 4KMLB 4WHCA 4YDIH 2F54D 3MOBH 5MHSD 5GRJH 5H35A 4H88H 3F8UB 1NUNB 3V5HB 3W9DB 3ARWA 4Y2DD 2ZOLB 3F12A 5DTFA 3TBVA 5EU6A 4YHIA 3P11H 3IJYA 5EBLA 3H3PL 1QA9A 1Q9LB 3D0LB 2P24B 1CU4L 2HMID 3FFCB 4M9PA 1NFIB 1C7TA 1NH6A 5IVZB 3C5SB 4H8WH 1J8HB 4UBDD 4HIIB 1CBVL 2AJSL 4HC1H 4U2ZA 5ACZB 1CDUA 4OIAA 5ERWB 3O6FC 4Y5VA 1MCIA 3DSFL 1LEIB 2VRAA 5BVJA 3MODL 2G2RA 3RWIA 1SMOA 4YXLL 1PQZB 3R4DA 2DTML 1MHCB 2HVKA 2R2EA 1KB5A 3DX8A 4JKWA 1AQDB 1DQJA 1FLTX 4PS4H 2OLDA 2LTQB 1B0RB 4HLJA 1FZKB 3PWUB 2HFFA 2ICWA 3GNMH 1OP5H 4OF7A 5BQ7A 1UYWH 1BZ7B 1MHEA 4MCZA 1INDL 3ZE1F 3KPLB 2DYPD 5C0FB 4TUKL 5DD0H 4Z7VB 3R1GL 3DRTB 1U91A 1VFBB 4DKFL 2X44D 4BUGA 5HGGS 1A7OH 3L3HB 3QDJD 3RNQB 2FIKA 3CD4A 4E41D 1ZGLB 5GQBA 1XIWC 1DZBA 3TIDA 3U48A 3WXWL 3X14B 3ULUE 2P46B 2EDTA 1INQA 3MV7E 5H2BA 3WNOA 4U6YB 1N6QL 1YC7A 3K74B 1WC7B 1CQKA 4P4KB 4HJ0C 4NSKB 4MXWH 5HHMD 2C3HA 4OBRA 4ZPTA 1CE1H 1U8NA 1FO0A 1G6RB 1U8KA 4TVPL 4GG6B 3L3JA 1QOKA 2MHAB 4DZBA 4PTUB 4GKSB 4F7CA 5SX4H 1S9WA 2YPLA 5IJVA 4F2MA 2O5YL 3DURB 4HXAH 1A6TB 4HGKC 4OFPA 5BO1L 3CVHA 4LPWA 4Z5RB 1W72A 4U4BA 3LRGA 2Z4QB 3PP4H 1HI6A 4J7RA 5GGUB 1FZOA 1TNNA 3QUZC 3VRLE 5D2NB 2DWDA 5C09D 5EORL 3BRGC 4GXUM 4WCYL 3G5XB 1QLRB 2F54A 3T4YA 5IHUL 1T4KA 5JIPA 2VLJA 4PJGE 3WO4C 4YHPB 5DHXB 2FX8L 3U9PH 4G6MH 1S3KH 3HUJE 1KTLB 3BXNA 3FRUB 2RJMA 5IF0B 4J2XA 4Y2DA 2IQ9H 4KQ4H 4NQED 4GBXA 2GSIB 1FFQA 3RPKA 2FEDD 5K9KA 1DBKH 3MV8A 4XNUL 5JW3L 1FV1B 1BECA 2R39A 1W0YT 4KUCF 1U8OA 5EO9B 2X4QA 5EFIB 4K8RD 3T77B 3L3GB 1X5AA 3I02A 4JPWH 1MY7A 3MRLA 3P11L 2YK1L 3NGBC 2PUQT 5I1JL 4KKCC 1NDMA 5F7MC 1CICC 2FD6H 5KG9A 3PHOB 4ZPVB 4WTZG 3M17B 2UWEB 4UIMA 1HH6A 2IAMB 3GMMA 3MLVL 2CKBB 1KC5H 3J8F7 4GJTB 1J1OL 4K23L 3FT2B 3HG1E 3UBXG 3NZHL 1MFBH 2B2XL 4N0YH 4M61B 5J13C 2FIRT 4MCYA 1WT5C 3WFBH 1P2CB 2FNBA 4F7EB 3NACL 1H5BC 3KAAA 4L3AA 2OL3L 1T0MA 2R23B 2VZ1A 3UTQB 4UZGA 2DYPA 5F71A 1GAFH 3QDGD 5CLTA 2ATPB 2CR3A 4LARL 3UBXB 4N8VA 4WJ5A 3VXMD 1NFDA 4Y1AA 1NKRA 1H3PH 1K5NA 4E41A 4ELKA 3GDBA 1XR8A 3QFDB 5B8CC 4IRJD 2J4WH 5IMKA 3OGCB 2C7UA 3RZCD 3BZFB 4PJEF 3QISA 4POZD 4ISVA 3E8UH 5JORA 3OJDA 4Z7QE 3D85D 2L0DA 3ARBC 3IU4H 4ZFFA 3A6CH 1T1XA 2DQTL 4PJCE 4RMUA 3L6FB 4JO2L 2ICEB 4FQIL 3MLWH 4HDIB 1ZHKA 3UJJH 4NQUA 5JW4Q 2E6QA 2XICA 1WZ1H 2YKLH 3KPRE 1TLKA 3WIHL 1F58L 3MRIA 4MXWL 1ES0B 4OF5A 2WWMD 4NZJA 5I73C 1QR1B 4D9QE 3MJ6A 1CE1L 3G6AA 4CJ1A 1C16B 5C0EA 1WAAF 2HKFL 1VEOA 5EPMA 5JMRA 4U7MA 1KFAL 3BKJH 4NHUB 3PG2A 1W8NA 4NJ9H 5ITFB 4ZXBB 2EH7H 2AV7A 4HXAL 4PJ7A 3HNVH 4XAKD 5IESH 2EIZB 2ZUYA 3SE9H 4P5MB 2MTPA 4R8WH 3VXRD 5SWQB 3OAUH 3QNXB 4K2UH 1LO0L 3PP4L 4YHLH 2ZG2A 1VCAA 1MCLA 1RZ8A 2DQJH 3KYKH 1ZGLP 3KLDA 4HG4K 4S2SA 5F9AC 5F7FA 3EZJB 5IFJB 2XZQH 4N0CD 3FQXB 4I18C 2IF7A 3A67L 4G3YL 4RA0C 1UENA 3GMNB 3B2UC 1G7QA 2W1NA 2IQ9L 4WW2B 1P5VA 2Z92A 2FHCA 5HHVL 4OLZH 2XWJB 4P3WA 3JTTA 3GK8H 5KZCB 2QL1A 1JK8B 2OTUB 4Q9BA 4P2QA 3QPXH 1ZT7B 3U83A 3DV4B 2Q7YB 1T0NB 3KPNB 4M7KL 3NBNA 2BVPB 3UZQA 3FZUD 3D2UB 1CDBA 4WTWA 1F4XL 3NAAH 2VIRA 4X0KA 1DQLL 4HJJH 4LFHG 3WUZA 3WLWC 4YHKH 5DEFA 4LEXH 3OAYH 5IIEB 3ZYZA 2ZG3A 5IVXE 4F37F 3VRIA 1KC5L 5ADPL 2YN3A 3BMVA 4OCWH 5EU3B 2VUYA 3EO0B 3QDGA 5J12B 3BRDA 1AGBB 4NZRL 1I1AA 1YEHH 4ODSL 4YDKH 3VXMA 5I8CA 5KOVC 2DLHA 4M6NL 5H35B 3VWJC 4W68A 1YEEL 5KW9L 4ZUUA 1CZ8H 3CXDH 2G9HA 3RZCA 3RVTD 4BYHA 2F8XC 4NO5A 2DWEA 3BAEL 3F12B 5ANME 4XHJD 3TBVB 4O4YH 2NQCA 5EU6B 4YHIB 5FKAA 1FFOA 2AJUL 3IJYB 2YOCA 5EBLB 5IMLA 1QA9B 4MNGA 5HYJE 4OCSL 5DMGC 1YNLL 2JCCA 4FQJH 3DI3B 3E8UL 3EJZC 2HLFD 5C7XL 4NKMA 3OL2A 3FN9A 2FSEA 1W0VA 4MNHB 1HQ4A 2HT3D 3WNPA 3LN5B 2E9WA 4P2OD 5C0BE 1PG7X 4GSDL 3RY5A 1YDPA 4Y5VB 4JJ5A 3S6CA 3MCKA 5IB5A 2NY5L 1UXSA 3X3GL 3DXAD 5BVJB 4ACPA 2G2RB 2ATKB 3RWIB 3O8XB 3W11C 3GMQA 5C0IA 3PL6D 1L0YA 1H8NA 4F57L 1JIBA 4OM0L 2BNRB 2HVKB 2R2EB 1KB5B 3TA3C 2GIYA 3DX8B 1DQJB 1V7ML 5GS0L 3DVIA 1A3LL 3RGHA 1V3JA 1JF1A 4JZOA 4GLRI 3L9RA 2HFFB 2ICWB 1BBDL 1YEIH 2GTZA 4X4ME 3RUGA 2HTKC 3S37H 4KK5D 5GGRA 3JUYA 3AC0A 5BQ7B 1UB6B 4OZFH 1MHEB 1B2WH 5INCA 3OAUL 3PV6B 5FCSH 4CGTA 5CILH 4OZHF 2OTWA 2EDLA 2VISA 1VGEL 2VQTA 5DA0B 1U91B 5CJQL 2OQJA 1U9KA 5F89A 3QJFB 2QKIA 3TT1L 2FIKB 4DVBB 3TIDB 4DN3L 4GG8A 4LHQB 3FB5B 3F7YA 4P5TD 1OT2A 3HKFA 2D4FA 2I5YL 1INQB 4XHQA 3MLYH 4N8PA 4AQOA 3O2DA 5H2BB 4EXKA 1RUQH 3HRZB 4DKDC 1MFEH 1YPZA 4MB4A 1YYMH 3T09A 1QVOA 4NWUL 1RFDL 5IROA 3MV7A 1U95A 2QHLA 1U8NB 2QHRH 1U8KB 4FP8L 1NGYA 3NVQA 3L3JB 3IVKB 3UTSE 2AI0L 4DZBB 4F7CB 2YPLB 1J1XL 1CXLA 3ARFD 2YEZA 3E3QE 3F58H 4GMSL 1KJ3H 3VMPA 5F7UA 5I2IB 1J1PH 1XCTA 3F7VA 3CVHB 1YEJH 2O93L 4CVUA 4HJJL 1HI6B 1WTLA 1FZOB 5GISH 2CLZA 3HE6C 5FB8A 5CD5C 4R7DA 5EZJA 4F7PA 1F00I 2YUXA 3ARGC 2DMKA 1B90A 5DD1H 3TWCL 2R29L 4WGVB 1CLCA 3H0TA 4I77H 4AG4H 5C71A 2W0LA 2XZAH 2B7DT 2F54B 3T4YB 1BBJA 1I9RL 2VLJB 3IF1A 4MXQC 2WUCH 5HVHC 1BD2B 3MLZH 3BXNB 5I8OH 5GGVY 4Y2DB 4GBXB 5K9KB 4R4BA 3MV8B 4LPYA 2DDQH 1B0WA 3HUJA 5KSVA 5IR1A 3OXRA 3MX0A 4KVCL 1U8OB 2X4QB 4KHTH 3I50H 4KMTL 3BD5A 2FGZA 1K6QH 4FA8A 3CH8A 3I02B 4J4PA 5MEQA 5CBAB 1WV7T 2HWZH 3BT2H 1BGXH 1QFWM 4P2OA 3CUPA 1PX4A 2I9TB 1NDMB 5I1IL 4V1DB 5CZXC 5KG9B 3GMRB 3OKDA 4XNQA 3MJ7A 4XVJH 3DXAA 4O2FA 4UIMB 3SOBL 4YBLB 2W07A 1S9XA 2APVA 1JWSA 2CO7B 3E6HA 4J6RL 1CGUA 3PL6A 1QFPA 3QWQB 1QYGH 5IBTL 4N8VG 1P4LA 1SM3H 1TQCC 3QWOB 5ISZE 1IGJA 3QCUH 5FYKH 1A6WH 1D5XA 3HG1A 4X5LA 4LIQL 4M8VA 4UU9A 3S35L 2R8SL 5BXFA 1T7XA 1T0MB 3T0BA 5LWYL 4ZOAA 4M1DH 1MFAL 5DLMH 3CH1A 3D25B 4K55A 4N8CL 3H42L 4FQ1L 5DA4A 1NFDB 4Y1AB 3SGKC 1K5NB 1QRKA 4E41B 2AEQL 2QADB 2DLIA 1XR8B 3BX7C 5SV4A 1FPTH 1AXIB 5DQ9B 1Z3GL 2C7UB 5DVNA 3ZYIA 3LEXA 3QEQE 4ISVB 5JORB 3OJDB 3B3IA 2IPKA 4HCRL 4ZFFB 1T1XB 3BDYH 2V7NA 2APBA 1C1EH 4BH7A 4ZFGL 3CSYA 3MRQA 4HLZH 5LBSH 3U2SA 1HKLH 1ZHKB 1AY1H 3ZHKA 5GGTL 2A9ML 1NLBL 1CFNA 4FFWD 2AQ3A 1MFEL 3GZKA 2CMRH 4FOMA 2WIMA 2VERN 1QBMH 1FYTE 3MRIB 1JYNA 5HYJD 3ZTJH 3OX8A 1BOGA 3O0RH 5C0EB 1FZMA 1EXUA 1UZ6E 4KVNH 1O5DT 5EPMB 3U30B 4JN2A 3KPRA 4P2YA 5F1OB 3EDKA 5DHVA 4F15C 4QTHB 1JN6A 4X9IA 2AV7B 2FJHA 4PJ7B 5AYUH 5FO7B 4Y4KB 5E8OB 3I3BA 5DMIH 1F11A 1YNKL 1XGYH 2EE2A 2NXYB 4I48A 5IB2A 2ESVE 1TCMA 1TITA 2ZSWA 4K3DH 1A14H 2QSTA 5J11C 2R1XA 2VKWA 2AXJA 2MQ3A 4PRHD 2VDLL 4S2SB 3UXFA 2E7LC 2EH8L 2IGFL 5DJCA 3OKEA 3DX7B 2D4DA 4Q74A 2O5XL 4XVSL 1P4BH 3FB8A 3U4BH 4JFEE 1IFHH 3O3AA 1G7QB 3FTGA 3FO2B 2GK2A 1UACH 4OCRL 3ZSSA 3NABL 3L3KA 4F9PC 4XI5D 5A2JH 5JXAL 2DDQL 5D5ME 4K7PY 5D8JH 4N5ED 3LKPA 4P2QB 1K6QL 2G60L 5ID1A 3ZE2E 1NUGA 1R5WA 2EICA 1T1WA 3T1FA 1VPOH 4P9HL 5KSAD 3PGDA 4OI9A 3ARDC 4X6CF 1BGXL 3RKDD 2EEBA 4JVWA 1CDGA 1UEYA 3I3DA 2VIRB 3W2DH 4ZTOH 4XWGH 5DEFB 1S7QA 3AS3A 3EOTH 2Z35A 1BJ1H 4QKXB 4RGNB 43CAA 3VRIB 3QO0A 1TXKA 4MSWA 5I15L 4LSTL 5IVXA 1QPPA 3QDGB 1CLOH 2E9JA 3T4AA 3LB6D 5F7YC 1I1AB 2ZCLL 4UNTA 5ESAB 2HLAA 3VXMB 5I8CB 5DRZA 2P8LB 5AWNH 3ZKSD 3VG0L 1Z9LA 2J5LB 4NC2B 5KVEH 4ZUUB 2BJMH 2G9HB 5E6YA 3RZCB 1R0AH 1XF4A 5EC1A 4NO5B 2DWEB 1DP0A 4PGZA 1EMTL 3V7MA 1FFOB 5TE6H 4MD0B 1WQVT 2PO6C 5IMLB 1IZJA 1FPTL 4MNGB 1SYSA 4Y5XA 1AH1A 4ENED 4JHZA 1BEYH 3GI9L 3QHTC 1AKJA 4NKMB 1IKFH 1J0HA 1W0WA 2FSEB 1W0VB 3V0WH 1N3NB 5HYJA 2R56L 5F3HA 1H9VA 1WBYA 4QEGA 5FOBA 1U3HC 2DQUL 1MLBA 5T1KB 1YDPB 3MCKB 4DK3A 5IB5B 1UXSB 4ZDHB 3ILPA 1G7PB 3S34L 3GMQB 1LDPH 2B1HL 5C0IB 2CO6B 1MELA 4Z7NF 4WEUD 5D7IF 2WW8A 2VZUA 3CFKA 3SCMD 4Y88A 5D1XA 4UQ2A 3DI2B 3HZVA 1X9QA 2FH6A 5DEZA 1DQQB 3MA9L 3V6BR 3L9RB 1MCDA 2GTZB 1HHJB 5IWLC 4FQXB 4PRHA 1KCRL 1F8TH 5GGRB 4GQ9H 3H7BA 4KRPC 5FGBC 1N7MH 1HILA 3OR6A 4OLUH 5INCB 5C08D 1WIOA 4L9LC 3SKJH 15C8L 4H1LA 1JGUH 5C0AD 5C8JB 2OTWB 2VISB 4WNQA 1YECH 4X4MA 1OARL 4JZNB 5CGYD 1EGJH 3V6FA 3MRJA 1MCHA 2P5EE 3D3VD 3SBWC 5F89B 3MFGB 2QKIB 3MA7A 4YR6A 2XKNA 3F7YB 3MROA 2FBJH 4MJ6A 3S36H 5DHYA 1AD0A 2R9HD 1NAMB 4PJAF 2YRZA 5T3XD 3SDAA 1TETL 1IAIH 1WEJH 3GMPA 3UC0H 4JFQA 4BZ1L 1QVOB 2ARJQ 1NBYA 1OSZA 4PJ9C 5KSAA 3OKKB 3MV7B 4XNYH 3QEQD 1Q72H 4R9HA 4KTEH 1I7UB 3HZMA 4QF1B 1BFSA 5CJ5A 2YEZB 4OI8A 5HPOA 3NIFE 5IK3A 4KROD 2VR5A 5EU7C 2YD8A 5B39A 3F7VB 3UTSA 1A7PL 3AS1A 3BEVA 1MF2L 5D9SA 4MAYA 2NY2B 1U6AH 1X5GA 4QNPF 4IS6A 2CLZB 2ILLA 1TJGL 4L8DB 5FB8B 4R7DB 5F7LB 4F7PB 4A6YL 4IMKA 5KVGH 1X4YA 3MQIA 5HI3D 4TTDD 1SY6A 4CRPA 1RURH 3H0TB 4TVPE 2EYSA 2VDPH 4I4WA 4XP4L 1ZLUK 1EHLH 1MVFA 3QEGH 2JJVA 1RULH 3ULSA 1C5BL 3D39E 3I75A 4UV7L 2W91A 4G7YH 1DLHB 3JVGC 1GGCL 1U8IA 5DQJA 2ITCA 4PJGB 4NC1C 4JKPL 2EDEA 2NY7L 2IQAB 2CJUH 4R4BB 4P99A 3U0TA 2NZ9D 2V2XA 3HUJB 1DSFL 2H2PC 3OXRB 1K8IA 3KXFD 3IFPA 3V4VH 4S0SD 1DEDA 1MCRA 5MEQB 1I1YA 1BFOA 1KB9J 5FXCH 5GS1C 3VD9A 4NZUH 2EDDA 4O02L 3CUPB 2LTQC 1JPGA 5GS2D 1NCWL 2HKHH 3WS6A 1B4JH 2FWOA 3QNZA 1HH9A 4HMCA 3MJ7B 1A5FL 4MB5A 4O2FB 4OFKA 3GBMH 1RY7B 1T83A 1S9XB 1JWSB 3E6HB 4LVHB 4LSUH 5HYEA 3T0DA 5E8NA 1KEGL 3JV5A 4J23A 2FZ3A 3WMSA 1P4LB 2AS5M 4YAQA 1L9MA 1KSRA 2RAMA 1FGNL 7FABL 2CXKA 4U3HA 1IJ9A 2BRQA 3QR2A 5DWUH 4XPTH 1D5XB 2CRZA 3HG1B 1LDPL 4EOWL 1WSST 4UU9B 4YFDB 2HT4C 5C08A 5JW4R 2G5BA 5BXFB 3SDCD 1XF3A 3FT4A 2QQNH 1DBML 2BY1A 1P4IL 1R3HA 5AZEH 4X98A 1SJEA 5SX5K 4XNZB 1F45A 4P4KC 1WZLA 1YMHA 4P59L 3CH1B 1MUJB 3L95A 1MI5D 1NGPL 3HNTL 3RZWA 2E27H 4Q6IA 4WI2A 4OLUL 4Y16C 4GW1A 4RQQA 5ACLA 1V3KA 3B3IB 2IPKB 1PY9A 1RJZB 2A6JA 1S78D 5I71B 1E6OH 4TQEH 5TF1L 3IJSB 4M8QB 2V7NB 1AGCA 4BH7B 3MRQB 3QEQA 3U2SB 4R0LB 5D2NC 4Z6AT 4A2MA 1CFNB 1FC1A 5AUMB 2XQBL 1PYWA 4PJCB 5HPMA 1NSNH 3EZ8A 2OR9H 3OX8B 1BOGB 4LSSH 4JG1H 5D7KE 1OP3K 3QEUB 1F6FB 1FZMB 5T3ZH 1KCVH 1SEQH 4E42A 3KPRB 5JR1H 1FYTA 5DHVB 4P23D 1JN6B 3GO1H 2FJHB 4FFZH 3IDXH 2HFTA 2Q20A 1E4KA 3MV9E 4PRIE 4HV8B 1F11B 3L1OL 5KSBF 5JW4M 4C57C 5JZ7D 4GKNA 2ZSWB 5LGJB 32C2A 2R1XB 4X6EB 3EOAA 1QFOA 3EYVA 1FLRH 4LU5L 4U3XA 1WFOA 5EC2A 5HGAA 5DJCB 4LLUA 3UJIH 3KYOA 5GJSH 2AV1A 2GJ6E 3FB8B 3HMXH 3QEGL 4JRXE 4PJBA 3B9KD 3G9AB 2IAMC 3O3BB 3MGTA 2P7TA 2XTLA 1RK0B 2WNGA 4Q9RL 1D9KA 1EHNA 3O6LL 2E7MA 4Z76A 3L3KB 4JFEA 4NFBA 3MYJA 4ZOCA 4PJFF 4ERSL 5L88L 5GIRB 4YWGH 3P0VL 4LRNH 35C8L 1JPTL 1BX2A 4PJIF 1S8DA 4FNLH 5GZNC 2BOBA 3I84A 4X7SL 5ID1B 5I1LA 1A6UH 2C3WA 5GRUL 3BEWA 1R5WB 3FQNB 5D5MA 3HB3C 1T1WB 4PIRF 3T1FB 2E7HA 1G1YA 4LSDA 3BIAX 4GQPH 1T1YA 3PGDB 1TJHH 4OT1H 3N1MC 4FG6D 1G6RH 3CZFA 3LV3A 1NLDL 1EK3A 1CGSL 2AEWA 2BSED 2F5BL 6FABH 5BZDA 3LEVH 3WBDA 4ZYKA 2KQMA 1CGVA 1S7QB 1JWMA 2EDJA 2Z35B 4NKOA 1H3TA 1XCQA 5FEBA 2EDFA 4ZFZA 43CAB 1FFRA 5HHOD 4QY8A 1HKFA 3QO0B 4D3CL 4MSWB 1WBZA 2YPKB 1GZPA 3ISWA 2XNAA 3SDCA 3DO3A 4XMKH 3TCXA 2X4TA 3I9GH 4G6AC 3HFMH 5IVXB 1X5YA 2WIIA 2WAHA 3T4AB 1YEKH 5BW7A 1B4RA 3RY6A 2EXWC 1CIDA 1CL7H 4UI2A 3NFSL 3BIKA 5DRZB 3QUYD 1FORH 3VFMA 1S9VB 3LRSA 1FL6B 4RGMB 1GIGH 4TVPD 5L6YL 1XF4B 5EC1B 2VZSA 4IOFD 4JDTH 4KQ3L 2D7TH 4Y19D 2HJLA 3D39D 4B41A 3O3DA 4RNRB 1S5IH 3VFUB 3QDME 4ZXBC 4Q6YA 1ACZA 5LCVL 4Y5XB 3WHXA 3QCVL 1AKJB 4PGJA 3N06B 5CKAA 1W0WB 1ZKAA 4XC1H 5HYJB 1YC8A 3OB0H 5FOBB 2XA8L 3MLXH 1U36A 2GJJA 1MLBB 2ADIA 4RX4A 1MHPH 2EE6A 3SPVA 5BOPA 4H1LG 1UKTA 8FABA 3HI5L 3ILPB 5JUEH 3WIFB 2H2SC 1OAUL 5C0BB 4G6JH 2XG5A 2CKBH 4JY6A 1B9ZA 4LLAA 5BOZG 2QQKL 1KXQE 1N59B 2MFNA 3ZSTA 1OWWA 4R4NC 1MIML 3CFEA 3CFKB 5D1XB 2NW3A 1UA6H 4UQ2B 3HZVB 3VDAA 5DZNA 4WW2C 1Q9WA 2JJTC 5F88A 4I0PD 1KUMA 4FMFA 3H7BB 4FFZL 1HILB 3OR6B 5FM5O 3VI4F 4N90E 3P0YH 4H1LB 2A38A 4MJID 4NM8H 4WNQB 2IBGA 3V6FB 3B9KA 4R2GB 4PJEE 1FLRL 2UZIL 3CU7A 2YR3A 5A2LH 3VG9B 1KV3A 2ZPKL 3UJIL 4JDZA 4YR6B 3ZKQD 1LD9A 1YJDC 2AW2A 5KAQF 5GGSY 3GHBL 4OB5H 4R26H 2P5EA 2XKNB 1JZ4A 3O2WL 4NGHH 1QHPA 5B39G 5DHYB 1AD0B 4U05A 3NFPA 2Y5TB 2KL6A 3SDAB 3K2UH 4GXUN 3GMPB 3HPJB 3PABA 4JFQB 3RQ3A 4ZQKA 4ODXA 1NBYB 1OSZB 5KSAB 4J3OC 1A7NL 1CVRA 1HINL 3RNKA 1WAAE 5J12C 2C3VA 3G5ZA 1LK3H 2R4RH 4BFIA 3HZMB 2X1WL 2V9RA 5FUZH 4RZCA 4I3RL 4PG2C 3DVGA 2YRLA 3C5ZD 5IK3B 2NY3D 3RTQB 3V4UH 5B39B 5HHOA 1W8OA 3UTSB 4OLXH 4NUJA 5DD5H 1A64A 3BEVB 4RFNB 4DCQA 4ZMAT 4MAYB 1S7RA 1DFBL 3HA0A 5CEZH 1FP5A 4IS6B 4HD9A 1QLEH 2UUDH 1QFWI 5TQ2H 3KPSD 5IT2L 3ARRA 2JF1A 3BKMH 4O5LL 4HS6A 3VCLA 4LLVA 4ZO8A 3O4LD 4Z8FH 2EYSB 1FVDA 4I4WB 4DW2L 3ULSB 2J1KA 4NQCD 4O9HL 4KZDL 1G7JA 3C60B 3ZT6A 1U8IB 3C5JA 5TH2A 5DQJB 2NCMA 3RI5K 1CL7L 2ITCB 5E7BA 4PB9H 3D39A 4KKBC 5B21A 4Y5VC 1K8IB 1SEBA 1U0QA 2D7NA 3PWNA 3KDMA 4PD4J 4UNUA 3EYUH 3A6BL 4GKZB 1EFXD 3QEHA 5K9JH 1I1YB 1BFOB 1HCFX 1KLGA 5F7EL 5KVDL 2EO1A 3T0ED 5JHLH 1CFTA 3PNWB 4LDEB 4XCFH 1JPGB 3V4PL 4FABH 3Q6GL 1A6AA 1QSFD 1HH9B 1YN6B 3QNZB 1KENL 2OXGA 1CDHA 2W59A 4QHNA 5E8NB 2NY6D 5SWZE 4B0MM 1MNUH 5DQDH 3PWLA 4PLKD 1ZWIA 1PSKH 4HUWA 4NO3A 2FZ3B 4TYUA 5GRVK 3KLHC 4YAQB 1YJDH 2PKDA 1HSAB 1RVFL 5CWSA 3WKMH 4EIZC 4MJ4A 3CX2A 4E0RA 2ZSVA 4F58H 2NNAA 5C08B 2G5BB 1I9IL 4X7CC 3ZT5A 3BQUD 1KBGL 1HYSD 3FT4B 2EEAA 5FYLD 2H9GA 4MJIA 1R3HB 2XYCA 5DMJB 1VENA 2RHEA 3TF7C 3WFCL 2J6EA 4LAQH 1AJ7H 1YMHB 5EUOE 2XV6B 3L95B 3RAJH 1T0PB 2V9TA 2XN9E 1KIRA 3DWTA 4Q6IB 3OSKA 4RGOL 3T2PA 3GBNH 1KEMH 4NHCL 1YEFL 4IRZL 5T1DL 3SKUD 4NM8L 4EBQL 3GEWB 1I9EA 1IBGL 4LIQE 4TRPH 5E0QA 2JJSC 2B8OT 2VAJA 25C8L 1FBIL 4AEIL 3X3FH 2A6JB 1J5OH 4KTDL 3BPLB 4CU8A 1AGCB 5FA3A 3O2VH 4RWHA 2CK0H 2VYRE 3QEQB 1OWRM 4J3SA 4NGHL 4NYLB 4MQXD 2Y07H 3H9SE 2P47B 2OL3A 3IDGA 1PYWB 5A40E 2KDGA 5I18L 5DO2C 4KROB 2CRIA 4MA7L 4K71B 5D7SL 4Q58C 2IPTL 1IGCH 4NC0B 1EJOH 3KG5A 4M7LL 3V52H 4Z7WA 4E42B 1F4AA 5HDLA 3QUML 1CF8L 1FNGA 3LKNA 5E2VH 1FYTB 4Y2DC 1T5XB 1AD9A 2VE6A 1PGRB 3BUYB 4JKMA 4GBXC 4UIKH 3KPSA 1IGYB 2AK4D 3WDJA 2AVGA 3BSZL 4JM4L 3KR3H 2CK2A 3IXTA 4I8DA 4RFOL 1KB5H 3WHE1 1FFNA 4GKNB 4OZHE 4DFIA 5IGXH 32C2B 4CN1A 4H0IA 4NQCA 3MV9A 3EOAB 4OAWA 3EYVB 4PRIA 5CEXB 1J0YA 2NX5D 4JFDE 5HGAB 5C9KA 1BJMA 2ESVB 5C2BL 3KYOB 3ZL4H 1X5LA 4S10A 5I8EA 2CIIA 3WIHA 3BYTA 4XP5H 1S7VA 3QNYA 4L8CB 2WSKA 2HJKA 5DT1L 3RL2A 3LY6A 4YBLC 1EBAA 3MGTB 2P7TB 2Q87A 1P7QD 1EFXA 1D9KB 4Z76B 4JRXA 1WITA 4JFEB 3MYJB 3DVFA 1ZAGA 4EDWH 5EO1B 3MGOA 3EYFA 3INUL 4PRAA 3MRHA 2BOBB 2VDKH 1YQVL 4G43A 1SVCP 1VB9A 2WBJB 5GS0D 3BEWB 3DSNA 4RMWA 1VACA 5D5MB 3MCLH 1MJUL 3FB6A 4AT6A 4KI5C 1T1YB 2OZ4L 1U92A 5I74B 3NOIA 3QT2A 1HOCB 5BZDB 1A0QL 3P9LA 4FFVC 3NCMA 4CVZA 4ZYKB 5F9OH 1QKZH 1JWMB 4NKOB 1KT2A 1XCQB 4ZFZB 4C54A