5FMNA

The nickel-responsive transcriptional regulator inrs
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
SQESLQKLVNRLSRIEGHIRGVKTMVQENRPCPEVLIQVAAVRGALDRVARLILDDHMNECITRAAAEGNIEQELAELKEALDRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INRS
publication title A tight tunable range for Ni(II) sensing and buffering in cells.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Dna binding protein
total genus 37
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5fmnA00
5LCYA 4ADZA 5LBMA 2HH7A 5FMNA 4M1PA 4UIGA 3AAIA
chains in the Genus database with same CATH superfamily
3GMIA 3F2EA 2V7JA 3G06A 3PU3A 3KBTA 2WMOA 4DV4T 5JDHA 1YQ4A 4HFIA 3RPUA 1UUSA 1UX5A 2V7MA 1OEDA 2Q9QB 4YTMA 4Q25A 3CX7B 3DJBA 3LG7A 4PNIA 4WW0A 2E9XA 1MMNA 2CHNA 5HWYA 3ESLA 4HFHA 5BR8T 3CX8B 3EHZA 3BQKA 4DV3T 3HKCE 5FXZA 5JR9B 4HFCA 4LF8T 1QUUA 1ZKEA 3AE2A 4YTPA 2BS4A 3ONJA 1D1CA 3R84B 4ZI3D 3EDUA 4TUYE 4F6RC 3VR9A 5F3JA 1KNPA 4I50E 5FXXA 4YJ3E 3TLWA 3K8PC 3NBXX 1NWMX 4M1PA 1HNWT 4I4TE 4KHPT 5AQJB 1HR0T 1KEYA 2JQ9A 3P7IA 5FVLA 3S4UA 2X9YA 3UFEA 5AQQB 2SPCA 2Y8DA 4X64T 4G2AA 2HPLA 2K24A 2EHOB 4EZHA 1XMOT 4YT0A 3ZPOA 1N34T 4PW8A 1J1JA 4ZI7E 3ZC1A 2Y48B 5EZYE 3RRCA 1QSDA 2X66A 5KX5E 5AQRB 2HN2A 1W09A 3PV0F 5ADXL 2HHHT 3RRWA 4DIDB 4DV6T 2XAFB 4IT4A 1KNRA 2E5LT 2W67A 3SWHA 1WYCA 2CRBA 2VQFT 4UV8B 2HH7A 4KMCA 5H6RB 3ZYKA 4PJJA 1G8XA 2BBHA 4UXNB 2WBLA 4PAGA 4COFA 3ZN0B 2MPKA 1Z8UA 3ZMZB 5FL1A 4IIJE 4UEMA 3FB2A 4HWCA 5DABA 4ILBA 3OTOT 3QB5A 1E7PA 2FUPA 4H9QC 4EEDA 1WYBA 5LP6E 4HWDA 5EK2A 4AXPA 1YXRA 3AE1A 4AKIA 2YKSA 5E0OA 3AE3A 4YJ2E 3I0OA 3AXJB 4EXTA 4BJNA 2I59A 5HAXA 2CXDA 1Y01A 4PK6A 3X1DA 2BBJA 5LHHB 2XAJB 4ZZBA 1QLBA 3T8OA 2JPFA 3ANWB 2IC9A 2CHOA 3K3QC 4CI1B 2YK0A 3RYFE 2X68A 3C50A 1D0ZA 1CUNA 2L8KA 4PFPA 2CA5A 3RYCE 2F4VT 3LFMA 4AQGA 2XSAA 1AJ3A 4IE0A 4DV5T 5HEOA 3BQIA 2C5KT 2N1GA 2PBIA 4P0BA 4GYRA 5ABEA 1E1HB 2CCQA 3LBXB 2J47A 3E0ZA 3PJAA 5AQNB 3O9XA 2W00A 3UU8A 4B3ST 5IUXA 3UUMA 2X51A 3Q5DA 4GYSA 3UQ4A 5A1LA 3C98B 4X1YE 2X9WA 2IDOB 3PDYA 2NW8A 4QH5A 2DLRA 2BKNA 2LOPA 2ZM2A 3HL6A 3TLUA 2WZIA 4ZEYA 3N2GE 2WZHA 4AKLA 4WYVA 4CI3B 1UCUA 5J1GA 2BG9C 5LJNA 4YSZA 5LBMA 4K0UA 2HN1A 2A3DA 5L3GB 3Q5WA 2LKHA 4P0AA 4LMJA 2JQKA 3AVSA 4EIWA 2YDRA 1J5ET 4ZOLE 5F8PA 5L4HA 4OX9T 4NIQA 4YSYA 4QH4A 1JNRA 4GIWA 2QYWA 3Q2MA 4ERRA 3RKGA 2D5UA 1N36T 2RP4A 5JREA 3ZCIA 4JLEA 1HNZT 2BS3A 5FXVA 4ISSA 4H9RC 5IYZE 1EZ3A 2NW7A 3H37A 5AQKB 2DWKA 3OPCA 5AQFB 3ZMSB 2X67A 5AQTB 4IDNA 3JAFA 3FZHB 4LFAT 4E7ZA 3AEEA 3KDSE 3M3ZB 4PJMA 1WFDA 3J7Yq 3RC3A 3RF1A 3IEEA 2IUBA 4XZCA 2D2SA 2WSSV 2DL1A 4Z90A 3JCFA 2XPKA 3EDVA 3LSVA 3AEGA 3AECA 4X66T 4AQFC 3UU4A 2D0TA 3C64A 1HX8A 5L3FB 4YFSA 4XAXB 4Z91A 1W9RA 3T1YT 5FNVE 1FMVA 2YDQA 4Z8XA 2V6YB 1MNEA 3AA7B 3NVOA 1MMAA 1OEDC 2G0UA 3RQWA 3ZT5A 2R6GF 2E9XC 3RC8A 3M65A 3RYHE 4IE7A 4MBQA 3UT5E 1HG5A 3KV5A 3FBZA 3IBPA 2V26A 3AA0B 5HXHA 2CBJA 2C5IT 2X0HA 3P8CD 3I0QA 4OHFA 3UTKA 1S35A 4YHHT 3ZKRA 1FJGT 1VCSA 3HKDE 4YXDA 2ACXA 3IHRA 3PUVF 4B3TT 2LJLA 3L8RA 1KF6A 4DVDA 5AQGB 2D9DA 4LFCT 4UVBB 1ZEEA 2ES0A 3ANWA 3PUYF 5IWAT 1NEKA 5L3EB 4PFOA 5J2TE 1B7TA 3UQ7A 2QRXA 2V8SV 5J2UE 2OLTA 3GN5B 2YDSA 4DR4T 1XDOA 4NXMT 3LK2B 2NOXA 3TLVA 3AAAB 3EI0A 2XQ7A 4TV8E 4EOZB 1WR0A 3KV4A 1G73A 4CN6A 5JDGA 4QXCB 3BK9A 2V5CA 5FP3A 3FZMB 3RIUA 2XZEA 4GKKT 3NRYA 1XZYA 3N9PA 4X5TA 3AAEB 3QNUA 3WAJA 5L47A 1Z0PA 3MA9A 3QOFA 2VB6A 2ZMAA 1LKXA 4IDPA 4UVCB 2YU1A 1N33T 3J9X1 4BA9A 4DR5T 1ZHCA 3PE0A 2MAWA 4ILUA 4P09A 2L3LA 3UUBA 2W61A 3O1HA 3NZQA 4DO0A 2H89A 3LK42 1W0AA 2BDEA 2H7VC 2XQ3A 1MNDA 3C4XA 4EEBA 2A72A 5HXRA 4LF6T 2V7LA 2JIWA 4TWDA 3VRAA 2LT3A 2Q9QD 4B3RT 1I6ZA 1HS7A 2Z6EA 4C91A 2CMRA 3PJAJ 2W63A 4YY3T 2RPAA 4WBNE 4ZI2D 2KWHA 3NRXA 1KK7A 2XQYA 4PK4A 2WCAA 4DBQA 3P4PA 4IDOA 4BAYB 3I9WA 3UUXB 2JJ9A 4BJMA 2XQ4A 2E8IA 2XM1A 5JRCB 4UF0B 5IHYA 3AE9A 3CIRA 1NAFA 2N9DA 4A98A 3ZCJA 4TWFA 4U3CA 3RIAA 3DTOA 4EAHA 4KBMB 2KSRA 4V1Av 2KT9A 3LDQB 4ZS3A 1IBLT 3VKGA 1US7B 4MFRA 3VKHA 2V7KA 4JI3T 3F31A 3BQLA 5ABFA 3CX6B 5J0ZA 3ABVA 2NWBA 2DCFA 3B57A 2EHOD 3L09A 4P1NA 4OYKA 5AFUL 4KUMB 2YEVC 4HWFA 4KHZF 5HEJA 2CBIA 4ILCA 2ZM8A 1YW0A 2XY8B 3P4WA 4O4IE 2CXLA 1BR0A 3MK7C 5JVDE 3ONLC 2V6YA 2M6IA 4EZ4A 4ZI3C 4TV9E 2V1DB 4DV2T 2NTXA 1HF8A 4LF5T 2DHRA 4GK5E 1D1BA 5KXJA 2BG9B 3ONXA 2N2NA 1IJ5A 1ZOYA 3FZLB 4A56A 5JQGE 1OXZA 1NENA 1IBKT 3JC6D 5C2TA 5HYAA 3O4XE 3UFGA 4YHJA 5BMVE 4DBRA 2ODUA 5LGNB 4IE5A 3AA6B 2JMHA 2VKJA 3RH3A 1T7SA 1XDPA 3SFEA 3QB5K 4X1IE 5LYJE 4NXNT 4MHCA 4J2CA 3K1SA 3I1AA 3I9YA 4MLKA 4H9PC 2HPJA 2D0UA 1D1AA 3L3PA 3HKBE 4DV0T 3CQGB 3C4ZA 1ZP0A 4NUUA 3KV9A 3ZYLA 2XQ6A 3ZLIA 1MMDA 3PUZF 4EV6A 2K5BB 3LJCA 2WDVA 5EK4A 4QH1A 4JEUB 4HN9A 4DMWA 5JDQA 2ZM6T 1X79A 1CHUA 3ZSTA 3RI5A 2FJEA 5AQVB 4IGUA 2CLYC 4HKAA 2WU2A 3ZSSA 4LMLA 5FY0A 1IZNB 4I55E 3A7MA 5LGTB 1M62A 3N9OA 3AA1B 3KVAA 2KLQA 4H9NC 3CQCB 4FI5A 1VRBA 2Q9QA 3CQXC 4KI0F 4KP3C 3N9NA 5JDLA 4EYYR 2A2FX 4OYJA 4AI6A 2DI4A 2W0GA 4DV1T 3AEDA 2DWGA 3FBLA 4JI1T 4LMKA 3MXZA 2JQHA 1HX1B 2IC6A 1OEDB 3AEBA 4O4HE 5JR9A 1SHZC 1U4QA 1YKEB 3N2KE 1N32T 4N78D 1S94A 4K0KT 1R8IA 2XAHB 2JQQA 4QHOA 3FXDB 1WRDA 3AVRA 4O2BE 2H88A 4DR1T 5L3DB 5LOVE 2WY2A 5CJ5A 5LHGB 5JDMA 5FL0A 4GK0E 2VWAA 4CZZB 1JNZA 4UF0A 5JRCA 3AEAA 2KINB 2YOEA 4AISA 2IAKA 4H63V 2CEAA 3PUWF 1J5WA 2EHOA 2ZLYA 1T72A 3FXEB 4JI7T 5AQLB 1D0XA 3ZT6A 4PJLA 3SRZA 2LHRA 1HCIA 3P4QA 3PURA 1E2AA 4AKRB 2UUAT 5CA0E 2CM0A 5AQOB 2VASA 4UIGA 3Q5XA 4FJOA 4ADZA 4JI0T 5JH7E 3JAEA 2XUEA 1UGOA 4AKHA 2AXDS 4KX6A 3RIUC 5HEUA 4XBFB 4F8HA 3UUNA 2X0LB 1H7CA 3NKZA 2WAUA 1SE7A 3ZMUB 3AE5A 1BR4A 3ZT7A 2LOSA 3PUQA 4TNVA 3CK6A 2BG9A 4QX7B 1IAPA 2UXXB 5L3BB 2UXNB 1FEWA 4EYUA 2KMFA 3VHLA 5HCMA 3GA8A 3MJXA 3AAIA 4GKJT 5LHIB 5FXWA 2XTLA 2MBGA 5HXSA 5HCJA 3AXJA 2LSIA 2OA5A 4YLHA 2M6BA 5L3CB 2FBWA 3A5XA 3VU7H 2WMNA 2WDRA 4YSXA 4HE8A 5CA1E 2NTYA 2KZ7B 5LMUT 4JV5T 4EGWA 2I6HA 2UXDT 2XASB 2KWIB 2WM9A 1LVKA 2QVAA 5FMNA 3SOLA 2NR4A 3KV6A 4E7SA 2C5JA 3AE7A 3A8YC 4CN4A 3HR0A 1W0BA 3HKEE 2M67A 2FJDA 4JI6T 3LBXA 4ZS2A 2FJBA 1M7KA 4B3MT 4QXHB 3UU5A 3ETUA 2VKDA 2UXBT 4DNDA 5LG3A 4LF4T 3C51A 5C8YE 3OJAA 1HNXT 3IF8B 2B76A 2LEHA 2CE7A 5DJQC 4U2YA 5LNKA 3ZJ1A 3RGLA 5C3JA 4IDZA 3KBUA 4X20E 4NUVA 1VCTA 3PUGA 4HFEA 4JI2T 5EK3A 4IDQA 2LSYA 4JI8T 3CMLA 2LKGA 2JRKA 2PFVA 3UU6A 3QC9A 3QUJA 3K3OA 3OBVE 1KFYA 3PU8A 2YU2A 3AE6A 2NP9A 1BR1A 4U33A 2VK9A 3O1IA 1HFAA 3UULA 3NWIA 3VRBA 5ABHA 2QA7A 3OYXA 2MTQA 3RHWA 3RQUA 3MACA 4HFVA 4QWNB 4JBWF 5F5WA 4TWHA 4ZHQE 4IHJE 1Y64B 5DQVA 3UU3A 2LRLA 3SS1A 5HEHA 1XNQT 3WI3A 4CI2B 2UU9T 3PUXF 3ZMVB 2W62A 3RLFF 5CGMA 3CWZB 3QK6A 4OFZA 4IE4A 3KFWX 1SA0E 3C4WA 1IJ6A 4DV7T 4DR3T 2ZM0A 4A97A 5LB7B 1UURA 2WS3A 4O4LE 4A5XA 1IBMT 2C0SA 3EUHA 1MMGA 1XMQT 1WLXA 2YINA 2J62A 3ZC0A 3F57A 2LSGA 4TN7B 5FKYA 5LJMA 2L9QA 2K9AA 3OVUA 5LMNT 5AQMB 2CLYB 2XAQB 3V5UA 5DQWA 4U7IA 2BKOA 3FZKB 5LCYA 3AEFA 5AQIB 4H63H 2LRKA 2B1EA 4JYAT 5L2LA 4L9IA 4NPPA 4QKNA 2E5VA 3IA3A 5HWXA 3B5MA 4HWHA 2XSBA 1HTJF 2CWOA 2XQAA 1BR2A 3EVYA 4CXWA 1LRZA 4EB6E 2Q9QC 4CN1A 2K3WA 4LF9T 4O8SA 1FIOA 2VL0A 4ZI2C 5AQPB 3TKLB 5CFBA 2WU5A 4U74A 4AIUA 2J1DG 4TNWA 2WWUA 4IL9A 2XQ9A 5TAOA 3CKDA 3AE8A 5LGUB 4UVAB 2LLYA 4HGAA 5JR9C 4TX5A 3R6NA 4JI4T 3NZPA 1UK5A 3GWHA 2WP9A 3E08A 2KXPB 4DR6T 4H9OC 3PTRB 5H6QB 1SUMB 2W66A 3RKOA 4IE6A 3HA4A 3WAKA 2V6XA 3FZFB 3V5SA 4DUYT 5LG4A 4ASKA 5FY7A 2QGSA 2VKOA 5AQHB 3GN5A 2LSJA 4C90A 3H3AA 3N9LA 3PUSA 4GOUA 2IW5B 5L4EA 1LVFA 2BKPA 4U31A 3RYIE 4X62T 4X1KE 3U78A 2LHNA 2EHOC 2ODVA 4L5GA 3RX6A 3P4RA 5JDFA 2A9UA 5FY1A 1L0VA 2W2UA 2DNXA 1DU2A 2CPTA 2WWVA 1VOMA 5AQSB 2JMKA 2UXCT 1XNRT 3KVBA 4UV9B 2PTFA 5CB4E 2I0MA 2VVSA 2IIUA 3LK3B 2KNDA 5AQUB 4YTNA 2BS2A 5LA6E 2H3RA 1MIVA 5HXEA 4WNKA 3AE4A 3JC6C 4HEAA 3DP7A 3E22E 3EAMA 3N5LA 2E9XB 3SFDA 4DR2T 4I0UA 2YN6A 1XWMA 2WDQA 2CXFA 2X9XA 4JI5T 4WBOA 2IHR1 2BVLA 4MALA 3P50A 5HXCA 2LSKA 4ANJA 4OK0A 4I43B 1MIYA 2E9XD 3ZYMA 3O1JA 2XM2A 3FHNA 2RA1A 3L39A 4CQIA 3RIFA 4DR7T 4HTEA 1HG2A 1I94T 4IL4A 2VVNA 1T98A 2J4GA 3EABA 1GQEA 1X9BA 2BG9E 4UELA 5FYMA 3KINB 4TZ4C 4HFDA 4O2AE 2H7OA 4ILAA 2X0YA 2VQET 1D0YA 2IMLA 3N2OA 1YQ3A 3Q9DA 3OKQA 3MKDA 2X9HA 5ABGA 4WZXA 4IREA 1MIWA 2BVMA 2PG8A 2K48A 2GK9A 4U7YA 3HI2A 3AB3B 2MOZA 5LXTE 2PJQA 3B13A 3N9QA 5ABFB 4PK5A 3U3IA 3H3MA 3CPZA 4G63A 4U2ZA 3P4SA 4H9SE 4LF7T 1ZV4X 4CXYA 3K3NA 2VKHA 3N9MA 3OYZA 2UUCT 4JUYA 4B6XA 1YD8G 2XAGB 5KDMC 4DMVA 5LBQB 1YKHB 2NW9A 4LFBT 3ZJ2A 5HEGA 2P9BA 3Q5EA 2XQ8A 4AKGA 3TLTA 2BZBA 4ISTA 1WCRA 4X65T 3MZKB 4O4JE 3JADA 4AQYT 5JTGA 5JDNA 3T1HT 2XJ7A 2ACZA 3ZEFB 1O3XA 2AE9A 2V5DA 2LM2A 4UR9A 4L0RA 2CWYA 2Y6XA 3VR8A 2W4XA 2OV9A 4JEHB 3ETVA 2UUBT 2FJAA 2WB5A 1U5PA 3ZN1B 2VL8A 5ETWA 2E2AA 2V7IA 4QX8B 3CVRA 5FVKA 1OEDE 5M4YA 1UX4A 2LM9A 1OWAA 1T8BA 2MYSA 4QXBB 5KMGP 5GONE 3PUAA 4CXXA 3W15B 2VURA 4HWIB 4U72A 2XHEB 4ZXLA 2LE8A 1FMWA 4HFBA 4PJNA 3ZMTB 3D0TA 1WR6A 4AQFA 1V9DA 4DUZT 4ZZCA 2XQ5A 2WQYA 3TLSA 1KNZA
chains in the Genus database with same CATH topology
3GMIA 3EDVA 5LCYA 3F2EA 2V7JA 5FY0A 4H63H 1IZNB 4AQFC 4I55E 3PU3A 5LGTB 3KBTA 2B1EA 5L2LA 2WMOA 2D0TA 3C64A 3N9OA 4L9IA 3AA1B 1HX8A 3KVAA 5L3FB 2KLQA 4QKNA 4H9NC 3CQCB 4YFSA 4FI5A 4XAXB 5JDHA 1VRBA 2Q9QA 3CQXC 5HWXA 5FNVE 1HTJF 2CWOA 3RPUA 4KP3C 1BR2A 1FMVA 3N9NA 5JDLA 4EYYR 3EVYA 2A2FX 4CXWA 1LRZA 4OYJA 4AI6A 1UX5A 2DI4A 2V7MA 2W0GA 4Z8XA 4EB6E 2Q9QB 2Q9QC 3CX7B 2DWGA 1MNEA 3DJBA 3AA7B 3LG7A 4PNIA 4WW0A 3FBLA 4O8SA 2E9XA 1MMNA 3MXZA 1FIOA 5HWYA 3V5UA 2IC6A 3ESLA 4O4HE 1MMAA 4ZI2C 2G0UA 3TKLB 4U74A 5JR9A 3CX8B 2J1DG 2WWUA 1SHZC 3BQKA 2E9XC 1U4QA 1YKEB 3HKCE 3N2KE 3RC8A 3M65A 5TAOA 3CKDA 3RYHE 4IE7A 4N78D 4MBQA 3UT5E 5FXZA 1S94A 1HG5A 3KV5A 3FBZA 5LGUB 4UVAB 3IBPA 5JR9B 2V26A 4HGAA 2XAHB 5JR9C 3AA0B 1QUUA 1ZKEA 2JQQA 5HXHA 4QHOA 4TX5A 2C5IT 3FXDB 1WRDA 3P8CD 1D1CA 3R6NA 3I0QA 4OHFA 3R84B 4ZI3D 3UTKA 3EDUA 3NZPA 1S35A 4TUYE 4F6RC 3AVRA 4O2BE 3GWHA 3E08A 5L3DB 2KXPB 4H9OC 5F3JA 5LOVE 3PTRB 5H6QB 5FXXA 4I50E 4YJ3E 3HKDE 3K8PC 5LHGB 2ACXA 3RKOA 4IE6A 3IHRA 5JDMA 3NBXX 3HA4A 2LJLA 1NWMX 4GK0E 2VWAA 3WAKA 4M1PA 3V5SA 5LG4A 4CZZB 5JRCA 4UF0A 4ASKA 4DVDA 4I4TE 2KINB 4UVBB 1ZEEA 2QGSA 5FY7A 2VKOA 2ES0A 2IAKA 3ANWA 3GN5A 2LSJA 3P7IA 4C90A 4H63V 2CEAA 3H3AA 3N9LA 3PUSA 2EHOA 3S4UA 2X9YA 2ZLYA 4PFOA 3UFEA 4GOUA 5L3EB 5J2TE 2IW5B 1B7TA 1LVFA 2Y8DA 2SPCA 3FXEB 5J2UE 3GN5B 4G2AA 2HPLA 2K24A 3RYIE 1D0XA 2EHOB 4X1KE 3U78A 3LK2B 2LHNA 4PJLA 2EHOC 2ODVA 4EZHA 4L5GA 2NOXA 3AAAB 3RX6A 4TV8E 3SRZA 2LHRA 3KV4A 5JDFA 3ZPOA 1HCIA 4EOZB 5FY1A 4PW8A 1G73A 3PURA 4AKRB 4ZI7E 2DNXA 5JDGA 4QXCB 3ZC1A 2Y48B 5CA0E 3BK9A 2CM0A 1VOMA 5EZYE 5FP3A 3RRCA 1QSDA 2X66A 2JMKA 2VASA 4UIGA 5KX5E 3Q5XA 4FJOA 5ADXL 4ADZA 3KVBA 3RRWA 5JH7E 3NRYA 4UV9B 2XUEA 5CB4E 3N9PA 4AKHA 3AAEB 3WAJA 2XAFB 3LK3B 2KNDA 3SWHA 1WYCA 1Z0PA 3MA9A 4XBFB 4UV8B 2HH7A 4KMCA 5H6RB 3UUNA 5LA6E 2VB6A 2ZMAA 3ZYKA 1LKXA 2H3RA 2X0LB 1H7CA 4UVCB 1MIVA 2YU1A 2WAUA 5HXEA 4PJJA 3ZMUB 1G8XA 3JC6C 4HEAA 4WNKA 3J9X1 4BA9A 3DP7A 1BR4A 1ZHCA 3E22E 3PE0A 4UXNB 2WBLA 2LOSA 4ILUA 3PUQA 4P09A 4PAGA 3ZN0B 2L3LA 3N5LA 2E9XB 3ZMZB 4IIJE 2W61A 4QX7B 4UEMA 3FB2A 3O1HA 3NZQA 4DO0A 1IAPA 3LK42 2UXXB 5L3BB 5DABA 2UXNB 1FEWA 4EYUA 2KMFA 2BDEA 2H7VC 3VHLA 1MNDA 3C4XA 3GA8A 2A72A 2CXFA 3MJXA 5HXRA 3AAIA 2V7LA 5LHIB 5FXWA 4H9QC 2XTLA 2X9XA 2LT3A 4WBOA 2Q9QD 2BVLA 1WYBA 2MBGA 1HS7A 2Z6EA 5HXSA 5LP6E 4MALA 4C91A 2CMRA 2LSIA 5HXCA 2OA5A 2W63A 4AXPA 5EK2A 4YLHA 4WBNE 5L3CB 4AKIA 2LSKA 4ANJA 4ZI2D 3A5XA 2KWHA 4OK0A 5E0OA 3VU7H 2WMNA 3NRXA 1KK7A 4YJ2E 2XQYA 3I0OA 4I43B 1MIYA 4PK4A 2E9XD 4HE8A 4EXTA 5CA1E 2NTYA 4DBQA 4BJNA 3ZYMA 3O1JA 2KZ7B 4BAYB 2I59A 3I9WA 3UUXB 2JJ9A 3FHNA 2RA1A 2CXDA 5HAXA 4PK6A 4BJMA 4CQIA 2E8IA 5LHHB 5JRCB 4UF0B 5IHYA 2XAJB 2XASB 2KWIB 2WM9A 1LVKA 4HTEA 5FMNA 1NAFA 1HG2A 3T8OA 2JPFA 2N9DA 3ANWB 1T98A 2IC9A 3ZCJA 3SOLA 3K3QC 4CI1B 2YK0A 3RYFE 3KV6A 2X68A 4E7SA 3C50A 1D0ZA 1CUNA 2L8KA 4PFPA 2C5JA 4UELA 2CA5A 3DTOA 4EAHA 5FYMA 3RYCE 3KINB 4TZ4C 4KBMB 4O2AE 3HR0A 3LFMA 3HKEE 4AQGA 4V1Av 1AJ3A 2KT9A 4IE0A 2H7OA 2M67A 4ZS3A 1D0YA 3BQIA 3VKGA 3LBXA 4ZS2A 3N2OA 3Q9DA 1US7B 3OKQA 3MKDA 2C5KT 2N1GA 2PBIA 4MFRA 3VKHA 2X9HA 4QXHB 2V7KA 4P0BA 3F31A 4GYRA 3BQLA 1E1HB 3ETUA 3CX6B 1MIWA 2BVMA 2PG8A 2K48A 2GK9A 2CCQA 2VKDA 3HI2A 3LBXB 3AB3B 4DNDA 3C51A 2NWBA 3E0ZA 5C8YE 3OJAA 2DCFA 3O9XA 2MOZA 5LXTE 3IF8B 3B57A 2EHOD 3L09A 2PJQA 2W00A 3B13A 3N9QA 4PK5A 4OYKA 5AFUL 3U3IA 2X51A 3UUMA 4KUMB 2YEVC 4GYSA 3CPZA 2LEHA 5A1LA 4G63A 3C98B 4X1YE 2X9WA 2ZM8A 1YW0A 2CE7A 3PDYA 5DJQC 4H9SE 5LNKA 1ZV4X 3ZJ1A 2NW8A 4CXYA 3K3NA 4O4IE 2CXLA 2DLRA 1BR0A 2VKHA 3MK7C 3N9MA 4IDZA 2LOPA 5JVDE 3OYZA 3KBUA 2ZM2A 4JUYA 4B6XA 1YD8G 4EZ4A 4X20E 3HL6A 2XAGB 5KDMC 4NUVA 3PUGA 4ZI3C 4TV9E 5EK3A 2V1DB 3N2GE 4DMVA 2LSYA 3CMLA 5LBQB 2NTXA 4AKLA 2JRKA 1HF8A 2PFVA 1YKHB 2DHRA 4GK5E 2NW9A 1D1BA 3ZJ2A 2P9BA 4AKGA 3ONXA 4CI3B 1UCUA 5J1GA 2N2NA 3QC9A 2BZBA 3QUJA 1IJ5A 3K3OA 5LJNA 3OBVE 4ISTA 3PU8A 2YU2A 5LBMA 4K0UA 4A56A 2A3DA 3MZKB 2NP9A 5L3GB 5JQGE 1OXZA 4O4JE 1BR1A 3Q5WA 2VK9A 3O1IA 3JC6D 5JDNA 4P0AA 1HFAA 3UULA 3ZEFB 5HYAA 1O3XA 3O4XE 4YHJA 5BMVE 2QA7A 3OYXA 4DBRA 2MTQA 3AVSA 4EIWA 2ODUA 5LGNB 4L0RA 2CWYA 3MACA 4HFVA 2Y6XA 4IE5A 4QWNB 4ZOLE 5F8PA 3AA6B 4ZHQE 4IHJE 1Y64B 2JMHA 5DQVA 4JEHB 3SS1A 3ETVA 2VKJA 3WI3A 4GIWA 3Q2MA 3RH3A 4CI2B 4ERRA 2D5UA 3ZMVB 1U5PA 2W62A 3ZN1B 2VL8A 4X1IE 2RP4A 5ETWA 5LYJE 3CWZB 5JREA 3QK6A 4OFZA 4MHCA 4J2CA 4IE4A 3KFWX 2V7IA 4QX8B 1SA0E 3CVRA 3ZCIA 3C4WA 4JLEA 1IJ6A 5M4YA 1UX4A 2LM9A 1OWAA 2ZM0A 2MYSA 3I1AA 3I9YA 4MLKA 4ISSA 4H9PC 5FXVA 2HPJA 2D0UA 1D1AA 3L3PA 3HKBE 4H9RC 4O4LE 5IYZE 1EZ3A 2NW7A 3C4ZA 3CQGB 3H37A 4NUUA 4QXBB 2DWKA 3KV9A 3ZYLA 5KMGP 3ZLIA 3ZMSB 2X67A 5GONE 3PUAA 1MMDA 4CXXA 3W15B 4E7ZA 2C0SA 3EUHA 4U72A 2K5BB 1MMGA 1WLXA 2YINA 3LJCA 3KDSE 3ZC0A 5EK4A 4PJMA 2XHEB 3F57A 4JEUB 3J7Yq 2LSGA 3RC3A 3IEEA 4TN7B 2LE8A 4HN9A 1FMWA 5LJMA 4PJNA 4DMWA 5JDQA 3ZMTB 3D0TA 1X79A 1WR6A 4XZCA 4AQFA 2D2SA 2L9QA 2WSSV 2K9AA 1V9DA 2CLYB 4IGUA 2CLYC 2XAQB 5DQWA 4HKAA 1KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCY A;  4ADZ A;  5LBM A;  2HH7 A;  5FMN A;  4M1P A;  4UIG A;  3AAI A; 
#chains in the Genus database with same CATH topology
 3GMI A;  3F2E A;  2V7J A;  3G06 A;  3PU3 A;  3KBT A;  2WMO A;  4DV4 T;  5JDH A;  1YQ4 A;  4HFI A;  3RPU A;  1UUS A;  1UX5 A;  2V7M A;  1OED A;  2Q9Q B;  4YTM A;  4Q25 A;  3CX7 B;  3DJB A;  3LG7 A;  4PNI A;  4WW0 A;  2E9X A;  1MMN A;  2CHN A;  5HWY A;  3ESL A;  4HFH A;  5BR8 T;  3CX8 B;  3EHZ A;  3BQK A;  4DV3 T;  3HKC E;  5FXZ A;  5JR9 B;  4HFC A;  4LF8 T;  1QUU A;  1ZKE A;  3AE2 A;  4YTP A;  2BS4 A;  3ONJ A;  1D1C A;  3R84 B;  4ZI3 D;  3EDU A;  4TUY E;  4F6R C;  3VR9 A;  5F3J A;  1KNP A;  4I50 E;  5FXX A;  4YJ3 E;  3TLW A;  3K8P C;  3NBX X;  1NWM X;  4M1P A;  1HNW T;  4I4T E;  4KHP T;  5AQJ B;  1HR0 T;  1KEY A;  2JQ9 A;  3P7I A;  5FVL A;  3S4U A;  2X9Y A;  3UFE A;  5AQQ B;  2SPC A;  2Y8D A;  4X64 T;  4G2A A;  2HPL A;  2K24 A;  2EHO B;  4EZH A;  1XMO T;  4YT0 A;  3ZPO A;  1N34 T;  4PW8 A;  1J1J A;  4ZI7 E;  3ZC1 A;  2Y48 B;  5EZY E;  3RRC A;  1QSD A;  2X66 A;  5KX5 E;  5AQR B;  2HN2 A;  1W09 A;  3PV0 F;  5ADX L;  2HHH T;  3RRW A;  4DID B;  4DV6 T;  2XAF B;  4IT4 A;  1KNR A;  2E5L T;  2W67 A;  3SWH A;  1WYC A;  2CRB A;  2VQF T;  4UV8 B;  2HH7 A;  4KMC A;  5H6R B;  3ZYK A;  4PJJ A;  1G8X A;  2BBH A;  4UXN B;  2WBL A;  4PAG A;  4COF A;  3ZN0 B;  2MPK A;  1Z8U A;  3ZMZ B;  5FL1 A;  4IIJ E;  4UEM A;  3FB2 A;  4HWC A;  5DAB A;  4ILB A;  3OTO T;  3QB5 A;  1E7P A;  2FUP A;  4H9Q C;  4EED A;  1WYB A;  5LP6 E;  4HWD A;  5EK2 A;  4AXP A;  1YXR A;  3AE1 A;  4AKI A;  2YKS A;  5E0O A;  3AE3 A;  4YJ2 E;  3I0O A;  3AXJ B;  4EXT A;  4BJN A;  2I59 A;  5HAX A;  2CXD A;  1Y01 A;  4PK6 A;  3X1D A;  2BBJ A;  5LHH B;  2XAJ B;  4ZZB A;  1QLB A;  3T8O A;  2JPF A;  3ANW B;  2IC9 A;  2CHO A;  3K3Q C;  4CI1 B;  2YK0 A;  3RYF E;  2X68 A;  3C50 A;  1D0Z A;  1CUN A;  2L8K A;  4PFP A;  2CA5 A;  3RYC E;  2F4V T;  3LFM A;  4AQG A;  2XSA A;  1AJ3 A;  4IE0 A;  4DV5 T;  5HEO A;  3BQI A;  2C5K T;  2N1G A;  2PBI A;  4P0B A;  4GYR A;  5ABE A;  1E1H B;  2CCQ A;  3LBX B;  2J47 A;  3E0Z A;  3PJA A;  5AQN B;  3O9X A;  2W00 A;  3UU8 A;  4B3S T;  5IUX A;  3UUM A;  2X51 A;  3Q5D A;  4GYS A;  3UQ4 A;  5A1L A;  3C98 B;  4X1Y E;  2X9W A;  2IDO B;  3PDY A;  2NW8 A;  4QH5 A;  2DLR A;  2BKN A;  2LOP A;  2ZM2 A;  3HL6 A;  3TLU A;  2WZI A;  4ZEY A;  3N2G E;  2WZH A;  4AKL A;  4WYV A;  4CI3 B;  1UCU A;  5J1G A;  2BG9 C;  5LJN A;  4YSZ A;  5LBM A;  4K0U A;  2HN1 A;  2A3D A;  5L3G B;  3Q5W A;  2LKH A;  4P0A A;  4LMJ A;  2JQK A;  3AVS A;  4EIW A;  2YDR A;  1J5E T;  4ZOL E;  5F8P A;  5L4H A;  4OX9 T;  4NIQ A;  4YSY A;  4QH4 A;  1JNR A;  4GIW A;  2QYW A;  3Q2M A;  4ERR A;  3RKG A;  2D5U A;  1N36 T;  2RP4 A;  5JRE A;  3ZCI A;  4JLE A;  1HNZ T;  2BS3 A;  5FXV A;  4ISS A;  4H9R C;  5IYZ E;  1EZ3 A;  2NW7 A;  3H37 A;  5AQK B;  2DWK A;  3OPC A;  5AQF B;  3ZMS B;  2X67 A;  5AQT B;  4IDN A;  3JAF A;  3FZH B;  4LFA T;  4E7Z A;  3AEE A;  3KDS E;  3M3Z B;  4PJM A;  1WFD A;  3J7Y q;  3RC3 A;  3RF1 A;  3IEE A;  2IUB A;  4XZC A;  2D2S A;  2WSS V;  2DL1 A;  4Z90 A;  3JCF A;  2XPK A;  3EDV A;  3LSV A;  3AEG A;  3AEC A;  4X66 T;  4AQF C;  3UU4 A;  2D0T A;  3C64 A;  1HX8 A;  5L3F B;  4YFS A;  4XAX B;  4Z91 A;  1W9R A;  3T1Y T;  5FNV E;  1FMV A;  2YDQ A;  4Z8X A;  2V6Y B;  1MNE A;  3AA7 B;  3NVO A;  1MMA A;  1OED C;  2G0U A;  3RQW A;  3ZT5 A;  2R6G F;  2E9X C;  3RC8 A;  3M65 A;  3RYH E;  4IE7 A;  4MBQ A;  3UT5 E;  1HG5 A;  3KV5 A;  3FBZ A;  3IBP A;  2V26 A;  3AA0 B;  5HXH A;  2CBJ A;  2C5I T;  2X0H A;  3P8C D;  3I0Q A;  4OHF A;  3UTK A;  1S35 A;  4YHH T;  3ZKR A;  1FJG T;  1VCS A;  3HKD E;  4YXD A;  2ACX A;  3IHR A;  3PUV F;  4B3T T;  2LJL A;  3L8R A;  1KF6 A;  4DVD A;  5AQG B;  2D9D A;  4LFC T;  4UVB B;  1ZEE A;  2ES0 A;  3ANW A;  3PUY F;  5IWA T;  1NEK A;  5L3E B;  4PFO A;  5J2T E;  1B7T A;  3UQ7 A;  2QRX A;  2V8S V;  5J2U E;  2OLT A;  3GN5 B;  2YDS A;  4DR4 T;  1XDO A;  4NXM T;  3LK2 B;  2NOX A;  3TLV A;  3AAA B;  3EI0 A;  2XQ7 A;  4TV8 E;  4EOZ B;  1WR0 A;  3KV4 A;  1G73 A;  4CN6 A;  5JDG A;  4QXC B;  3BK9 A;  2V5C A;  5FP3 A;  3FZM B;  3RIU A;  2XZE A;  4GKK T;  3NRY A;  1XZY A;  3N9P A;  4X5T A;  3AAE B;  3QNU A;  3WAJ A;  5L47 A;  1Z0P A;  3MA9 A;  3QOF A;  2VB6 A;  2ZMA A;  1LKX A;  4IDP A;  4UVC B;  2YU1 A;  1N33 T;  3J9X 1;  4BA9 A;  4DR5 T;  1ZHC A;  3PE0 A;  2MAW A;  4ILU A;  4P09 A;  2L3L A;  3UUB A;  2W61 A;  3O1H A;  3NZQ A;  4DO0 A;  2H89 A;  3LK4 2;  1W0A A;  2BDE A;  2H7V C;  2XQ3 A;  1MND A;  3C4X A;  4EEB A;  2A72 A;  5HXR A;  4LF6 T;  2V7L A;  2JIW A;  4TWD A;  3VRA A;  2LT3 A;  2Q9Q D;  4B3R T;  1I6Z A;  1HS7 A;  2Z6E A;  4C91 A;  2CMR A;  3PJA J;  2W63 A;  4YY3 T;  2RPA A;  4WBN E;  4ZI2 D;  2KWH A;  3NRX A;  1KK7 A;  2XQY A;  4PK4 A;  2WCA A;  4DBQ A;  3P4P A;  4IDO A;  4BAY B;  3I9W A;  3UUX B;  2JJ9 A;  4BJM A;  2XQ4 A;  2E8I A;  2XM1 A;  5JRC B;  4UF0 B;  5IHY A;  3AE9 A;  3CIR A;  1NAF A;  2N9D A;  4A98 A;  3ZCJ A;  4TWF A;  4U3C A;  3RIA A;  3DTO A;  4EAH A;  4KBM B;  2KSR A;  4V1A v;  2KT9 A;  3LDQ B;  4ZS3 A;  1IBL T;  3VKG A;  1US7 B;  4MFR A;  3VKH A;  2V7K A;  4JI3 T;  3F31 A;  3BQL A;  5ABF A;  3CX6 B;  5J0Z A;  3ABV A;  2NWB A;  2DCF A;  3B57 A;  2EHO D;  3L09 A;  4P1N A;  4OYK A;  5AFU L;  4KUM B;  2YEV C;  4HWF A;  4KHZ F;  5HEJ A;  2CBI A;  4ILC A;  2ZM8 A;  1YW0 A;  2XY8 B;  3P4W A;  4O4I E;  2CXL A;  1BR0 A;  3MK7 C;  5JVD E;  3ONL C;  2V6Y A;  2M6I A;  4EZ4 A;  4ZI3 C;  4TV9 E;  2V1D B;  4DV2 T;  2NTX A;  1HF8 A;  4LF5 T;  2DHR A;  4GK5 E;  1D1B A;  5KXJ A;  2BG9 B;  3ONX A;  2N2N A;  1IJ5 A;  1ZOY A;  3FZL B;  4A56 A;  5JQG E;  1OXZ A;  1NEN A;  1IBK T;  3JC6 D;  5C2T A;  5HYA A;  3O4X E;  3UFG A;  4YHJ A;  5BMV E;  4DBR A;  2ODU A;  5LGN B;  4IE5 A;  3AA6 B;  2JMH A;  2VKJ A;  3RH3 A;  1T7S A;  1XDP A;  3SFE A;  3QB5 K;  4X1I E;  5LYJ E;  4NXN T;  4MHC A;  4J2C A;  3K1S A;  3I1A A;  3I9Y A;  4MLK A;  4H9P C;  2HPJ A;  2D0U A;  1D1A A;  3L3P A;  3HKB E;  4DV0 T;  3CQG B;  3C4Z A;  1ZP0 A;  4NUU A;  3KV9 A;  3ZYL A;  2XQ6 A;  3ZLI A;  1MMD A;  3PUZ F;  4EV6 A;  2K5B B;  3LJC A;  2WDV A;  5EK4 A;  4QH1 A;  4JEU B;  4HN9 A;  4DMW A;  5JDQ A;  2ZM6 T;  1X79 A;  1CHU A;  3ZST A;  3RI5 A;  2FJE A;  5AQV B;  4IGU A;  2CLY C;  4HKA A;  2WU2 A;  3ZSS A;  4LML A;  5FY0 A;  1IZN B;  4I55 E;  3A7M A;  5LGT B;  1M62 A;  3N9O A;  3AA1 B;  3KVA A;  2KLQ A;  4H9N C;  3CQC B;  4FI5 A;  1VRB A;  2Q9Q A;  3CQX C;  4KI0 F;  4KP3 C;  3N9N A;  5JDL A;  4EYY R;  2A2F X;  4OYJ A;  4AI6 A;  2DI4 A;  2W0G A;  4DV1 T;  3AED A;  2DWG A;  3FBL A;  4JI1 T;  4LMK A;  3MXZ A;  2JQH A;  1HX1 B;  2IC6 A;  1OED B;  3AEB A;  4O4H E;  5JR9 A;  1SHZ C;  1U4Q A;  1YKE B;  3N2K E;  1N32 T;  4N78 D;  1S94 A;  4K0K T;  1R8I A;  2XAH B;  2JQQ A;  4QHO A;  3FXD B;  1WRD A;  3AVR A;  4O2B E;  2H88 A;  4DR1 T;  5L3D B;  5LOV E;  2WY2 A;  5CJ5 A;  5LHG B;  5JDM A;  5FL0 A;  4GK0 E;  2VWA A;  4CZZ B;  1JNZ A;  4UF0 A;  5JRC A;  3AEA A;  2KIN B;  2YOE A;  4AIS A;  2IAK A;  4H63 V;  2CEA A;  3PUW F;  1J5W A;  2EHO A;  2ZLY A;  1T72 A;  3FXE B;  4JI7 T;  5AQL B;  1D0X A;  3ZT6 A;  4PJL A;  3SRZ A;  2LHR A;  1HCI A;  3P4Q A;  3PUR A;  1E2A A;  4AKR B;  2UUA T;  5CA0 E;  2CM0 A;  5AQO B;  2VAS A;  4UIG A;  3Q5X A;  4FJO A;  4ADZ A;  4JI0 T;  5JH7 E;  3JAE A;  2XUE A;  1UGO A;  4AKH A;  2AXD S;  4KX6 A;  3RIU C;  5HEU A;  4XBF B;  4F8H A;  3UUN A;  2X0L B;  1H7C A;  3NKZ A;  2WAU A;  1SE7 A;  3ZMU B;  3AE5 A;  1BR4 A;  3ZT7 A;  2LOS A;  3PUQ A;  4TNV A;  3CK6 A;  2BG9 A;  4QX7 B;  1IAP A;  2UXX B;  5L3B B;  2UXN B;  1FEW A;  4EYU A;  2KMF A;  3VHL A;  5HCM A;  3GA8 A;  3MJX A;  3AAI A;  4GKJ T;  5LHI B;  5FXW A;  2XTL A;  2MBG A;  5HXS A;  5HCJ A;  3AXJ A;  2LSI A;  2OA5 A;  4YLH A;  2M6B A;  5L3C B;  2FBW A;  3A5X A;  3VU7 H;  2WMN A;  2WDR A;  4YSX A;  4HE8 A;  5CA1 E;  2NTY A;  2KZ7 B;  5LMU T;  4JV5 T;  4EGW A;  2I6H A;  2UXD T;  2XAS B;  2KWI B;  2WM9 A;  1LVK A;  2QVA A;  5FMN A;  3SOL A;  2NR4 A;  3KV6 A;  4E7S A;  2C5J A;  3AE7 A;  3A8Y C;  4CN4 A;  3HR0 A;  1W0B A;  3HKE E;  2M67 A;  2FJD A;  4JI6 T;  3LBX A;  4ZS2 A;  2FJB A;  1M7K A;  4B3M T;  4QXH B;  3UU5 A;  3ETU A;  2VKD A;  2UXB T;  4DND A;  5LG3 A;  4LF4 T;  3C51 A;  5C8Y E;  3OJA A;  1HNX T;  3IF8 B;  2B76 A;  2LEH A;  2CE7 A;  5DJQ C;  4U2Y A;  5LNK A;  3ZJ1 A;  3RGL A;  5C3J A;  4IDZ A;  3KBU A;  4X20 E;  4NUV A;  1VCT A;  3PUG A;  4HFE A;  4JI2 T;  5EK3 A;  4IDQ A;  2LSY A;  4JI8 T;  3CML A;  2LKG A;  2JRK A;  2PFV A;  3UU6 A;  3QC9 A;  3QUJ A;  3K3O A;  3OBV E;  1KFY A;  3PU8 A;  2YU2 A;  3AE6 A;  2NP9 A;  1BR1 A;  4U33 A;  2VK9 A;  3O1I A;  1HFA A;  3UUL A;  3NWI A;  3VRB A;  5ABH A;  2QA7 A;  3OYX A;  2MTQ A;  3RHW A;  3RQU A;  3MAC A;  4HFV A;  4QWN B;  4JBW F;  5F5W A;  4TWH A;  4ZHQ E;  4IHJ E;  1Y64 B;  5DQV A;  3UU3 A;  2LRL A;  3SS1 A;  5HEH A;  1XNQ T;  3WI3 A;  4CI2 B;  2UU9 T;  3PUX F;  3ZMV B;  2W62 A;  3RLF F;  5CGM A;  3CWZ B;  3QK6 A;  4OFZ A;  4IE4 A;  3KFW X;  1SA0 E;  3C4W A;  1IJ6 A;  4DV7 T;  4DR3 T;  2ZM0 A;  4A97 A;  5LB7 B;  1UUR A;  2WS3 A;  4O4L E;  4A5X A;  1IBM T;  2C0S A;  3EUH A;  1MMG A;  1XMQ T;  1WLX A;  2YIN A;  2J62 A;  3ZC0 A;  3F57 A;  2LSG A;  4TN7 B;  5FKY A;  5LJM A;  2L9Q A;  2K9A A;  3OVU A;  5LMN T;  5AQM B;  2CLY B;  2XAQ B;  3V5U A;  5DQW A;  4U7I A;  2BKO A;  3FZK B;  5LCY A;  3AEF A;  5AQI B;  4H63 H;  2LRK A;  2B1E A;  4JYA T;  5L2L A;  4L9I A;  4NPP A;  4QKN A;  2E5V A;  3IA3 A;  5HWX A;  3B5M A;  4HWH A;  2XSB A;  1HTJ F;  2CWO A;  2XQA A;  1BR2 A;  3EVY A;  4CXW A;  1LRZ A;  4EB6 E;  2Q9Q C;  4CN1 A;  2K3W A;  4LF9 T;  4O8S A;  1FIO A;  2VL0 A;  4ZI2 C;  5AQP B;  3TKL B;  5CFB A;  2WU5 A;  4U74 A;  4AIU A;  2J1D G;  4TNW A;  2WWU A;  4IL9 A;  2XQ9 A;  5TAO A;  3CKD A;  3AE8 A;  5LGU B;  4UVA B;  2LLY A;  4HGA A;  5JR9 C;  4TX5 A;  3R6N A;  4JI4 T;  3NZP A;  1UK5 A;  3GWH A;  2WP9 A;  3E08 A;  2KXP B;  4DR6 T;  4H9O C;  3PTR B;  5H6Q B;  1SUM B;  2W66 A;  3RKO A;  4IE6 A;  3HA4 A;  3WAK A;  2V6X A;  3FZF B;  3V5S A;  4DUY T;  5LG4 A;  4ASK A;  5FY7 A;  2QGS A;  2VKO A;  5AQH B;  3GN5 A;  2LSJ A;  4C90 A;  3H3A A;  3N9L A;  3PUS A;  4GOU A;  2IW5 B;  5L4E A;  1LVF A;  2BKP A;  4U31 A;  3RYI E;  4X62 T;  4X1K E;  3U78 A;  2LHN A;  2EHO C;  2ODV A;  4L5G A;  3RX6 A;  3P4R A;  5JDF A;  2A9U A;  5FY1 A;  1L0V A;  2W2U A;  2DNX A;  1DU2 A;  2CPT A;  2WWV A;  1VOM A;  5AQS B;  2JMK A;  2UXC T;  1XNR T;  3KVB A;  4UV9 B;  2PTF A;  5CB4 E;  2I0M A;  2VVS A;  2IIU A;  3LK3 B;  2KND A;  5AQU B;  4YTN A;  2BS2 A;  5LA6 E;  2H3R A;  1MIV A;  5HXE A;  4WNK A;  3AE4 A;  3JC6 C;  4HEA A;  3DP7 A;  3E22 E;  3EAM A;  3N5L A;  2E9X B;  3SFD A;  4DR2 T;  4I0U A;  2YN6 A;  1XWM A;  2WDQ A;  2CXF A;  2X9X A;  4JI5 T;  4WBO A;  2IHR 1;  2BVL A;  4MAL A;  3P50 A;  5HXC A;  2LSK A;  4ANJ A;  4OK0 A;  4I43 B;  1MIY A;  2E9X D;  3ZYM A;  3O1J A;  2XM2 A;  3FHN A;  2RA1 A;  3L39 A;  4CQI A;  3RIF A;  4DR7 T;  4HTE A;  1HG2 A;  1I94 T;  4IL4 A;  2VVN A;  1T98 A;  2J4G A;  3EAB A;  1GQE A;  1X9B A;  2BG9 E;  4UEL A;  5FYM A;  3KIN B;  4TZ4 C;  4HFD A;  4O2A E;  2H7O A;  4ILA A;  2X0Y A;  2VQE T;  1D0Y A;  2IML A;  3N2O A;  1YQ3 A;  3Q9D A;  3OKQ A;  3MKD A;  2X9H A;  5ABG A;  4WZX A;  4IRE A;  1MIW A;  2BVM A;  2PG8 A;  2K48 A;  2GK9 A;  4U7Y A;  3HI2 A;  3AB3 B;  2MOZ A;  5LXT E;  2PJQ A;  3B13 A;  3N9Q A;  5ABF B;  4PK5 A;  3U3I A;  3H3M A;  3CPZ A;  4G63 A;  4U2Z A;  3P4S A;  4H9S E;  4LF7 T;  1ZV4 X;  4CXY A;  3K3N A;  2VKH A;  3N9M A;  3OYZ A;  2UUC T;  4JUY A;  4B6X A;  1YD8 G;  2XAG B;  5KDM C;  4DMV A;  5LBQ B;  1YKH B;  2NW9 A;  4LFB T;  3ZJ2 A;  5HEG A;  2P9B A;  3Q5E A;  2XQ8 A;  4AKG A;  3TLT A;  2BZB A;  4IST A;  1WCR A;  4X65 T;  3MZK B;  4O4J E;  3JAD A;  4AQY T;  5JTG A;  5JDN A;  3T1H T;  2XJ7 A;  2ACZ A;  3ZEF B;  1O3X A;  2AE9 A;  2V5D A;  2LM2 A;  4UR9 A;  4L0R A;  2CWY A;  2Y6X A;  3VR8 A;  2W4X A;  2OV9 A;  4JEH B;  3ETV A;  2UUB T;  2FJA A;  2WB5 A;  1U5P A;  3ZN1 B;  2VL8 A;  5ETW A;  2E2A A;  2V7I A;  4QX8 B;  3CVR A;  5FVK A;  1OED E;  5M4Y A;  1UX4 A;  2LM9 A;  1OWA A;  1T8B A;  2MYS A;  4QXB B;  5KMG P;  5GON E;  3PUA A;  4CXX A;  3W15 B;  2VUR A;  4HWI B;  4U72 A;  2XHE B;  4ZXL A;  2LE8 A;  1FMW A;  4HFB A;  4PJN A;  3ZMT B;  3D0T A;  1WR6 A;  4AQF A;  1V9D A;  4DUZ T;  4ZZC A;  2XQ5 A;  2WQY A;  3TLS A;  1KNZ A; 
#chains in the Genus database with same CATH homology
 3GMI A;  3EDV A;  5LCY A;  3F2E A;  2V7J A;  5FY0 A;  4H63 H;  1IZN B;  4AQF C;  4I55 E;  3PU3 A;  5LGT B;  3KBT A;  2B1E A;  5L2L A;  2WMO A;  2D0T A;  3C64 A;  3N9O A;  4L9I A;  3AA1 B;  1HX8 A;  3KVA A;  5L3F B;  2KLQ A;  4QKN A;  4H9N C;  3CQC B;  4YFS A;  4FI5 A;  4XAX B;  5JDH A;  1VRB A;  2Q9Q A;  3CQX C;  5HWX A;  5FNV E;  1HTJ F;  2CWO A;  3RPU A;  4KP3 C;  1BR2 A;  1FMV A;  3N9N A;  5JDL A;  4EYY R;  3EVY A;  2A2F X;  4CXW A;  1LRZ A;  4OYJ A;  4AI6 A;  1UX5 A;  2DI4 A;  2V7M A;  2W0G A;  4Z8X A;  4EB6 E;  2Q9Q B;  2Q9Q C;  3CX7 B;  2DWG A;  1MNE A;  3DJB A;  3AA7 B;  3LG7 A;  4PNI A;  4WW0 A;  3FBL A;  4O8S A;  2E9X A;  1MMN A;  3MXZ A;  1FIO A;  5HWY A;  3V5U A;  2IC6 A;  3ESL A;  4O4H E;  1MMA A;  4ZI2 C;  2G0U A;  3TKL B;  4U74 A;  5JR9 A;  3CX8 B;  2J1D G;  2WWU A;  1SHZ C;  3BQK A;  2E9X C;  1U4Q A;  1YKE B;  3HKC E;  3N2K E;  3RC8 A;  3M65 A;  5TAO A;  3CKD A;  3RYH E;  4IE7 A;  4N78 D;  4MBQ A;  3UT5 E;  5FXZ A;  1S94 A;  1HG5 A;  3KV5 A;  3FBZ A;  5LGU B;  4UVA B;  3IBP A;  5JR9 B;  2V26 A;  4HGA A;  2XAH B;  5JR9 C;  3AA0 B;  1QUU A;  1ZKE A;  2JQQ A;  5HXH A;  4QHO A;  4TX5 A;  2C5I T;  3FXD B;  1WRD A;  3P8C D;  1D1C A;  3R6N A;  3I0Q A;  4OHF A;  3R84 B;  4ZI3 D;  3UTK A;  3EDU A;  3NZP A;  1S35 A;  4TUY E;  4F6R C;  3AVR A;  4O2B E;  3GWH A;  3E08 A;  5L3D B;  2KXP B;  4H9O C;  5F3J A;  5LOV E;  3PTR B;  5H6Q B;  5FXX A;  4I50 E;  4YJ3 E;  3HKD E;  3K8P C;  5LHG B;  2ACX A;  3RKO A;  4IE6 A;  3IHR A;  5JDM A;  3NBX X;  3HA4 A;  2LJL A;  1NWM X;  4GK0 E;  2VWA A;  3WAK A;  4M1P A;  3V5S A;  5LG4 A;  4CZZ B;  5JRC A;  4UF0 A;  4ASK A;  4DVD A;  4I4T E;  2KIN B;  4UVB B;  1ZEE A;  2QGS A;  5FY7 A;  2VKO A;  2ES0 A;  2IAK A;  3ANW A;  3GN5 A;  2LSJ A;  3P7I A;  4C90 A;  4H63 V;  2CEA A;  3H3A A;  3N9L A;  3PUS A;  2EHO A;  3S4U A;  2X9Y A;  2ZLY A;  4PFO A;  3UFE A;  4GOU A;  5L3E B;  5J2T E;  2IW5 B;  1B7T A;  1LVF A;  2Y8D A;  2SPC A;  3FXE B;  5J2U E;  3GN5 B;  4G2A A;  2HPL A;  2K24 A;  3RYI E;  1D0X A;  2EHO B;  4X1K E;  3U78 A;  3LK2 B;  2LHN A;  4PJL A;  2EHO C;  2ODV A;  4EZH A;  4L5G A;  2NOX A;  3AAA B;  3RX6 A;  4TV8 E;  3SRZ A;  2LHR A;  3KV4 A;  5JDF A;  3ZPO A;  1HCI A;  4EOZ B;  5FY1 A;  4PW8 A;  1G73 A;  3PUR A;  4AKR B;  4ZI7 E;  2DNX A;  5JDG A;  4QXC B;  3ZC1 A;  2Y48 B;  5CA0 E;  3BK9 A;  2CM0 A;  1VOM A;  5EZY E;  5FP3 A;  3RRC A;  1QSD A;  2X66 A;  2JMK A;  2VAS A;  4UIG A;  5KX5 E;  3Q5X A;  4FJO A;  5ADX L;  4ADZ A;  3KVB A;  3RRW A;  5JH7 E;  3NRY A;  4UV9 B;  2XUE A;  5CB4 E;  3N9P A;  4AKH A;  3AAE B;  3WAJ A;  2XAF B;  3LK3 B;  2KND A;  3SWH A;  1WYC A;  1Z0P A;  3MA9 A;  4XBF B;  4UV8 B;  2HH7 A;  4KMC A;  5H6R B;  3UUN A;  5LA6 E;  2VB6 A;  2ZMA A;  3ZYK A;  1LKX A;  2H3R A;  2X0L B;  1H7C A;  4UVC B;  1MIV A;  2YU1 A;  2WAU A;  5HXE A;  4PJJ A;  3ZMU B;  1G8X A;  3JC6 C;  4HEA A;  4WNK A;  3J9X 1;  4BA9 A;  3DP7 A;  1BR4 A;  1ZHC A;  3E22 E;  3PE0 A;  4UXN B;  2WBL A;  2LOS A;  4ILU A;  3PUQ A;  4P09 A;  4PAG A;  3ZN0 B;  2L3L A;  3N5L A;  2E9X B;  3ZMZ B;  4IIJ E;  2W61 A;  4QX7 B;  4UEM A;  3FB2 A;  3O1H A;  3NZQ A;  4DO0 A;  1IAP A;  3LK4 2;  2UXX B;  5L3B B;  5DAB A;  2UXN B;  1FEW A;  4EYU A;  2KMF A;  2BDE A;  2H7V C;  3VHL A;  1MND A;  3C4X A;  3GA8 A;  2A72 A;  2CXF A;  3MJX A;  5HXR A;  3AAI A;  2V7L A;  5LHI B;  5FXW A;  4H9Q C;  2XTL A;  2X9X A;  2LT3 A;  4WBO A;  2Q9Q D;  2BVL A;  1WYB A;  2MBG A;  1HS7 A;  2Z6E A;  5HXS A;  5LP6 E;  4MAL A;  4C91 A;  2CMR A;  2LSI A;  5HXC A;  2OA5 A;  2W63 A;  4AXP A;  5EK2 A;  4YLH A;  4WBN E;  5L3C B;  4AKI A;  2LSK A;  4ANJ A;  4ZI2 D;  3A5X A;  2KWH A;  4OK0 A;  5E0O A;  3VU7 H;  2WMN A;  3NRX A;  1KK7 A;  4YJ2 E;  2XQY A;  3I0O A;  4I43 B;  1MIY A;  4PK4 A;  2E9X D;  4HE8 A;  4EXT A;  5CA1 E;  2NTY A;  4DBQ A;  4BJN A;  3ZYM A;  3O1J A;  2KZ7 B;  4BAY B;  2I59 A;  3I9W A;  3UUX B;  2JJ9 A;  3FHN A;  2RA1 A;  2CXD A;  5HAX A;  4PK6 A;  4BJM A;  4CQI A;  2E8I A;  5LHH B;  5JRC B;  4UF0 B;  5IHY A;  2XAJ B;  2XAS B;  2KWI B;  2WM9 A;  1LVK A;  4HTE A;  5FMN A;  1NAF A;  1HG2 A;  3T8O A;  2JPF A;  2N9D A;  3ANW B;  1T98 A;  2IC9 A;  3ZCJ A;  3SOL A;  3K3Q C;  4CI1 B;  2YK0 A;  3RYF E;  3KV6 A;  2X68 A;  4E7S A;  3C50 A;  1D0Z A;  1CUN A;  2L8K A;  4PFP A;  2C5J A;  4UEL A;  2CA5 A;  3DTO A;  4EAH A;  5FYM A;  3RYC E;  3KIN B;  4TZ4 C;  4KBM B;  4O2A E;  3HR0 A;  3LFM A;  3HKE E;  4AQG A;  4V1A v;  1AJ3 A;  2KT9 A;  4IE0 A;  2H7O A;  2M67 A;  4ZS3 A;  1D0Y A;  3BQI A;  3VKG A;  3LBX A;  4ZS2 A;  3N2O A;  3Q9D A;  1US7 B;  3OKQ A;  3MKD A;  2C5K T;  2N1G A;  2PBI A;  4MFR A;  3VKH A;  2X9H A;  4QXH B;  2V7K A;  4P0B A;  3F31 A;  4GYR A;  3BQL A;  1E1H B;  3ETU A;  3CX6 B;  1MIW A;  2BVM A;  2PG8 A;  2K48 A;  2GK9 A;  2CCQ A;  2VKD A;  3HI2 A;  3LBX B;  3AB3 B;  4DND A;  3C51 A;  2NWB A;  3E0Z A;  5C8Y E;  3OJA A;  2DCF A;  3O9X A;  2MOZ A;  5LXT E;  3IF8 B;  3B57 A;  2EHO D;  3L09 A;  2PJQ A;  2W00 A;  3B13 A;  3N9Q A;  4PK5 A;  4OYK A;  5AFU L;  3U3I A;  2X51 A;  3UUM A;  4KUM B;  2YEV C;  4GYS A;  3CPZ A;  2LEH A;  5A1L A;  4G63 A;  3C98 B;  4X1Y E;  2X9W A;  2ZM8 A;  1YW0 A;  2CE7 A;  3PDY A;  5DJQ C;  4H9S E;  5LNK A;  1ZV4 X;  3ZJ1 A;  2NW8 A;  4CXY A;  3K3N A;  4O4I E;  2CXL A;  2DLR A;  1BR0 A;  2VKH A;  3MK7 C;  3N9M A;  4IDZ A;  2LOP A;  5JVD E;  3OYZ A;  3KBU A;  2ZM2 A;  4JUY A;  4B6X A;  1YD8 G;  4EZ4 A;  4X20 E;  3HL6 A;  2XAG B;  5KDM C;  4NUV A;  3PUG A;  4ZI3 C;  4TV9 E;  5EK3 A;  2V1D B;  3N2G E;  4DMV A;  2LSY A;  3CML A;  5LBQ B;  2NTX A;  4AKL A;  2JRK A;  1HF8 A;  2PFV A;  1YKH B;  2DHR A;  4GK5 E;  2NW9 A;  1D1B A;  3ZJ2 A;  2P9B A;  4AKG A;  3ONX A;  4CI3 B;  1UCU A;  5J1G A;  2N2N A;  3QC9 A;  2BZB A;  3QUJ A;  1IJ5 A;  3K3O A;  5LJN A;  3OBV E;  4IST A;  3PU8 A;  2YU2 A;  5LBM A;  4K0U A;  4A56 A;  2A3D A;  3MZK B;  2NP9 A;  5L3G B;  5JQG E;  1OXZ A;  4O4J E;  1BR1 A;  3Q5W A;  2VK9 A;  3O1I A;  3JC6 D;  5JDN A;  4P0A A;  1HFA A;  3UUL A;  3ZEF B;  5HYA A;  1O3X A;  3O4X E;  4YHJ A;  5BMV E;  2QA7 A;  3OYX A;  4DBR A;  2MTQ A;  3AVS A;  4EIW A;  2ODU A;  5LGN B;  4L0R A;  2CWY A;  3MAC A;  4HFV A;  2Y6X A;  4IE5 A;  4QWN B;  4ZOL E;  5F8P A;  3AA6 B;  4ZHQ E;  4IHJ E;  1Y64 B;  2JMH A;  5DQV A;  4JEH B;  3SS1 A;  3ETV A;  2VKJ A;  3WI3 A;  4GIW A;  3Q2M A;  3RH3 A;  4CI2 B;  4ERR A;  2D5U A;  3ZMV B;  1U5P A;  2W62 A;  3ZN1 B;  2VL8 A;  4X1I E;  2RP4 A;  5ETW A;  5LYJ E;  3CWZ B;  5JRE A;  3QK6 A;  4OFZ A;  4MHC A;  4J2C A;  4IE4 A;  3KFW X;  2V7I A;  4QX8 B;  1SA0 E;  3CVR A;  3ZCI A;  3C4W A;  4JLE A;  1IJ6 A;  5M4Y A;  1UX4 A;  2LM9 A;  1OWA A;  2ZM0 A;  2MYS A;  3I1A A;  3I9Y A;  4MLK A;  4ISS A;  4H9P C;  5FXV A;  2HPJ A;  2D0U A;  1D1A A;  3L3P A;  3HKB E;  4H9R C;  4O4L E;  5IYZ E;  1EZ3 A;  2NW7 A;  3C4Z A;  3CQG B;  3H37 A;  4NUU A;  4QXB B;  2DWK A;  3KV9 A;  3ZYL A;  5KMG P;  3ZLI A;  3ZMS B;  2X67 A;  5GON E;  3PUA A;  1MMD A;  4CXX A;  3W15 B;  4E7Z A;  2C0S A;  3EUH A;  4U72 A;  2K5B B;  1MMG A;  1WLX A;  2YIN A;  3LJC A;  3KDS E;  3ZC0 A;  5EK4 A;  4PJM A;  2XHE B;  3F57 A;  4JEU B;  3J7Y q;  2LSG A;  3RC3 A;  3IEE A;  4TN7 B;  2LE8 A;  4HN9 A;  1FMW A;  5LJM A;  4PJN A;  4DMW A;  5JDQ A;  3ZMT B;  3D0T A;  1X79 A;  1WR6 A;  4XZC A;  4AQF A;  2D2S A;  2L9Q A;  2WSS V;  2K9A A;  1V9D A;  2CLY B;  4IGU A;  2CLY C;  2XAQ B;  5DQW A;  4HKA A;  1KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...