5FM8A

Structure of the c-terminally extended domain my4 of human myomesin (space group p65)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm8A01
1S7QA 4YO0B 3UTPE 3KPSE 5CILH 1H3VA 2Y4SA 1GZPA 1FBIL 1OP5H 5JR1L 4E42A 4IHOA 1U3HB 3FO1A 4XI5C 5DUBA 5IMMB 2W0KA 4KMLB 1DBAL 4Y4HB 2L7JA 3U46A 5D7LE 5I1GH 4EEEA 5F7UA 4WEBH 3FO9A 1B4RA 5GZOC 3MCLH 3N0PB 5EOQH 5E00A 4LQFL 1CXIA 4TOYL 5C07B 3VXSE 1LE9B 1G0DA 2N7BA 3LD8B 1R3JA 1DBBL 4LCCA 4FOMA 5F3HB 1KENL 2C7UA 4L29A 1HKLH 4M9OA 4W6YB 4PRNA 1KTKE 5KSAC 5T1DL 1FLRL 1KCUL 2DQCH 2PTVA 4WNQA 2P8LA 2GITA 3KLHC 2LABA 3IT8D 3QQ4A 5E6IA 3D9AL 1UWXK 1UZ6F 3HB3C 4NKOA 5CINH 3GMOA 3ULSA 4YPGA 2A6DB 3CPLB 2O5XL 2Z8VC 4CADB 4EXPX 1HE7A 3DX8A 2X7LB 4ONFH 5E24E 5C0RL 1KPUB 1YYLL 4Y4FC 1Z0MA 3VXPB 3TH3T 5JXAL 3I3DA 2CR3A 1MH5A 3ZYJA 3RVTC 3NIFF 4J12A 2DDQL 1HZHH 1MCWW 4YEEA 5IB5A 3QSKB 2EIZB 5AUMB 5FYJD 4H25B 3HZVB 4NIKB 2EDRA 4ZUWA 3IDIA 1XZ0A 5GZND 3DHMA 1T03H 3GMLA 1I9IL 1S5IH 1HSAA 4FA8A 3MRRA 4OLYL 1AXIB 3WIIH 4OD3L 4NRZB 4R90H 2DL9A 3S35H 1A5FL 3HE6D 2APBA 5JHDA 1IGIL 4NNYB 3QUXD 5EZIH 5I8KL 3UZVB 4YDLB 4HZLB 1F00I 5GRJH 1FCCA 2E27L 4NUGH 4C4KO 4Q9RH 1SYVB 3BI9X 3ES6B 4IRJB 1A1OB 4ZODA 4NKMB 5T3ZD 4Y5XB 4UIKH 3QEUA 1D5BB 4MA1C 1RZJC 1OLLA 5TGBB 2V5MA 5L8JB 3O6FC 1HI6B 1G7JB 1OQXA 1C5CL 2YPVL 4LOUC 4FXGA 5HGAA 1F90H 5GJSL 4LLDA 3LSOB 2PF6A 4PR5A 2OZ4H 4KKNA 2GFBA 1JWMA 1FH5H 1TZIA 3MODH 2IANE 1CD9B 3T0WA 2CUMA 2ITDA 3WL9A 3TH2T 4PJAF 5ANME 2XKSA 2IJ0C 4JFEA 4OSUL 1WAAF 5C08B 3JWOL 2DQTL 3JUZA 3RGVA 1NEZG 3BH8A 1XGTA 3OKLA 3H2WA 4X9BA 3WSQL 4XNMB 1Q72L 4P2CG 4YHZH 3X3GH 1N59B 4PLJC 3BUYB 3CX5J 2XZCL 3QXTA 1Z9SA 3GMQB 1G84A 1HILA 2WANA 2I5YH 3SGJA 5CP7B 3MV7D 4NFCA 2C3VA 2IAMD 5HHMB 5EPMA 2YPLB 1JGUL 1T0NA 1YEDB 5DJXB 1YNKH 2AK1L 5DSCA 4I77L 4XCYA 2MOVA 1UXSA 1J10A 3VXOB 1MFNA 3MGTA 1RK1B 4M48H 1FC1A 4Y16A 3H9SB 1A7PH 4O2EB 5IEHB 5B8CC 1OT2A 4PJ7A 3HPLA 1U95A 4JM4H 4OF7A 4L5FL 3CZJA 3AS3A 1J86A 3WXVL 2W92A 4ENEC 4N0FB 3MNZA 4YHMH 3HC3H 3R0NA 2D4DA 3LZFH 3S4SA 4Q9CA 3UYOD 3GSUB 1MCOH 1X5LA 4NKIH 1NBZA 4OIBA 5MENA 2F53A 1T83C 3AREA 1IGJB 3S3JA 1OGAB 1CK0H 4XCNA 4CW1B 1DN0B 3TBWB 2I07A 3IFLH 4J3WA 3QCUL 1R6VA 1XR8B 4NBZB 3SY0A 3TIEB 1KULA 1NBYA 4FG6C 4QRRA 4UUJB 1ZS8B 2ICWA 3HR5B 3RIAK 3DURB 4FQHB 1XIWC 3ZKND 5GS0H 1AHWA 4I1NB 1F6AB 2J3SA 5ISZE 3G5XA 3IXAA 2X4UB 3IU4L 2V2TA 4I2XA 2CRIA 3GMNA 2PKDA 2CIKA 1B88A 8FABA 4X5WB 2ZSWA 1FRGH 5C09D 2AEPL 5AZEH 5T1KA 1J1XH 2WUCL 4L9LA 5A2JH 2J8UA 4F7TB 4LCWD 3N50A 1CIDA 3BP4B 3BRFA 4JREC 4PJIE 4XBPA 2G75A 1IEAA 5C0BB 4RFEB 3NTCH 3FT3B 4NHCH 2H32B 1XGYL 1CTOA 4QHMA 4YIQA 1MRCL 4RBPH 3MRIB 3MLTB 1L6XA 4D9LL 1J1OH 1SJHB 3IB4A 3QEHB 4FXLA 5EBWA 1AD0A 3OKNA 1KCVH 4LLAA 1YPZE 4XCCL 4S10A 3BGFB 2JE8A 2P47B 4JPKH 1P84K 3SKNA 4FTVB 1EHLL 5JW3H 1UM4L 1OAZH 2JJSA 2R0WH 4GG6E 1HH6B 1RIVH 3M8OL 4JDTH 3HCVB 4M5YH 4OGYH 2IH1A 2Q3AA 2X1XR 4PRHA 1DUZB 3ARBC 4HJJH 5F3BA 5L9DL 5GJTL 4QRUB 3G6JF 4OT1L 2AJSL 2CDFA 3BN9C 4CDGC 4ALAH 3BXNA 3O6MH 5D1ZA 4PY7A 4QGTA 2L7UA 1I9EA 2X4QB 5F1NA 2BCKA 3ZMRA 2VXUH 1LO2L 2NXZC 4I48B 2UYLB 2R69L 2DM3A 1FO0B 5CEZL 1KF9B 1TCRB 5JW4N 2OI9C 2DJUA 1J8HE 3JWOC 1KN4H 4KY1L 4LF3B 5HDOA 4D8PB 1T7VA 2JJTA 4ZUSA 4NN5C 3VE0B 5A3ID 1F11A 3D39D 3JWDL 3OKOB 3RZCC 3EYFA 3X17A 1FZKA 2XA3A 1PKOA 1KIUA 4EOWH 4X4XA 3VJ6B 5CBAA 2Q76A 5CEXB 3EYUL 4ZXBA 3WHE0 1EEYB 1Q1JH 2X4OA 1CVSC 3ALXA 4PTUA 3TO4D 2B4CC 4WO4C 3D0LA 4ZYKB 4MWFB 4OTXH 2YBRB 2W9DH 4X8JB 1JHTA 3ZHKA 1IAOB 3P77A 3MJ9L 1CF8H 2ZCHL 3NIDE 2EH8L 3OWEA 3RJQB 3VGBA 4U2YA 1Q0XH 3FQTB 3UJJL 4PJGA 3BJ91 4HMDA 3RTQD 1EFXD 1S7TB 1UADC 3MZGB 4TNVK 4YE4L 1QPPA 4R0LA 5IG7B 5J12C 5CZXD 2XICA 4RGMC 1JTPA 5EOCJ 4DKAA 1OL0A 1U8NB 3PWPA 4G6FD 4DK3A 2B0SL 1NDMB 2W91A 4Y2DD 4QO1A 5EZOL 4HJGA 4KK5D 1AGFA 3IDMB 1N2RA 4X6EA 4RMTA 5DEZA 4P2YA 4EZMA 3SKMB 3HZYA 3PV6B 3ZDXE 2XPGB 3FQRA 5DD1L 1QFUH 5FOJA 4RGNC 2AJ3A 1IC4L 4OZ4B 1OW0C 1S3KH 3FRUB 4L4TE 1KFAH 3GB7B 3ARXA 5SWQA 1MEXH 1CZ8L 5KS9F 4KDTC 4JFOA 4PG2C 1A6VH 2XTLA 1DQJA 2EDQA 4O4YL 2P1YA 2PO6B 3LMJH 5EC1A 4FQPA 5FK9A 3OBAA 2NY2D 1I8KB 3FQXA 5HTSA 5FB8A 1T4KA 2V9QA 4JZOA 1R0AL 4DN4H 2A83B 3QRGL 3VFVA 1K8IB 3P2TA 5IMOB 1LGVA 5I17A 3GSNH 3O2VL 3HE6B 1H3PL 3QIBD 4OLXL 4X98B 3QUXB 2PXYA 1W8NA 4DUWA 1TZHA 5FF6B 5T33L 4M6NH 3MNWA 4MD5A 5MEPB 1CDJA 2HVJA 1BQHB 1KEML 4M43H 3MV9D 5E2WL 4HS6B 4G7YH 1RZ8B 1BZQK 3QUKB 2B1AH 4XP9L 5L7XL 3DUHA 3DRTA 1U3ZA 3B9KC 2CD0A 4WI3A 3TP4A 1GL4B 2AEQL 3DX7A 4LCYA 5DD6B 3SPVA 1NFDB 1GGCL 3NA9L 4JN2A 4Z5RB 3C5JA 4QLRA 2Z93A 4OCWH 4YXKL 1LNUB 1FFRA 4IDJL 2AJVH 4M7KH 1FNEA 1QBMH 4P4RA 4M1CD 2IH3B 5I76A 1LEGA 4YHKL 3MV7B 3MUZ1 2IAMB 4IDLA 4NZTL 3DROB 1ZANL 1M6OB 3RI5F 4BFIA 3LRHA 5F7MC 3BZ4B 1QNZH 4MA7L 3OKKA 1UH4A 3CMOH 1LD9A 4HK0A 4DQOH 3FO0H 5ERWB 4M03A 1N5YH 4FABL 1BBJA 2AK4E 32C2B 4NO3A 1NGYB 1IBGH 4OQTH 5EU5A 2R1YB 2PYEA 3B83A 4OI9A 4WI8A 1U8HA 4XCFL 1IZKA 1F3DH 3UC0L 5E5MB 5JPMB 3CDGB 1T5XA 3VFMB 1EIBA 3W2DL 4HUVA 4DKFL 2DTMH 2CJUH 2GJJA 5C0DA 5GXBB 2OL3H 3GIZH 3GSNA 1FYTD 3JWDC 4XP1H 3G5YA 4JKMA 1GGIH 1I7UA 1OOAA 3T0EC 4L3CA 1L0XA 4JY5H 1PKQB 3K8KA 3QWRA 4HV8A 1UEMA 4QXUH 3RNKB 4PV8A 5HVFB 2Y06L 3VXME 5F7EH 1KEGH 4Z7UA 4G9FE 5EIVA 5ID0A 2AJXH 1TNMA 3RWCA 1TETH 1D5ZA 4ODUA 1VHPA 2XZQL 1OSPL 4XBGA 1UZ8B 3LAFA 1J0ZA 5EO9A 3SQOH 1DLFH 1OD9A 3F7PC 3IVKB 2QSCH 3ECBA 4YNYA 5I75B 2QSTA 5C0JB 1IGFL 4OGXH 2F5BH 4WUUA 1QACA 3PXHA 1FORH 1XCQB 2ZKHH 4HPYH 3VFUB 1A7OH 2B2XH 1S7SB 1TVDA 5C09B 3NFPB 3I9GL 4YHNA 4NM8H 5BRZE 4OV5B 3WFDH 4CL7A 1OVZA 4JZJA 3QFJA 4LCWB 4MJID 4OCXL 1BFOA 1FJ1B 4X9HA 1WT5A 3VCLA 4WWKA 4DN3H 5FDWA 3KNBB 4XNQA 2OTWA 1T7XA 1CU4H 5F1KC 1CFQA 1GGTA 2VZTA 4JGUA 4ZTOL 5T3XE 3H3KA 1A7NH 1GRWA 4HFUL 4MAYA 4QOKD 4M1DH 1A4KB 5EO0A 4JAMB 4IOIB 1JBJA 4NHUB 3PGCB 4KV5F 4RRPA 5DJCA 4JKLA 2ITCA 4M61A 3E6HA 2R1WB 3L3OA 4JANB 3KLAA 4NO5B 1UACH 3BFOA 3W81A 4K8RL 4HKBA 1FFNA 1R3KB 5BS0D 4M1GH 3W0WD 4BSVA 1LE5A 1VEMA 1KACB 3VD4A 2H26A 3E2HC 1NCBH 3HE7D 4ZPVB 1F4WH 1OM3H 1IGYB 1UCBL 4H8WH 4R96A 5IOPA 4RISH 2IALA 1QSFA 3FFCE 3LN4A 1S78D 3DV4B 4OLWL 2A0LD 2VDOL 2IADA 2YA2A 2YD8A 4G6ML 4U6TA 3EDFA 3GK8H 1FL6B 4Z95H 2DWEA 4GSDL 2CXGA 2QQLH 2VLKD 3FB5A 3HUJB 4S1QL 2H8PA 4U0RB 5E8EA 5SWZD 3WHE1 3TLRA 4NQSB 4H1LB 1JZ6A 1CE1L 1NL0H 1YMMD 5CMAB 4PJDB 3V9FA 4U6XA 3DGCR 1PY4A 3TM6A 5FO7A 1FNAA 3V5HB 4RCAA 2OP4L 4MD4A 5AG8A 3D39B 1FVCB 3S96B 4FZ8H 1PEWA 4TVPL 2EICA 2VLJE 4BH7B 4BSWB 4QHKI 2BSSB 4PGBB 4OF6A 4PYGA 2E6JA 3TO4B 5JQHC 4MXVE 2A6KA 3BRDA 4X4MA 2CH8A 3BKYH 4HBCL 4OFIA 4UAOC 1N26A 1QQDB 5DFVC 5DS8A 3QDGE 4S0TD 3RHWK 3RTQB 3R1GH 2W9LA 4P5TC 1SJXA 3VFRA 2O61B 1EFXB 4MS8C 3QIUC 4JKWA 2DI7A 4LLQA 5KW9H 3TBSA 1K4CB 1V3JA 1YEFH 2XWTB 3WD5H 3S36H 4F37K 2GTWA 3ROLB 3DLQR 4RIRA 3I02A 5I8EA 5I8CA 4KQ3H 5FA3A 4Y2DB 3GSRA 1MY5A 4X6DE 4DWHA 4KRPC 4X9IA 1X5XA 5EU7C 5DT1L 2CDGA 1JV5A 2NY6B 4J4PD 1E6JH 4B50A 3LB6D 3AFLA 3IYLW 1JCKA 2X9XA 4JRYD 3AAZA 4JQIH 3EO0B 5F6HI 3K4ZA 4EI6B 5B3JF 1AO7A 5KOVC 3MXVL 5DEGA 5EFIA 4BUHA 2DICA 2WINA 5IMKB 4AQ1B 5JLZB 4DOHE 1NGQL 3IFNH 1QTYT 2ENSA 5IVZB 2LTQB 2NY2B 2Q87A 2A6IB 1AH1A 1MI5A 3OXRA 4I18A 4LIQL 3D85A 4NQCA 1PZ5A 3TN0A 5D1QA 4WENB 5D1XA 1INEL 1WEJL 1AP2A 3QIBB 5GRVK 1JTOA 3MFGB 2XTJC 4UOJA 4JM2D 1CDHA 3O8XD 2BDNL 2X4PA 5LGHH 4U7KA 3NABL 4ODTH 1KCKA 3BPOB 3GEWB 1F42A 4O5LL 3RBSA 4U1LA 1Y6NR 3AC0A 3MV9B 4Z7OF 2MQ3A 4WFEE 4PP2B 4PLKD 5KVMC 1MWAH 2DLEA 2J6EH 1H5BA 2GJ6A 3PWLB 4YDVA 3TV3H 4DGIH 1ZTXH 3MRKA 2ADGB 2F74A 1FPTH 5DUMH 3GSQA 2WW8A 4K8RC 5E99H 2BNRD 2YR3A 3DXAE 2F15A 4QT5A 3BEVA 5DJDB 2C3XA 5CJ8A 3EHBC 1JK8B 3BP6A 5ICXB 3B6SA 3CU1A 3MA7B 2E9BA 3MA9L 5ALBH 1MIEH 4GW4B 4LRNH 1IM9D 3RAJL 3VWKC 2HWZH 3SDAD 3WYRA 2ZPKH 2FGZA 5JOEA 2NYYD 1OB1A 1T04B 2WWKT 4X9FA 2YS4A 4PRDA 1I1YB 2JJWA 4J3UA 5C3LD 5I1KH 2Z91A 1EHNA 1NBVH 2RQ8A 1TVBB 4Q6IA 2Y5TB 2HP4A 5FGBC 3KYOB 2ZZUT 5DRWB 4MSWB 2ESVA 3ARDC 4EIGB 3VDBA 2BOBB 4KMTL 1R24A 2EDYA 5DA0B 1PQZA 2W65A 1P9MC 4PRPA 2JCCB 3M1BA 3BDBA 3WUWB 3TJEL 5GSVA 3MLZH 1G0YR 1YYMH 1FYTB 4NOBA 1Y6KR 5TDNA 1G6RL 3L95A 3U7WL 4XNZB 3QNXB 1FL5B 1MHEA 4XGZB 4XAWH 4XNXH 2M8XA 1X5IA 1UQSB 3WS3A 5JTWA 5GRVL 5FA4B 2PR4L 3V8CA 1YEKH 1TJIL 3QQ9D 4QRPE 1KT2A 1P7QD 2NPLX 3KPMA 5D6DA 1MWAA 4KJQD 3S35L 3G5ZB 2HVKB 2J6EA 4MJ6A 5EZIL 5DRNB 3A6OA 3ALPA 5DHVH 1F13A 5GRJL 4ODSH 1QSED 3UP1A 1T1YB 1T1WB 1JPTH 3QG6A 4DK6A 3V6OA 5I1AB 2NNAB 4NKQB 3GM0A 4GKOA 3EO1A 3L3HB 1HHKB 3LKRB 3B2VH 4LCCC 2OQJB 4HT1H 1FCGA 5CHNA 4JVWA 1GC1H 4RFOL 1MCJA 2UZYB 5FHBL 3UPRA 3NACL 4AENB 4PPTA 2B5IB 1XGQB 2Y72A 3TPUA 4MJIB 5D7SH 3L9RA 1U92B 5E6IC 3MXWH 4TN9A 3C60D 4HWBH 3AROA 3MYJB 1J11A 1D6VH 4X6BB 1CTNA 4PTTB 4ZFFB 4YHZL 4LHUA 3RKDC 4QOKB 3GMRB 2FRGP 1T2QL 3T65B 2WV3A 2VAAA 2CGRH 3UEZA 3EJYD 3RPIB 1TJHH 5KSBB 3C6SA 1Q9WA 4O58H 4PJEE 3V95A 1KLGB 5BS0B 2CLVA 1EV2E 2XN9E 3W0WB 4XZUA 4HGWA 3HG1A 4LEOA 5SWSD 5D2LA 1SHMA 5FO8B 1F58H 4PJ7F 3HE7B 2VQTA 5HHOA 3MBED 3BJLA 1ZK9A 3MLXL 4DCQA 1IEBB 2VB5A 4JM4L 4ELMB 2C3HA 2HFFA 2VWEC 1U93B 5GGSB 4L3EA 3OB0K 4AY0A 4D3CL 5FYKE 1WC7A 1LEIB 5DHVA 3LZFL 4WDIB 2VLKB 3KVQA 1MCOL 4NO2B 2VXVH 1VCAA 2OR8A 4HJ0C 5SWZB 4JN1L 4H5SA 4RZCA 4ZUVA 3HMXH 5TDOB 5HHVL 1NGWA 1KSRA 3U36A 1EHAA 2XWBB 5FV2A 3PP4H 1HHGA 3WFHA 4M7ZB 1YMMB 4JFFD 3QULA 1IQWL 4BFEA 4LAQH 3WNLA 5D7JD 1EEZA 5CJBA 1N4XH 1BQHG 3I6KA 4M4PA 4ODBD 2VR5A 4JFZL 4NQDE 2FB4L 3LPWA 1S8DA 5C07E 4F7CB 3O3DA 2ADFL 5F7NC 5IWLA 3BZFB 1RUKL 2AXGB 4G8FB 3RGVC 3EOTH 5CP3A 1DBKL 5E4EC 3W39B 3MOBH 3IKKA 5KTEL 4HMEA 4JFPB 1J05B 4C56D 2J8UF 2I27N 1J1XL 4N0YL 4YBLC 4WW2B 1S9VA 3UPAA 5I2IA 1WBZB 1EAJA 2R8SH 3BO8A 2VLRD 4TULH 3ZYIA 4N8VA 5A16A 1A6WL 2OTUA 3VXQB 1QR1A 5FYLH 5ITFB 2OTPA 5DVMA 3QUYD 2RHEA 4K9EL 3QH3A 1J1OL 2P24A 3Q5OA 3SKJH 1A9BA 1JZ5A 2R1XA 3BWAA 4LBEA 3PGFL 1YNLH 4OF3A 1F8TH 5IB2B 1ACYL 3IFPB 3OAZH 4GAYA 1AD9A 2ILLA 3IJSB 4CMMA 4JRYB 1JWUB 4IS6B 1MNUH 1SMAA 3UDWA 4PD4K 2BNQE 1NGZA 5E8OA 1LO5B 2H2PC 1JRHH 4UT6H 3V4VH 1BZ9B 2R0WL 4JRXE 3GSVA 4JO4H 3RUGE 4WVRA 4LLMA 4F57L 2MWCA 4XPAL 4LHQB 1MOEA 3HNVH 1DJSA 5IVXE 2MHAB 4XPFL 1E28A 4HJJL 3HMXA 3AREC 1IGCH 4IJ3B 4EIZC 3BYTA 3FOMB 3L3JA 4ALAL 3O6ML 1DL7H 4P0DA 1ZHKA 3SGDH 4M6OL 1RZFL 4XRCB 4YPJA 4NM4H 3QXAA 5BV7L 1GIGH 4UB0H 4WHTB 1XF2A 4PJFB 5EIQA 1P84J 4AH2B 1AHWC 2GKIA 3BP7B 4DUXA 1C1EH 1KJMB 5T1MB 4X6CE 3WEXB 1NCUA 2X42A 5GS3A 3F8UB 4WTZG 1IJ9A 3MJ8A 4L9LC 3I6GA 4Z76B 5GRYA 4YXHL 2FHBA 4P46A 3CVHB 2VLLA 3J7HA 3QB7C 1Q1JL 1VB9A 3KJ4C 4LSVH 1U9KA 5FO9B 1JPFA 2BNRB 3PWJA 2IG2H 5GGRY 1WSST 2FYYA 2XRAH 3KS0J 2QADC 2X4NA 1XCTA 3DVGB 3DJ9A 2XY1A 5IJVA 3O11A 1RZGA 1SBSL 3HNTH 4PJGF 2HJKB 2UUDK 4YC2C 2RFXA 4HKJA 1IM9B 1N6VA 5L88L 3ULUE 1OAYH 3SDAB 1T0MA 2DQJH 4JFDE 1MQKL 3OKEA 2QKIA 1CXEA 3FQWA 1E6OL 1BEYH 1JNLH 2WQRA 4YDIH 5GISH 1MFAH 4HWZA 4N9OB 4DZ8A 4FQXD 3KPQA 3TO2A 3M17A 4P3DB 1M71A 2JJSC 3U6RB 3CZFA 2ZOKA 3GZKA 1S7WB 2P8MA 4GS7C 4LSRH 5SX5K 4UOW1 3LY6A 1D5XB 4HW6A 4J1UB 3P4NB 5ITBH 2ICEA 2DQDH 3RU8L 2AKRA 3K2UH 3K8MA 3AMKA 5L2KE 5EUOE 1QFUL 1UYWH 5D1ZC 2EDNA 2FEDD 1MJUH 1DQLH 2JIXA 5JW4Q 2KDGA 1I8MB 5IBTH 1JGEA 1C8PA 2X89A 5KVDH 4FXKA 5HYFA 1KFAL 3P0YH 1DTUA 1MHHB 4X5XA 3RVUD 2JK5A 4XNUL 5GS0C 1G7MA 1I7RA 4MMZC 4NYLB 4QTHA 1A6VL 5DJ0A 5HVGB 3KXFE 1TXKA 5HPMB 2VISB 5LXGL 4GRWE 4Q2ZA 2AJZB 3OAYK 1TQCC 3MUGA 3U7YL 4F7EA 1FVDA 1LDSA 3T1FB 3AY4A 2EKSA 5DF0A 2JJTC 3FO1B 1CI5A 3U46B 2YEZB 2A74B 4NSKB 5B39A 3L6FA 4YBQC 4RFNC 3QJFA 3U0WL 1QA9A 1QSEB 4ZXBC 3IDGB 1AGEA 1CLZL 4N0RA 5D8JH 5FM5M 3VXUD 3JV4A 2RJMA 3DVNB 5LWYL 1HHJA 1AE6L 1WBYA 1I9JH 3Q6GH 5ELIA 1LEKA 4G7YL 3MRGB 2B1AL 2UZIH 4OB5L 5C0FA 2YC1B 2XYCA 3QQ4B 4R0LC 2IPTH 2W60A 2BJMH 3O3UN 5JA8B 3O41B 5ICYA 1JGLH 4KHTL 3C8KB 1KIQB 3C60B 5BZDA 4JFXA 4BUGA 5M7QA 2Y7QB 4KKCD 4HULB 3DUSA 3QXUA 3E6FB 1WWBX 1TDQA 4EDWH 5EULV 2YPKA 4UDTA 2OK0L 1T89A 4ZUTA 3UTTD 4M7KL 1EAPB 3IRZA 4PREA 3MLSL 5CWSB 5IBLC 5DWUH 3U4BH 1NC4D 2DL2A 1CQKA 3GJEB 3ZO0A 3ARGA 4KAQH 5BV7C 1JHLH 2KKQA 2I9LA 4ZUWB 5CLTA 1DUYB 2V5YA 3IDIB 4DQOL 5SWSB 1IKNA 3CIQA 4BKLB 5I66A 5DC9B 1G9ML 3MBEB 4XCEA 1KJVA 5C71A 3OZ9H 4P5MB 5D71H 4L8CB 4XHJD 1MJJB 1FAIL 1F4AA 5MEQA 2YD6A 3BSZH 4TYUA 1INQA 2DLFH 4HH9B 4GMTL 3SGKA 1R5WA 2PXYC 1NAMH 4F15C 2F8VA 1A14H 5MERA 1FZJB 1GGIL 2BVOB 5INDB 1QLEH 3QEUB 1CG9B 3CK0L 2GJZA 1GJIA 2XNAB 2O26U 5TPWH 4FXGB 4Z7UF 1AGCA 1DEEB 4ZPTA 1KEGL 5EB9A 4OFYD 1DQQB 4PJ9A 4LLDB 1OAKH 2UVEA 2E8ZA 4JFFB 4GAGH 1UJ3A 1MAKA 5D7JB 4PRID 3O3EB 4KUCD 3D1MC 4EN3A 3P0VL 2H6PB 1E4JA 5T5NG 3SQOL 1DLFL 2OR9H 3HNSH 3V6ZB 3PWUB 2QSCL 3C9NA 2XKUA 1NEUA 2FX7L 3Q48A 1YECH 2DMKA 1HNGA 3H6JA 2NY7L 1BVKB 2V9RA 1FORL 2FWOB 4C83B 1GYAA 2P8PB 4YHIA 2B2XL 4PS4L 4Y19D 2BRRH 4C56B 4YEFA 2AV1B 5HD8D 3TVMA 4IRZH 2C3VB 1CDCA 1CGWA 3MTRA 1RJZB 2G2RA 2VLRB 3OKDA 5FFLA 3VFGL 3H0TA 2D7QA 3SBWA 5J7CC 3BH9A 3D3VE 2X70B 3BVNB 4Q9QH 3WO4B 2WSKA 3QUYB 1Y18B 5HYSA 1HIMH 1QBAA 4M1DL 2V5RA 3LN9A 1F3JB 5IW1A 4P9MH 2F8XC 4X99B 4W4NA 1MCLA 5T1LA 3F7YB 1CGXA 4RA0C 4LSQH 2ED7A 4NQXA 2EDOA 1BQLL 5E9DA 3BQUA 1UACL 1HQ4A 3FQNB 3DI3B 3QDMA 3MROA 3V6FA 1U8IA 1NAMA 2FATH 5MP6H 3MUY1 1FGVL 4QYOA 1NCAH 5E08H 4OZIB 3WUWG 1F4WL 2X4TB 3V2AR 1I3RA 2I07B 3MOAH 2CKNA 5JZ7C 3TWCL 5D9SB 1KPVA 1W0VB 4GAJL 1C08B 3GK8L 5ACLA 3K80A 1TQBB 1VADA 4KHXH 4M93B 3G5XB 4DJMA 3IXAB 3LKNB 2V2TB 3GGWA 4F9LA 4MMXC 3MRBA 3QHFH 2HFEB 2HT3C 3KPNA 3PHQB 2E6PA 8FABB 1N6QH 3QQ3A 1T20B 3KPOA 3RNQA 2DQIH 1JWSB 2NX5E 5DJYA 2EO1A 1FL3B 3PIQA 5DO2D 1G7HB 3V0VA 3P11H 4K3EH 4P2QE 3TT1H 1T5WA 2J8UB 3UZEA 4GO6B 3UO1L 5TQ2H 5AWNH 1WWCA 3DBXA 1DBMH 5IHUL 3B8SA 2KUTA 4JZJC 2IMNA 3T2OA 2CSPA 1LP9B 1IEAB 1S9WB 4L8SA 4MB3A 3MV01 5AG9A 1UZ6E 1IZJA 4IBLT 4WWKC 4MZ3A 4Q0XH 4NUJA 1N0XH 4UTAH 3BEWA 4RQQA 5CJOL 3BKCL 4XHQA 5DRXA 5ENWA 3MRFA 3TA3D 1SM3L 1QHOA 5B38G 4XP4H 1MVUA 4MAYC 1D5MA 4LARH 1Q0YH 7FABL 5ID1A 3QWOB 1V8HA 1G9MC 4LPUA 4G8IA 1NDGA 3C87A 3R1GL 4E9LA 3HTLX 4JPIB 5BOZG 1R5IB 1T22A 3KAAA 1NMAH 3T2PA 3MCKB 4D0BB 3NIFE 4P2OA 4DFHA 3GKZA 2FHCA 2MJWA 3T77B 2N56A 3WD5L 4ZD3H 3S36L 1DZBA 4FQXB 3BZEB 5CGTA 3MLWL 1VGEH 3MJ7A 3QI9D 5CJQL 2X10A 4G8GD 4JEGB 4AZ8A 2H3NB 2XKNB 4KGJA 1IILE 5DVOA 2OLDA 1CICA 3MRMA 3OHXB 4XPHH 4ZO7A 2OXHA 2CDFB 1X4XA 5JDSB 2HTKD 1TTFA 1NJ9B 1ZT7A 2B39A 2ZOLA 5I74C 4PY7B 2FJGA 2R29L 3PABA 2XQYG 4WTWA 2CO6B 1MJ7L 5GS2H 3NFNA 2CDEA 1TNNA 5LGKA 5K9QG 1CGVA 1H3TA 4GW5A 1KB9K 3IFNL 3IKCA 4NT6A 5DJ6A 5DFTA 4GMSH 3V5DA 1MCPH 2GUOB 4N1CA 4DUVA 4G6AC 1HKFA 1AQDA 4OLVH 3KPRD 4Z77B 3MLUH 1P4LB 1BP3B 3O3AA 2R2HA 5DDHA 3ZTJH 2HN7A 2GY7B 3SO5A 3C6LA 4Z7VA 5IF0A 4FQ1H 1F11B 3A6CH 3EYFB 1FZKB 4NCC2 1CFNB 5LCVH 2VKXA 4PJAE 3CFJB 1PG7H 4AEHL 3KYMA 4PTUB 4X83A 1WAAE 2AABH 3QHZH 3LDBC 1MJ8H 4K3HA 3VXUB 1S9XA 4YO0A 3P77B 4J3TA 5F96H 3PNWB 1DE4A 4ZFZB 1N64H 1MWAL 2UZXB 2HTLD 1U3HA 5IMMA 5FM5O 3EZ8A 1FPTL 4I3SH 2EEDA 5E99L 5H37H 5JOFB 4O9HH 2VXSL 4EJ1C 5FECB 1LE9A 3VG9C 1AGFB 4X6EB 3LH2L 5F3HA 1MIEL 4H8WC 1J9CT 5D5MB 3UTTB 3MLYL 4BQCA 3ROOB 4KZEL 3CCHB 1NC4B 3IDUA 3DYPA 4K7PH 4OCRL 1HOCB 4OI8A 3OAYH 1NBVL 5FUCC 1U8JB 4YK4B 1BMGA 5FUOH 3FJTA 3FQXB 4R3SB 2ID5A 4PY8I 3W5MA 2A6DA 5LGJB 5FB8B 2JLLA 2EYSB 4I18C 2X7LA 5DQJB 4R2GD 5I30L 1G7PB 1CLYH 1KPUA 3VXPA 3TN0C 1VKXB 5D1QC 5D1XC 3TCLB 3OSKA 1ITCA 4ETYA 1EH9A 2QLVB 3VXRD 4JFQB 4Z7NF 2EDBA 1UM5H 5AUMA 2C3WA 4H25A 2H2SC 2J8HA 3HZVA 5AYUH 1MFBH 4XAWL 1LDPH 4XNXL 1FG9C 1Z0NA 3NH7H 1YY9C 4Z0BH 4TPRH 4AMKH 3W11C 5HDQH 1UVQB 3RY5A 1YEKL 4G6JH 4Y7MA 3T4AB 2GJ6D 4PGEB 3VW3H 1S7UB 1H5BC 4CVXB 4NRZA 4PRIB 3WJJA 4NNYA 4HZLA 4UMGA 1JPTL 3DX7B 1T80A 1SYVA 2WK2A 3ES6A 4IRJA 1A1OA 1W2KT 4B53A 4NKMA 2J4WH 4XH2B 4LVHB 4Y5XA 1VGKB 4Z0XB 1D5BA 3LV3B 5TGBA 1LQSR 5IUSA 1HI6A 1G7JA 5BO1H 1GC1L 1FNEB 4V1DE 5I1EH 2Z8WC 4Y19B 3F12B 3N1MC 2OM5A 4NZUH 4ZS7H 4TTDD 4YDKH 5J57B 2PW2B 3IJHB 3ZL4H 3MXWL 5CUSH 5D6CB 5GSRB 2GI7A 1ZEAL 1OWWA 3Q5TA 1XF5B 2BVQA 4UTBH 4Q6IC 4HK0B 3WFCL 1FQ9C 5C08A 1D6VL 5SX4H 3JWNC 4LEXL 4R4NC 5DK0B 3T2NL 4XNMA 1V3KA 1EUUA 1BGXL 4NGHH 3KYNB 5IQ7L 3NCMA 1N59A 2R2BB 1U8HB 3LCYA 4P4KD 3G6JE 4RGNE 3G08B 5IM7B 1NCWL 3GMQA 3WKNA 5GRUH 5FYJU 2R9HC 5DQDH 5C0DB 1K85A 1JZ7A 4MA8H 1JGDA 3U1SL 1CGYA 3O2WL 3VRLF 2NR6D 5D2LF 5DMJB 2H32H 1J7VR 3QISA 4JZNB 4JO1H 3VXOA 3SDDD 2Z92A 4HV8B 1UM6H 25C8L 4PV8B 1RK1A 1RAMA 1L6ZA 3H9SA 4XVTL 5IEHA 1MVFA 2ORBH 3MRQB 4U1SB 5CSZB 5TE7L 2V2WB 4XVUD 1F5WA 3P30H 4XX1G 4NFBA 1HINL 4OUUA 4MD0B 3QEQE 5D6DC 2LQRA 4NZRH 1BQUA 1RUPH 2NQCA 4N0FA 3HN3A 1SY6A 4FFZH 4JDVA 5EO9B 1K9TA 5GGQH 3ECBB 5KANG 5KJRH 4YNYB 1FNFA 2FX9L 4Y1AD 2VXVL 2VTFA 4FP8H 3V6OC 3VXTB 3HMXL 2GAZB 1KCRH 3HI1B 1IGJA 1LO3H 5F70A 3OL2A 1OGAA 1VFBB 1DN0A 3TYFB 3TBWA 3SO3B 4YHNB 1W72B 5I9QB 5EU6E 4APQC 5F93C 2Y5EA 2NZ9C 5CZVH 1XR8A 1N4XL 3TIEA 2GY5A 4UUJA 1GOHA 1ZS8A 2EC9T 3HR5A 3DURA 4FQHA 1OP3K 4ACPA 1F6AA 1AGDB 4PGDB 2X4UA 4Q58C 4NRYB 3EOTL 2ZSVB 4PJXA 3TA3B 1DN2A 1W0WB 4X5WA 2F54D 5E6YA 3GSOB 1AQKL 5J3HD 4I9WE 5DHYB 1B0GB 2R8SL 4F7TA 1D6EB 5GGVY 4TULL 3FHQA 3MUJA 5E8PB 3BP4A 2FBJH 1FFNB 4DTGL 1T0PB 4O02H 2OL3B 4DKEH 3RIFK 4EUPB 4P2RD 5JW4R 3WDIA 1JZ8A 5C0BA 5D7IA 5CEZE 2E7BA 5KS9E 3L3GB 4RFEA 2R2EA 1LE5B 2H26B 3RVXC 3FT3A 2H32A 3QI9B 4G8GB 3MLTA 1UWEH 5J13C 4R96B 1SJHA 3SKJL 1LVEA 1NLDH 2W1NA 3QEHA 2YKLL 3LN4B 2WNGA 1V05A 4KRMB 2QHLA 3U0TB 1FIGL 2IGFH 4M6ML 3VG0H 1PYWB 4MDIB 1LWRA 4POYA 4NQVB 4FTVA 2YXMA 1C16B 3T0EE 1UKTA 5BXFB 4JO4L 2AI0L 2XTJD 3IDXH 2BVTA 4HCRA 1HH6A 2FH8A 2Y07L 3HCVA 3DX6B 3EYVB 3ZDZF 5T3XL 4E41E 1DUZA 1QFWI 4HF5L 4B41A 3CFEB 3REVB 1P4IH 4BQBA 1JN6B 3KPRB 4QRUA 2LU4A 4K2UL 5C70A 2BSTB 4CVUA 1GC1C 3OKMB 4ZAKD 1T66D 1FNSH 4QF1B 4UU9B 2X4QA 3AXLA 2C1PB 5DD5H 1OAXL 4N5EC 4UB0L 4X7EC 3ZTNH 4MDJB 3VI3F 4PD4J 1RQ5A 2UYLA 3WN5A 3ZYZA 4K8RD 1SEQH 2EDFA 2F19H 5EC2B 5IWLC 2XFXB 1TCRA 4ZOAA 2HLFC 2A6KB 2D03H 1WIPA 3UAJC 3Q3GA 3T08A 1UFUA 3DX9B 1TITA 5DS8B 3NCFB 3S3PA 5ESAB 4H26B 4XTRC 2Z8RA 3PDOB 3IDYB 4LLQB 3VE0A 5AAWA 4NQED 1MF2L 1MRFH 5EZLB 3OKOA 4D9QD 1T6VN 3HI6H 1YEHH 3VJ6A 5CEXA 5D7KD 1DFBL 1EEYA 4RIRB 3SE9L 2IG2L 1K8DB 2FIKB 1EPFA 1DQDL 4KROD 5J0BA 2HH0H 4LSTH 5HDLA 4ZYKA 4MWFA 2YBRA 1UWGH 4X8JA 2ERJC 1IAOA 3D0VA 3QDJD 1A1MB 3LKQB 4U2ZA 2J5LB 1ORQB 3ARDD 1OAYL 3FQTA 5D93C 3VMOA 3V7AG 4U1MB 1S7TA 3JTSB 1GOFA 3UDWC 3RWDB 1PEZA 2X1PA 5IG7A 2DQEH 4G9DB 4JG0H 2FR4B 5DEGB 2OYPA 2WINB 5I19H 5JUEL 1U8NA 1NDMA 1DSFH 4M5ZH 1ZLWK 3OGCB 2EIDA 4OF5A 3S4SG 4OGZA 3IDMA 3SKMA 1KELL 3PV6A 3AB0B 2XPGA 3LPFA 4Q97A 4R2GB 5MHSD 1MJUL 2VDNH 3QPXL 4OZHB 3RA7H 2V6HA 3FRUA 1INDL 3S98A 3VXRB 3GB7A 2XZAH 1HXMB 5DJ2B 5I1CH 3EGSB 2V5SA 5I1JH 3UTQB 3HZMB 5GPRA 2IPUG 2X4PB 1WFOA 2RCSL 5EORH 5I6XC 5GGVH 4LMQE 1I8KA 1QKZL 1XEDA 4JVUA 4R8WL 3A6BL 4OCSH 4R6UA 4F37F 3BX7C 2A83A 2GJ6B 1K8IA 4OFDA 5IMOA 1G1YA 4GKZA 5HPOA 4YWGH 3HE6A 1QSZA 4P46C 4X98A 1TPXB 3V4PL 1OQOA 3GSQB 3QUXA 3R06B 3HI5H 5FF6A 4J3XA 5A2IH 4QT5B 5DMIL 3PXJA 5FYLD 5DD3L 5DK3A 3B6SB 1JF5A 4CN4A 1HDMB 5MEPA 4LSSL 4M6AA 4FNLL 1CQYA 2A6JB 3H7BB 3Q6GL 2W9EL 5J89A 2EDTA 3GBMH 3U30B 4HS6A 1YA5A 4KV5E 1PG7W 3SJVD 3K1DA 4BJLA 5JXED 5J11B 3OF6D 2UZIL 3LS4H 3QUKA 1RULH 4U1JB 4HIJA 3BUTA 4N0UB 1Z9MA 5K9JH 2Q7YB 1QBBA 3FN9A 1T2XA 1WBXB 3RWIB 1JGLL 1GPOH 5J6HB 3CDFA 4JGMA 3HA0A 5DD6A 2CLRA 1NFDA 3MMEA 4OZGB 3QIWD 5EU7E 2VH5H 4Z5RA 12E8L 4LLUB 2ESVB 2EXWD 1LNUA 4NNPH 1QZ1A 4P4KB 3TFKC 1H8OA 4PP1C 5DWUL 3FONB 2VSCA 2IH3A 1C5BH 5E5RB 3MV7A 35C8H 3AU1B 3B8YA 3LRSB 3M1BB 2IAMA 3DROA 1QP1A 1M6OA 4URTB 4KAQL 3SQBA 4KQ4H 4PJCB 3BZ4A 1JHLL 4ONGH 1NMCC 2BHZA 2HMID 3CX2A 1HQRA 3O0RH 2EE9A 3ISWA 5JHLL 5F9OL 5SV3A 5BJTB 1YC8A 3SDDB 5ERWA 2CKBH 4MNQD 3OZ9L 4LMQI 32C2A 4JY4B 2E9JA 3BW9B 1QRND 2R1YA 2BERA 5JIPA 3IU3B 4PG9A 1KT2B 3AY4C 2MCG1 4C57C 3UTSD 4CN6A 5E5MA 5JPMA 3CDGA 3BSZL 4Y4KD 3VFMA 3EUUA 1EJOH 2X4RB 2DLFL 4POZD 4TRPL 3ZKXB 3FB8B 2NY0C 5HSFA 3ZT5A 4YLQT 4KTYA 3LKSB 3CX5K 5E1HB 3NMEA 1PKQA 3RNKA 3GKWL 4OCYH 4ZS6D 1FZOB 4XVJL 3U4AA 5BVJB 2ZJSH 2CK2A 4GAGL 4JQVA 5D70L 3INUH 4MNGE 1PX3A 5FEBA 1U8KB 3WFBL 1ZKAA 1UZ8A 1BVLB 1NCCH 4J2XA 4DW2L 4FFVC 5C0EB 5HVHC 1AXTL 4PJ5D 3IVKA 3O4LE 1YECL 3RVWD 2B1HH 5DR5H 3QG7H 4H1LH 5C0JA 5IFAL 4LHUB 1XCQA 1U41A 3VFUA 4KK9C 4ZSOE 3CFCH 3P3YA 1S7SA 2F54B 5C09A 5DFWH 3NFPA 2MPAL 3B5GA 2DI9A 4YJZL 4OV5A 1BD2E 1B0WA 4POUB 1CGSH 1FVEB 3ARZA 4JB9H 4L9DA 4L3AA 3C6SB 2P5EE 1A3RH 1RFDL 4LCWA 3BIBX 4KKAC 5B3JE 2P5WE 1FJ1A 3ARGC 2H2PD 4P2RB 5GS1B 3KNBA 3X13A 5IKCB 1DBJH 2Y1VA 2FLRT 3ULVL 1HIML 1IKNC 3DMMC 2Y36H 1UEYA 4YBHA 1LO4L 1A4KA 4DCQB 5DLMH 4P9ML 4JAMA 2Q8BH 4IOIA 3KLSA 2MSPA 3PGCA 3ZSSA 3ILQD 1D3CA 3DYMA 4JQXA 4JANA 4XWGL 4NO5A 1U8QB 3OXSA 3BPLB 2WIMA 4O2FA 4TVPE 3SGKC 2VITB 1UT9A 1MFEH 2FATL 5IQ9B 3CLEH 3BT2H 4UV4L 5IFHH 1NCAL 5E08L 1AKJD 1OARH 1NGWB 1JI1A 3U36B 1F6FB 4ZPVA 2CK0H 3M45A 4NCDA 1IGYA 1IC7L 3A67L 4Z7OE 1QO3B 3DSFL 4PJ9C 1DQTA 2BRQA 3DV4A 3I6KB 5CD5C 2VN4A 4ZAKB 5E1AB 4KTDH 3O9WD 4EN3C 1FL6A 3G9VA 4MA3B 5F7FA 4N8PA 2WBJA 3HUJA 5FCSH 5SV4A 4RAHA 1WLHA 3ILPB 4S1SH 3QHFL 4NQSA 4M3JA 2FGWL 4KKLD 1N6QL 3EJZD 4H1LA 2W0FB 5CMAA 3TVMD 4PJDA 5GGTL 1HCVA 1E0OB 5EBLB 2ADJA 3GSXB 4K3EL 5I2IB 1S9VB 1JGVH 4A6YL 1AIFB 3V5HA 4N8VB 1A6TB 5F6IC 4NQEB 3GMMB 2JTDA 4GXUN 3D39A 4M62L 5FYKL 1FVCA 2OTUB 2BFVH 4LCUB 4BH7A 3BN3B 2FNBA 4BSWA 3SBWC 5I71C 1N0XL 2BSSA 4PGBA 4NJAH 3IF1A 3ULVF 1IAIH 5CSGA 1NC2D 4KROB 2BVEA 4PB9L 5C0AD 4LARL 5HI3D 1Q0YL 4LIQE 1QQDA 1RJYB 2FZ3B 3QDJB 4JHZA 4TSCH 4X4YB 3ARDB 3RTQA 1QYGL 3TZVD 1NMAL 4GRMA 2O61A 1EFXA 3K8LA 3B3IB 3BQUC 1VFUA 1K4CA 2XWTA 4LLMB 5E2TL 5EO1A 3ROLA 1VGEL 4FFYH 2H9GB 3VA6A 5DUPH 1KIPB 4QRQB 3UZQA 4JHWL 4Y2DA 1OCWL 4PLOB 2VWEE 4XPHL 5TF1H 2R0ZH 3ARUA 2DB8A 5F88A 1XH3A 5KANI 3JTTB 2HT2D 5CGYC 5JHDE 3WFEL 2IFFL 3NPSC 3H8NA 3BE1H 1SEBB 5BMFL 2XXCB 2AGJL 3EO0A 2JF1A 1D9KC 3SE8L 4EI6A 2E7HA 4KI5F 4P59L 4R4FH 4UIMB 4NFDA 1CD8A 5IMKA 5IMLB 5JLZA 4ZFOB 5C9KA 4GMSL 4F9LC 3MV8D 3PDDA 1ZLSH 5IVZA 4HLZH 2A6IA 2MKWA 5C0NC 1AC0A 3GJFK 4Z7VF 1RU9L 3MRLB 2AJUH 3NGBB 2D7TH 3BPNB 3A6CL 4H0HB 4XVSL 4NQTA 4P23D 3MLVL 4JFEE 5IK3B 3ARVA 1PG7L 4L8SC 2R0LH 3JXAA 2X09A 8CGTA 3OJDB 2AABL 1MJ8L 3CDYA 2Y6SC 1XCTB 4K3JL 1UJTA 5IJVB 4HPOH 1KB9J 3ULVC 5F96L 4UQ3B 1TJGH 3MV9A 1D5IH 2UWEB 1N64L 3FTGB 4LLYB 4PP2A 2CRMA 4U0QB 3S7GA 3SKUD 4JPWL 2QKIB 1WIOA 3PJSB 4P2OD 3PWLA 4J6RH 1T3FB 4GOSA 4HS8L 4XAKD 4I3SL 2ADGA 1ZLWH 3S5LB 4RRPG 1XF1A 5CEYB 5DJDA 5ALCH 3QIWB 2HA1A 1JK8A 4PJ7E 4YHOL 1GHFL 1CICC 2NY1D 3MA7A 2ZUQC 4GW4A 5HI5C 3RQ3A 5KSVB 3CFKB 3ALWA 1T04A 5HHNA 1KGCE 1YN6B 4K7PL 1CD0A 1DVFD 1A7RH 3V4UH 4PB0H 3EFDL 2Q8AL 5E5UB 4HUWB 1IVLA 5MENE 1TVBA 4LSUL 2Y5TA 5HHXH 2F53E 1MCRA 4KI5C 4TQEL 2Q6WB 3TJHC 4HK3N 2ARJA 5FKPA 4AM0B 3VD7A 3KYOA 3MR9B 4KK8D 1EMTL 1RUML 1EEQA 2OMBA 5DRWA 4MSWA 4MNQB 2WWKO 3CDCA 4E5XB 4BQ6A 3AMLA 1QRNB 2DJ4A 5BW7A 5C6WH 1MFCH 4QRRE 3UTSB 2NY4C 1X44A 3FHAA 3SGEH 3C6LC 4MX7B 3S37H 2VXQL 4IOFD 3ZT7A 4Y4KB 3IRPX 1JYNA 3I84A 1UC6A 5DEFB 2JCCA 5JOPD 3WUWA 4N90D 2D7MA 5EH1A 1FYTA 4I2XE 5AYUL 2BVYA 1T7ZA 1LDPL 1FL5A 5JQ6L 5L6YH 4X4ZA 4XGZA 5C9JB 4TSBH 4AG4H 1A64A 2EO9A 1DCLA 3QHTC 4MAUH 1UQSA 3LEVL 1YQ2A 1JPGB 2Z4QB 4PYHA 1HK6A 2J8UE 3U48A 4HIHB 1HXYB 4L1DA 1M7DB 1Y0LB 2A77H 4ZNEA 1YEJH 2X1QA 1MHPH 1SY6L 1U3HC 5GIRA 3HC4H 2AV7B 3G5ZA 1SJVA 1PLGH 4OQ1A 3EOAB 3RX8A 4Y4HC 3PQYD 5ICYB 4YQXH 1T1YA 1T1WA 4OD1L 1H15A 4PJ5B 4JFXB 3FOLB 5I1AA 2ZUVA 2NNAA 4LVOB 1CCZA 3L3HA 2FO4A 1HHKA 3LKRA 3LD8C 1G6RB 4IEFB 15C8H 4UDTB 4UBDC 2EC9U 3ABZA 3SOBL 1WTLA 5KOMC 3KHQA 1AFVL 4AENA 4YDKL 3IGAB 1XGQA 2VC2H 3KR3L 1A6ZB 3N06B 3MRDB 4RWHA 3T3MF 1EBPA 3Q1SL 3ZL4L 4KRNA 3GBNH 4MJIA 1U92A 4X80L 5C92A 5E4IA 3ZKMC 2NY5L 1ADQH 4PRHE 4YHPB 1KCSH 1CFTB 4Z8FH 3MYJA 4X6BA 3NZHH 3OJ2C 5HYJD 4PTTA 4ZFFA 1ZLUK 4AEIL 4NGHL 4KH2A 4QOKA 3GMRA 5HI4D 5HYIA 1H3WM 4WUKL 4J8RB 3T65A 3TYGH 4OBSA 2HRLA 2ZWLT 4OZFB 5IEKB 2J7LA 2VAJA 4ODWB 1ZT1B 2ICWI 3RPIA 5KSBA 5C7XH 4H20L 1TTUA 1CXKA 2P45B 1KXTB 4MQXD 1KLGA 1UKQA 5BS0A 3FKUS 3F7QA 3L5XH 4FQCL 3W0WA 1I1FB 3MOQA 4UINL 2DQHH 2R23B 5KBNC 5T5FL 1V7NH 5FO8A 2DOCA 3HE7A 4HLJA 2G5BB 2PCPB 3RY6A 2R15A 4C59B 4MQTB 3P30L 3KJ6H 1IEBA 3UTPD 3KPSD 1UJ3B 3W9EB 3VDCA 4ELMA 1U93A 5DMYA 1GZQA 1A7QH 4NZRL 4NN7B 5H94B 3O9WB 3WJJC 5DVNA 1LEIA 1P7HL 3IS0X 4HCRL 4GXVL 4WDIA 2VLKA 3I3EA 5D7LD 4IRJC 4ZO8A 1I7ZB 3B2UD 2D0GA 1RUQH 4Y5XC 5SWZA 4Q7DA 4Z6AT 2P46B 5TDOA 3EKCA 4PJHB 2GEEA 1LO3L 3VXSD 2AVGA 2YUZA 2XWBA 4PJGE 2HLAB 2DKSA 4G3YL 5DMGC 4JGJA 1YMMA 3TVMB 4P57B 1QOKA 5HGHB 2ARWA 2BOCB 3WXWL 1HH9A 4QHKJ 1MCSA 5EA0L 1RZKL 4LASL 3LKPB 1K5NB 2FL5B 3PWPE 1ONQA 4NKDB 1FO0L 4F7CA 2MQ0A 3BAEL 3T0XA 4K3DH 4PJXF 1ADQA 2LU7A 5IVNA 3BZFA 3N9GH 4GQ9H 2AXGA 1NC2B 4G8FA 3VGAB 1CDGA 4OV6F 5KVEH 5IW1B 1ITBB 3W39A 5C0AB 3F65A 4JFPA 4N8CH 1BX2B 1J05A 1I7TB 3EAKA 4OIIH 5GGRB 3TESA 4WW2A 1NCNA 1IM3B 1OAUL 5E7BA 3TZVB 3CVHH 5I0ZA 3MROB 2FBJL 1AC6A 5D7IF 2VLME 1I1RA 4O02L 3CNKA 2VUYA 3VXQA 5ITFA 3N85L 1J0HA 4X7SH 1UWEL 1BVZA 4RMWA 5IR1A 4HAGA 4DKDC 4NN6B 1Z3GH 4TUJA 5F6HJ 4ESKA 4NP4H 3AS2A 5IB2A 3STZA 4J4PA 5HXMA 3I85A 3IFPA 3FFDB 3IJSA 3H3BC 2D7OA 2YK1L 4JRYA 1JWUA 3VG0L 2QHRH 1BJ1J 1VADB 1SVCP 1LO5A 4U6VH 4J3SA 3S8WA 2NW3A 4IMKC 1BZ9A 1F4XH 4Z7WB 1IT9H 1OWRM 3QPQC 3EYOB 3GGWB 1YJDH 4HUNB 3F7VB 1IAIM 2ED9A 2MHAA 3SDYL 1C5DA 5DJYB 1OPGL 3H42H 4O00A 1QLFB 3I6LE 5INCA 1T5WB 3KDMA 4XRCA 5DD5L 5FGCB 4P23B 4CJ0A 2JJUA 4WHTA 4QXGL 4M7JL 4PJFA 5FYJL 3ZE2F 4AH2A 3BEWB 2F19L 2YRLA 4JM2A 2NY5C 3O8XA 1IKFH 3BP7A 1CDBA 2D03L 1ZHLB 1J0JA 3JV6A 4G80B 5FM4A 1VFOA 2Q20A 2PETA 4XMPH 4OM1H 3WEXA 2J8OA 5FUZH 4ODVH 1CFVL 5B4MC 3V7MA 1K3ZA 5B3NA 2APFA 4LHUG 4Z76A 4P2OB 1MRFL 1OTUD 3CVHA 2GSIB 1A1NA 1QPXA 4GJTB 4R97B 5T3ZL 4FFWD 5FO9A 2BNRA 3ARYA 3NVQA 4W81A 1MLCA 2AXFB 1RIHL 2HH0L 3ARSA 5IB4B 2HKHL 2PYEE 2NY1B 5TE6H 4JKKA 2LV4A 1ZT7B 2H41A 3WHXA 5KN5B 4QWWD 3SDAA 4YXLH 2DLHA 2Z9TA 3BGFC 3P4OA 3D48R 3ULUH 2CDEB 4JE4B 5KVFH 2DQEL 1DVFB 2QR0A 2D3VA 4N9GB 4GW5B 3U6RA 6FABH 2JB5L 1S7WA 5D2NB 2IWGA 5GQBA 5K9OB 1D5XA 3ARWA 3P4NA 5EOCH 1AQDB 1ZE3C 2ZG2A 4Z7UE 5ESVB 3O3AB 4CN1A 5IESH 3HMWH 4L4JA 3N1GC 4G5ZH 1KYOK 3H3PL 4WIQA 1KJ2H 3GO1H 1MFDH 1I8MA 3VWJD 1KIRA 3T0AA 4CVZB 3KYMB 1OY3B 2XY2A 4WUUE 4NYLA 1NCDL 2D9QB 4K07A 3BGAA 3HFMH 2B7DT 1N7MH 1F3RB 3GBLA 5HPMA 2VISA 1S9XB 2P49B 3BKJH 1SJEB 2DQUH 2AJZA 2YUXA 5ISZD 1A6UL 1DE4B 1CL7H 2R56L 4OCSL 3SDXB 4IRSD 4ELKB 3T1FA 3C09B 2VZ3A 1EBAA 3QFJE 1P7QA 3SCMD 1A9EA 4P49A 4YWGL 2YEZA 2A74A 3KYKH 4NSKA 4I3RH 4HIXH 3PQYB 3HI5L 1QSEA 3VRIB 1EVTC 3FCTB 3IDGA 4YH6A 2F58L 3K46A 4N8VG 4AIZB 4JO3L 1MRDL 4K71B 1PBYA 3BDYL 3JVGC 2IMMA 3DVNA 4FQJH 5E95B 1MCCA 1S7XB 3S88L 3GBML 4LL9A 4FRWA 1FP5A 2Z31A 3LS4L 3TGXA 3MRGA 4PJBB 5BVPH 2YC1A 2R0KL 5K9JL 5EN2B 1YEGH 1NFDF 1GPOL 3O41A 3WIHL 3U4EB 3C8KA 1KIQA 1NGPL 3C60A 5JW5B 5CKGA 4HXAH 4X6FB 2Y7QA 5HYJB 2A9ML 1MQ8A 3E6FA 4BZ1H 1AJ7H 1QSFE 1X4YA 2EDWA 3BHBB 1H8SA 4UNVA 1UA6L 3RX7A 1EAPA 1FFQA 5CWSA 1GGBH 3WV0A 3OMZA 1U8LB 3NCYP 3GJEA 1F4HA 2YWZA 3T3PF 4LVNB 1XR9B 4KQ4L 3NOIA 2WUBH 5I1HL 4I3GA 2HAZA 4WFFE 2YA0A 3BIKB 4LFHG 3O0RL 1CLOL 1DUYA 3DUUB 2Z35B 1HSBB 5SWSA 2BSRB 2PO6C 4BKLA 2N1KA 5GZNC 3MBEA 1PDKA 4QGYA 1CR9L 4P5MA 1NMBL 1J8HD 4L8CA 1MJJA 4MB5A 3HPJB 3KPSB 4U6HB 1QRKA 4APQD 1JHKH 2ZCLH 4LK4A 4XMKL 4G6KL 3HE6C 4HH9A 4WY7H 3NCJH 2J88L 3QUXC 5ADOL 2VQUA 4N5UA 3SDCD 2EZ0D 1FZJA 2BVOA 5D7LB 5INDA 4X4ME 4G43B 1CG9A 5ACZB 5CAYB 2EE6A 2XNAA 4ONHB 3FL7A 4OCYL 1A7BA 3VXSB 2IQ9L 1DEEA 4KJWD 1DQQA 5FOBB 4JFFA 5D7JA 2GSGB 3FRPA 2MNUA 3O3EA 5JA9A 1VFAA 2GCYA 1NCCL 2A9NL 1BWMA 4TNWF 2H6PA 2BVQB 4WV1A 1ZLUH 2HRPH 3DPBA 3PWUA 3V6ZA 2VQ1B 3G04B 4XC1L 1J87A 4LPVA 5DR5L 1BVKA 1BOGB 4XNYH 3S5LG 2FWOA 4OKVA 4P3CL 4C83A 3GI8H 2P8PA 3HAEH 4PGJA 4I4WB 4C56A 1MLBB 2AV1A 4CKVX 1NANH 3GM8A 5AD0B 1CGSL 3QCVH 4JB9L 3QO1B 3MRHB 1JGDB 1AO7E 2QQNH 4JFHE 1IC5H 2IAMC 1RJZA 5FUCE 3PWNB 2VLRA 3S3SA 3WS6A 1KLFA 5TE4H 1YQVH 3CSPA 3MUHL 2B4CL 2NXYD 2ZNXA 4L4TD 2X70A 3BVNA 2Z92B 2FX8H 2G9HB 1ND0B 4TSAH 4DGYH 5C2UB 3QUYA 4M8VA 1Y18A 1F4YL 1MI5E 3T2QA 2QQKH 3L3DA 3QUZD 1RSFA 2XQBL 2YD9A 2OS7A 4NQCE 3IFOB 1F3JA 1JJUA 4G7VH 4X99A 4LNRB 4OUUB 3F7YA 2DBJA 1OTSD 2C9AA 4ZFGH 2CLZB 1IGML 3CH1B 4HKZB 5IHZB 5DYOB 3FQNA 4JDVB 5FCUL 1EFQA 1MFEL 3CLEL 4XBEH 3T4YA 4K7FB 4ZOBA 5B39G 5IFHL 1OARL 4HSQA 3ORJA 4OZIA 2ZUUA 2CK0L 1X5KA 2X4TA 2EEBA 2F5AH 2AW2A 2EXYD 4JHAL 5MI0B 2LU3A 4ODHH 3I2CH 2OZ4A 4HG4J 3EBAA 5D9SA 1ED3B 1W0VA 5LAXB 1C08A 5ADPH 2DD8H 3HUJF 3MYZA 1VA9A 2QTEA 4JKPL 1CDYA 3ZKNC 3VH8A 1YEEH 4W68A 3LKNA 2Q86B 5I75C 3T0DA 4PJXB 4KTEL 2HFEA 3PHQA 2YSSB 4PJDF 2X41A 1T20A 1JWSA 3GHEH 2ADIB 3WNMA 1FL3A 4G42B 1JL8A 3HAEA 1G7HA 1EZVY 1OAQH 4Y5YB 3AVEA 3R4DA 5H2BB 4WI2A 5CJ5A 1BWWA 1LP9A 1S9WA 4DFIA 5D7IB 4UV7H 2R2EB 4D94A 4CMHB 3G6DH 2L0DA 2VDLL 1QFWL 3RWHA 4X8XA 1G9NH 2ESVE 1JNHB 5LBSL 4BZ2H 3G6AB 3F62A 1I1AD 2VZUA 2JELH 4H88L 3PP3H 3QWOA 4K23L 4TSCL 4FZEL 2AK4D 2EH7H 3LEXA 4PRPE 1BFVH 4JPIA 3UYRL 1R5IA 4JQXC 5IIEB 1RHHB 3MCKA 4D0BA 4ORGB 5C0IB 3T77A 2N4IA 4Z7NE 1N3NB 4FQXA 3BZEA 5A40E 4GG8B 4FFYL 1KBGH 5DUPL 4QCIB 2H3NA 2XKNA 1KG0B 2VL4A 2R2CA 4ZNCD 3QNZA 3RI5K 1ZA6A 3OHXA 4YAQB 5JDSA 1EEUA 1NJ9A 2ZUSA 3B4NA 3AS0A 3VXMD 3BE1L 3LS5H 1FBIH 3AXLB 5JR1H 1UB6B 1U36A 4G9FD 3VWJB 4WHCA 2WBJD 1PW3A 3V6OE 3WN5B 3FB7B 1DBAH 2DMCA 4IIQB 4U0RC 3D18A 4LQFH 4TOYH 4RAUB 3Q3GB 2GUOA 3BGMB 1ZLSL 2I9TA 5ISZB 3N1QC 5HGGS 5ABDE 3CH8A 1DBBH 4WHYH 4Z77A 1P4LA 4IRSB 2AJUL 2ZUWA 1KENH 2D7TL 4R4BB 3RWEB 3SCMB 2XQYK 3DGGB 5A3IC 5BRZD 1CFNA 5T1DH 1U8PB 2R0LL 1FLRH 3CFJA 1KCUH 3BKML 3PL6C 2FIRT 4LCIH 1V3MA 4KJPD 5TF0A 3NBNA 4PJIB 3TEUA 3MJ6A 3GDBA 3TO4C 3VXUA 5L8KB 3D0VB 5T5NF 1TJGL 2X4SB 3PNWA 2E5EA 1LO0L 5C8JB 5T3XD 2O5XH 4WU7A 4LU5L 4ZFZA 1I3GL 5HYSG 1UGNA 3RTQC 4PLNC 1A8JH 1ZLVK 3VGDA 5F9JB 4UT9L 1YPZB 3HG1E 3VRLE 5CZXC 1BJMA 5D2LE 5HHOE 5JOFA 3P40A 5FECA 1KTLA 2YUWA 1KN2H 2J2ZA 4Y2DC 4GG6B 4WFHE 4LKCB 3VFTB 2NTFB 3ARPA 4KK5C 4L1HA 4L3EE 5AZ2L 1G7IB 5D5MA 2NY6C 1UENA 3UTTA 3ROOA 3NZ8B 4BSJA 5B8CA 4OFPA 3CCHA 1OTTD 1A4JA 1NC4A 3GRWL 4KMQA 4W4OA 1A7RL 5DZNA 1HOCA 4OD3H 4KI1A 4DGVL 2HFGH 4KKBD 1B6DA 1U8JA 2VL5B 4HXBL 2E27H 3RDTD 4IM8A 3MACH 4R3SA 5GRWA 3HRZB 5LGJA 2LTQC 2NY2C 2EYSA 4B0MM 1J8HB 1MFCL 5DQJA 1C5CH 2YMXH 1G7PA 2YPVH 2JCCF 2IQAB 4GKZB 1VKXA 5GJSH 4GFTB 3TCLA 4NWUL 2VXTL 2G5RA 4OIAA 1RURL 2YOCA 3QIBC 3ZE0F 4JFQA 1N5AA 3WIFB 3LVEA 3SDCB 3DIFB 3CFBB 5L6YL 1X5AA 2VLJD 4OSUH 3UXFA 4F7PA 1AY1L 5DD0L 2WLZA 3BPOC 3OAUH 4LP4A 1UVQA 5F44A 3WSQH 1JMZA 4OFYA 3T4AA 2ARJQ 1UWXH 4KVCL 4PGEA 5E8NB 1S7UA 4HIJB 5F7KC 3VXNB 3QDGD 4CVXA 1IQDB 4PRIA 2VDQL 4M7LT 1IAKA 2C4XA 2CLRB 3MMEB 4JFYB 4Y8AA 3T0VA 2SEBB 1EZVX 4FQ2H 4LLWB 2AK1H 3ZDYF 4UT7H 4XH2A 1VGKA 4Z0XA 4E0RB 1TVHB 3GSWA 3LV3A 3TBTA 3L3KA 2KZ1B 1W72H 2VOTA 4U1GB 2NY3D 5L0QB 4Y19A 1ULVA 3F12A 5EDXA 4DZBB 5J56B 3UJTL 3GNML 2VC2L 2GW5A 4M1CC 5IT2L 5M94B 1IAMA 1ZSDB 2PW2A 3IJHA 3GBNL 5DK2B 3WXVH 1U3YA 1QSVA 4U1NB 5D6CA 5GSRA 1HQRB 4MQ7B 2NXYB 1XF5A 4L4TB 4PJ8D 3LHPH 1E4XH 3ZDZE 4EI5D 5DK0A 4MVBD 3BRGC 3QUZB 4HEPG 4V2CB 1NCTA 3TT3L 3KYNA 3ARBA 2HJFA 4PG9B 2R2BA 4YZFF 5JNYB 3O3BA 3G08A 5IM7A 2NW2B 5BW7C 1FDLL 5BQ7B 5KSBF 1AXSB 5C86A 1VPOL 3FT2B 5C7XL 3C2SA 4EUPH 3QEGL 3VI3E 3DRQB 4HUMB 5D72L 4KFZC 4JZNA 4XNZC 3E3QC 2BC4A 5ETUB 1UH2A 3QYCA 1N6UA 1IL1A 1BBDL 5ECJE 3IU4H 4ELMF 3MRQA 1FE8H 3KJ6L 4U1SA 2XWJB 5CSZA 3LIZL 2V2WA 2HT4D 1X5YA 3A0OA 3C08L 3WLWD 4GRLD 4MD0A 2AEPH 2VDRL 2VDKH 4WFED 4BM7A 2YA1A 5BZWA 2WUCH 1EO7A 4LAJH 3RZCA 4JDZB 1RUAH 2X9YA 1RUQL 3VXTA 3RPKA 4EQ2A 4LDEB 2GAZA 2GTZB 3DXAD 3EYQC 1XGYH 1MRCH 3HI1A 3KPLB 5CCKL 5CJXA 1VFBA 3TYFA 4D9LH 1W72A 1ZHBB 1CD1A 2B5IC 1MCNA 1Z6JT 5IW6B 2EYTA 4L4VA 5A1AA 4HWEL 3X13B 1EHLH 1AGDA 1KJ3H 1RZ7H 5LQBL 4PGDA 4FS0A 3DI2B 5GGSY 4NRYA 1M05B 2ZSVA 5KVEL 3TA3A 4QNPF 2CKBB 3M8OH 1W0WA 1WGOA 2EE3A 1I1AB 4N8CL 1ZMYA 4RMSA 4OQTA 4WW2F 4OIIL 3GSOA 5L9DH 5GJTH 4WJ5B 2R4RH 2AK4B 3T8XB 5DHYA 5F7DB 1B0GA 2DMBA 4OT1H 2AJSH 3CVHL 1D6EA 1RJLB 3OXSB 4O2FB 2VZSA 1B2WH 4EBQL 3OPZH 5E8PA 3O6LL 5DHXB 2OL3A 4EUPA 1A6PA 3QXVA 3ZTJG 1RVFH 3L3GA 3OTTA 1LO2H 4OLZL 2BVUA 3QI9A 5KAQF 2R69H 4G8GA 4XP6H 1R3LB 2I60L 4HX1B 3HE7C 3MRPB 1Z3GL 3V79C 3RY6C 5KZCD 2V2XB 2D2OA 4NPYB 3D2UD 4KY1H 3VXMB 3U0TA 4LDLB 1S78C 3THMH 1PYWA 2A0LC 2WM0A 4MDIA 1NAKL 4QRPD 1FGNH 1QLRA 4G9FB 5EU4B 4NQVA 3IAGC 2WBJB 1C16A 5BXFA 5GGUB 1IT9L 1ZA3B 5E2UH 1NQBA 1YJDL 3EYUH 2KPNA 4S1DC 3DX6A 3EYVA 4TVSa 3RL2B 4M8QA 5E94B 3CFEA 4WI6A 3H42L 3REVA 4RDQF 4P9HL 1JN6A 5H37G 3C2AL 4M7ZC 3KPRA 2ADJB 3VDAA 1MPAL 2BSTA 2ZCHH 1KTRL 3OKMA 2EH8H 3UJJH 4PJFF 4QF1A 4UU9A 2C1PA 2AQ2A 4PUBH 5BRZB 5E7FA 1IRAY 1I9RH 3B9KA 4MDJA 4JM2F 4YE4H 1WCBB 2YD2A 3G5VB 5DJ8B 1OP5K 3IF1B 1T6WA 5EC2A 3MO1B 5HGDB 2DQFB 2XFXA 1IKFL 4U1KB 2PYFB 2B0SH 1X5JA 4XMPL 3DX9A 3NA4A 4I0PD 1GAFL 3V0AC 5EZOH 5ESAA 4H26A 4LPTA 4O51B 5HI5D 3PDOA 4GRMB 1T1ZB 4U6YB 4QHLA 4WW2C 3SGDI 1NFIB 5DD1H 2Q3ZA 3OGOE 5EZLA 2J12B 1IC4H 3LOWA 4FQLL 5JORB 5EO1B 4HHAA 5IHBA 5F7WC 1MAJA 5FKAA 4G6FB 3X3FL 1K8DA 2FIKA 4HQQL 3DHJA 1CZ8H 5DJZB 1FG2B 1U42A 4MXWL 2XN9D 4O4YH 2NZIA 2YN5A 4HEME 1A1MA 5F88B 3LKQA 1KTDB 1XH3B 5I16B 1ORQA 3KS0H 4J4PC 4HZAA 1FNGB 1SVZA 3LB6C 4Y5VB 4U1MA 5BOPA 1R0AH 1XF3B 3QRGH 3JTSA 1P1ZB 3RWDA 4G9DA 2HKFL 2FR4A 2W0LA 4PY8J 1IGTB 1FSKB 1H3PH 1LK2B 5EG6C 1H3GA 3NFSL 4NDMB 5FYKD 4NC1C 4OKDA 3EOBB 5C6TL 3VRJB 3RDTB 5T33H 5EOCL 3OGCA 3JZ7A 1R3IL 2F9BT 4X0KB 4RMUA 3T1WA 4IJ3C 1KEMH 2ICES 3VD5A 3DO7B 5E2WH 1EDQA 3GO1L 1MFDL 4OZHA 1FIEA 2XV6B 4GBXD 4XP9H 2PNDA 4YUEL 4KXZH 1NUGA 3C5ZD 4Y4HD 3VXRA 1HXMA 4MB4A 5DJ2A 3EGSA 4LGPB 3UTQA 3HZMA 4NQDD 4NWTH 2YXFA 1JNJA 1N7ML 1UG9A 2VLJB 1CE6B 5CILL 2DQUL 4Z9KB 1CL7L 2GT9B 3QA3B 3IETA 4NBYB 1ZLVH 4YXKH 3TBYA 5HVWA 4PLKC 3CC5A 3QUMB 4IDJH 2BY2A 4KUZH 1I3UA 5F1IB 3RVVD 3MNVB 3QDGB 1BJ8A 3N1PC 5I1GL 2FJHB 4WEBL 1KYOJ 4YHKH 3MCLL 3R06A 4NZTH 5EOQL 1KLUB 1ZANH 2X2YA 4QHUA 1JZ2A 4HUXB 4YHYB 4MXQC 1HDMA 3T09A 1YMHB 2A6JA 4Z78B 3H7BA 1HKLL 3UCRA 4FABH 5E9DE 4X6DB 2NY3B 3QDME 3SDAC 5BVPL 5HHNB 1MUJA 2DQCL 2H1PH 2NYYC 4U1JA 3S6CA 3UC0H 1MELA 3C5SB 1T1XB 2X44D 4N0UA 3OG4B 1HYRC 3W2DH 2Q7YA 2APTA 3L1OH 3VGGA 4DKFH 1WBXA 3RWIA 5J6HA 3B9AA 2BNQD 4D2NA 3B43A 4OZGA 4XP5H 5CINL 5HJ3B 3NCYS 4QTIH 2ARJB 4PJ8B 1MREH 2FBOJ 4GH7B 4UDUB 5FKPB 4JRXD 4Q6YA 4EI5B 1YJDC 3HC0B 1ZXQA 4LLUA 4DOHB 4ONFL 4P4KA 5I8OH 4P9HC 2V5TA 1C12B 2Y06H 3FONA 3FZUD 1FFPB 5C0CA 3AU1A 3LRSA 1NKRA 4LVEA 1HZHL 1VFMA 2WUBL 2XZQH 4PJCA 1OSPH 4OGAD 5DRZB 1T03L 5BJTA 4D0DB 3SDDA 3QNYB 1TLKA 1B3JA 5IB1B 1S5IL 4JY4A 3BW9A 2KQMA 1ZT4B 1F97A 3IU3A 3WIIL 1EUTA 3QQ9C 2Y23A 4IOSD 4R90L 4WI5A 5GIRB 4GRLB 3TNNB 3I9GH 3DV6A 4KJQC 1WFNA 2X4RA 4WY7L 1QFHA 3NCJL 3QJHB 4NUGL 4Q9RL 1GH7A 1H15B 4CNIB 3FB8A 1A0QH 4OCXH 4UIKL 3ULVE 4Y1AA 2FO4B 3LKSA 4GXUM 1ODAA 4ZTOH 4HC1H 1F90L 1FZOA 4ODXB 2Z31D 1P2CB 5H35B 3WE6B 5BVJA 2OZ4L 1J8KA 1FH5L 1QG3A 2IEPA 3D25B 3MODL 4TTGA 1G0XA 1U8KA 4P5TA 4XAKE 3ULUD 1BVLA 4JFDD 1XFPA 1U91B 5C0EA 4K8RH 4KK6D 5FAAA 5EUKB 5K33A 3C60C 3BD4A 4XNYL 1X7QB 3X3GL 2DTSA 3GMPB 2F54A 3PV7A 1UCBH 2I5YL 3DETD 3UPCA 2UVFA 3X12B 2X1OA 2RB8A 4RBPK 1FVEA 2QQNL 5L2KD 3EJYC 5TE4L 1YNKL 1X6NA 3OJMB 4H0IA 4OLWH 3ZT6A 4KI5E 4G6MH 1OSZB 4P2RA 3EFFB 1TTGA 5GS1A 3CSYA 2FX8L 5IKCA 3FO2B 4M48L 1A7PL 1FV1B 1MCKA 4ZG1A 1JTTA 2HYMA 3MBEC 3KXFD 5DC4B 4G7VL 4Z7VE 1CE1H 1QFWM 1GZQB 1YUHB 2O5ZH 3D2UB 4YHML 5JOPE 3HC3L 4OAWB 4QRPB 1U8QA 2VITA 2OP4H 5IQ9A 4NKIL 4OZIF 2FEEL 1Q9KB 1MAMH 1CK0L 3PWVB 3RWFB 4ZO6A 5F9WB 1QO3A 1ZGLM 2F5AL 3IFLL 4GKSB 3QAZB 4HC1A 3D6GA 3RZWA 4ODHL 1HH9B 3MBXH 4ZAKA 5D7JC 5E1AA 2X40A 4JY6B 2DD8L 5F1OB 5GS0L 1ONQB 2UY6A 1EO5A 4MA3A 1UB5B 4MNGA 2X9WA 4HWBA 3ILPA 3HZKB 1KC5H 1FRGL 2WWMC 2W0FA 1MY7A 3STBA 5AZEL 4I0PB 4PIRF 3VFPB 5EBLA 3SGJC 5DT1H 3GSXA 5EWIH 1XF4B 4P5KB 1AIFA 1LP9F 4S2SB 1A6TA 4NQEA 3GMMA 3WS6C 4YFEA 2CR6A 3V5KB 3NTCL 1BECA 4LCUA 4NHCL 1AI1H 3MXVH 2QQQA 3WO4C 1DLHB 5IR1B 1ACZA 4PJEB 3QUYC 4Y16C 5I1LB 4Z7QF 3AS1A 1A47A 2XN9B 4TUJB 3LQZB 2BK8A 1RJYA 1KCVL 2FZ3A 3QDJA 3STZB 4X4YA 2OSLB 2EH7L 3ARDA 5DJAB 1BFVL 4LIQH 4JPKL 1GGYA 3B3IA 1M7IB 3ARFD 2NW3B 1INEH 1WEJH 1OAZL 5JW3L 4A6YB 1O7VA 1KPRB 1L7IH 3UMTA 1RIVL 4HK3J 4JDTL 4M5YL 4NZDA 2H9GA 4OGYL 1F2XK 3DOSA 1KIPA 4QRQA 1C5DB 1K2DB 4LPCA 1EVUA 1E4WH 4KGLA 4GUPB 3NABH 5B21A 1P53A 5I73B 5INCB 3KDMB 1J88A 1R5VB 4O5LH 1MCWM 3JTTA 3QZWB 2HG5B 3LS5L 2A73B 4XI5D 1OLZA 1SEBA 2VXUL 2DN7A 1TQBC 4GBXB 2FO1A 3AM8A 3C5ZB 5GZOD 4M93C 4UIMA 4JM2B 5IMLA 4ZFOA 3O8XB 4X7CC 4NQDB 3SKOB 3LEYH 3JV6B 3MRCB 1KN4L 4XPGH 1DDHB 1L9MA 3IDJB 3MRLA 2P7TB 3MA9H 4K94H 2EDXA 4WI4A 3RGHA 3RAJH 1XT5A 5KSAD 5I15H 1JF1B 3T3ME 4EOWL 5IGXH 1A1NB 4OCLC 3KLHD 3OR7B 5IK3A 4LCIL 1ERNA 5C08E 1MLCB 3HB3D 3OJDA 4D9RE 2YN3A 4PV9B 4OTXL 5HBBA 2W9DL 3D3VD 4Q9BA 1MIMH 1RK0B 5D96B 1CF8L 4UQ3A 5HHQA 3VFOB 1Q0XL 3WHXB 2XOTA 2UWEA 3FTGA 4JJ5B 4LLYA 2WP3T 5HHME 1RY7B 2YPLE 3SJVA 4LHJB 4Y4FD 3P4OB 5JXEA 3OF6A 5BCAA 3PJSA 3VFWB 1ZOXA 4KMTH 1I8IB 1T3FA 3RVTD 2QR0B 3BDXA 4RX4D 1U8MA 1M7XA 5F89B 3S5LA 3GFUA 3BPCB 4FQXC 5A43C 4PBXA 3TJEH 4D0CB 2BNQB 5CEYA 3L5HA 3BD5A 3H9SE 3QIWA 4DEPB 1MCIA 1AR2A 1G6RH 4XPBH 3U7WH 4JRXB 1KN2L 1XGRB 1VSCA 3RUGB 1M1SA 2PO6D 4ZMAT 5D5MF 3RJDA 5IVXB 4R7NB 2PR4H 5KSVA 3CFKA 1TJIH 3WCYA 1DR9A 1S3KL 4I8DA 1KIRB 1YN6A 2FEDC 4TUOA 3F5WA 5DZLA 3DO3A 1MEXL 2BNUB 4HS3B 3RL1B 1ZGLP 2HFGL 4HUWA 4R9HA 4U1IA 2JB6B 3RVUC 1OF2A 3LMJL 4LPYA 2Q6WA 1OGAE 3MACL 4AM0A 1ZAGA 3MR9A 3FN0H 3O6FD 4OBRA 3L3IA 4WTXA 1W8OA 4MNQA 1CDUA 2YD3A 2BHUA 4LOUD 4E5XA 1J0IA 1VENA 4DN4L 4OZFH 1QRNA 2YMXL 1P7QB 3NCBB 1O7SA 1A9EB 3IDNB 3UTSA 2NX5D 4WFGE 4H1LG 4X6CB 4RFOH 4MX7A 5FHBH 3GSNL 4Y4KA 1BAFH 4OJFH 5DEFA 4P2QD 1FFOB 3NACH 2Z8SA 3UTOA 4M6NL 1G7QB 4PJXE 5FM8A 3KYAA 4XC3H 5C9JA 2DM4A 4M43L 1G9NC 3OAUL 1FNLA 2FCBA 4I0CC 1JPGA 2Z4QA 4PLJD 2A2QT 4ZDHB 3T0BA 2Z31B 1TENA 4HIHA 1HXYA 1M7DA 1Y0LA 1J0KA 1T2QH 1BFTA 4KUCF 2AV7A 1AR1C 2DM2A 4GAFB 1HN1A 1HEZB 5C0BE 1X5ZA 3EOAA 5D7IE 2X1WL 2ED8A 3S35X 4JFDB 4PJ5A 4FQ2L 4AEEA 3FOLA 2BXYA 3GJFB 4UT7L 3R8BB 4OCWL 4KKCC 1OGTB 1G6RA 3PF2A 5E56A 2YRPA 4GQPH 1W72L 2AJVL 5K59F 3VFSB 1QBML 3IJYB 3MLXH 3P4MA 1DP0A 3WNKA 2XG5A 4NQUA 1ZV5A 2P42B 2FJFB 3O4OB 1CN4A 4FTVE 4GLRH 1R3HB 3IGAA 1A6ZA 1KJ2B 4ENED 3MRDA 4W4OC 5EUOB 5L2KB 1QNZL 1WVZA 4NOFA 4RAVB 4D3CH 2OXGA 3CMOL 3JV0A 4YHPA 4YK4C 3LHPL 3FO0L 4GW1A 1CFTA 2ATPA 1E4XL 1N5YL 3V6BR 4OQTL 1IBGL 4JN1H 5HHVH 1G6VK 3KXFB 4PGCB 4J8RA 4GRWB 3WJLA 2IFGA 4XHJC 4MJ5B 4OZFA 2VKWA 5IEKA 5F8RC 4ODWA 2DTML 1ZT1A 2CJUL 1IQWH 4M7LH 4FG6D 3RWJA 2OL3L 3GIZL 1KB5B 1KCLA 3M07A 4XP1L 1XIWD 2ATKB 3ZE2E 5HY9B 3RY4A 4JFZH 2FB4H 1I1FA 2VZOA 4JY5L 2R23A 4LSDA 5SX4I 2VDMH 3O45A 4QXUL 1AKJA 2ADFH 2YZ1A 5TH2B 2G5BA 2PCPA 3U83A 5I18H 1RUKH 5F7EL 1FE8L 4NNXB 1DBKH 1P6AB 5KTEH 2AJXL 3W9EA 1Z9OA 1TETL 2VDKL 4U1HB 1VFAB 2GCYB 3TH4T 4N0YH 4QHNB 5H94A 1PAMA 3O9WA 1A3LH 4WV1B 2P48B 2FSEB 4W6WB 5EU3B 1RUAL 1I7ZA 1A6AB 1A6WH 4OGXL 2F5BL 4AL8H 1NH6A 4LVHC 1AGBB 2ZKHL 3H9ZA 4HPYL 4OKVB 5F1SA 1A7OL 4PJHA 3BESR 2YD7A 2HLAA 4K9EH 5FHAH 3MRNB 4NM8L 4P57A 1PZUB 2C1OB 5HGHA 2BOCA 3PGFH 5HD8C 3I50H 3WFDL 3Q6FA 1ACYH 4M00A 1J1PH 3QO0B 3LKPA 4DN3L 1K5NA 2FL5A 4NKDA 5ESQB 1CU4L 4HUUB 3U2SB 1KJ3L 4RNRB 1RZ7L 5LKNA 1A7NL 1B0RB 1LILA 1NC2A 1UKSA 3L3DB 4F57H 4XPAH 3ARBD 3OB0H 5C0AA 1URLA 3L5JA 4XPFH 3SE4A 1BX2A 1I7TA 1WCQA 3BN9D 2R4RL 5GGRA 1RIUH 1IM3A 3TZVA 1QEWB 4HLZG 1B2WL 4UZGA 3OPZL 3ARFB 5FYJE 4M6OH 1RZFH 4M1GL 3T4YB 2NXZD 5BV7H 1N0LA 1RVFL 1X5HA 1WF5A 1NCBL 4X9GA 3GI9H 4XP6L 2XXMB 1OM3L 4H8WL 4RISL 3JUYA 2DYPA 2VN7A 2KQNA 1CGUA 5ILTH 3WDHA 1MHCB 3I75B 3B9VA 1JIBA 3MFFB 3FFDA 3FQUB 3THML 2DLIA 4Z95L 1S7RB 1FGNL 3RZCD 4F8TA 2QQLL 3GIVB 4YXHH 3ESVF 5GRZA 3VH8B 5T3ZE 3PL6D 4Z7WA 5E2UL 5MEOB 3VU2A 3EYOA 1B90A 3Q0HA 3L7EB 4J3OC 1J12A 1RMFH 4PRAB 4WO4D 3F7VA 1NL0L 5D4QA 1L9NA 3MV8A 4MCZA 5CJXC 2K9UA 2NLJB 3HAEB 2MQCA 3SO3C 1SBSH 1QLFA 4OFKA 5I9QC 5DO2C 3L5WB 5L88H 4V1DD 1QFOA 5KSAB 4L4VD 4PUBL 4FZ8L 1EJ6A 4P23A 1I9RL 1MQKH 3ARTA 1NFDE 1WT5C 4F7MB 1E6OH 4WW1B 1JYWA 2YZ8A 3RWHB 3JV5A 4YGAB 3MQIA 4Z18A 3FT4B 3BKYL 1ZHLA 3D3VB 4G80A 3TA3C 5FXCH 4R26H 1CLCA 3MV7E 3LEXB 5EIIB 2NY6D 3RU8H 4Y4FB 4RGND 5KW9L 4QRSB 1YEFL 3T3PE 2GSIA 4XXCA 2CXKA 5J4MA 4ZTPH 2AXFA 3V52H 4KQ3L 4XNUH 3QI9C 5IB4A 1JYXA 5IFJB 3QNZB 3RIAF 1TIUA 1ZA6B 5LXGH 4G8EB 1E6JL 1EXUB 1VERA 5KN5A 2HTKC 3U7YH 4JQIL 2E7LA 1JFQH 3QEQD 1DVFA 5EOTB 2GQHA 5I1DB 2COQA 4N9GA 4LQ1A 1JUFB 2WIIB 3D18B 1PKQE 3U0WH 3STLB 5D2NA 2OBGA 2I9TB 1QBLH 1CLZH 5K9OA 4MA1B 3DECA 3O6FB 5ESVA 1JVKA 2Y9RT 3DYOA 5F97E 1ES0B 5JDJA 1LK3H 5LWYH 1CT8B 4OZHF 1AE6H 5DQ9B 1ETZB 2NX5B 4J23A 5EU6D 3B9KD 1EO8H 4OB5H 3NAAH 1WWWX 4P2QB 4CVZA 1HHIB 1DEDA 3PG2A 3UJIH 2UUDH