5FM8A

Structure of the c-terminally extended domain my4 of human myomesin (space group p65)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords MYOMESIN-1
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm8A01
3D39B 5D7LD 1AKJB 2NY3C 3T77B 4OF7A 2ED9A 1G7IA 1T5XB 1XGQA 2DJ4A 3O41B 4MD4B 4EXKA 4MDIA 2ITCA 4NWUL 1OTSC 4NZTH 3KPSB 4QHNB 3B3IB 4L1HA 3HCVA 3OKDA 4IDLA 2AEQL 3BO8B 4N5UA 3QUYA 3O3UN 1UXSB 2J8UF 2ED8A 3DO7A 1JF6A 3MLXH 5MENE 2Q6WA 2A73A 1U8NB 5HI4C 3KYOB 4X99A 2A6KB 4GKNB 3AREC 2Q8BH 5DMYA 1CLOH 1C5DB 5GS2H 4P49A 2E9BA 1VEOA 3MRBB 5HDBE 3C2AL 4PRHB 3TYFB 3FOLA 2P44B 2JK5B 1NLDH 4X4XA 3MACH 3MR9A 3G6JF 3EDKA 3NCYP 4G9DA 4LKCB 4PLJC 2YKLH 5ESQA 4WI6A 1Q72L 1G6RH 5HGAA 5CCKH 2VDNL 5FYLL 5I1KL 1R3IH 4OCMC 2RJMA 3MJGX 1AQDB 4NDMB 4F15B 3WV0A 5FUCE 4LDEB 1DQJA 1ZS8B 3IXAB 4UT9H 1A7PL 4QOKE 3MACL 4MHHI 4RZCB 3SOBH 5L88L 4N90D 3EYQC 3BIBX 1RHFA 2CXGA 4KRPC 4QXWA 4Y5YC 2EDNA 2DQEL 1VFBB 2OTUA 3GI9H 3IDJB 5E6YA 1OAKL 1P9MA 1L9MA 1PKQA 1CDCA 1AR1C 2IH3B 2MCPL 1CFVL 4OSUH 1HI6A 1IFHH 1OQXA 4QF1A 3B5HA 5F96H 1D5IH 3O9WC 5C71A 1C5BL 1CGVA 3UTTD 1ZT1A 4PYGA 1KCKA 5MENA 3PWPB 4UU9A 1RZIA 3P77B 5D93C 4GG6B 4NCDA 3LV3A 1EERB 3F7VA 5A3ID 3O8XD 4NZDA 4I13B 2FEEL 1G7PB 3LPFA 2E8YA 5I76A 4Z0BL 2X4RA 4NQXB 3RVXC 2JJVA 4ZFGL 1UWXK 2EE2A 3OR6B 3PWJB 1OPGH 4BKLA 5SX5K 4JQVA 3SDCB 3H7BA 3HI1B 4HHAA 4G8IA 3EJYC 4FQXC 3AS2A 1CR9L 3S3PA 3IDGB 1HINH 3FKUS 4H8WC 3RTQB 2CSPA 2EDJA 2BVTA 1W72A 3FHAA 3LZFH 2EDLA 5FV1L 4JJHA 1UWEL 1MJ7H 1QFUL 4QOKD 4Z7VF 1GGYA 1KEGH 4GQPH 3SKJL 3VD3A 1G0DA 4PRDB 2GTZA 1XCQB 2H2SC 1KB9J 3T4AA 4HMEA 5FUZL 3MLPA 3VFTA 4GAYA 4OM0H 3SDXE 4EDWH 4QEGA 1YNTB 4UDUB 5EIVA 2FDBP 4PP2A 5EOTA 3T8XA 3KR3L 4PJFA 4Y19A 4CDGC 3QEHB 5E6IA 4U1SA 3WS3A 1NBYB 4PJGE 1MHPH 3FFCD 5T3ZL 4S10A 3DX8A 4M4RA 1YEEL 3DV6B 3I6KA 3ULUE 5HYJD 5IW6B 4K8RD 1T7XA 4XVUD 5T1MB 5I74C 4PJDB 1QPPA 3FRPA 5JOPE 3N85L 4K3GA 3O4LE 3X12A 4OM0L 4D3CH 4ETQB 3BGFC 4GAJL 4ZNEA 1P4LA 3QFJA 1BZ9A 5D6CA 5LQBL 3FMGH 1WZLA 1GPOH 5DJ2A 3MRMA 5EUOE 4K07A 4JM2A 1EFXA 3DXAB 4JRYE 4LVOB 1ROWA 1B6DA 5EZLB 4GOSA 3A6BH 1QNZH 1HQRA 2NXZC 5ISZB 3L1OH 4OZHA 4POZC 4DKEL 5L7XH 4U1HA 3T0VA 4J3VA 2EDYA 1EZVX 3LPGA 3CCHA 3V9FA 4M1GH 4FMKA 1U8OA 3DXAD 5F3HB 5TPWH 1FO0H 1I4FB 1NGZA 5FKAB 3TM6A 1YEDB 2NY6C 2FBJL 4Z7QF 4BUHA 1K8DB 2EEDA 2EDBA 1FVDB 4K2UL 4UQ2A 4P4RB 5IHZA 1KEMH 4LCUA 5I8CB 3U46B 1FFOB 7FABH 3BSZL 2J6EH 4YEEA 2X1QA 3BEWA 2R1WB 3FB7B 2Y25A 2XNAB 5J9PA 4N1CA 4FQJL 4AH2A 3FONB 1INEL 1A1OB 4YZFF 3T2PA 5JA9A 3O2DL 1BPVA 4PGCA 3SE3C 4XMLH 4MGXA 1EPFA 4GJTB 3WSQH 2BOCA 2ADFH 5JZ7D 1BQLL 2CKBA 3RWIB 5MHSE 2UY7A 4LIQL 5DQJB 2O5ZL 4NQTA 3CX5K 4U1GB 1PX3A 3VG0H 2X4TA 1ND0B 1WISA 1UWGL 1MRDL 4PP1D 4PRHA 4RDQG 5I1EL 2NY4C 1FG9C 3QCTH 3NFPA 4UUJA 4XCCH 1FCCA 4RISL 5TQ2H 3QG7H 4LCIH 2ICWB 3B8SA 1CU4H 2APXA 4NRYA 4OTXL 2FD6H 2ESVA 5E2UL 5JXEA 5HD8D 3KYOA 2ARJA 4LIQH 5I18H 1YEKL 1F45A 3W5NA 3D9AL 5T5NG 3B9AA 5KSAB 1I8MB 4RAUA 4WY7H 2VXSL 5IG7A 3M17A 3WFBL 5IBUG 1RUAL 2VLKE 4KROC 1HYRC 1ZLUK 4Z9KB 3U83A 1JE6A 2FECL 1IKFH 3B3IA 4RISH 2Z93A 3MV8D 2OXGA 2Q8AH 3RNKA 3BVNB 3T0WA 4M1CD 2W65A 2ZNWA 3T77A 2LAGB 1AKJA 1BD2A 1KPRB 5GS2D 1MCFA 2QKIB 3V8OA 2AJ3B 2R56L 2APTA 4OFYA 2VLJD 2E6PA 2E8ZA 4LASL 3I6LE 2XG4A 4ZUWA 3VA6A 2CPCA 5IJKA 5IHZB 4S1RH 3WIFB 1YMMA 2W9DH 1YMMB 3BZDA 2ICEB 2DBLH 3T3MF 4W6YB 3S36H 3B6SB 1CD8A 5D8JH 3G08A 3B9KB 1LE9A 4PRIA 3Q2CA 4FQ1L 1NL0L 1MQKH 5C07D 4V1DD 2OMBA 3OXRB 3ZSSA 4X6DA 3N1GC 3RRQA 3DX9A 4M5YH 4XNUL 1J5OH 4HFUH 5DC9B 5I75B 4NQUA 4LAJH 4LLDA 3OG4B 5GS0H 3VI3E 4MAUL 2V5RA 5DGQA 1T2QL 5KS9A 3CMOL 3NFNA 4P2QD 4L8SC 2YBRB 5EPMA 3RJQB 1QFWH 1AC6A 4R97C 5KSBA 5IB1A 4KY1L 3EO1A 1KF9B 4PJDA 1QA9B 2R2EA 5GS0L 1P7KB 5MP6L 4YFLF 1QG3A 2F53A 1U8HB 2MNUA 3ZYZA 2GK0B 2VL4A 4QCIA 3KXFD 5CD5C 1X5JA 5GHWH 3PXHA 3SDYL 1S5IH 3EDDA 3FQRA 4IRSC 5DQJA 1BJ1J 3ARBD 4BSJA 2E6QA 2GTZB 4M43L 4DVRL 3HI6H 1G7MB 4EOWH 5MERB 5F7MC 4U6XA 3TH3T 4Z7QE 3RWGA 1ZXQA 2ZCKL 5FYJD 5C8JA 4HXBH 3IAQA 2IFFH 3VRLE 4QT5A 2CMRL 4F7EA 1ERNA 3TO4A 5LJYH 2IMMA 2XQBH 3BJ91 2WLZA 2W0FA 4ZTOL 4KDVA 3P0VH 1PQZB 3MJ9L 2F74A 2BFVH 4P2OD 3KWWA 5KS9B 5DVOA 3BHBA 3JV6B 4B50A 2ZCKH 1TNNA 3B2UC 1JGDB 4FFYH 3KPQB 5IESH 4TVPH 1Q9WA 4Y5XA 1YEHL 4DEPB 2R2CA 3RHWK 3ARGC 4IIQC 1KTDB 2R4RH 4MA1B 4U1JA 1DFBL 3C08H 5J6HA 3WLWC 2HT3D 2VIRB 3KYKH 4NKOA 5CKGA 3LN4B 1BFOA 3VG9C 5AZ2L 5IQ9B 4QF1B 1KIUA 1TJIL 3VXQB 4OZFG 2ZOKB 1MY5A 3QG6A 2J7LA 1UQSA 3ALWA 2B8OT 3BKCH 3JV4A 2GUOA 3TBTB 5SWSE 2R4RL 5BRZB 4NYLB 3REWB 4ZFFB 3RWDB 1AXSB 2B4CC 5J12B 1CGTA 4DZ8B 2B1HL 3RY6A 3EFDH 4MX7A 2V17H 3T3PE 1S7TA 3FN3A 1QSFE 4AEIL 4NHUA 2WANA 4C4KO 4G8GE 4KK5D 4X7CC 3O6KH 2ZUQB 4WI5A 1XEDA 4QRSA 5IR1A 2UWEE 1UZ6F 2CLZA 3QIWC 4OFKA 3UTSB 4OZIE 4YBLB 4OZGB 3WHE0 4FP8H 4FS0A 4UDUA 3P9LB 4GKOA 3RKDC 3SQOL 1LEIB 1G7JB 2ZPKH 3GJEA 2PYFA 3V4VL 2V17L 2WIIB 4PJ5D 1MCPL 1FNGA 1MJ8L 1A7QL 1HYSC 4P5MA 2DMKA 3MODL 3TEUA 3DSFH 3VGAC 4TTDC 3GB7A 4Y2DC 3BISA 3EBAA 1N59A 3KPOB 2QQQA 1NH6A 2IPTL 3P3YA 3RVUC 5SWZB 3BPNC 3X13A 5IROC 3ARGD 1KLUA 1BBJB 3HMWL 5KN5A 3QUKA 2YUWA 1DBKL 2EE6A 5EC1A 3QUML 3P73B 4NSKB 3BKYL 4PJXE 5EO1A 2QQKL 4XXDA 5DEFB 1MHEB 5BXFA 1PZUB 5TF1H 4OFPA 3TGXA 4LVHC 1ZSDA 3FQTB 3VFVB 1YYMH 4NKDB 1HZHH 3NTCH 4OGXH 1AH1A 2RCSH 4FXGA 1G7PA 1BAFL 4RMWA 1NEZG 5GRUL 2BOBA 2NXYB 2XTJD 3FONA 4X9BA 4I18B 2IGFL 3BP4A 2ICCA 5J11B 3VA2C 5C09B 4WHDA 1IAMA 2P46B 3L3OB 4FA8A 4RNRA 3D5OF 3FO1A 4R4BB 3KPRE 4WUKL 4MSWA 3ME0A 1AGBA 1FFOA 4JO2L 2XQYK 5FGBA 2HTKD 1QSFA 3ZTJH 1ED3B 3LIZL 1VGKB 5TJWK 9CGTA 3Q5OA 3BDYL 2BMKA 2XZQH 1FL5B 1FL5A 1ZMYA 4O5LH 3VH8A 3P0YL 1MFEL 2E7LA 1J8HA 4MB3A 4WUKH 1JMZA 4M7ZC 5K9KB 3F8UB 1EHLL 5B38A 1NGQH 3L3HA 3F58H 5T33H 3ARRA 3PDDA 3TN0D 1Q9WB 4QKXB 3QQ3A 4ODUA 3EFFA 4FXGB 3ZT5A 1GAFH 2VXVL 5JDSB 4NZUL 5AZEL 4XP5L 4CVZB 2C3HA 3O9WB 4MD0B 5D7LB 1I8LC 2VLJB 5DHVH 4R7DB 5I16A 5DJ2B 4NZTL 4DFHA 3L7FA 4N9GA 5FUOL 4XVJL 5C0AD 5IEHB 5H94B 2VXUL 3MRQA 3ZL4H 4JFOA 3F58L 1F3JA 3RIAK 3W2DL 5IB3B 1EXUB 3I6GA 1OGTA 1LD9A 1PLGH 4OZHF 5E9DA 4YHIA 2OQJB 1NBZB 4ZFOL 3CXDH 4IS6A 5DD3L 2FGWL 4V1DB 4UQ3B 3ZTNH 5CIPB 1W2KT 1HWGB 5T5NF 1OTTD 2Q8BL 2GT9A 2PYFB 3RZCC 3ZE0E 3LKOB 1UYWH 1Q94A 2X10A 2EE3A 5E08L 1K4DA 1B0RB 3O2VL 4OM1L 4R97B 2GSGA 4H8WL 2CLZB 5I8KH 1T7YA 5GISH 1R24B 2EDOA 4H88L 1H5BA 2D7MA 2N4IA 5CSZA 2CKNA 2Y36L 1JCKA 1WEJL 3H42H 1L7IL 2YKLL 4BQ6A 2UZIH 4NUGL 2BRQA 1NBQA 1UYWL 4YGAB 1URLA 3GNML 3HNSH 1JYWA 2CK0H 3RHWF 4PS4H 1U8MA 3J8F7 1F4XH 2IAMB 3HC4H 1FFQA 5F93C 3CK0L 4JFPB 5M94B 5DJXA 1GCFA 3K4DA 2DQTL 1BJ1H 1RFDL 2CGRL 2JLLA 4XPAH 4HUNB 2ERJC 4F7TA 4G7YH 4LFHG 4TYUA 2CO7B 3BP7A 3KYNB 1CFVH 4ZD3L 3LSOB 3RWEA 1A3LH 1UXWB 4W4OA 2AEPL 3JWDH 3QWOA 1MWAA 1ZTXL 5DMGC 1MHHB 2V9QA 4JFYA 4PTUB 5GRXG 4JKMA 4OGAC 4JZJC 3G9AB 3QNYB 2ICEA 4KJPD 1FGVL 2VDQL 2IH1B 2GYSA 3DETD 3CC5B 3RFZC 1JPFB 4CNIA 1ZVHA 5TFSH 5TDPB 3S37X 3MX0A 4HV8A 4WTZG 3TT3H 3VXRD 3G6DL 4XMPH 3F7PC 4U6VH 3WHE1 4MAYC 3CUPB 3R0MA 3KPLA 3MYJA 4GS7B 4PJ5E 3DX7A 4QT5B 1YPZF 4X7TA 4GQ9H 4PJBA 3FB8B 4FFVC 5I1DB 4GRWF 3LEYL 4JHZA 4NNPH 1FNAA 5DEGB 4HLZH 1WZKA 1IKNC 1FNEB 2J8OA 3BD3A 4NC1E 4NQDA 5TE4L 5I15H 4WTZA 4LIQE 2PYEB 4HX1B 5LCVL 4C56B 2DKMA 1Q9KB 4JCLA 3NZHH 3VXPB 3ZYIA 5I1LB 4R3SB 3ARVA 1M7IB 3BN9C 2VAAB 4HJ0C 1PG7H 5CD3B 4GRLC 5GRZA 3JTTA 3TYGH 1GXEA 5F71A 4YX2H 2V9RA 2E5EA 4PRBB 4WFGE 5C0CB 4LLWB 2ZOLB 3BPCA 3WIHL 4XXCA 2CKBB 5KSUB 5IB2B 2JELH 3QUXD 5ICXA 4P2RA 4AY0A 3MJ7B 4LPTA 1U3HB 5CEZE 4CMHC 3FFDA 4NRXA 3TYGL 1KCVL 2NY4B 4PJAE 3WXVL 3P4LA 3UJTL 4WI2A 3FCTB 3HPLA 3ZYOA 2BVEA 3GMNA 4K8RL 2R1WA 4KI5F 5CZXD 3ZE1F 5HY9B 1SM3H 4O2FB 2VLKB 2ORBL 4DQOH 1XF2B 1OF2B 5HHME 3UJIL 1OW0A 4ZS7L 4HWZA 1G9NH 3BZEA 1I7TA 4O51B 3UYRH 2MJWA 4JHWH 1EJOL 3SGJC 1NGZB 2KKQA 4LVEA 5FKAA 3MCKB 4OFDA 3NBNA 3NABH 1QLFA 3VDCA 3DLQR 1H0DA 7FABL 4J12A 1IEBB 3WS6C 3K46A 2CR6A 1FL3A 1NFDB 3N9GL 3QHTC 2ESVE 5D70L 2W9LA 3Q48A 2WUBL 2J3SA 3MRFB 2DQGH 2GHWB 1BFSA 1NBVL 4TSBH 2CQVA 5KVDH 2P8PA 4LKXB 4DK3A 5GGUA 1IGTB 1Z9MA 1I7ZA 5F6HI 5CZVL 1IE5A 4XMLL 1QRNA 4RAUB 3WSQL 4HS8H 5D1XD 2XI9A 5DRNA 1EFQA 2Q87A 2D4FA 5FHBH 3CVHA 1RIVL 1T22B 2VZ1A 1RIUH 4NM4L 5IMMB 4X6CB 3WFDL 1GGCH 4N0YL 4X7DC 4YXLL 3D39E 2OYPA 4I2XB 3WYRA 2F5AL 4M6AA 1AGFA 4MQ7A 5D1XA 3IVKB 1NFIB 5GQBA 4EXPX 5IMLA 4Z7NF 3RTQC 1N64H 4LCIL 3TPUA 2EYSA 4A6YA 1TETH 2Z91A 5D5MB 1V3MA 3VFTB 3V8CA 3RKPA 1CVSC 5GJSH 2DDQH 2B7DT 4ZS6C 2KZ1B 1BQHB 4ZUUA 4CU8A 4F57H 3O2DA 1P84K 4HEME 4Q9RL 3K8LA 4YGVB 3TH4T 3KPLB 3MYJB 1XF3A 4G6ML 3LEXB 4BZ1H 2RGSA 6CGTA 3B2VL 4GSDL 4CL7A 1FDLL 3ZMRA 4Y4FC 2GJ6D 1VFUA 3K8KA 5IVZB 2P5ED 3QIUB 4XNXH 3BD4A 3DETC 3DRTA 4GXVH 3U46A 4ODVL 1XGRA 2NY0D 3KPSD 1PW3A 3GSQA 2BXZA 1A6TA 3SKUD 1DEEA 3P9WB 2XZAH 3BI9X 3IU4H 3I75B 4MAYD 3IFOB 3S8WA 3BT2H 4S1RL 1AD9B 5B22A 3OWEA 4QWWD 5IFAH 1UJ3C 4GUPA 3QDJE 4OB5L 3S4SG 2OZ4L 2IQ9L 3QDMD 2DWEA 1NL0H 4RWYH 4MAYA 1MCLA 3RIFF 4JN2A 2HMIC 1MF2L 1S3KH 5I9QB 3WFHA 4DAGH 1K5NA 3IU4L 1JWUA 3PP4L 3QEUA 2XWBA 4CN4A 1HH6B 1B4JH 3BT2L 3TNMA 4JDVA 4OZGE 3QDMA 4YE4H 3C60B 1P2CA 1T20A 4K23H 4QOKA 1ONQA 3U2SB 5IFAL 2JJWA 4Z76B 3BRFA 4JZJA 1DQJB 3O11A 4M6NH 1U93A 4OKVA 2IQ9H 2HWZH 2EXYD 5HGBB 1BIHA 3OB0K 3MLWH 2ZNXA 5ICZA 1S3KL 2V2XB 2HRPH 1I3GH 4DAGL 3BDBA 2Y06L 5E2VH 3V79C 5IHUL 3BIKA 3VGFA 1NSNH 5F7EL 5HHQA 3KLHC 1VCAA 4QRRA 2C3XA 4AEHL 5F1NB 1CL7L 3MR9B 1IGIH 2H32B 5C0IA 4XBPA 3CDGB 2NX5B 3EO9H 1F2QA 1J0KA 3HHRB 1MAML 2DIAA 3KDMB 4OD1H 4UQ3A 5DI8B 1B0WA 5GRYA 4OZFA 3TIEB 3ZDYF 3VWKB 1S5IL 1L7TH 3VXRB 5F88B 3CFKB 5E2VL 4GKNA 5D2LF 3F62A 4YHPA 4PJ8A 5I30L 3HRZB 3D0VA 3SO5A 2YD5A 1CL7H 4HLJA 4OI9A 1NCDL 1GRWA 3O8XB 4NQEE 2HJKB 4R7DA 5I16B 2XQBL 5D1QB 4R0LC 4NBXB 4L5FH 4LDOB 4NT6A 1XF4B 2H8PA 1HHIA 1N3NB 4JR9L 5BRZE 1FZJB 4RX4D 5I19H 4U6TA 5EUOB 3D25A 5E00A 1C1EL 3FQXB 4OLXH 1FJ1A 3K4AA 3TESA 2BVPA 5E2TH 3LKNB 4TVPD 1QVOA 1A6UH 2E7MA 3MSPA 2UZXB 3PGDB 3QWRD 1R5VA 2X05A 4UI2A 3FQNB 4GLRH 2VQ1A 5HJ3B 5DXWA 1L6XA 4M7JH 5DJZA 3IDNB 5K9JH 3MLTB 3HZKB 3TCLA 3U48A 4Z7UE 5F1KC 3KXFA 2FSEA 1KIQB 2VLRA 2Z0BA 4ODHH 5E1AB 3QQ9C 2D7NA 3GSRB 1A7OH 2DQHH 2Z9TA 1T1ZB 1BP3B 5ISZE 1AGBB 1FGNL 1I8LA 5IK3B 5T1KA 1ZOXA 4MXVF 4O2CB 3IXAA 1DL7L 4L4VE 3BGMA 2ITDA 4FG6C 2BOBB 4Y8AA 1FHGA 3MXVL 4MNHB 2OJZH 1H8SA 3FOMB 5HGDB 1JGLL 4KDWA 4KDTA 1ZANH 1DBMH 1CN4A 3RAJL 1D5BB 3HG1B 5AYQA 4D0DA 3AFLA 1S7VA 4BFIA 2FO1A 4YDVA 3WE6A 1RUPH 1KIRB 3QUKB 4XP6L 4ZPVB 1D9KA 2DIBA 4OGYH 4LCWD 1CGUA 3BXNB 4L9DA 4KMTH 1T0MB 2B1AH 3TA3C 5KG9B 1XH3A 2VLLA 4HH9B 4OCWL 5C09E 3QCVH 3UTSD 4MA8L 3D48R 1JK8B 4JRXB 3TZVC 2HFEB 2X9XA 1J1PH 1UACH 1MCNA 3MRIB 1KENL 1S8DA 1WQVT 3RL1A 1LEIA 5E1AA 1ZGLB 1IC7L 4LLYB 1EH9A 5EOQL 3OG6B 3HN3A 5IR1B 3OAYK 1LO0H 1F4YH 5MEPB 3HMWH 1MFCL 4JREB 4MA8H 1IAIM 1T89C 5IBLD 5EO0B 3JWDC 2GAZB 2GKIA 3LQZA 1IQDA 3MRDB 4GW5B 4HCRL 1JRHL 1IBGH 4PR5A 3NN8A 1KCUL 1GZQA 2ADJA 4XT1C 4N8CL 4ZO9A 4JFFA 3U0TB 3RGVC 4OT1L 4JN1H 1BAFH 4UT7H 2HYMA 3G04B 1HH9B 2O5YH 1KN2H 2VZSA 5K33A 4X9GA 4LGSB 3IU3A 2X41A 4GRWE 3ULUL 4KMQA 4L8CA 4PJ7A 5I74B 4KK8D 1I7RB 3OXSA 1VDGA 3QIWA 4LOUD 3L3DA 4PJIB 4ELMB 3GO1H 1B9ZA 3HNVL 1SVZA 4NKOB 5DFWH 1B2WL 5HHNB 5D7IE 3UDWC 1UC6A 5E9DE 4R3SA 3DMMD 3H9HB 4O4YH 2IC2A 3QEGH 1WCQA 1MFEH 2CJUL 3QUXC 5K93A 3ULUH 1MLBA 1F97A 1I9JL 4JHBA 1EHLH 3LRHA 3U9PL 5D7SH 2HJLB 3DTXB 4UV4L 2OP4L 4MA1C 1U8JA 4M8QB 3MRNA 3EJJX 3HA0A 1O5DT 3ZKMD 1OAUH 2W0FB 4NN6B 4QRPD 5F70A 2I07A 5D96C 2VDRL 5EUKB 4ZAKB 4BM7A 1OTTC 1UZ6E 2OTPA 4XVJH 2XXMB 3NA4A 1CK0L 5JORB 1I9JH 1QZ1A 4GXUM 4BQCA 4S1DC 5SV4A 1WLHA 3O3AB 4MQTB 1JFQH 5ETUB 1X5LA 1TVDA 4CADB 5CBAA 4DTGH 3TNNB 1E4WL 1JWUB 2F15A 3SEPA 5HGGS 3RZWA 1HNFA 2JB6B 1LNUA 5EOCL 4XCNA 1T0NB 5DZLA 5HHMB 2PW1A 4OCXL 4RMTA 4XPTL 2QQNH 4P23A 5E08H 3SCMB 3VU2A 4OM1H 1CD0A 1RZFH 4RCAA 3EJZC 1LO5A 3VMPA 3WHXA 3D2UB 5B8CB 3O81A 4HKXB 4Y4KD 1CDYA 2VXTL 4WI4A 4Y1AD 3V0AC 4U1GC 5BV7B 1W0YT 4IMLB 1Q9OB 4JFDE 3V7AG 2AJZB 5EOCH 1SEQL 2V7HA 5JLZA 4GKZB 3HNSL 3DI2B 1QACA 3BH8B 3VMNA 3NCEB 4DW2L 1A3QA 1AR2A 2ADJB 3EJYD 1T80A 4DN3L 5H35B 4MZ3A 3IT8D 2AK1H 4FXKA 1OCWH 5KSBF 4FTVE 4PGDB 1C12B 4M93C 3BN9D 3SDAA 1J88A 3I02A 3QDGB 5FYKH 3AMLA 1VKXB 3QJHA 3VE0B 4LHUG 4KROB 4XMKH 1YEFL 3T3ME 4XAKD 2ESVD 1IC4L 4XNZC 5IKCB 2OBGA 3IXTA 1RIHH 2RFXA 4I4WB 3QI9C 5KW9L 4Z7NE 3VDBA 2EYSB 5KSAC 4K71B 1II4E 3BYYA 2C7UB 5CZKA 1BVKB 3ULUD 4OCSH 4LP5A 1ORSA 4WHCA 1S7UA 2GQHA 5GGTL 1RK0B 5C0AB 2H2PC 3OKOB 4FZEL 4HJ0D 4R4FL 5DO2C 5C0FA 4NM8L 5DMJB 4OV5B 1MLCA 5H37H 4GW4A 4FRWA 3VI3F 3BVNA 5D9SB 5D6DA 3MV8A 5HVHB 3QXTA 5CJOH 4HWBA 4NZRH 3JUZA 4P3WA 1GGBL 5EO9B 5MEOA 1AKJD 3OAUH 4P46B 4TQEH 3RDTC 5E8PB 4X6FA 1ACZA 4MQSB 2XY2A 4V2CB 3V4PL 3OKKA 4HCRA 4CVZA 1Q9LB 5C9JA 5KSAA 4PD4K 3QI9A 3ZKXB 4RBPH 5AD0A 4BUGA 4XNQA 4K3EL 4YDLC 2VUYA 1MIEH 4P59H 4K3HA 1WBXB 4N68A 4TQEL 2VAAA 4RMQA 2XACC 1MPAH 3SO3B 1RK0A 5D72H 2VDPL 4JGMA 2AXGA 5DUBB 4RQQB 2BNRE 4L3EE 3VFPA 4Q6IB 4LMQE 1F13A 2FEDC 4ZOEA 1GGUA 3TA3B 4HQQH 2QJDA 5DUPL 1ZA6A 2BVQA 1LK2B 1IAKA 3FB6B 4HT1H 1RURH 2Q7NA 5EN2B 4RNRB 2HFGH 2OCFD 4X7TB 25C8L 3KNBA 1F3DJ 2ADIA 4QXUL 4YHLH 2CIKA 1K9TA 1FLRL 1FORH 4U0RC 4J23A 4JM2F 2XYCA 3IS0X 2HVKB 2Z92B 1X3DA 3QDJB 2HJKA 2R0LL 3H2WA 4HQQL 3CZFB 4JAMA 1OAQH 4IMKA 4PLKC 4E42A 2IH1A 4FZ8L 1SBBA 1EVUA 2C3WA 1H3VA 2HLAB 5DJ0B 4HAGA 4QXUH 3B9VA 5M7QA 2ORBH 3R4DA 5J0BA 1A5FL 3EGSA 5HYQA 4FXLA 2GITA 4YHNA 4P5MB 1UH2A 1HNGA 4TVSa 4Y0GA 1X5GA 3KJ6L 3MRLB 4UT6L 1QBLH 4KTYA 1K8IB 1VESA 3IDXH 3KYNA 1H15B 5GGRB 4H26A 1EJOH 3GSUB 4TRPL 3MBXH 4B5EA 4PBXA 3VRJB 3HC3H 1ZT4A 4OZGA 3LN5B 3INUL 4NQDB 1R5WA 1MH5A 4D0BB 4DKFH 3TNNA 5GSRA 2Y5TA 4ZNCD 1U9KA 5CSBA 4QRSB 1R3KB 2FR4A 1JJUA 5BCAA 1CICD 5JOFB 3O45B 1WWCA 3PWVB 4AJ0A 3QUXA 5LAXA 2OL3L 4JZJB 4F3FB 5JXAL 2GK2A 1RJZA 1CGYA 2D9QB 4HS8L 3C09B 4P5TD 1NAMH 4E5XA 3UO1H 2V2TB 3HE7A 2JCCE 4F9PA 2UYLB 1MI5B 2Z8VC 2D7QA 1X5HA 3UTPE 4NQSA 1DVFD 4I5BB 1U8JB 3H3PL 4F9PC 3HE7C 3V6ZB 4BQ9A 4GRLD 4DOHB 2NY2C 2HFFA 4JN2B 3T8XB 1U3JA 3VRJA 4YXHL 4HS3A 1KLGA 2NLJA 1NCAH 4JM2C 1LEGB 4L4VA 1DEDA 2E9JA 2L7JA 4L3CA 3UC0H 3ZDYE 3SE8H 4HG4K 1JHKH 3PL6A 3PQYA 3JWOC 4JFOB 5IW1A 4NIKB 5I66B 2EIZB 3K1KC 3NPSC 3MNWB 1FZOA 3CFDA 5H2BA 4ZYKA 4UOW0 5I1IL 4CGTA 5JW5B 3CZFA 4G8IB 4XCCL 3LRGA 4JFPA 2YPLA 1CU4L 5L8LB 1QOKA 1NPUA 5E6IC 3UPRB 3TO4B 3DXAE 4MNGB 5IP4A 2MQCA 1J7VR 4PR5B 3ROOA 5IVNA 4IDJH 4JFHE 1MY7A 1DUYB 1A21A 1J8HB 1R6VA 2WP3T 3D18A 1F6FB 4GG6A 1VFOA 1I1FA 3VGAB 3PHQA 5D2LB 3TA3A 4WUUD 4BFBD 5GIRB 1OB1A 2Z4QA 3FT4B 3GSVA 3VH8B 3BWAB 2NNAB 4TUJA 4LLYA 1NFDE 3MLZH 5ID0A 3QHZL 4KK9C 1JPSH 1ED3A 1AGFB 2X1OA 5DVNA 5F7DA 1NC2A 2WV3A 4HKZB 5HHVH 3VXSA 1FVCA 4KDTC 1N4XH 3N50A 5AG9A 2IALB 3FHQA 4MJ6A 2N56A 3SJVA 4X98B 1NGYB 1S9YA 1UVQA 2VRAA 4XP1H 4Q0XL 4Z95H 1X7QA 4JY4A 1J0YA 2V7NB 3FT2B 2PTTA 2WNGA 5D8JL 1DQML 3F7QA 5EB9A 4Z7UB 1S7VB 5ESQB 2EE9A 5MEQA 5FYKD 4NJ9H 1TQBC 3OSKA 4GW1B 1X5XA 4PJCE 2HRPL 5EO9A 5MEOB 1N4XL 2B5IB 4X9IA 2VITB 4HIEA 5I8OL 2I9LB 2NXZD 4MNHA 3EFFB 2W07A 2VQUA 4FFWC 1DLHA 1GL4B 4OV5A 1N59B 3KPOA 3STZA 2FJFB 5E8NB 3DGGA 3MOBL 3G08B 3D3VB 1EHAA 2UWEA 1CT8B 5E94A 5C70A 4Z7UF 3SDXF 5FA3B 5A1AA 2BDNL 1TMCB 1NC4B 1FIGL 4N8PA 5GS3A 1G9MH 3VJ6A 2IBGA 1WIUA 5C6WH 4WWID 5EC2A 3FQNA 4LSRL 5JHDD 4JDTH 4U49A 4GBXD 5CINL 4ZNEE 5GZOC 4GG6F 2VLRE 4F2MB 3FCTA 3HPLB 4U4BA 3Q6GL 3ZO0A 3VFNA 4J3WA 4Q9QL 1K4CA 3MRCB 2F8OA 4K3DL 1P4BL 3RQ3A 4GRWH 2NY3D 5LBSH 5GHWL 4XX1G 1NMAL 2BSSA 3NACH 4PJXA 2YD9A 1XF4A 2H8PB 3B9EA 4EZMA 1KEGL 1RI8A 2HT2D 2C1OA 4WFFE 4X4YB 3AREA 4U3XA 1A6UL 5EZOL 4BK5A 4GG8B 2PCPA 1EJ6A 3DPBA 4NO0B 2HVJA 4XBGB 5GRJH 1OD9A 1T5WB 4M7JL 3PQYB 1Y0LB 4DZBB 5HGHA 3NIGF 1AGEA 5I1CH 4Z7WE 1YNLH 4U1JB 3VXPA 2CDGA 4ZUSA 2ENYA 4DGYH 1DZBA 4MJ5A 4APQD 1N5YL 4PG9A 1KCSL 5HI5D 2GJZA 3ZDZE 3MGTA 4FFYL 2A74A 5FYJU 3CU1A 5IGXL 3IFNH 1N8ZA 4ERSL 1R3LB 1U42A 3IETB 2IAMC 2D2OA 4YDIH 4PY8I 2I25N 4TUKH 3DO3A 2GFBB 3VFMB 2GEEA 5C92A 2QHLA 1TQCC 1QLEH 4OQTL 1YEJH 4ZSOA 3RVVC 1QR1B 4WV1B 1QNZL 5FOBB 5HHOB 1DQLH 5FOBA 3PGFL 4RX4A 2E27H 4MX7B 2I9TA 1V3JA 3QUXB 1UJ3A 3T0EE 4LRNL 4DKEH 3OJVC 1Z2KA 2XNAA 4ERSH 3FB7A 4KPHL 3VFMA 3MGOB 4WEUD 5MERA 2DL9A 5TDPA 2I26N 4HKBB 3H6JA 1ZGLM 4G6FD 1R3KA 1JHTA 5ADOH 5I1AA 4LLVA 1YEJL 2DQIL 2P5WE 5HHOD 4NKIL 2IG2H 1GHFH 1UM6H 1KENH 4G8FA 3CDFA 4KKBC 1YY9D 4PG9B 4PJ7E 5DURB 3NAAL 1H3XA 4JFQB 3QNXB 4P2CG 4EVNB 1AY1H 3MV8E 4IRJD 4Y4FA 3X3FL 2FJHA 1XGUA 1KLFA 4DN4L 4KVCH 5D71H 1MCIA 1T1WA 1UH4A 5F72S 4TNVF 3ZDZF 4KKCC 2X4NA 3ZHDA 1MFDH 1TZIB 3C6SA 5LWYH 4NKIH 1JGDA 4MXQD 1GHFL 2OR9L 3OR7A 4M61A 2C1OB 4KK8C 5DWUL 1EGJL 3TVMD 2I24N 5DJ6B 3ZTJG 2R0ZL 1FH5L 2Y4SA 4IOFC 2V6HA 4WUUE 3WD5H 1FN4A 4IRJB 1EEYB 5T1DL 4YO0A 3GM0A 4TOYL 1BZ9B 4R26L 1LMKA 1A8JH 3LHPH 5B8CC 1MRDH 3GMOB 1HDMB 3DARA 5D1XC 3OXRA 4ODXA 1XIWC 3PGCA 5TGBB 3PWPE 2PF6A 2OR9H 1Y6NR 2VWEE 1KJMA 5F7KC 2BK8A 2R1XA 4U1SB 1U0QA 2JJUA 2LU7A 3VD9A 3MOAL 2ZSWB 1WK0A 1U3HC 3D9AH 2J4WH 4OCRH 3RL1B 1YEIH 2DBJA 2PYEE 3MV9B 3H9ZA 1ZLWH 2D0FA 1T89A 5JIHA 5INDA 1NBZA 4AEEA 1CD9B 3QNZA 1Y0LA 1D5XA 1I7UB 4PGEB 3BOVA 4XVUC 2G75A 3F12B 2IEPA 3WS6A 4AYFA 3IFLH 1MCWW 3KPTA 4M62L 1O0VA 3P0YH 3ARWA 4IJ3B 3WBDA 3E6HB 2VDRH 5C9JB 4X4YA 1TCRA 3OR6A 3PWJA 5LGHL 2DQCH 4MWFA 2AI0L 2R9HC 4WUUB 3CH8A 2APVA 4P2YA 5F9WB 1Q0YH 5DZOA 3UZQA 3T2QA 3BGMB 1AD0B 3F7VB 3H9SE 4NZUH 3RUGA 1KTLB 3ULVH 1BLNB 3QNZB 1ZHBB 2ID5A 1MCBA 1DBJH 3PWPA 4UU9B 1BECA 1X5AA 2EXYC 4OCXH 3BH9B 2AI0H 2HN7B 1OB1B 2DM7A 2Z4QB 1KXQE 4K3JL 4LSDA 3TJHC 4MAUH 1PLGL 2Y1VA 5L0QB 1AQKL 4HPOL 4YDLB 1CT8A 3ZE0F 1G9EA 5EIIA 3NCMA 4XXCC 5DD3H 3ZTNL 3L3OA 1JPGA 1N6VA 1QRND 4FQ2L 4LPXA 3HTLX 1KPRA 3OF6D 3E6FA 5E00B 3D25B 3K2UL 3P4OA 2FHBA 3ECBA 2G60L 1SMAA 5IFHL 2HT2C 1ZHLB 1EFXD 4FFVD 1NCCH 3RVWD 4N9OB 2W9EL 5IG7B 1ZLUH 3FO2A 2C3VB 1ULVA 2LV4A 3K8MA 4LHQB 3UMTA 3WHXB 4NN5C 2ESVB 4GBXB 2FJHB 1PKOA 4ORGB 4R0LA 1MOEA 3I85A 4OF5A 1K2DA 4FTVD 3SDCC 4H0HB 5DJDA 4XGZB 5HDQH 1Q9KA 4ZPTB 1CL7I 5ANMB 1A1NB 2Y07L 5IBTH 3TT1L 3SE9L 5J4MA 2EDEA 1A4JB 3MMEB 5CBAB 3PF2A 5D7JB 3REVA 4HW6A 3ZHLA 1MAJA 2G9HA 2PYED 1BQUA 4C57C 3D18B 4YHYB 4JVWA 3GMMB 3KPSA 3LEVL 5L88H 1XGQB 4TVPL 4CMMB 3NIFF 1HHJA 2FX7L 5CP3H 2A83B 4XZUB 4WFHD 3SE9H 2W60B 4PJHF 2FR4B 1JP5A 4K3EH 1U8LB 3EOTH 2DLHA 5C0JA 2X2YA 4YLQT 1OL0A 1RZ7L 2FB4L 1N7MH 5D72L 1TJIH 1H3UA 3U7WL 5IW1B 12E8H 2R0WL 3NCBB 4KAQH 2AV7B 4U1LB 1BBDH 2P43B 1CIDA 4HJJH 4MB5A 2XWTA 1RUKL 1MCEA 4PJGB 1AGEB 2YRLA 5F7FA 5FCUL 3PE9A 4MNQE 1CF8L 3ULSA 3TO2A 15C8L 2DIJA 5I1JH 2FX8H 4FQQB 3QHFL 5KVMC 1T66D 4UIKL 2PCPB 3A67H 4ELKB 1RZ7H 2FB4H 3PUCA 1XGRB 1DQDL 2Y7QB 1NMBH 1H5BC 5D2LE 4YHLL 3ESVF 3SDCA 1FORL 5JIKA 4HH8A 3LKQA 3HR5B 4NO0D 4NHCH 4KUCD 3TIDA 4YAQA 1DUZA 1RUML 1CE6A 1A7RH 4PRID 5KSAD 3SQOH 5FCSH 5BV7C 5CAYB 3MRCA 5JPMB 5IF0B 4A2LA 2ZUWA 4ZUUB 4MMZC 5D7IF 3HMXL 3V7AE 1MIMH 1A7QH 3KXFE 1PYWB 4K7FA 4DJMA 2I5YH 3DSFL 1KIPB 3GK8L 3IJHB 4LHUB 4NC0B 1UFUA 2P5EE 3G6JB 4MA3B 2MHAA 5DHYA 2HG5B 4PJFB 3ZKNC 4U1NA 5EZIL 5E8DH 3QPQD 1NFIA 2GK0A 3V0WL 3QXAA 4XGZA 3CXHK 3TFKC 5DTFB 3C6LB 4RAHA 4ZAKD 4PRDA 5BMFH 3QA3B 4V1DA 1MIML 2MQ0A 1HZHL 4YHIB 3GK8H 1OP9A 3FMGL 3BXNA 4ZS7H 4FN0A 1F3JB 1AFVH 5E99H 3RA7H 4JZOA 1YNKH 4XBEL 1NDMB 4JY5L 4PJ5B 1ZLVK 5FECB 2E7LC 3L7FB 4R8WH 3V52H 1YPZE 3BMVA 3TBSA 1CFBA 2R9HD 3DROB 3P4OB 5JDSA 3RX5A 5I76B 3U0PA 2HLFC 1DVFB 4X7FC 1JPGB 1T7WA 3KNBB 1V7NH 3BP5B 2UZYB 1MJJA 1NGQL 3IDIB 3GSNL 5ALBL 4D9LL 1H8NA 1A02N 2FSEB 5JW4Q 2MQ3A 4JLRB 3O6ML 3UC0L 1J8KA 1E27B 3S5LB 3OL2A 1RIVH 5JIPA 4HKJA 3N1MC 3DO7B 4NM4H 2A77L 2G5BB 2VDLL 6FABL 2VH5H 1GYAA 4FQJH 3IDMA 2P5WB 3GSXB 3PHSA 4X6EB 5HYJE 3SO3C 1ZHBA 1JI1A 1V7NL 3O2DH 3HNTH 1ZS8A 4MJIE 4OLWL 2YD6A 5KS9E 3W2DH 2RHEA 4D9LH 4LEOB 1U3HA 3S35X 4XAKE 5AD0B 4ZFZA 2IBZY 1OW0C 4YDJA 3FTGA 4Y2DA 1RPQA 1RU9L 3ULVD 3VFVA 4PRHD 4ZUTA 2YPLB 3Q5TA 3RP1A 1QSEA 3W11D 2FYYB 3M17B 4EI5D 4J4PA 1QEWA 5AUMB 3K80A 4NWUH 1N6QH 3RVWC 4P9HH 1XIWA 2CDEA 2GTWA 4XHJD 1IC1A 5EO1B 1R0AL 1OSPL 2Q86B 3PXJA 1FCGA 5IV2A 4G8GB 3D2UA 5B8CA 2G75B 3F12A 4GH7B 5TQ2L 5SWZA 1KV3A 5I8KL 3FT3A 5GXBB 4K94C 3B9KD 3HRPA 1FSKC 4P23B 5INDB 3VXMD 4UIMA 1FNGB 5GGVY 4C4KT 4JJ5A 4HIJA 5JQ6H 2WWKT 1N6QL 3RY6C 1FNEA 3GNMH 1OSPH 2MPAH 4U1KA 4UILL 4Y5YB 3QEQD 1TITA 3CK0H 4MDJB 4X0KA 1UENA 1DN2A 4U31A 3MV7D 4ZTPH 1BVLB 3HE6D 1DQMH 3P40A 1WBYA 2O5XH 2OZ4H 5JNYB 2NR6D 5E5MA 5TE6L 3MRGB 3T0AA 1MF2H 1T03L 4PTTB 5DO2D 3PWVA 1IKNA 5JTWA 3BKJH 1G84A 3PP4H 4X6CF 3BEWB 3ZE2E 1IGFL 1A3LL 1B4JL 5C6PB 4M8QA 1FN4B 3ARGA 4IIQA 5JR1H 4U3HA 4Y4HA 2XWJA 4KI5E 2DBLL 3QG6B 4Y5XC 3IJSB 1FVDA 2HKFL 2AXFB 1KTRL 5I75C 3WKML 1S7XA 5IVXB 2AJSH 1MQKL 3O4LB 5E8OA 1I4FA 1G0XA 5D7JD 1J10A 4I0CC 1XGUB 3G5VA 4W4NA 3WUWA 5EU3B 4JDZB 1IFHL 1QQDA 1QQDB 2DS4A 3VFRA 3FFCE 5HI5C 2D9CA 1J1OL 3EHBC 4I48A 4PJEB 3PV6A 1IAII 3CZJA 1G7LB 1DTUA 5EZLA 1U2HA 1NGPH 3P4NB 1A6TB 4FMFA 4L4TE 5DD5L 4ODSL 4J7RA 1EFXB 1MRCH 4QXGH 4OD1L 4C56E 2YZ8A 4XCEB 3E3QC 3LEYH 4W4OC 2ED7A 4AIXA 1L7TL 3U0TA 4Z0BH 1IT9L 1FE8L 1U8MB 4KWUA 3QFJB 4TTGA 2W0PA 3LQAL 1CE1L 1GGIH 5CLWA 4S1QL 3LKPA 3F5WA 5CP7A 2CIKB 4HIIB 4CVWA 3KLHD 2EYRB 2HTKC 2JKXA 4YEFA 2E6JA 1A4KA 3WLBB 3FQWA 3WO4B 5IUSA 5I1HL 3DECA 3RWCA 1EDQA 3U82B 1LK2A 4ODTL 3NCYS 5HTSA 4L8SA 4M43H 5FM4A 1Q94B 1GGIL 1HXMA 4GAYB 3WDJA 4EOWL 1J0HA 4MXQC 5C0NC 2AK4A 3S6CA 1YN7B 4HWBH 1GZPA 5F1IA 3EJZD 5BOPA 2PR4L 5DK0A 2R23A 4IM8A 4Z7VA 4DVBA 3QYCA 1TJGH 5BRZD 4TN9A 3FT3B 4K7PX 3F65A 4R6UA 1BQSA 1QBAA 3NA9L 4LSSH 4HS6B 4XNZB 1CDIA 3VXTA 4WNQA 4JFEA 4Z5RB 3CFEB 3RZCA 5C08E 3SPVB 2H6PB 5AUMA 5BVPH 2RBLA 2IQAA 3N85H 4C58B 1G6RB 5C07B 2BCKB 3VFGH 3ILPB 1PZ5B 1L0YA 3UJIH 1TJGL 2QTEA 4LLDB 2FHFA 4HF5H 3RGHA 3MXVH 1TZHA 3M45A 3UTTE 3T0BA 4Z0XA 4JVUA 1S9VB 3MJ8A 1ZANL 1YECL 1UM6L 1TZGL 5BQ7B 4NZJA 2NY7H 4XPGL 1J1XH 2DWDA 4MJID 3W82A 3OKMB 3TC9A 4BYHA 5BZDB 2DM2A 1HQ4A 3IFPA 1IGMH 2YPVH 1BF8A 3LMJL 2D0GA 3GJFA 2J6EA 4G43A 4M1GL 4LLQA 1NBVH 5FA3A 4KMTL 4JEGB 4TNVK 2B1AL 5IMKB 2SEBA 1CLYL 2PO6B 3AAZA 1I3VA 3U7AA 5LWYL 5FB8A 1A2YA 1UACL 2QV2A 2X1XR 4EIZC 3WEXA 1VFMA 1OM3L 2YD8A 3NOIA 1OAYL 1K6QH 2F9BT 3V7MA 3KLDA 5JXEC 2XRAH 3RPKA 3MJ7A 1CXFA 3LKRB 1YZZA 1F4YL 1NANH 3M8OH 4GMTH 1MFCH 2VZUA 2XY1A 3X17A 5JLZB 3BPCB 2ZPKL 1KLUB 2J2ZA 4Z8FH 1IM9B 4NFDA 1N64L 4IMLA 5TDNA 4ZUVB 1CFSA 2CIIB 2IJ0C 3FO0H 1NGYA 1UVQB 1OAZH 3SJVD 2EECA 3S98A 2VC2H 5E7BA 2AGJH 1JHLH 4JZNA 3SDXA 4OZFB 2AV1B 5GJSL 5KVEH 1JWMA 3MGAA 3QA3A 4E9LA 4HC1L 3SE3A 1SBSL 4LVHB 1ZWIB 5T1LB 2D31B 2G5RA 4PY7A 1HN1A 2WUCL 4KJPC 5HBBA 1O7SA 4Z8FL 5IROA 3PL6C 4WHTA 2VC2L 1ETZB 3HKFA 2KPNA 3OAZH 1SBSH 5T3ZE 2R2HB 5A3IC 1LO2L 3O6LH 5HYSA 1AP2A 2ATKB 2AS5M 4YHKH 1Q0YL 4JDVB 1SEBA 1DJSA 1CZ8L 3RL2B 2GUOB 1NMCB 4FNLL 1IQWL 3IDMB 2BY0A 4LNVA 1TQCB 4OB5H 5CBEB 1EUTA 4NFBA 4ZXBA 1RZJC 2FX9L 4GXUN 4AG4L 5DRXA 2R56H 4ELKA 3CFJB 3D0VB 1CD1B 3O6LL 1RJLB 1FL6B 5JOEA 1A6ZB 3OKMA 4OZ4A 1U8OB 1ZK9A 4OBSA 1OT2A 3TFKD 4NWTL 4QRPE 2O61A 3LD8C 1P53A 5KVGL 1TZHB 1JYNA 3OXSB 3K3QA 1HQRB 2NW2A 5J13C 5FUOH 3UPCA 5HHMD 2AJUL 5JW4N 3NFSL 2HFTA 3L3JA 3K2UH 1NSNL 2X9WA 4HXAH 4WWKB 4PJBE 3MUZ1 3GRWL 4N5EC 2YA1A 4X5XB 4K8RC 5HGBA 1A6WH 2XTJE 4TVPE 3BP6B 4CW1B 3KPRD 2A2QT 5JOFA 1JNJA 3DGCR 4IMKC 5DTFA 1HHGB 1R24A 5IB4B 2GJ6B 3VFUB 4BQBA 3WFCL 4RGMB 3WFHB 1A6VL 1MREL 3CH1A 2VN4A 5MP6H 3TO4C 3MRPA 4POYA 1BJMA 3NCJL 5HDQL 5HYJA 3X3GH 3GSUA 4FQXA 2Y23A 1MRFH 4JQVC 2X1WL 3H42L 3GZKA 3SDYH 5IMMA 3QFJD 1EAPA 2ZG2A 5E8EB 3D85B 3EOBA 4PS4L 4NJAH 5KG9A 5E9DB 3MZGB 2CIIA 4OLXL 1OP3H 1WC7A 3MLRH 1HHHA 1QSEE 4OCYH 3S34H 1W8OA 4OCSL 3R1GH 2AKRA 5FYJH 5GGSY 4H25B 3HG1A 4PJXF 1JGVL 2DQDL 4JPKL 3CGTA 5EA0L 2DI7A 2NY6B 3O9WA 1EV2E 5K9JL 1DQTA 5ACLA 1U8KA 4ZD3H 3V5HA 1QFWI 4RGND 3LDBC 1MCHA 5ADPH 5CJOL 4LLMA 4TSCH 5FIEA 4MCZA 3OAUL 1OD7A 5DFTA 3OJMB 1CFNB 2DMBA 5JA8B 4WGWB 1N7ML 4O9HH 4LSPL 3GFUA 4XP9H 3S3SA 2X09A 4G9FA 1ZT1B 3RDTA 1V7ML 3VI4E 2IWGA 2P5EA 2OJZL 1S7XB 1XF2A 2FIKA 1RUKH 5D6DC 5DA0B 2FRGP 4G6KL 3FZUD 1E4XH 2X44D 4U05A 4Y1AB 1UM5L 4F7MA 3GMNB 2AJ3A 4UIKH 2VJXA 5I73B 5FM5O 3UTOA 4OF0A 3RDTD 1TDQA 2VDPH 4R4BA 5LVEA 1N0XL 3U7YH 5FO7B 5HYSB 3BP4B 3RWHA 5JPNA 4NHCL 3KVQA 3BE1H 5IJKC 4PGZA 5T5FH 1SJEB 3ARDB 1KN4H 4RRPA 1ZA3A 4LCWA 1INQB 4KI1A 5TE4H 2PXYB 3IAPA 5GGUB 3SDAC 5C0CE 3GBMH 3HG1E 4XAWL 3E6HA 3SPVA 3BPNB 1JWSB 1FZKA 5LGJB 4Q9BA 2DM3A 2H3NB 2WBWB 2I5YL 4U1KB 1J0ZA 2MSPA 4WU7B 3ROLA 1UKQA 5CS7A 1FL3B 4N1EA 2YHGA 4OLYH 1XGYL 4NKMA 2PO6D 2X4SA 5EZIH 1HILA 2RAMA 3EYSL 2JB5H 2XKUA 3JUYA 2ZKHH 2NX5A 5JMRA 3I9GL 4XAWH 5HDOA 4O51A 3QIBB 1MCOL 4G8GA 1MJ8H 4ZSOE 1FRGL 3W39A 3CNKA 3FRUB 4JN1L 1MEXL 3SGEH 3ARFB 1I1RA 4F58L 1JVKA 1U6AL 1KJMB 1X5YA 1XZ0B 3HB3C 3CIQA 4XCFL 3RWCB 3K1DA 4K94L 4P23C 4HUVA 4TRPH 3WFZA 2DB8A 3BKYH 4YDJB 3WN5B 4PJAF 2YD7A 3B9DA 4MDIB 4XP4L 4UB0L 4K7PY 4DZ8A 5C0DA 4DKFL 3SE4C 4IRZL 2RCSL 3QIWD 3T65B 5IB2A 1YMMD 4LSQH 3BN3B 1ITCA 1U6AH 4QYOA 1NGWA 2IGFH 1AGCB 1Q9OA 3Q5YA 4PJIF 4ELMF 5C0CA 4POZD 4RSVA 1CDBA 2QSCL 1Q0XL 1MCRA 2A6IA 3GSWA 5DK2B 3QWOB 1IJ9A 5CD3A 3LIZH 2H9GA 1MJJB 4ONHB 1QKZH 3OKEB 3LKSA 5I2IB 2ZJSH 1XF5B 4FQHB 1I85C 5EBWA 3ES6B 5D70H 2YSSA 3U4AA 4XC1L 2B0SL 4Y5XB 4YXHH 1CK0H 4ISVB 3V6OC 4QTIL 5IW3A 1T1YB 3IDYC 3DHMA 4KV5E 2W1NA 3Q6FA 3UDWA 4PTTA 1CGXA 4XC1H 1S9KC 1EK3A 2F53D 1MCKA 4KGJA 3V6FB 5F9OH 5IW6A 2NY0C 2OSLB 2NY2D 4XPBH 1BVLA 5DQDH 4MXWL 4ZSOB 5GGVH 4DWHA 3ZYJA 4NQCE 2BP3A 3S4SA 4KC3B 2VXUH 3HI5H 3ZL4L 2AK4E 1LE5A 4IOIB 3RGVA 1E4KA 2VXTH 4D9RD 5F1SA 3LKOA 1RSFA 3CH1B 2MHAB 5JO5A 3ABZA 1T7ZA 5F9OL 4Y4KC 4G6MH 3EIFA 5C7XH 3B4NA 4LRIA 3H3KA 4P9MH 2OL3B 5GISL 2ERJB 1FLTX 4FFWD 4ZTPL 5IEHA 4NBZB 4L8CB 4X5WB 5IMOB 2Z35B 2A6JA 1JPSL 3L3GA 1DUZB 1QRNB 5ITBL 1CYGA 1IL1B 3LPWA 1L7IH 4TTDD 4Y2DD 3WJLC 5FM5M 4AEFA 3TZVA 1QTYT 4L4TA 3B8YA 3C6SB 4P2QE 2X4NB 3ULVC 4ZFZB 5J6GA 1XIWD 1YC7A 3ZE2F 1D9KC 3UTZB 3DX9B 1TNMA 2AQ2A 4FQPA 4G3YH 5T3ZD 3NZ8B 1QLFB 4M7LH 4RDQF 2HMID 1Z3GH 2QADC 2ZG1A 3B9KA 3RY4A 4L8DA 1A6ZA 5F7WC 4G7YL 5ERWA 4PJGF 3QRFM 5CCKL 5BO1H 3B6SA 3B83A 1VGEH 2P4AB 3MTRA 2ARWA 5CJ8A 4KRLB 4P4KB 4LLVB 2AEPH 3JWDL 4KKAD 4LEXL 2CDFA 2XWJB 4I3SH 4PJ7F 4Y4HB 1QPXA 3RKDD 1VFBA 3RJDA 1A7PH 2C5DC 3SOBL 1UB6B 3EDJA 4K9EH 2UVFA 2EDKA 4HULB 3OJDB 1OAKH 1VENA 5TF0A 2NY5C 4XPHH 4O00A 3I3BA 3T4YB 1L9NA 4HIEB 3SBWC 3QZWG 5IHUH 1EO5A 5F96L 4RMVA 2CLVA 3BKMH 1F42A 1MHEA 3QDJD 4OJFL 4JDTL 3I3DA 2JIXB 5CINH 3VWKC 2VLJA 1CG9B 3FRUA 5C0CD 2ZOLA 3BQUA 4K3DH 1A1NA 3UP1A 4PY7B 4XPHL 1KG0B 3JTTB 4HIJB 2R4SH 4Z77A 3QRGH 4P46D 4PREB 5DD6B 3MCLH 5FO9A 2F53E 4HT1L 3C5SA 2P8MA 4HZAA 5D1QC 1NFDF 4LNRB 1P7QB 1T2XA 4YHOH 1T5WA 3QUZC 4UDTB 1X5IA 1MNUH 4B0MM 3MLTA 2DI9A 2X4TB 4PJ8C 4QY8B 5A2IH 4PV9A 3L5IA 2P24A 4Z7WB 5F89A 4AL8H 1CG9A 4JR9H 4PLJD 2VSCA 2P49B 1I1FB 4C54A 5JHLL 4PJXB 1DE4B 1MCWM 2ZCLH 4PJBB 1LGVA 3EOAA 2ITCB 3F7YA 3VFOB 1YQ2A 4HEPG 4L3AA 1A5FH 1QYGH 4ZO8A 3TJEL 1MI5D 4UV7L 1BM3L 4Y1AA 4Z6AT 5C1MB 5T3ZH 4H20H 3DYMA 2QHRL 1KCVH 1OGAB 3FFCB 3MBXL 3CSYA 3UJJH 4KUCF 3C5JA 1BBJA 2DQHL 2NY7L 4XPGH 1MFBH 4P2OA 4XNMB 3TBVB 3U6RB 1YMHA 3EO0B 4LRNH 3QEQE 4PBWD 1B0GB 4FABH 1X4XA 4EIGB 1RK1B 3TIEA 2F54A 3UTQB 4YR6A 4JKLA 1MQ8A 3TBYA 1BM3H 2YN3A 5EU5A 1F90H 1DQQB 3QP3A 4JHWL 1QSED 3Q1SL 4OLEA 2I9LA 3A6BL 5C0GA 2Z8RA 1OGAE 3VXNB 2IG2L 1YDPA 3D3VE 4KTEL 4YXKH 3V6ZA 3TBSB 1YA5A 1FNFA 3KPPA 3WDHA 5D93B 1PVHA 2AKRB 5SWZD 1JTTA 4WU5A 2YUXA 3CVHH 5K9OA 2H6PA 5A16A 1FO0L 5KZCB 1BEYL 1OARL 3C8KB 4JFEB 1HHJB 1SJXA 4LBEB 3M8OL 1A7BA 2BC4A 1GSMA 4NYLA 3GMMA 4MS8D 3Q0HA 4PJIE 4ELME 4HKZA 5BZWA 2E3VA 1IC7H 2J6EL 3VDAA 3UBXB 4KZDH 3FQRB 5B39B 2RIKA 3FL7A 3MV9A 1WUNT 4U0RB 1F8TL 1CXKA 4PJHA 4PJFF 4AT6A 3L5XL 1K4DB 1OARH 2F5AH 4JRYB 1BFOB 5CP3A 5FDWA 1E28A 4GS7C 2FWOB 4RFOL 4ZPTA 2GT9B 4KFZC 4H1LA 1QRNE 1G0YR 3HZMB 3NGBB 2DI8A 4JQIL 3QT2A 4JO1L 2ADFL 2HH0L 3JXAA 3S4SB 5E95B 1HSAB 2GITB 4YHNB 3PGCB 5FHAL 5TGBA 4KZDL 2QADD 3I6GB 4OT1H 4MNQA 5GS1B 4U7MA 5IB5A 3F5WB 3CFBB 1YN6B 3GSQB 3L5XH 4OGAD 3JWNC 3RTQA 4Z78A 1H8OA 1YEIL 5E5RB 3KHQA 3KPPB 3TWCL 3MJ6A 2HRLA 3QDHA 4PJ9C 1I8IA 4YJZL 5KVFL 5IVZA 1IEAB 5JW5A 4YHKL 3NPZB 3ZHKA 1FDLH 2NW2B 1Z5LB 5HPOA 2AABH 3FQUA 3H3BC 2F19L 3MNVB 2ICWJ 3MYZA 4OAWB 2DYPB 2K7QA 5I18L 1EBAA 4N0UA 3LRSA 4R2GD 3V6OE 3I3EA 4OUUB 1QSVA 3QHZH 4KXZH 4OBRA 1GH7A 2HAZA 3DHJA 1NUNB 3EDFA 1A0QH 3WFBH 4BK4A 5E4EC 1PKQE 3LS5L 2BVQB 4JDZA 5LGHH 5F8RC 4HS3B 3ZT7A 1IGYB 5BVJA 5INCB 5KVFH 4ZFOB 1E28B 1QFHA 4G80A 3U9PH 1KFAH 4JKKA 4M02A 4AT6B 2P47B 2D0HA 4WFGD 3SKNA 1U8LA 2BY1A 3WXWL 2NMSA 1U8HA 2R15A 1CDJA 4U0QB 4I2XA 5IWLA 5J06A 3MC0A 4MXVE 3SGJA 1A7NL 1CDHA 2C1PB 4V1DE 2AJUH 3LQMA 1D6VL 4KK9D 2I9TB 4OI7A 3NIDE 1TJHH 4ZOBA 2ZCHL 1ETZA 5L9DL 5K9OB 1A6WL 5KTEL 3GHBL 5DLMH 4HK0B 2YD3A 4R9HA 4QHKJ 4LKCA 1NDGA 4KHTL 3H8NA 1S7SB 1C08B 3W39B 1A6PA 1D6VH 3IB4A 5A2KH 4KKNA 5E56A 1D6EA 5IFJA 1DQQA 5DJDB 5DGRA 3QBTB 4R2GB 4AM0B 2ICWA 4ZDHB 2MTPA 1U2CA 4Y16C 3OKOA 5F6HJ 1IGIL 3MLYH 5A2JH 5DLML 5CUSH 4IHOB 4JPWL 1T3FB 1J8HD 1C5DA 1YY8A 3O4LD 1YPZB 4U2ZA 3L7EB 3QO1A 1KJ3H 3HE7D 1I7TB 2YOCA 3IXTB 3FO2B 3ZDXF 2B2XL 4HDIB 4GRLA 3KAAA 4YPGA 4M93B 2HLFD 5KJRH 4E41A 3NCCB 3DYPA 2PXYA 1QEWB 3LKRA 5F3BA 3QUYB 4PGCB 3R1GL 1NJ9A 1KB9K 5JW4M 3L3IB 5CUSL 2LFGA 1OCWL 4YNYB 4ZO7A 1RJCA 4X4MA 3B5TA 3BAEH 4WVRA 3FFDB 4MD4A 1I9IH 1M05B 1BFVL 4M6ML 2YC1A 5JW3L 3ETBF 3P4MB 1EA9C 2W0LA 5FYKU 1WAAF 1KBGL 4I3GA 3EYQD 4TSCL 5DD0L 3BUYB 3HI6L 4ZQKA 1HOCB 3ZLQC 1F11B 4CUCA 4UBDC 1I1YA 2LTQB 2HN7A 1NGXB 4KHXH 4DKDC 4EUPA 1MVFA 4M6OH 2Q7YB 1FNSL 3BH9A 2R29L 4ZOAA 1LQSR 2FX7H 3ZKND 3WMSA 1IGYA 5BVJB 5SWZE 4NRYB 2BNQB 1CXHA 1LWRA 1YPZA 3BP5A 1FG2B 2PETA 5J6HB 4QNPF 1QLEL 4OQTH 5DMGD 5FO9B 2LU4A 1A14H 3GMRA 1TVHB 2PW1B 2WBJC 5I6XC 4XNQB 3WN5C 3FN9A 3OMZA 1VPOH 3QI9D 4EQ3A 4Q7DA 3IKCA 3RTQD 5CILL 4LSTL 1FNSH 1DL7H 1ZV5A 1KACB 1IL1A 1NAKL 1NDGB 3BHBB 1U95A 3V5KB 5ADOL 2PTTB 3KYKL 1YN6A 3GKZA 4XWGH 1YC8A 4CVUA 4M7KL 1CTNA 1Q1JH 2WLYA 3U0WH 1EZVY 2R23B 4LSTH 3G5XA 4XP6H 2EKJA 1M7DB 3DRQA 5DF0A 4PRNB 3MA9H 2DTSA 1REIA 2HJLA 4O2EA 5F7DB 5JUEH 1F2XK 4WDIB 2Y6SD 3UTPD 1YNTA 3BPOB 3MUJA 3T4AB 4JFYB 5JW4R 1JNLL 5EH1A 5B3NA 5B39A 1Z6JT 3H9YA 2A1WL 2R0ZH 3L5WB 4M7KH 1J0IA 4KUZH 1IVLA 5CLTA 4U1HB 5HGHB 1AO7D 1MEXH 1HDMA 1QA9A 2L4OA 3MA9L 5IIEB 3LHPL 5CP7B 4PV8A 2V5YA 2VDKH 4NUJB 4FP8L 2R8SL 1W72L 4N5ED 1JNLH 2C4XA 2COQA 4GLRI 4M3KB 1HH9A 1DR9A 1T83A 3RY5A 3K74B 1QP1A 2PN5A 2X42A 3HZYB 4NNYA 2EC9U 1RULH 4NC2B 5IEKB 4N0CD 5MEND 5I17B 2EKSA 1IMHC 1AE6L 1JL8A 1FZMB 3CFCH 2VDKL 1EEZB 3AS0A 4URTB 5MEPA 4KK5C 1T1XB 3O4LA 3VWJA 1X44A 3OPZH 4ZAKC 5FO8A 3O0RH 2ZJSL 4XNYH 3GEWB 3NTCL 4OGXL 3WIFA 5EU6B 4YBHA 3CSYB 4CADA 1NGWB 1I3UA 2D03H 4L8BA 3V0VA 4DKAA 4LSVH 1M7DA 5K59F 4YPJA 1A47A 4IS6B 5JORA 4NO2A 4ZO6A 5DQ9B 4G8EA 3STZB 8FABA 5JXAH 3P30L 4APQC 3ULUC 1HE7A 3VXUB 2YK1H 5DT1L 3RVVD 3JBG7 1D9KB 1F58H 3OKNA 3S35H 2I07B 3HB3D 4XH2B 1ODAA 2Z93B 4PJCA 5CMAA 5C0BB 1A3RH 3C8KA 3U9UA 3S88L 5C2BH 4JKPH 5FGBC 3H7BB 3HI1A 1HWHB 1YJDC 1M71B 4GMSL 5F7UA 4Y5VC 4HMCA 5FGCB 4X4XB 3HI5L 5F7LB 1HHKA 3LB6D 1JFQL 5DS8A 5DT1H 4YBQC 3OGOE 5C0GB 4HPOH 5C0BD 5KANI 4BELD 3O8XC 3LV3B 5CGTA 2ZUQC 2XV6B 5IK3A 3PG2A 1JRHI 2P8MB 2WWMC 4HWEL 3VD5A 1BWMA 3UTQA 1UGNA 3NFPB 3F6LA 2DD8H 2QQNL 2IAMD 4F33A 2UVEA 3KXFB 1X9QA 4PJ7B 1CFSB 1FZKB 3DX6B 3DNKA 1NLDL 5GZND 5IFHH 2OTUB 5E1HB 4PLKD 3BRGC 1NCCL 3O3DA 4PD4J 3P4MA 4JFFE 1IAOB 4N0FA 4IDJL 4HWEH 1SEQH 2XA8L 4TSAL 4U6YA 1AHWA 4U6YB 4UAOB 1EX0A 3C60D 1SHMA 5J9PB 1EO8H 4JB9H 3BEVB 2G5BA 1JZ6A 2VZOA 4LPUA 4KJWC 4PIRF 3MLZL 1MCDA 5I1GH 1T6VN 4P4RA 4JM4L 1H3WM 2H45A 2Y07H 1F4WL 4KI5C 1FPTH 4KJYA 4PV9B 3RDTB 1S5HB 1K8DA 3THMH 3EYVA 4QRTB 5EZJA 1YEFH 5DDHB 4CBPA 3DGGB 2P48B 3MA7A 1JK8A 1DP0A 1DLFL 1RIHL 1ZVSA 1C5BH 5HDBF 1KJVA 1AO7A 1BZ7B 4I3SL 2ZSVA 2F8XC 2P7TA 1KTLA 3BZ4A 2B5IC 5GS0D 4Z0XB 1OLZA 3PP3K 4UOW1 3FN0H 2A6DA 4KKCD 3GIVB 3UTTA 3WKMH 1BGXL 4P99A 5ILTH 5DURD 1PZ5A 4KZEL 5MEQB 4PJBF 1M71A 4QLRA 5I1KH 4UNTA 2XOTA 2CR3A 4LCWB 1FFNB 5I8OH 1TCRB 1GGBH 1WTLA 2PW2A 4FTVB 4UMGA 5D6CB 4X5WA 5IMOA 2FBOJ 2EIEA 3MREA 5LG1A 4JRXD 3U7WH 5GSVA 4ONFL 1OY3B 3FN0L 1FGVH 1JNNL 4ODSH 5IBUB 4DFIA 2IBBA 4PB9H 3EAKA 5ID0B 3SKOA 3MCLL 3VGEA 15C8H 3MRPB 1D5IL 3WL9A 2FX8L 3VCLA 3EYOA 3G6DH 3CMGA 1KPVB 1MPAL 4L8SB 2AVGA 2DWEB 4I2XE 5HHXL 2NY1D 1B90A 3ARXA 1KIPA 1H15A 1WFTA 3L5JA 1JNNH 5C08B 1KOAA 4L8DB 5AG8A 2NW3A 3QDGA 3WUZA 3DI3B 2JCCB 3AY4C 1WFOA 5GPRA 3VD7A 3ARED 4IRSA 4ODTH 1YEEH 1MFNA 4PRPB 5J8OA 3MRRB 5BV7H 4I0PC 1FZJA 3MNVA 1UCTA 3GUTB 3LKPB 5F9AC 5J57B 5HHOE 4YK4C 1H3PH 3HMXH 4HJGA 4F80A 2WBKA 5HHXH 1T1YA 3OAYH 4XCEA 1KPUB 2OMNA 3QDJA 1QYGL 1QR4A 1GPOL 1FNHA 2YXMA 1F6AB 1TLKA 3OZ9H 4NBYB 1JV5A 3PABB 1WT5C 4F7CB 4X8JA 3UCRA 5E8DL 5L6YH 1XF3B 5CEZD 4IBLT 2JCCA 2IADA 5E6ID 4EI6B 3RVTD 2P1YA 4OLVH 3WIHH 4JG0H 4GO6B 4B7LA 3OKEA 3VFGL 5EU3A 4PJ9B 5L7XL 1UCBH 4JO4L 3U30C 5HVFB 5F21B 2K1MA 5GS1C 4OD3H 3EYOB 3V4UH 2W92A 5C0JB 2EO1A 1YNKL 3BGFB 5DSCA 1GOHA 3QAZC 2D7TL 4EBQL 2CRMA 5I1AB 2NY1B 3MV7E 2R0KH 4KTEH 3PGFH 1DCLA 1J1XL 2BSRA 1BVZA 3C8DA 1SM3L 1IM3B 4HG4J 5IB1B 4KU1A 3W0WA 3PWNA 1ZHKA 1OQOA 5EPMB 3CVHL 2BNQE 3V4UL 1IGCL 1I1AD 1MFAH 1U91B 2LQRA 4R96A 4WU5B 1WICA 1QSZA 5HSFA 1HH6A 3V5KA 4RIRA 5FKPB 1MH5B 2BX5A 3VXUE 3WNPA 1R3LA 4LVNC 2DF3A 2NY3B 5T1LA 5D9SA 3TP4A 5EU4B 4EDXB 2YPKB 3S5LG 3SDDA 1ZWIA 3N9GH 4N0UE 1G1CA 2H26A 4NQEA 1F00I 2R69H 4JRXE 4DN4H 3CAFA 1X4YA 5I2IA 3M1BB 4K2UH 1CLZH 4PJEE 4RMRA 5EBGA 3BSZH 5DRXB 4J3SA 1NEUA 4P57B 1XIWB 2GTWB 3RVUD 3U1SH 4R26H 5CJXA 1GGCL 2KQNA 1BHGA 1RV6X 4HWUA 4PRAB 5JXED 1INEH 4GAGL 3BO8A 4IEFB 4M48H 1RUAH 2BSSB 5D7KD 3QFJE 5H35A 1T5XA 3SGDH 1S9WA 2FNBA 3F7YB 4RAVA 4HFWA 1SYVA 3VFOA 1TETL 2PTVA 2Q8AL 4Y16B 2PO6A 4G6JH 2O5ZH 4ENEC 3ZZ1A 4EN3B 2SEBB 4MLIA 1U8QB 4OCRL 2J1KA 4QRUB 3A6OA 3T1WA 4JFFD 2UUDK 1U92B 4NO5A 1WIPA 1N0LA 5I1EH 2MPAL 1HQ4B 3MV9D 5D2NC 4LPWA 4WEBL 2HKHL 3IVKA 3IDIA 1OP3K 1KFAL 2FD6L 3VW3L 1BX2B 4QHUB 2YWYA 3EYUH 5F97E 1PGRB 4IRSD 3BX7C 1RAMA 2R2BA 5FUCC 3CLFL 5JQHC 4TULL 1XGTB 2R1YB 1UB5A 5DYOA 5EU4A 4EDXA 3BQUB 1IM9A 3BKJL 3D3VD 4LFHD 4MS8C 3T0XA 1G6RA 5C07A 5LGJA 1DANT 3N0PB 2WZPD 1S7QA 4RRPG 3U4BL 3PNWA 2FH6A 4P46A 1T6WA 5CJQH 3K7UA 4M5ZL 4OLUH 3MV8B 1KYOJ 2WBJB 4MJ4A 5I6XB 3OKNB 5KVGH 3CLFH 4RWYL 4TULH 2DLFH 4LASH 3H9SB 2C1PA 3TJHD 3P0GB 5T1KB 1K85A 5DFVC 4ONGL 1KC5H 1LP9B 4OD2B 5DJYA 5ID1A 4EI5B 3HS0A 1CFTA 4M5ZH 5CSGA 3IDNA 1MHHA 1NCTA 1ZEAL 3QXDB 2XKNA 4GRMA 5ESAA 3AU1B 1R5VB 1NUFA 4EN3A 2Y06H 3LSOA 5SWSD 3RWEB 4OFIA 5CEXB 1XT5A 1J5OL 3BFOA 3LQAH 3AMKA 1S9VA 3MJ8B 1KC5L 3QWRA 2VXQH 1FZMA 5JHDB 2OM5A 2AJVH 4X5XA 4P2QA 3I84A 4YO0B 1FV1B 1EEYA 2CMRH 1F6AA 3BH8A 3CMOH 3SKMB 1D5ZA 1EEQA 1MRFL 2X4QA 2BCKA 4KKLC 1MCCA 4S0TD 4LL9A 1FFPB 3MJ9H 3UYPA 1IC5H 4HIXL 2E7HA 4JGUA 3MO1B 5A2LH 3X12B 4ETQA 4FQQA 3MLRL 2XTLA 4WENB 1KSRA 2NY5L 1L0XA 5EZOH 1VFAB 4GRWB 4L9LC 2ZP0T 1E6JL 4MMXC 5DI8A 3ILQD 4G8FB 3TT1H 3GMLB 3WNOA 3CDGA 3SDDB 4PRPD 3UXFA 2BSTB 2WWMD 2EC9T 1VACA 3CFJA 4JRYA 2P42B 1N5YH 3KPNB 1KCSH 1CWVA 5DFVD 1BWWA 5E2TL 2MWCA 2NY5H 4Y2OA 2HFEA 5DRWB 4LSPH 4F37F 5JOPD 1XR8B 2CXKA 1OSZB 4N0CC 1RJZB 1EXUA 1AP2B 2I60L 3QR2A 4TUKL 5EBLB 3V5DB 1P4IH 4ZPVA 3RNQB 5CEZH 4FQIH 5I8EA 4WFED 3HFML 1P2CB 1P9MC 3QSKB 3AS3A 1JZ8A 4AIZA 3DTXA 3CC5A 4KV5F 4Y5YA 4MVBD 3IETA 3MBEC 2YA2A 1MWAL 2XWBB 1HIMH 3D0LA 5EIQA 4HIHB 3CU7A 1GIGH 3OX8B 2VE6B 4PTUA 4KJWD 2I60H 3IS1X 2OTWB 2A6DB 2VWEC 1DFBH 3C08L 1NCWL 5GGRA 3C6LD 2AQ1A 3KG5A 5EU5B 3WIIH 5CWSA 1KELH 3QHFH 2IADB 2F54B 1Y6KR 1FAIH 1RY7B 1MCPH 3U79A 2HT3C 3EGSB 1MVUA 3J7HA 4YFDB 4GG8A 4Y5VB 1AY1L 1BOGB 2EIDA 4E0RA 1NGXA 2CDEB 3I50H 4JGJA 1AI1H 5D71L 4XB8A 5ALCH 1RUMH 2B1HH 5SX4H 5D4QA 5GJTL 2YC1B 1KELL 5DWUH 3BQUD 5DJCA 3QUZB 1NCBH 2ATKA 1K4CB 5E5MB 2EEAA 3L3IA 3SHSA 1RZGA 3C6LC 4YGVA 5HGAB 1AI1L 5KVEL 5C09D 4YFLI 4LCCC 4HBCH 4C83A 3VXME 3ULVE 3CFCL 1RUQL 4ENED 2E9IA 1DE4A 2FIRT 3QUYC 4XCFH 1JPTH 5EC1B 2JJTA 1JBJA 5F89B 3KYMB 1ZGLA 4HWNA 1HKLH 4QY8A 3VCLB 4CMHB 4Q6IA 5H8DA 2WINB 1NCBL 5BZDA 1IRAY 2V2WA 3AC0A 2D31A 3LOWA 5E8NA 3VXRA 5IJVB 2VMFA 1LK3H 4Y8DC 3ARZA 5ESVB 2O5YL 1LD9B 2X40A 3MUY1 2YRZA 3T08A 1EHXA 2IPUK 3DVGA 1PSKL 4XBEH 4MHHG 2NZ9D 1BOYA 2E7CA 3MREB 1Q0XH 2OR7A 2VLKD 2VDOH 1PEZA 4FNLH 4HLZG 2AERT 3FRPG 4CKVX 3IFLL 4HK0A 4HPYL 1LK3L 3ARDA 5L2KD 1P1ZB 2V2XA 5C2UB 3FOMA 5HGDA 2EDFA 3MLSH 4O4YL 1VADA 4PJCF 3DMMB 2CJUH 1B88A 4Z76A 4JFHD 1IM3A 5K9KA 4A6YL 3KPRB 1FVCB 4NQDE 2YA0A 1BZ7A 2VB5A 3OJDA 3IYLW 1AO7B 5CZXC 5GGTA 1X5FA 5C0AA 5EG6C 5B4MC 3MCKA 2Q1EA 5DK0B 1JMXA 4M1DL 4X80L 1LO4H 3RZCD 2WINA 4LARH 1FP5A 6FABH 3LS4L 4KI5D 4ODWB 3KPNA 1VEMA 3S5LA 1RZ8B 4M03A 5IQ9A 4JQXC 2FL5A 3GJFB 3GM8A 4LQ1A 3L9RA 3IFPB 3QEQB 1QD0A 3VE0A 4A6YH 4OLWH 3FO1B 1AD9A 2AP2A 3MV7B 2BVPB 1C8PA 2FCBA 2VLMD 1RU9H 1EEZA 2V9TA 4H88H 3LRSB 3CX5J 1AHWB 2EO9A 2XQYG 4N0UB 5AZEH 3RUGE 3PIQB 1INDL 2UY6A 3ARQA 3HZYA 1IEAA 2NR6C 2NTFA 5FM8A 3P73A 4NSKA 4A2MA 3C8HA 4JREC 3NGBC 1DN0A 4ZYKB 2X4QB 4P9ML 5FXCH 3ESUF 5DJ8B 1O7VA 2G60H 2JCCF 4MNQB 5AWNH 3KLAA 2A9MH 1X6NA 3CFKA 1MVUB 4I0PB 4J1UA 3LH2L 2J12B 1CFQB 3TCXA 5ITBH 4JM4H 1W0WB 3SCMA 1KLGB 1Z0NA 2NLJB 4WW2A 2GY5A 1FVEB 3GMQA 1JN6B 2YR3A 4DW2H 4M1CC 3RBGA 4YC2B 4F37K 2JB6A 4MNQD 4EKXA 2YEZB 1B3JA 3GSNB 3HS0B 3D0LB 5EU7C 1JHTB 5FYJE 1JGVH 4NGHH 1WZ1H 1BGXH 5ILTL 3EZJB 5EA0H 2XXCB 4XZUA 5IBTL 5KOMC 4YUEL 3DX7B 3QH3A 5FFLA 1DBAH 4PRPE 1F4XL 3HC4L 1T20B 2CRIA 3ARBB 5JR1L 4GFTB 1J87A 4H1LH 1R3JB 1XR8A 1BD2E 4I1NB 1W0VA 2ZZUT 5D7JA 2DM4A 3REVB 1U95B 3R8QA 2CGRH 2Z31D 3X14B 2AJSL 1XR9B 4NM8H 3TA3D 4J3XA 1V7MH 4NQVA 4PB9L 4WO4A 4YUEH 4PG2C 1GJIA 4UBDD 3GGWA 4NZRL 4X6DB 4CU7A 3VWJB 1AXTL 5T3XL 3UZEA 5IQ7H 1YEGL 3OTTA 2M2DA 2N7AA 5LCVH 3ES6A 3KPMA 5HYQB 1CR9H 1VFAA 5DEZA 3VI4F 4DZBA 3DUUA 1PEWA 1T04A 2VDQH 4FQLL 4HGWB 1BBDL 3W9DB 5F9WC 1IGJB 5HXMA 2VNCA 1UH3A 3C5ZA 3AM8A 4RGNB 2R4SL 1KJ2B 3DRTB 1KN4L 5C3TA 4R2GC 3SKJH 2Z92A 1U8QA 3K0WA 4S1QH 2NZIA 1H9VA 1LDPL 1H3PL 3SKMA 1DQDH 1CIUA 4XB7A 1WTGT 3FTGB 4Y2DB 4DGVH 5I1HH 5JHDA 3KR3H 1WAAE 3MPCA 4GW5A 1MCSA 5FYLE 1JUFB 5JNYA 5EN2A 5L0QC 1C16B 2APFA 1G7MA 2YRPA 5KANG 5EIIB 3GI8H 2E7BA 2W38A 5F3BB 3AU1A 4ZXBD 5HHPA 5EC2B 1ADQL 4HKJB 4HWBL 1E6OH 5D1QD 4JG0L 2YS4A 3NZHL 4UDTA 4UTBH 1WJ3A 4N8VA 4C56D 4DQOL 2NXYC 5LQBH 4F58H 4I18C 1UCBL 4JO4H 1JGUL 4LHUD 3M1BA 4UV7H 1T3FA 3UYRL 3C5SB 4PGJA 4K94H 4GBXA 3GI8L 3G5YA 5GZNC 5KSBB 3VH8G 3QQ4A 4C56A 2I27N 5GGRY 4YWGH 2V5TA 3KJ4C 4NQEB 1GC1H 2CKBL 5MI0B 4AM0A 1MFBL 2HTLC 4GG6E 3NFNB 2J8UA 2GJJA 5IV2B 2BY2A 1CBVH 3OKKB 35C8L 4OIIH 3PNWB 5HI3D 1JWSA 2FATH 4QRRD 3WO3B 2DQGL 1ZLWK 1JGUH 4UT6H 1NDMA 4QXTB 2VZTA 4TUOA 5E99L 4Z7UA 3RA7L 1U36A 3HR6A 2UWEF 4MJIA 4BJLA 5DYOB 4PJAB 3PL6D 3IJYB 4OGZA 4GW4B 1XCTB 4YXKL 1WAAA 4NQCD 1A2YB 4XVTH 2VISA 1RIUL 35C8H 3CFIC 3KHOA 3V0VB 4MYWB 3GSXA 2BSED 2P5WA 4U33A 2FZ3B 1BEYH 1OTSD 4P4KA 3VMOA 1CXEA 1CLYH 2YPLD 3HG1D 1QRKA 3ILQC 3EOYG 1EEUA 4HGMA 1FNLA 1R3HA 3GSNH 4G9FB 1HOCA 2DYPD 3O6MH 1K6QL 1PYWA 2N7BA 2ADGA 2QKIA 3IF1B 4K7FB 4FXKB 1UA6H 3H3PH 3GMOA 2VH5L 5I17A 3ZKSD 1C7TA 4U1IA 3FQXA 5DHVA 2DYPA 1FQ9C 3BPOC 4XPBL 3V5HB 4RFOH 1U8KB 2BERA 1FSKB 4IRJA 4Y4FD 3TVMC 1QHPA 1OTUC 4G9FD 1ZSDB 3DXAA 3TZVB 4GSDH 2EYTB 3DYOA 3FZUC 4S2SA 4E41B 1NC2D 3RZCB 3QIBC 1KJ2A 4HUKB 4XNXL 5D1ZC 2X4UB 4PGBB 1OP5K 1Z9LA 2AGJL 3MNWA 1NKOA 3C5ZB 4PB0H 2JJSA 1KGCE 1YY8B 4M8VA 5I1LA 3DX8B 4KTDH 3HPJA 2H1PL 5C7XL 4OI8A 4KMLB 3HZMA 4LGPB 1HYSD 5JO5B 4ZDHA 1YN7A 4PRHE 1EMTL 1YMME 2AEWA 3WJJA 2YPKA 4WWKC 3E2HC 3GJEB 3VW3H 3R8BB 4N1HB 2IANB 5DEGA 3GIZH 2ATPA 1F3RB 2HG5A 5JQ6L 4PRIE 2R1XB 3WL9B 1XR9A 3CLEH 4O2EB 5K9QI 3JSSA 5J1AB 2B4CH 4I5BA 1A0QL 3BIKB 5A2FA 4Q97A 2GJ6A 4L9LB 2ICWI 1HHGA 3LS5H 4UILH 4ODXB 4NHUB 3GMPB 3V6FA 3B2VH 1J18A 3AM8C 1E0OB 1CZ8H 1EMTH 5ACMA 4WV1A 1P6AB 5CGYC 4P3DB 3DVFA 4Y19E 4M6NL 4CRPA 3WXWH 3HR5A 1BIIA 1CTOA 3L3JB 2RB8A 3LD8B 5GSRB 4XWOD 3GSNA 1MHCA 1K5NB 2EH7H 2ZOKA 4PG2A 3JWOL 4NN6C 2Y7QA 43C9B 4ODUB 3DVNB 1NUDA 2JTDA 4X6CE 1YDPB 3ARBC 4J6RL 3W9EB 1ZLSL 5B38B 4LQFL 5AEAA 1TVHA 3BGAA 4NWTH 1KB5A 2JE8A 4JANA 4K9EL 5KTEH 3GHBH 2P7TB 4W68A 1HK6A 1P7QD 4ONHA 4S11A 2XWTB 3WUWB 5D7KE 1ZEAH 3QISA 2XZZA 4DUWA 2HJFA 3ZT6A 4LVNB 3EO0A 1QFWL 1CD1A 2V5MA 2ZWLT 2KUTA 3IJSA 1T4KA 3IGAB 1J1OH 4HK3J 5FF6A 5I30H 2NYYC 4I9WD 4OJFH 5F7NC 3MRMB 1ZLSH 1WCBA 3GRWH 4OZGF 4CDHA 4NOFA 5AYUL 1FO0A 2HVKA 4NOBA 1E4XI 1MRCL 3RL2A 4QXGL 4WW2F 3MLWL 2APBA 3MRRA 5EUOF 4PFEA 4Q6YA 4JFEE 4HK3N 4JO3L 3QRGL 4WJ5A 5ANME 3I6KB 3D39D 3WFCH 1MI5E 4X4ZA 2O93L 5E2JA 3SCMC 5C6TH 3N1QC 5ACZB 4YPGB 3LB6C 2GSGB 3WS3B 1CGSH 2EDHA 3PWPD 1VERA 1JF1A 2VLJE 4KXZI 1YYLL 4Z7WA 2MFNA 5GGQL 2EDWA 1G9MC 3BAEL 1RZ8A 3EO9L 4EUPH 4L1DA 3QDGE 4CJ1A 5LB