5FMNA

The nickel-responsive transcriptional regulator inrs
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
b'SQESLQKLVNRLSRIEGHIRGVKTMVQENRPCPEVLIQVAAVRGALDRVARLILDDHMNECITRAAAEGNIEQELAELKEALDRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INRS
molecule tags Dna binding protein
source organism Synechocystis sp. pcc 6803
publication title A tight tunable range for Ni(II) sensing and buffering in cells.
pubmed doi rcsb
total genus 37
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5fmnA00
4UIGA 4ADZA 4M1PA 3AAIA 5FMNA 5LCYA 2HH7A 5LBMA
chains in the Genus database with same CATH superfamily
2K3WA 4QX7B 3RRWA 3GMIA 1E1HB 2LHRA 4A98A 5FY0A 3LJCA 3CWZB 2LM9A 4AQFC 4Q25A 2CLYC 1ZV4X 5LBMA 5ABGA 3ESLA 3CVRA 5LG3A 5LXTE 2IAKA 4NXNT 2YU1A 3O1IA 2WWVA 3U3IA 4WZXA 5CB4E 2CLYB 4H9SE 5AQUB 3PURA 4EAHA 2DWKA 3N9MA 5EZYE 2BG9C 4EZ4A 5ABEA 5JREA 3PU8A 3AA7B 5HEGA 4TX5A 3UFEA 1XDOA 3KV9A 4L5GA 4U7YA 3RIFA 4KHPT 3E08A 3Q5DA 3LBXA 3TLSA 4P0AA 2C5IT 1CUNA 3ZMZB 2A2FX 4I50E 1MNEA 2V7KA 1HX1B 1ZOYA 2WBLA 4HWCA 4H63H 5GONE 3NKZA 3AAAB 3SWHA 3UUNA 2BG9A 4JEHB 4CN1A 3ZKRA 5FL1A 4YHHT 4YFSA 4E7SA 3AEGA 3MJXA 5FVKA 2VB6A 2IW5B 3ONJA 4DIDB 4WW0A 3VRAA 3ZMSB 4ZHQE 4DR2T 4GK0E 4I43B 3HKCE 2BVMA 2N2NA 4H9NC 4CXXA 4EEBA 3LK3B 4AKIA 3OYZA 5FVLA 1W09A 2BS4A 4LMJA 4CI2B 2JJ9A 3HI2A 1NENA 4YHJA 4EOZB 5FMNA 4OYKA 3R84B 5ABFB 4DR5T 4WBNE 4XBFB 5IYZE 4ZZBA 3OTOT 1XMOT 3C51A 4JI4T 3PUZF 4P09A 4CN6A 4IL9A 4DMVA 2QYWA 3ANWA 3Q5WA 4Z90A 1YKEB 3F57A 4O4IE 4EEDA 4LMLA 1T98A 2D9DA 3NRYA 2JMHA 2WWUA 1HX8A 2ZMAA 2ZM6T 2XAHB 5LHIB 2V5DA 2X9WA 3FZLB 4XAXB 3RYCE 3TLVA 3C98B 2D5UA 3FBLA 3H37A 2WY2A 1V9DA 2NWBA 5AQMB 1HNWT 1M62A 2CXDA 2XTLA 2QVAA 3I9WA 5LMUT 1DU2A 3PU3A 4MFRA 2H3RA 3QB5K 4I4TE 2KSRA 2E2AA 4WNKA 3RPUA 4JI0T 5FY7A 2EHOC 4OYJA 5KMGP 4L0RA 3JC6D 4LF5T 2V6XA 2NTXA 2BVLA 3N9QA 4HFHA 1UX5A 1L0VA 4X64T 4LMKA 1WR0A 4HFBA 5AQRB 1S94A 4I0UA 3RQWA 5FXXA 3CQCB 4COFA 2XSBA 4JUYA 4EYUA 4PFOA 3FZFB 4H9OC 4YTMA 5LCYA 4ILAA 1J1JA 2PFVA 4JI5T 3ZYLA 5AQFB 4DV2T 4U7IA 3FZHB 3CK6A 1VCTA 2XAGB 1W0AA 2KINB 2BDEA 1D1CA 2H89A 5L4EA 3AE6A 2FJAA 2OV9A 3JAEA 5DABA 5FY1A 3RH3A 3T1HT 2CBJA 2C5KT 5FKYA 3EAMA 3OJAA 2UU9T 3EUHA 5L3BB 2BS3A 2K9AA 3ZN0B 5AQNB 2CCQA 4GIWA 2LT3A 5LP6E 1WRDA 3BQIA 4TUYE 2XQAA 2ZLYA 3BQKA 3UULA 3AE9A 3ZC1A 2LRLA 4JI3T 4UVCB 2CA5A 3KBTA 1YXRA 1SHZC 4A56A 3ZSTA 4AQGA 4KUMB 1HS7A 2XZEA 3CX6B 4DUYT 1T72A 2WS3A 1UGOA 3WI3A 2UUCT 3TLTA 3OVUA 3AEDA 2I0MA 2X9YA 5L3GB 3MA9A 4C91A 2YDQA 4DR4T 3KFWX 2WDVA 3AVSA 1JNRA 3KBUA 3HA4A 4NUUA 3MACA 5AQIB 4DR3T 4MHCA 4X20E 4YJ3E 4DR6T 4F8HA 1KNPA 2CXLA 1YW0A 2YOEA 3LK42 3O1JA 4PJNA 4Z91A 2WQYA 1LKXA 4H9PC 3AVRA 1UCUA 3N5LA 2W0GA 4DBRA 2XM1A 3NZQA 5LHHB 4B3TT 3ZMTB 2XAJB 4AI6A 5JDFA 2J4GA 3BQLA 2IDOB 2LSYA 4UELA 3R6NA 2PG8A 2JQ9A 2OLTA 3FXDB 1NEKA 2BBHA 3AA6B 4HFCA 4LF4T 2R6GF 1YKHB 2MOZA 2V5CA 3P7IA 4K0KT 1IAPA 3N2OA 1WFDA 3UU4A 3ZMUB 3B5MA 3ZYKA 3RYHE 1XDPA 5HEHA 2Y8DA 2DNXA 4CXWA 4DV5T 2NR4A 2K5BB 2Q9QB 3AAEB 2VVNA 2Z6EA 4JBWF 2NTYA 4LFAT 3EDVA 4UR9A 4GKKT 2FJEA 1W0BA 3UUBA 5E0OA 2RP4A 3PTRB 5L3DB 3KV5A 5FYMA 2HN1A 3LDQB 2XSAA 2XHEB 5CA1E 5LJNA 4IDPA 2E9XD 1U5PA 4B3MT 5CJ5A 3ZEFB 2VKJA 2KT9A 3FZMB 3P4PA 2JMKA 2NW8A 3KV4A 4UIGA 4X5TA 2L9QA 3K1SA 2V26A 2IIUA 4O4JE 3ZJ2A 3ETUA 1AJ3A 2GK9A 2LRKA 2BBJA 1FIOA 4UV8B 2XQ3A 3ZC0A 1MMGA 5HXCA 2W61A 5LBQB 5C8YE 1LVKA 2V7JA 4G2AA 4ZI3C 1OWAA 2V7IA 3L3PA 3J9X1 4UVBB 3VR8A 2UXBT 5EK2A 2LJLA 2KWHA 4NIQA 5HWXA 3ETVA 4TV9E 2W2UA 4LF7T 4O4HE 3GWHA 3P4QA 3Q9DA 5JVDE 2M6BA 3VR9A 4ANJA 1J5WA 5H6RB 4DR7T 4CN4A 2NP9A 2YEVC 1HG2A 2J62A 3ZCIA 3C4XA 2JRKA 3M3ZB 3GN5B 2KMFA 5AQQB 5JQGE 3QNUA 5IWAT 1ZP0A 1HFAA 2KWIB 2RA1A 2AXDS 2M6IA 3LSVA 4ZS3A 1N36T 3PUGA 5FXVA 3T1YT 2XQ5A 2XJ7A 4HFEA 3A8YC 3AXJB 4MALA 1MNDA 5HXRA 2V6YA 1D1AA 2DHRA 3UU8A 4OX9T 1XNRT 4KBMB 5ABHA 4HEAA 4A5XA 3NWIA 5JDQA 5AQKB 4KHZF 2QA7A 3K3NA 5HXEA 3T8OA 2VWAA 2NOXA 4QX8B 3AB3B 4AKLA 5J0ZA 1X79A 1YQ4A 5J2TE 4ZEYA 5M4YA 1WLXA 4UV9B 4EB6E 5TAOA 1G73A 4ISTA 5DQWA 2YN6A 5H6QB 3B57A 2BS2A 3QB5A 3J7Yq 1SE7A 2W63A 3AE1A 3M65A 4HFIA 2UXXB 1VCSA 2A72A 1G8XA 1LVFA 2LKHA 2XQ7A 1IZNB 3AE7A 3H3AA 2CRBA 3HKBE 3IBPA 2PTFA 3KDSE 2CPTA 3LFMA 3RX6A 3JC6C 4GYRA 3UU5A 2DI4A 4IE7A 4TWDA 4CQIA 4DV7T 4DV1T 4EYYR 2CHNA 4NXMT 4PJMA 3RIUC 1MMNA 2BKPA 4CZZB 5HEUA 3FHNA 1JNZA 3AXJA 4MLKA 2C5JA 2IUBA 4DVDA 4X66T 4DUZT 2CWOA 2X67A 4O4LE 4TZ4C 2X9HA 3SRZA 3PJAA 5JDLA 5LGTB 3U78A 4QKNA 4DMWA 3Q5EA 4ILCA 1Y64B 3E22E 3RIUA 4AIUA 4JI6T 4UXNB 1SUMB 3UUMA 3Q5XA 1Y01A 3UUXB 4YSXA 5HCJA 2IHR1 2MPKA 2FJDA 3MK7C 2QRXA 1YQ3A 3NZPA 3PUQA 4IDNA 1D0XA 1LRZA 2FBWA 3UQ4A 3G06A 2H7VC 4H63V 4HN9A 5L3FB 1VOMA 4JEUB 2XM2A 3ZT5A 3Q2MA 5AQLB 4LF8T 1XNQT 2BG9B 3QOFA 1FJGT 2E9XB 3CX7B 3OPCA 4F6RC 3RQUA 3IHRA 1BR4A 1BR1A 1KF6A 3ZT6A 5HXHA 4JI8T 5JDMA 4AXPA 1N34T 1GQEA 4P1NA 1MIWA 2W67A 3N9PA 1HG5A 2RPAA 4O2AE 2Y6XA 2LOPA 2LSGA 3PUYF 1HNZT 4AKHA 4U74A 5ABFA 3A5XA 2XAQB 2IMLA 3ABVA 3I0OA 2KNDA 3BK9A 3EVYA 3RKGA 3VHLA 3ZMVB 2VL8A 3H3MA 3D0TA 3WAKA 4GK5E 3AE4A 3I1AA 2KLQA 2P9BA 1MMDA 2AE9A 4I55E 4KMCA 4U2YA 4IT4A 5AQJB 2WU5A 3QC9A 2DL1A 3UT5E 2VASA 5LYJE 5LB7B 2V7MA 4GOUA 5IUXA 4TV8E 5BR8T 2WU2A 1WYCA 2I6HA 3PUAA 4FI5A 4FJOA 2ZM0A 3I0QA 3S4UA 4GKJT 2YDSA 1FMWA 2VK9A 4ISSA 4JI1T 5AQPB 2UUAT 4QWNB 1IBMT 1FEWA 2LE8A 1XMQT 1QSDA 3E0ZA 4HFVA 3QK6A 2LOSA 2HN2A 3P4WA 4IDQA 1MIYA 5F3JA 4DR1T 4YLHA 2ACXA 2BKNA 1BR2A 2X0LB 2D2SA 2XPKA 3O1HA 3NRXA 4IE0A 4U3CA 2IC9A 3P50A 5AQSB 3LBXB 3N9NA 5F5WA 5BMVE 2WAUA 4B6XA 2DWGA 3ZSSA 4WBOA 2J47A 4UVAB 3N9LA 2PJQA 3C4WA 4WYVA 3RYIE 2UXDT 2JQHA 2JPFA 1OEDB 2FJBA 4ILBA 4P0BA 4M1PA 4HWIB 4Z8XA 4JI2T 1KNZA 4IREA 3TLWA 4EGWA 2N9DA 3O4XE 5JR9A 5J2UE 3ONXA 3KVAA 1OEDC 3QUJA 2YDRA 4DBQA 4X65T 4HE8A 4ZXLA 3UTKA 1D1BA 3VRBA 3W15B 4A97A 5JTGA 2PBIA 4OFZA 4TN7B 3LK2B 5LHGB 3K3OA 1ZHCA 4PFPA 4EZHA 4X62T 1Z0PA 2WMNA 3OYXA 3P4RA 4TNWA 3ZYMA 3DTOA 3V5UA 4BA9A 5A1LA 1NAFA 2LM2A 4YTNA 2F4VT 1IBKT 2FUPA 5JR9C 3AE5A 1ZKEA 3EI0A 3FBZA 3RRCA 4AKGA 2LLYA 2WB5A 3VKGA 4G63A 3AEFA 2WZIA 4KP3C 5DQVA 2ES0A 4YSYA 2X9XA 2MAWA 2X66A 2CE7A 3GN5A 4JI7T 1I94T 2OA5A 3JCFA 4QH5A 2CMRA 4BJMA 4QH1A 4AQYT 5CGMA 1H7CA 1OEDE 2XY8B 3CPZA 2LSIA 4QXCB 1NWMX 2V8SV 1OXZA 3TKLB 2E8IA 4U72A 4UF0B 3RF1A 4C90A 5F8PA 3VU7H 1VRBA 4IL4A 4YTPA 2WMOA 2D0UA 3AE3A 4DV3T 1KFYA 1HF8A 2KZ7B 2YKSA 3PUXF 4QXHB 5CA0E 5AQVB 4TWHA 5JR9B 3L09A 1FMVA 4QH4A 2H88A 3PJAJ 1S35A 2D0TA 2EHOB 3IA3A 2Q9QD 3AA1B 4L9IA 2SPCA 5JDNA 3VKHA 2XASB 4J2CA 3RIAA 2JIWA 2CHOA 2B1EA 1YD8G 4ADZA 3CIRA 3UU3A 5LGNB 2A3DA 2VQET 5LMNT 5KDMC 2HH7A 4EIWA 2WCAA 4U2ZA 5J1GA 2XAFB 4BAYB 1EZ3A 4O8SA 1KNRA 3RC8A 2UXCT 2C0SA 2X68A 4U31A 4NPPA 5DJQC 2VQFT 1R8IA 3LG7A 2Q9QA 2CXFA 4IGUA 4X1IE 3P8CD 5LJMA 1HTJF 2N1GA 3PUVF 3N2KE 4N78D 3RKOA 1WR6A 2MYSA 4X1YE 2EHOD 3C64A 2MTQA 3HKEE 3L8RA 2CBIA 5KX5E 3NVOA 4ZI2D 2LHNA 2LKGA 2M67A 3MKDA 2I59A 1Z8UA 4UF0A 5AQTB 4LFCT 4XZCA 3B13A 5HYAA 3K8PC 2E5VA 1E2AA 4YT0A 1CHUA 2DLRA 2UXNB 5KXJA 2K48A 4DO0A 5LA6E 1B7TA 2WSSV 4JLEA 4U33A 3A7MA 2L3LA 2JQKA 5JDHA 3ZN1B 1QUUA 1I6ZA 5ETWA 3SFEA 5LG4A 3DP7A 5HWYA 3UU6A 4EXTA 4CI1B 3UQ7A 2DCFA 2A9UA 2LSJA 2E9XC 3AE2A 1IJ6A 3DJBA 3PV0F 1O3XA 3ZLIA 4AISA 2Y48B 4ZI7E 3I9YA 4IIJE 2NW7A 4ZZCA 4HTEA 4AQFA 1US7B 2VVSA 3P4SA 4LFBT 5HEOA 2W4XA 2B76A 2H7OA 3IF8B 4LF9T 2XUEA 3FXEB 3ZCJA 5L47A 2HHHT 5CFBA 4IHJE 4PJLA 4HFDA 1W9RA 4HWHA 3F31A 4PK4A 5L4HA 3X1DA 4ZI3D 3SOLA 5LNKA 2XQ8A 4ZI2C 2IC6A 2ODVA 1KEYA 3AEEA 4KI0F 1IBLT 4IDOA 2E9XA 2ACZA 2E5LT 4PJJA 3GA8A 3RC3A 3F2EA 1WYBA 2XQ4A 3C4ZA 4YSZA 3AEAA 4ILUA 4TWFA 1D0ZA 2YINA 4BJNA 2ODUA 5JH7E 4OHFA 3HL6A 2V6YB 4PAGA 2KXPB 1N33T 4CXYA 3C50A 4NUVA 5C3JA 3OKQA 5AFUL 3CX8B 4E7ZA 1OEDA 2VKOA 3FZKB 4QXBB 4ZS2A 3V5SA 2QGSA 4B3ST 3O9XA 5AQGB 1T8BA 2VKDA 3CQXC 3RYFE 5EK4A 5JRCA 3ONLC 2X0HA 2BZBA 4YXDA 4AKRB 3EDUA 1QLBA 2BG9E 2G0UA 4DV0T 5HAXA 3KINB 5FP3A 2LSKA 5HXSA 2VURA 1HCIA 3AE8A 3TLUA 2W00A 2WDQA 3MZKB 2W66A 3ANWB 4HKAA 2YU2A 1X9BA 2WDRA 4DV6T 4GYSA 2ZM2A 2WP9A 4ZOLE 1XZYA 3UFGA 3EABA 1WCRA 1UURA 3RGLA 3MXZA 1UX4A 2BKOA 4TNVA 5L3EB 3JADA 4UEMA 4HWDA 1N32T 2V7LA 3PE0A 2WZHA 4K0UA 4ERRA 2VKHA 1KK7A 2CM0A 3ZJ1A 1J5ET 4QHOA 5L3CB 5HEJA 4IE4A 3PUSA 2HPLA 4PNIA 3IEEA 5FXZA 5AQHB 2MBGA 5FXWA 2J1DG 3KV6A 3RLFF 4YJ2E 4IDZA 4PK5A 5FNVE 3K3QC 2WM9A 4HWFA 5FL0A 3N9OA 3ZPOA 4DV4T 4YY3T 3L39A 1XWMA 4PK6A 4EV6A 2NW9A 2XQ9A 3AECA 3SS1A 4ASKA 5JRCB 2CWYA 2XQ6A 2XQYA 2X0YA 4JV5T 2EHOA 3ZT7A 5ADXL 2YK0A 4HGAA 1HNXT 3FB2A 4LF6T 1ZEEA 4H9QC 3RHWA 1D0YA 2X51A 2LEHA 4H9RC 3SFDA 4DNDA 5L2LA 3AA0B 1U4QA 2ZM8A 5C2TA 3CMLA 3JAFA 5IHYA 2Q9QC 4KX6A 3HKDE 5AQOB 3WAJA 3EHZA 5LOVE 2K24A 2W62A 3RI5A 3NBXX 5LGUB 4B3RT 1T7SA 5HCMA 1E7PA 1UUSA 3AEBA 3HR0A 3KVBA 1IJ5A 2CEAA 2VL0A 3PDYA 2UUBT 4O2BE 4JYAT 1UK5A 3N2GE 3CQGB 4X1KE 2HPJA 4MBQA 4CI3B 2L8KA 4IE5A 1M7KA 1MMAA 2JQQA 3PUWF 4PW8A 2V1DB 1MIVA 3AAIA 1BR0A 1SA0E 3OBVE 4OK0A 5JDGA 4IE6A 3CKDA 4V1Av 1HR0T 5EK3A
chains in the Genus database with same CATH topology
4QX7B 3RRWA 3GMIA 1E1HB 2LHRA 5FY0A 3LJCA 3CWZB 2LM9A 4AQFC 2CLYC 1ZV4X 5LBMA 5LXTE 3ESLA 3CVRA 2IAKA 2YU1A 3O1IA 3U3IA 5CB4E 2CLYB 4H9SE 4EAHA 3PURA 2DWKA 3N9MA 5EZYE 4EZ4A 5JREA 3PU8A 3AA7B 4TX5A 3UFEA 3KV9A 4L5GA 3E08A 3LBXA 4P0AA 2C5IT 1CUNA 3ZMZB 2A2FX 4I50E 1MNEA 2V7KA 2WBLA 5GONE 3UUNA 3SWHA 4H63H 3ZC1A 3AAAB 4JEHB 4YFSA 4E7SA 3MJXA 2VB6A 2IW5B 4WW0A 3ZMSB 4ZHQE 4GK0E 4I43B 3HKCE 2BVMA 2N2NA 4H9NC 4CXXA 3LK3B 4AKIA 3OYZA 4CI2B 4EOZB 2JJ9A 3HI2A 4YHJA 4XBFB 5FMNA 4OYKA 3R84B 4WBNE 5IYZE 3C51A 4P09A 4DMVA 3ANWA 3Q5WA 1YKEB 3F57A 4O4IE 1T98A 3NRYA 2JMHA 2WWUA 1HX8A 2ZMAA 2XAHB 5LHIB 2X9WA 4XAXB 3RYCE 3C98B 2D5UA 3FBLA 3H37A 1V9DA 2NWBA 2CXDA 2XTLA 3I9WA 3PU3A 4MFRA 2H3RA 4I4TE 4WNKA 3RPUA 5FY7A 2EHOC 4OYJA 5KMGP 4L0RA 3JC6D 2NTXA 2BVLA 3N9QA 1UX5A 1S94A 5FXXA 3CQCB 4JUYA 4EYUA 4PFOA 4H9OC 5LCYA 2PFVA 3ZYLA 2XAGB 2BDEA 2KINB 1D1CA 5DABA 5FY1A 2C5KT 3OJAA 3EUHA 5L3BB 2K9AA 3ZN0B 2CCQA 4GIWA 2LT3A 5LP6E 1WRDA 3BQIA 4TUYE 2ZLYA 3BQKA 3UULA 4UVCB 2CA5A 3KBTA 4A56A 1SHZC 4AQGA 1HS7A 4KUMB 3CX6B 2X9YA 5L3GB 3MA9A 4C91A 3KFWX 3AVSA 3KBUA 4NUUA 3HA4A 3MACA 4MHCA 4X20E 4YJ3E 2CXLA 1YW0A 4PJNA 3LK42 3O1JA 1LKXA 4H9PC 3AVRA 1UCUA 3N5LA 2W0GA 4DBRA 3NZQA 5LHHB 3ZMTB 2XAJB 4AI6A 5JDFA 3BQLA 3R6NA 2LSYA 4UELA 2PG8A 3FXDB 3AA6B 1YKHB 2MOZA 3P7IA 1IAPA 3N2OA 3ZMUB 3ZYKA 3RYHE 2Y8DA 2DNXA 4CXWA 2Q9QB 2K5BB 3AAEB 2Z6EA 2NTYA 3EDVA 5E0OA 2RP4A 3PTRB 5L3DB 3KV5A 5FYMA 5LJNA 2XHEB 5CA1E 2E9XD 1U5PA 3ZEFB 2VKJA 2KT9A 4UIGA 2JMKA 2NW8A 3KV4A 2L9QA 2V26A 4O4JE 3ZJ2A 3ETUA 1AJ3A 2GK9A 1FIOA 4UV8B 3ZC0A 1MMGA 5HXCA 2W61A 5LBQB 5C8YE 1LVKA 2V7JA 4G2AA 4ZI3C 1OWAA 2V7IA 3L3PA 3J9X1 4UVBB 5EK2A 2LJLA 2KWHA 5HWXA 3ETVA 4TV9E 4O4HE 3GWHA 5JVDE 4ANJA 5H6RB 2NP9A 2YEVC 1HG2A 3ZCIA 3C4XA 2JRKA 3GN5B 2KMFA 5JQGE 2KWIB 1HFAA 2RA1A 4ZS3A 3PUGA 5FXVA 4MALA 1MNDA 5HXRA 1D1AA 2DHRA 4KBMB 4HEAA 5JDQA 2QA7A 3K3NA 5HXEA 3T8OA 2VWAA 2NOXA 4QX8B 3AB3B 4AKLA 1X79A 5J2TE 1WLXA 4UV9B 4EB6E 5TAOA 1G73A 4ISTA 5DQWA 5H6QB 3B57A 3J7Yq 2W63A 3M65A 2UXXB 2A72A 1G8XA 1LVFA 3Q9DA 3WI3A 1IZNB 3H3AA 3IBPA 3RX6A 3HKBE 3KDSE 3LFMA 3JC6C 4GYRA 2DI4A 4IE7A 4CQIA 4EYYR 4PJMA 1MMNA 4CZZB 3FHNA 4MLKA 2C5JA 4DVDA 2CWOA 2X67A 4O4LE 4TZ4C 2X9HA 3SRZA 5JDLA 5LGTB 3U78A 4QKNA 4DMWA 1Y64B 3E22E 4UXNB 3UUMA 3Q5XA 3UUXB 4MBQA 3MK7C 3NZPA 3PUQA 1D0XA 1LRZA 2H7VC 4H63V 4HN9A 5L3FB 1VOMA 4JEUB 3Q2MA 2E9XB 3CX7B 4F6RC 3IHRA 1BR4A 1BR1A 5HXHA 5JDMA 4AXPA 1MIWA 3N9PA 1HG5A 4O2AE 2Y6XA 2LOPA 2LSGA 4AKHA 4U74A 3A5XA 2XAQB 3I0OA 3VHLA 2KNDA 3BK9A 3EVYA 3ZMVB 2VL8A 3WAKA 3D0TA 5J2UE 4GK5E 3I1AA 4I55E 2KLQA 2P9BA 1MMDA 4KMCA 3RH3A 5JDGA 3UT5E 3QC9A 2VASA 5LYJE 2V7MA 4GOUA 4TV8E 1WYCA 4FJOA 3PUAA 4FI5A 2ZM0A 3I0QA 3S4UA 1FMWA 2VK9A 4ISSA 4QWNB 1FEWA 2LE8A 1QSDA 3E0ZA 4HFVA 3QK6A 2LOSA 5F3JA 1MIYA 4YLHA 2ACXA 2X0LB 1BR2A 2D2SA 3O1HA 3NRXA 4IE0A 2IC9A 3LBXB 3N9NA 5BMVE 2WAUA 4B6XA 2DWGA 4WBOA 4UVAB 3N9LA 2PJQA 3C4WA 3RYIE 2JPFA 4P0BA 1KNZA 4M1PA 4Z8XA 2N9DA 3O4XE 5JR9A 3ONXA 3KVAA 3QUJA 4DBQA 4HE8A 3UTKA 3W15B 1D1BA 2PBIA 4OFZA 4TN7B 3LK2B 5LHGB 3K3OA 1ZHCA 4PFPA 4EZHA 1Z0PA 2WMNA 3OYXA 3ZYMA 3DTOA 3V5UA 4BA9A 5A1LA 1NAFA 5JR9C 1ZKEA 3FBZA 3RRCA 4AKGA 3VKGA 4G63A 4KP3C 5DQVA 2ES0A 2X9XA 2X66A 2CE7A 3GN5A 2OA5A 4BJMA 2CMRA 1H7CA 3CPZA 2LSIA 4QXCB 1NWMX 3TKLB 1OXZA 2E8IA 4U72A 4UF0B 4C90A 5F8PA 3VU7H 1VRBA 2WMOA 2D0UA 5CA0E 1HF8A 2KZ7B 4QXHB 5JR9B 3L09A 1FMVA 5M4YA 4L9IA 1S35A 2D0TA 2EHOB 5JDNA 2Q9QD 3AA1B 3VKHA 2SPCA 2XASB 4J2CA 4ADZA 2B1EA 1YD8G 5LGNB 2A3DA 5KDMC 2HH7A 4EIWA 5J1GA 2XAFB 4BAYB 1EZ3A 4O8SA 3RC8A 2C0SA 2X68A 5DJQC 3LG7A 4X1IE 2Q9QA 2CXFA 4IGUA 3P8CD 5LJMA 1HTJF 2N1GA 4N78D 3N2KE 3RKOA 1WR6A 2MYSA 4X1YE 2EHOD 3C64A 2MTQA 3HKEE 5KX5E 4ZI2D 2LHNA 2M67A 3MKDA 2I59A 4UF0A 4XZCA 3B13A 5HYAA 3K8PC 2DLRA 2UXNB 2K48A 4DO0A 5LA6E 1B7TA 2WSSV 4JLEA 2L3LA 5JDHA 3ZN1B 1QUUA 5ETWA 5LG4A 3DP7A 5HWYA 4EXTA 4CI1B 2DCFA 2LSJA 2E9XC 3DJBA 1IJ6A 3ZLIA 1O3XA 2Y48B 4ZI7E 3I9YA 4IIJE 2NW7A 4HTEA 4AQFA 1US7B 2H7OA 3IF8B 2XUEA 3FXEB 3ZCJA 4IHJE 4PJLA 4PK4A 5LNKA 3F31A 4ZI3D 3SOLA 4ZI2C 2IC6A 2ODVA 2E9XA 4PJJA 3GA8A 3RC3A 3F2EA 1WYBA 3C4ZA 4ILUA 4BJNA 1D0ZA 2YINA 5JH7E 2ODUA 4OHFA 3HL6A 4PAGA 2KXPB 4CXYA 3C50A 4NUVA 3OKQA 5AFUL 3CX8B 4E7ZA 2VKOA 4QXBB 4ZS2A 3V5SA 2QGSA 3O9XA 3RYFE 2VKDA 3CQXC 5EK4A 5JRCA 2BZBA 4AKRB 3EDUA 2G0UA 5HAXA 3KINB 5FP3A 2LSKA 5HXSA 1HCIA 2W00A 3MZKB 4HKAA 3ANWB 2YU2A 4GYSA 2ZM2A 4ZOLE 3MXZA 1UX4A 5L3EB 4UEMA 2V7LA 3PE0A 4K0UA 4ERRA 2VKHA 1KK7A 2CM0A 3ZJ1A 4QHOA 5L3CB 4IE4A 3PUSA 2HPLA 4PNIA 3IEEA 5FXZA 2MBGA 4YJ2E 5FXWA 2J1DG 3KV6A 4IDZA 4PK5A 5FNVE 3K3QC 2WM9A 3N9OA 3ZPOA 4PK6A 2NW9A 4ASKA 3SS1A 5JRCB 2CWYA 2XQYA 2EHOA 5ADXL 2YK0A 4HGAA 3FB2A 1ZEEA 4H9QC 1D0YA 2X51A 2LEHA 4H9RC 4DNDA 5L2LA 3AA0B 1U4QA 2ZM8A 3CMLA 5IHYA 2Q9QC 3HKDE 3WAJA 5LOVE 2K24A 2W62A 5LGUB 3NBXX 3HR0A 3KVBA 1IJ5A 2CEAA 3PDYA 4O2BE 3N2GE 3CQGB 4X1KE 2HPJA 4CI3B 2L8KA 4IE5A 2JQQA 1MMAA 4PW8A 2V1DB 1MIVA 3AAIA 1BR0A 1SA0E 3OBVE 4OK0A 4IE6A 3CKDA 4V1Av 5EK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIG A;  4ADZ A;  4M1P A;  3AAI A;  5FMN A;  5LCY A;  2HH7 A;  5LBM A; 
#chains in the Genus database with same CATH topology
 2K3W A;  4QX7 B;  3RRW A;  3GMI A;  1E1H B;  2LHR A;  4A98 A;  5FY0 A;  3LJC A;  3CWZ B;  2LM9 A;  4AQF C;  4Q25 A;  2CLY C;  1ZV4 X;  5LBM A;  5ABG A;  3ESL A;  3CVR A;  5LG3 A;  5LXT E;  2IAK A;  4NXN T;  2YU1 A;  3O1I A;  2WWV A;  3U3I A;  4WZX A;  5CB4 E;  2CLY B;  4H9S E;  5AQU B;  3PUR A;  4EAH A;  2DWK A;  3N9M A;  5EZY E;  2BG9 C;  4EZ4 A;  5ABE A;  5JRE A;  3PU8 A;  3AA7 B;  5HEG A;  4TX5 A;  3UFE A;  1XDO A;  3KV9 A;  4L5G A;  4U7Y A;  3RIF A;  4KHP T;  3E08 A;  3Q5D A;  3LBX A;  3TLS A;  4P0A A;  2C5I T;  1CUN A;  3ZMZ B;  2A2F X;  4I50 E;  1MNE A;  2V7K A;  1HX1 B;  1ZOY A;  2WBL A;  4HWC A;  4H63 H;  5GON E;  3NKZ A;  3AAA B;  3SWH A;  3UUN A;  2BG9 A;  4JEH B;  4CN1 A;  3ZKR A;  5FL1 A;  4YHH T;  4YFS A;  4E7S A;  3AEG A;  3MJX A;  5FVK A;  2VB6 A;  2IW5 B;  3ONJ A;  4DID B;  4WW0 A;  3VRA A;  3ZMS B;  4ZHQ E;  4DR2 T;  4GK0 E;  4I43 B;  3HKC E;  2BVM A;  2N2N A;  4H9N C;  4CXX A;  4EEB A;  3LK3 B;  4AKI A;  3OYZ A;  5FVL A;  1W09 A;  2BS4 A;  4LMJ A;  4CI2 B;  2JJ9 A;  3HI2 A;  1NEN A;  4YHJ A;  4EOZ B;  5FMN A;  4OYK A;  3R84 B;  5ABF B;  4DR5 T;  4WBN E;  4XBF B;  5IYZ E;  4ZZB A;  3OTO T;  1XMO T;  3C51 A;  4JI4 T;  3PUZ F;  4P09 A;  4CN6 A;  4IL9 A;  4DMV A;  2QYW A;  3ANW A;  3Q5W A;  4Z90 A;  1YKE B;  3F57 A;  4O4I E;  4EED A;  4LML A;  1T98 A;  2D9D A;  3NRY A;  2JMH A;  2WWU A;  1HX8 A;  2ZMA A;  2ZM6 T;  2XAH B;  5LHI B;  2V5D A;  2X9W A;  3FZL B;  4XAX B;  3RYC E;  3TLV A;  3C98 B;  2D5U A;  3FBL A;  3H37 A;  2WY2 A;  1V9D A;  2NWB A;  5AQM B;  1HNW T;  1M62 A;  2CXD A;  2XTL A;  2QVA A;  3I9W A;  5LMU T;  1DU2 A;  3PU3 A;  4MFR A;  2H3R A;  3QB5 K;  4I4T E;  2KSR A;  2E2A A;  4WNK A;  3RPU A;  4JI0 T;  5FY7 A;  2EHO C;  4OYJ A;  5KMG P;  4L0R A;  3JC6 D;  4LF5 T;  2V6X A;  2NTX A;  2BVL A;  3N9Q A;  4HFH A;  1UX5 A;  1L0V A;  4X64 T;  4LMK A;  1WR0 A;  4HFB A;  5AQR B;  1S94 A;  4I0U A;  3RQW A;  5FXX A;  3CQC B;  4COF A;  2XSB A;  4JUY A;  4EYU A;  4PFO A;  3FZF B;  4H9O C;  4YTM A;  5LCY A;  4ILA A;  1J1J A;  2PFV A;  4JI5 T;  3ZYL A;  5AQF B;  4DV2 T;  4U7I A;  3FZH B;  3CK6 A;  1VCT A;  2XAG B;  1W0A A;  2KIN B;  2BDE A;  1D1C A;  2H89 A;  5L4E A;  3AE6 A;  2FJA A;  2OV9 A;  3JAE A;  5DAB A;  5FY1 A;  3RH3 A;  3T1H T;  2CBJ A;  2C5K T;  5FKY A;  3EAM A;  3OJA A;  2UU9 T;  3EUH A;  5L3B B;  2BS3 A;  2K9A A;  3ZN0 B;  5AQN B;  2CCQ A;  4GIW A;  2LT3 A;  5LP6 E;  1WRD A;  3BQI A;  4TUY E;  2XQA A;  2ZLY A;  3BQK A;  3UUL A;  3AE9 A;  3ZC1 A;  2LRL A;  4JI3 T;  4UVC B;  2CA5 A;  3KBT A;  1YXR A;  1SHZ C;  4A56 A;  3ZST A;  4AQG A;  4KUM B;  1HS7 A;  2XZE A;  3CX6 B;  4DUY T;  1T72 A;  2WS3 A;  1UGO A;  3WI3 A;  2UUC T;  3TLT A;  3OVU A;  3AED A;  2I0M A;  2X9Y A;  5L3G B;  3MA9 A;  4C91 A;  2YDQ A;  4DR4 T;  3KFW X;  2WDV A;  3AVS A;  1JNR A;  3KBU A;  3HA4 A;  4NUU A;  3MAC A;  5AQI B;  4DR3 T;  4MHC A;  4X20 E;  4YJ3 E;  4DR6 T;  4F8H A;  1KNP A;  2CXL A;  1YW0 A;  2YOE A;  3LK4 2;  3O1J A;  4PJN A;  4Z91 A;  2WQY A;  1LKX A;  4H9P C;  3AVR A;  1UCU A;  3N5L A;  2W0G A;  4DBR A;  2XM1 A;  3NZQ A;  5LHH B;  4B3T T;  3ZMT B;  2XAJ B;  4AI6 A;  5JDF A;  2J4G A;  3BQL A;  2IDO B;  2LSY A;  4UEL A;  3R6N A;  2PG8 A;  2JQ9 A;  2OLT A;  3FXD B;  1NEK A;  2BBH A;  3AA6 B;  4HFC A;  4LF4 T;  2R6G F;  1YKH B;  2MOZ A;  2V5C A;  3P7I A;  4K0K T;  1IAP A;  3N2O A;  1WFD A;  3UU4 A;  3ZMU B;  3B5M A;  3ZYK A;  3RYH E;  1XDP A;  5HEH A;  2Y8D A;  2DNX A;  4CXW A;  4DV5 T;  2NR4 A;  2K5B B;  2Q9Q B;  3AAE B;  2VVN A;  2Z6E A;  4JBW F;  2NTY A;  4LFA T;  3EDV A;  4UR9 A;  4GKK T;  2FJE A;  1W0B A;  3UUB A;  5E0O A;  2RP4 A;  3PTR B;  5L3D B;  3KV5 A;  5FYM A;  2HN1 A;  3LDQ B;  2XSA A;  2XHE B;  5CA1 E;  5LJN A;  4IDP A;  2E9X D;  1U5P A;  4B3M T;  5CJ5 A;  3ZEF B;  2VKJ A;  2KT9 A;  3FZM B;  3P4P A;  2JMK A;  2NW8 A;  3KV4 A;  4UIG A;  4X5T A;  2L9Q A;  3K1S A;  2V26 A;  2IIU A;  4O4J E;  3ZJ2 A;  3ETU A;  1AJ3 A;  2GK9 A;  2LRK A;  2BBJ A;  1FIO A;  4UV8 B;  2XQ3 A;  3ZC0 A;  1MMG A;  5HXC A;  2W61 A;  5LBQ B;  5C8Y E;  1LVK A;  2V7J A;  4G2A A;  4ZI3 C;  1OWA A;  2V7I A;  3L3P A;  3J9X 1;  4UVB B;  3VR8 A;  2UXB T;  5EK2 A;  2LJL A;  2KWH A;  4NIQ A;  5HWX A;  3ETV A;  4TV9 E;  2W2U A;  4LF7 T;  4O4H E;  3GWH A;  3P4Q A;  3Q9D A;  5JVD E;  2M6B A;  3VR9 A;  4ANJ A;  1J5W A;  5H6R B;  4DR7 T;  4CN4 A;  2NP9 A;  2YEV C;  1HG2 A;  2J62 A;  3ZCI A;  3C4X A;  2JRK A;  3M3Z B;  3GN5 B;  2KMF A;  5AQQ B;  5JQG E;  3QNU A;  5IWA T;  1ZP0 A;  1HFA A;  2KWI B;  2RA1 A;  2AXD S;  2M6I A;  3LSV A;  4ZS3 A;  1N36 T;  3PUG A;  5FXV A;  3T1Y T;  2XQ5 A;  2XJ7 A;  4HFE A;  3A8Y C;  3AXJ B;  4MAL A;  1MND A;  5HXR A;  2V6Y A;  1D1A A;  2DHR A;  3UU8 A;  4OX9 T;  1XNR T;  4KBM B;  5ABH A;  4HEA A;  4A5X A;  3NWI A;  5JDQ A;  5AQK B;  4KHZ F;  2QA7 A;  3K3N A;  5HXE A;  3T8O A;  2VWA A;  2NOX A;  4QX8 B;  3AB3 B;  4AKL A;  5J0Z A;  1X79 A;  1YQ4 A;  5J2T E;  4ZEY A;  5M4Y A;  1WLX A;  4UV9 B;  4EB6 E;  5TAO A;  1G73 A;  4IST A;  5DQW A;  2YN6 A;  5H6Q B;  3B57 A;  2BS2 A;  3QB5 A;  3J7Y q;  1SE7 A;  2W63 A;  3AE1 A;  3M65 A;  4HFI A;  2UXX B;  1VCS A;  2A72 A;  1G8X A;  1LVF A;  2LKH A;  2XQ7 A;  1IZN B;  3AE7 A;  3H3A A;  2CRB A;  3HKB E;  3IBP A;  2PTF A;  3KDS E;  2CPT A;  3LFM A;  3RX6 A;  3JC6 C;  4GYR A;  3UU5 A;  2DI4 A;  4IE7 A;  4TWD A;  4CQI A;  4DV7 T;  4DV1 T;  4EYY R;  2CHN A;  4NXM T;  4PJM A;  3RIU C;  1MMN A;  2BKP A;  4CZZ B;  5HEU A;  3FHN A;  1JNZ A;  3AXJ A;  4MLK A;  2C5J A;  2IUB A;  4DVD A;  4X66 T;  4DUZ T;  2CWO A;  2X67 A;  4O4L E;  4TZ4 C;  2X9H A;  3SRZ A;  3PJA A;  5JDL A;  5LGT B;  3U78 A;  4QKN A;  4DMW A;  3Q5E A;  4ILC A;  1Y64 B;  3E22 E;  3RIU A;  4AIU A;  4JI6 T;  4UXN B;  1SUM B;  3UUM A;  3Q5X A;  1Y01 A;  3UUX B;  4YSX A;  5HCJ A;  2IHR 1;  2MPK A;  2FJD A;  3MK7 C;  2QRX A;  1YQ3 A;  3NZP A;  3PUQ A;  4IDN A;  1D0X A;  1LRZ A;  2FBW A;  3UQ4 A;  3G06 A;  2H7V C;  4H63 V;  4HN9 A;  5L3F B;  1VOM A;  4JEU B;  2XM2 A;  3ZT5 A;  3Q2M A;  5AQL B;  4LF8 T;  1XNQ T;  2BG9 B;  3QOF A;  1FJG T;  2E9X B;  3CX7 B;  3OPC A;  4F6R C;  3RQU A;  3IHR A;  1BR4 A;  1BR1 A;  1KF6 A;  3ZT6 A;  5HXH A;  4JI8 T;  5JDM A;  4AXP A;  1N34 T;  1GQE A;  4P1N A;  1MIW A;  2W67 A;  3N9P A;  1HG5 A;  2RPA A;  4O2A E;  2Y6X A;  2LOP A;  2LSG A;  3PUY F;  1HNZ T;  4AKH A;  4U74 A;  5ABF A;  3A5X A;  2XAQ B;  2IML A;  3ABV A;  3I0O A;  2KND A;  3BK9 A;  3EVY A;  3RKG A;  3VHL A;  3ZMV B;  2VL8 A;  3H3M A;  3D0T A;  3WAK A;  4GK5 E;  3AE4 A;  3I1A A;  2KLQ A;  2P9B A;  1MMD A;  2AE9 A;  4I55 E;  4KMC A;  4U2Y A;  4IT4 A;  5AQJ B;  2WU5 A;  3QC9 A;  2DL1 A;  3UT5 E;  2VAS A;  5LYJ E;  5LB7 B;  2V7M A;  4GOU A;  5IUX A;  4TV8 E;  5BR8 T;  2WU2 A;  1WYC A;  2I6H A;  3PUA A;  4FI5 A;  4FJO A;  2ZM0 A;  3I0Q A;  3S4U A;  4GKJ T;  2YDS A;  1FMW A;  2VK9 A;  4ISS A;  4JI1 T;  5AQP B;  2UUA T;  4QWN B;  1IBM T;  1FEW A;  2LE8 A;  1XMQ T;  1QSD A;  3E0Z A;  4HFV A;  3QK6 A;  2LOS A;  2HN2 A;  3P4W A;  4IDQ A;  1MIY A;  5F3J A;  4DR1 T;  4YLH A;  2ACX A;  2BKN A;  1BR2 A;  2X0L B;  2D2S A;  2XPK A;  3O1H A;  3NRX A;  4IE0 A;  4U3C A;  2IC9 A;  3P50 A;  5AQS B;  3LBX B;  3N9N A;  5F5W A;  5BMV E;  2WAU A;  4B6X A;  2DWG A;  3ZSS A;  4WBO A;  2J47 A;  4UVA B;  3N9L A;  2PJQ A;  3C4W A;  4WYV A;  3RYI E;  2UXD T;  2JQH A;  2JPF A;  1OED B;  2FJB A;  4ILB A;  4P0B A;  4M1P A;  4HWI B;  4Z8X A;  4JI2 T;  1KNZ A;  4IRE A;  3TLW A;  4EGW A;  2N9D A;  3O4X E;  5JR9 A;  5J2U E;  3ONX A;  3KVA A;  1OED C;  3QUJ A;  2YDR A;  4DBQ A;  4X65 T;  4HE8 A;  4ZXL A;  3UTK A;  1D1B A;  3VRB A;  3W15 B;  4A97 A;  5JTG A;  2PBI A;  4OFZ A;  4TN7 B;  3LK2 B;  5LHG B;  3K3O A;  1ZHC A;  4PFP A;  4EZH A;  4X62 T;  1Z0P A;  2WMN A;  3OYX A;  3P4R A;  4TNW A;  3ZYM A;  3DTO A;  3V5U A;  4BA9 A;  5A1L A;  1NAF A;  2LM2 A;  4YTN A;  2F4V T;  1IBK T;  2FUP A;  5JR9 C;  3AE5 A;  1ZKE A;  3EI0 A;  3FBZ A;  3RRC A;  4AKG A;  2LLY A;  2WB5 A;  3VKG A;  4G63 A;  3AEF A;  2WZI A;  4KP3 C;  5DQV A;  2ES0 A;  4YSY A;  2X9X A;  2MAW A;  2X66 A;  2CE7 A;  3GN5 A;  4JI7 T;  1I94 T;  2OA5 A;  3JCF A;  4QH5 A;  2CMR A;  4BJM A;  4QH1 A;  4AQY T;  5CGM A;  1H7C A;  1OED E;  2XY8 B;  3CPZ A;  2LSI A;  4QXC B;  1NWM X;  2V8S V;  1OXZ A;  3TKL B;  2E8I A;  4U72 A;  4UF0 B;  3RF1 A;  4C90 A;  5F8P A;  3VU7 H;  1VRB A;  4IL4 A;  4YTP A;  2WMO A;  2D0U A;  3AE3 A;  4DV3 T;  1KFY A;  1HF8 A;  2KZ7 B;  2YKS A;  3PUX F;  4QXH B;  5CA0 E;  5AQV B;  4TWH A;  5JR9 B;  3L09 A;  1FMV A;  4QH4 A;  2H88 A;  3PJA J;  1S35 A;  2D0T A;  2EHO B;  3IA3 A;  2Q9Q D;  3AA1 B;  4L9I A;  2SPC A;  5JDN A;  3VKH A;  2XAS B;  4J2C A;  3RIA A;  2JIW A;  2CHO A;  2B1E A;  1YD8 G;  4ADZ A;  3CIR A;  3UU3 A;  5LGN B;  2A3D A;  2VQE T;  5LMN T;  5KDM C;  2HH7 A;  4EIW A;  2WCA A;  4U2Z A;  5J1G A;  2XAF B;  4BAY B;  1EZ3 A;  4O8S A;  1KNR A;  3RC8 A;  2UXC T;  2C0S A;  2X68 A;  4U31 A;  4NPP A;  5DJQ C;  2VQF T;  1R8I A;  3LG7 A;  2Q9Q A;  2CXF A;  4IGU A;  4X1I E;  3P8C D;  5LJM A;  1HTJ F;  2N1G A;  3PUV F;  3N2K E;  4N78 D;  3RKO A;  1WR6 A;  2MYS A;  4X1Y E;  2EHO D;  3C64 A;  2MTQ A;  3HKE E;  3L8R A;  2CBI A;  5KX5 E;  3NVO A;  4ZI2 D;  2LHN A;  2LKG A;  2M67 A;  3MKD A;  2I59 A;  1Z8U A;  4UF0 A;  5AQT B;  4LFC T;  4XZC A;  3B13 A;  5HYA A;  3K8P C;  2E5V A;  1E2A A;  4YT0 A;  1CHU A;  2DLR A;  2UXN B;  5KXJ A;  2K48 A;  4DO0 A;  5LA6 E;  1B7T A;  2WSS V;  4JLE A;  4U33 A;  3A7M A;  2L3L A;  2JQK A;  5JDH A;  3ZN1 B;  1QUU A;  1I6Z A;  5ETW A;  3SFE A;  5LG4 A;  3DP7 A;  5HWY A;  3UU6 A;  4EXT A;  4CI1 B;  3UQ7 A;  2DCF A;  2A9U A;  2LSJ A;  2E9X C;  3AE2 A;  1IJ6 A;  3DJB A;  3PV0 F;  1O3X A;  3ZLI A;  4AIS A;  2Y48 B;  4ZI7 E;  3I9Y A;  4IIJ E;  2NW7 A;  4ZZC A;  4HTE A;  4AQF A;  1US7 B;  2VVS A;  3P4S A;  4LFB T;  5HEO A;  2W4X A;  2B76 A;  2H7O A;  3IF8 B;  4LF9 T;  2XUE A;  3FXE B;  3ZCJ A;  5L47 A;  2HHH T;  5CFB A;  4IHJ E;  4PJL A;  4HFD A;  1W9R A;  4HWH A;  3F31 A;  4PK4 A;  5L4H A;  3X1D A;  4ZI3 D;  3SOL A;  5LNK A;  2XQ8 A;  4ZI2 C;  2IC6 A;  2ODV A;  1KEY A;  3AEE A;  4KI0 F;  1IBL T;  4IDO A;  2E9X A;  2ACZ A;  2E5L T;  4PJJ A;  3GA8 A;  3RC3 A;  3F2E A;  1WYB A;  2XQ4 A;  3C4Z A;  4YSZ A;  3AEA A;  4ILU A;  4TWF A;  1D0Z A;  2YIN A;  4BJN A;  2ODU A;  5JH7 E;  4OHF A;  3HL6 A;  2V6Y B;  4PAG A;  2KXP B;  1N33 T;  4CXY A;  3C50 A;  4NUV A;  5C3J A;  3OKQ A;  5AFU L;  3CX8 B;  4E7Z A;  1OED A;  2VKO A;  3FZK B;  4QXB B;  4ZS2 A;  3V5S A;  2QGS A;  4B3S T;  3O9X A;  5AQG B;  1T8B A;  2VKD A;  3CQX C;  3RYF E;  5EK4 A;  5JRC A;  3ONL C;  2X0H A;  2BZB A;  4YXD A;  4AKR B;  3EDU A;  1QLB A;  2BG9 E;  2G0U A;  4DV0 T;  5HAX A;  3KIN B;  5FP3 A;  2LSK A;  5HXS A;  2VUR A;  1HCI A;  3AE8 A;  3TLU A;  2W00 A;  2WDQ A;  3MZK B;  2W66 A;  3ANW B;  4HKA A;  2YU2 A;  1X9B A;  2WDR A;  4DV6 T;  4GYS A;  2ZM2 A;  2WP9 A;  4ZOL E;  1XZY A;  3UFG A;  3EAB A;  1WCR A;  1UUR A;  3RGL A;  3MXZ A;  1UX4 A;  2BKO A;  4TNV A;  5L3E B;  3JAD A;  4UEM A;  4HWD A;  1N32 T;  2V7L A;  3PE0 A;  2WZH A;  4K0U A;  4ERR A;  2VKH A;  1KK7 A;  2CM0 A;  3ZJ1 A;  1J5E T;  4QHO A;  5L3C B;  5HEJ A;  4IE4 A;  3PUS A;  2HPL A;  4PNI A;  3IEE A;  5FXZ A;  5AQH B;  2MBG A;  5FXW A;  2J1D G;  3KV6 A;  3RLF F;  4YJ2 E;  4IDZ A;  4PK5 A;  5FNV E;  3K3Q C;  2WM9 A;  4HWF A;  5FL0 A;  3N9O A;  3ZPO A;  4DV4 T;  4YY3 T;  3L39 A;  1XWM A;  4PK6 A;  4EV6 A;  2NW9 A;  2XQ9 A;  3AEC A;  3SS1 A;  4ASK A;  5JRC B;  2CWY A;  2XQ6 A;  2XQY A;  2X0Y A;  4JV5 T;  2EHO A;  3ZT7 A;  5ADX L;  2YK0 A;  4HGA A;  1HNX T;  3FB2 A;  4LF6 T;  1ZEE A;  4H9Q C;  3RHW A;  1D0Y A;  2X51 A;  2LEH A;  4H9R C;  3SFD A;  4DND A;  5L2L A;  3AA0 B;  1U4Q A;  2ZM8 A;  5C2T A;  3CML A;  3JAF A;  5IHY A;  2Q9Q C;  4KX6 A;  3HKD E;  5AQO B;  3WAJ A;  3EHZ A;  5LOV E;  2K24 A;  2W62 A;  3RI5 A;  3NBX X;  5LGU B;  4B3R T;  1T7S A;  5HCM A;  1E7P A;  1UUS A;  3AEB A;  3HR0 A;  3KVB A;  1IJ5 A;  2CEA A;  2VL0 A;  3PDY A;  2UUB T;  4O2B E;  4JYA T;  1UK5 A;  3N2G E;  3CQG B;  4X1K E;  2HPJ A;  4MBQ A;  4CI3 B;  2L8K A;  4IE5 A;  1M7K A;  1MMA A;  2JQQ A;  3PUW F;  4PW8 A;  2V1D B;  1MIV A;  3AAI A;  1BR0 A;  1SA0 E;  3OBV E;  4OK0 A;  5JDG A;  4IE6 A;  3CKD A;  4V1A v;  1HR0 T;  5EK3 A; 
#chains in the Genus database with same CATH homology
 4QX7 B;  3RRW A;  3GMI A;  1E1H B;  2LHR A;  5FY0 A;  3LJC A;  3CWZ B;  2LM9 A;  4AQF C;  2CLY C;  1ZV4 X;  5LBM A;  5LXT E;  3ESL A;  3CVR A;  2IAK A;  2YU1 A;  3O1I A;  3U3I A;  5CB4 E;  2CLY B;  4H9S E;  4EAH A;  3PUR A;  2DWK A;  3N9M A;  5EZY E;  4EZ4 A;  5JRE A;  3PU8 A;  3AA7 B;  4TX5 A;  3UFE A;  3KV9 A;  4L5G A;  3E08 A;  3LBX A;  4P0A A;  2C5I T;  1CUN A;  3ZMZ B;  2A2F X;  4I50 E;  1MNE A;  2V7K A;  2WBL A;  5GON E;  3UUN A;  3SWH A;  4H63 H;  3ZC1 A;  3AAA B;  4JEH B;  4YFS A;  4E7S A;  3MJX A;  2VB6 A;  2IW5 B;  4WW0 A;  3ZMS B;  4ZHQ E;  4GK0 E;  4I43 B;  3HKC E;  2BVM A;  2N2N A;  4H9N C;  4CXX A;  3LK3 B;  4AKI A;  3OYZ A;  4CI2 B;  4EOZ B;  2JJ9 A;  3HI2 A;  4YHJ A;  4XBF B;  5FMN A;  4OYK A;  3R84 B;  4WBN E;  5IYZ E;  3C51 A;  4P09 A;  4DMV A;  3ANW A;  3Q5W A;  1YKE B;  3F57 A;  4O4I E;  1T98 A;  3NRY A;  2JMH A;  2WWU A;  1HX8 A;  2ZMA A;  2XAH B;  5LHI B;  2X9W A;  4XAX B;  3RYC E;  3C98 B;  2D5U A;  3FBL A;  3H37 A;  1V9D A;  2NWB A;  2CXD A;  2XTL A;  3I9W A;  3PU3 A;  4MFR A;  2H3R A;  4I4T E;  4WNK A;  3RPU A;  5FY7 A;  2EHO C;  4OYJ A;  5KMG P;  4L0R A;  3JC6 D;  2NTX A;  2BVL A;  3N9Q A;  1UX5 A;  1S94 A;  5FXX A;  3CQC B;  4JUY A;  4EYU A;  4PFO A;  4H9O C;  5LCY A;  2PFV A;  3ZYL A;  2XAG B;  2BDE A;  2KIN B;  1D1C A;  5DAB A;  5FY1 A;  2C5K T;  3OJA A;  3EUH A;  5L3B B;  2K9A A;  3ZN0 B;  2CCQ A;  4GIW A;  2LT3 A;  5LP6 E;  1WRD A;  3BQI A;  4TUY E;  2ZLY A;  3BQK A;  3UUL A;  4UVC B;  2CA5 A;  3KBT A;  4A56 A;  1SHZ C;  4AQG A;  1HS7 A;  4KUM B;  3CX6 B;  2X9Y A;  5L3G B;  3MA9 A;  4C91 A;  3KFW X;  3AVS A;  3KBU A;  4NUU A;  3HA4 A;  3MAC A;  4MHC A;  4X20 E;  4YJ3 E;  2CXL A;  1YW0 A;  4PJN A;  3LK4 2;  3O1J A;  1LKX A;  4H9P C;  3AVR A;  1UCU A;  3N5L A;  2W0G A;  4DBR A;  3NZQ A;  5LHH B;  3ZMT B;  2XAJ B;  4AI6 A;  5JDF A;  3BQL A;  3R6N A;  2LSY A;  4UEL A;  2PG8 A;  3FXD B;  3AA6 B;  1YKH B;  2MOZ A;  3P7I A;  1IAP A;  3N2O A;  3ZMU B;  3ZYK A;  3RYH E;  2Y8D A;  2DNX A;  4CXW A;  2Q9Q B;  2K5B B;  3AAE B;  2Z6E A;  2NTY A;  3EDV A;  5E0O A;  2RP4 A;  3PTR B;  5L3D B;  3KV5 A;  5FYM A;  5LJN A;  2XHE B;  5CA1 E;  2E9X D;  1U5P A;  3ZEF B;  2VKJ A;  2KT9 A;  4UIG A;  2JMK A;  2NW8 A;  3KV4 A;  2L9Q A;  2V26 A;  4O4J E;  3ZJ2 A;  3ETU A;  1AJ3 A;  2GK9 A;  1FIO A;  4UV8 B;  3ZC0 A;  1MMG A;  5HXC A;  2W61 A;  5LBQ B;  5C8Y E;  1LVK A;  2V7J A;  4G2A A;  4ZI3 C;  1OWA A;  2V7I A;  3L3P A;  3J9X 1;  4UVB B;  5EK2 A;  2LJL A;  2KWH A;  5HWX A;  3ETV A;  4TV9 E;  4O4H E;  3GWH A;  5JVD E;  4ANJ A;  5H6R B;  2NP9 A;  2YEV C;  1HG2 A;  3ZCI A;  3C4X A;  2JRK A;  3GN5 B;  2KMF A;  5JQG E;  2KWI B;  1HFA A;  2RA1 A;  4ZS3 A;  3PUG A;  5FXV A;  4MAL A;  1MND A;  5HXR A;  1D1A A;  2DHR A;  4KBM B;  4HEA A;  5JDQ A;  2QA7 A;  3K3N A;  5HXE A;  3T8O A;  2VWA A;  2NOX A;  4QX8 B;  3AB3 B;  4AKL A;  1X79 A;  5J2T E;  1WLX A;  4UV9 B;  4EB6 E;  5TAO A;  1G73 A;  4IST A;  5DQW A;  5H6Q B;  3B57 A;  3J7Y q;  2W63 A;  3M65 A;  2UXX B;  2A72 A;  1G8X A;  1LVF A;  3Q9D A;  3WI3 A;  1IZN B;  3H3A A;  3IBP A;  3RX6 A;  3HKB E;  3KDS E;  3LFM A;  3JC6 C;  4GYR A;  2DI4 A;  4IE7 A;  4CQI A;  4EYY R;  4PJM A;  1MMN A;  4CZZ B;  3FHN A;  4MLK A;  2C5J A;  4DVD A;  2CWO A;  2X67 A;  4O4L E;  4TZ4 C;  2X9H A;  3SRZ A;  5JDL A;  5LGT B;  3U78 A;  4QKN A;  4DMW A;  1Y64 B;  3E22 E;  4UXN B;  3UUM A;  3Q5X A;  3UUX B;  4MBQ A;  3MK7 C;  3NZP A;  3PUQ A;  1D0X A;  1LRZ A;  2H7V C;  4H63 V;  4HN9 A;  5L3F B;  1VOM A;  4JEU B;  3Q2M A;  2E9X B;  3CX7 B;  4F6R C;  3IHR A;  1BR4 A;  1BR1 A;  5HXH A;  5JDM A;  4AXP A;  1MIW A;  3N9P A;  1HG5 A;  4O2A E;  2Y6X A;  2LOP A;  2LSG A;  4AKH A;  4U74 A;  3A5X A;  2XAQ B;  3I0O A;  3VHL A;  2KND A;  3BK9 A;  3EVY A;  3ZMV B;  2VL8 A;  3WAK A;  3D0T A;  5J2U E;  4GK5 E;  3I1A A;  4I55 E;  2KLQ A;  2P9B A;  1MMD A;  4KMC A;  3RH3 A;  5JDG A;  3UT5 E;  3QC9 A;  2VAS A;  5LYJ E;  2V7M A;  4GOU A;  4TV8 E;  1WYC A;  4FJO A;  3PUA A;  4FI5 A;  2ZM0 A;  3I0Q A;  3S4U A;  1FMW A;  2VK9 A;  4ISS A;  4QWN B;  1FEW A;  2LE8 A;  1QSD A;  3E0Z A;  4HFV A;  3QK6 A;  2LOS A;  5F3J A;  1MIY A;  4YLH A;  2ACX A;  2X0L B;  1BR2 A;  2D2S A;  3O1H A;  3NRX A;  4IE0 A;  2IC9 A;  3LBX B;  3N9N A;  5BMV E;  2WAU A;  4B6X A;  2DWG A;  4WBO A;  4UVA B;  3N9L A;  2PJQ A;  3C4W A;  3RYI E;  2JPF A;  4P0B A;  1KNZ A;  4M1P A;  4Z8X A;  2N9D A;  3O4X E;  5JR9 A;  3ONX A;  3KVA A;  3QUJ A;  4DBQ A;  4HE8 A;  3UTK A;  3W15 B;  1D1B A;  2PBI A;  4OFZ A;  4TN7 B;  3LK2 B;  5LHG B;  3K3O A;  1ZHC A;  4PFP A;  4EZH A;  1Z0P A;  2WMN A;  3OYX A;  3ZYM A;  3DTO A;  3V5U A;  4BA9 A;  5A1L A;  1NAF A;  5JR9 C;  1ZKE A;  3FBZ A;  3RRC A;  4AKG A;  3VKG A;  4G63 A;  4KP3 C;  5DQV A;  2ES0 A;  2X9X A;  2X66 A;  2CE7 A;  3GN5 A;  2OA5 A;  4BJM A;  2CMR A;  1H7C A;  3CPZ A;  2LSI A;  4QXC B;  1NWM X;  3TKL B;  1OXZ A;  2E8I A;  4U72 A;  4UF0 B;  4C90 A;  5F8P A;  3VU7 H;  1VRB A;  2WMO A;  2D0U A;  5CA0 E;  1HF8 A;  2KZ7 B;  4QXH B;  5JR9 B;  3L09 A;  1FMV A;  5M4Y A;  4L9I A;  1S35 A;  2D0T A;  2EHO B;  5JDN A;  2Q9Q D;  3AA1 B;  3VKH A;  2SPC A;  2XAS B;  4J2C A;  4ADZ A;  2B1E A;  1YD8 G;  5LGN B;  2A3D A;  5KDM C;  2HH7 A;  4EIW A;  5J1G A;  2XAF B;  4BAY B;  1EZ3 A;  4O8S A;  3RC8 A;  2C0S A;  2X68 A;  5DJQ C;  3LG7 A;  4X1I E;  2Q9Q A;  2CXF A;  4IGU A;  3P8C D;  5LJM A;  1HTJ F;  2N1G A;  4N78 D;  3N2K E;  3RKO A;  1WR6 A;  2MYS A;  4X1Y E;  2EHO D;  3C64 A;  2MTQ A;  3HKE E;  5KX5 E;  4ZI2 D;  2LHN A;  2M67 A;  3MKD A;  2I59 A;  4UF0 A;  4XZC A;  3B13 A;  5HYA A;  3K8P C;  2DLR A;  2UXN B;  2K48 A;  4DO0 A;  5LA6 E;  1B7T A;  2WSS V;  4JLE A;  2L3L A;  5JDH A;  3ZN1 B;  1QUU A;  5ETW A;  5LG4 A;  3DP7 A;  5HWY A;  4EXT A;  4CI1 B;  2DCF A;  2LSJ A;  2E9X C;  3DJB A;  1IJ6 A;  3ZLI A;  1O3X A;  2Y48 B;  4ZI7 E;  3I9Y A;  4IIJ E;  2NW7 A;  4HTE A;  4AQF A;  1US7 B;  2H7O A;  3IF8 B;  2XUE A;  3FXE B;  3ZCJ A;  4IHJ E;  4PJL A;  4PK4 A;  5LNK A;  3F31 A;  4ZI3 D;  3SOL A;  4ZI2 C;  2IC6 A;  2ODV A;  2E9X A;  4PJJ A;  3GA8 A;  3RC3 A;  3F2E A;  1WYB A;  3C4Z A;  4ILU A;  4BJN A;  1D0Z A;  2YIN A;  5JH7 E;  2ODU A;  4OHF A;  3HL6 A;  4PAG A;  2KXP B;  4CXY A;  3C50 A;  4NUV A;  3OKQ A;  5AFU L;  3CX8 B;  4E7Z A;  2VKO A;  4QXB B;  4ZS2 A;  3V5S A;  2QGS A;  3O9X A;  3RYF E;  2VKD A;  3CQX C;  5EK4 A;  5JRC A;  2BZB A;  4AKR B;  3EDU A;  2G0U A;  5HAX A;  3KIN B;  5FP3 A;  2LSK A;  5HXS A;  1HCI A;  2W00 A;  3MZK B;  4HKA A;  3ANW B;  2YU2 A;  4GYS A;  2ZM2 A;  4ZOL E;  3MXZ A;  1UX4 A;  5L3E B;  4UEM A;  2V7L A;  3PE0 A;  4K0U A;  4ERR A;  2VKH A;  1KK7 A;  2CM0 A;  3ZJ1 A;  4QHO A;  5L3C B;  4IE4 A;  3PUS A;  2HPL A;  4PNI A;  3IEE A;  5FXZ A;  2MBG A;  4YJ2 E;  5FXW A;  2J1D G;  3KV6 A;  4IDZ A;  4PK5 A;  5FNV E;  3K3Q C;  2WM9 A;  3N9O A;  3ZPO A;  4PK6 A;  2NW9 A;  4ASK A;  3SS1 A;  5JRC B;  2CWY A;  2XQY A;  2EHO A;  5ADX L;  2YK0 A;  4HGA A;  3FB2 A;  1ZEE A;  4H9Q C;  1D0Y A;  2X51 A;  2LEH A;  4H9R C;  4DND A;  5L2L A;  3AA0 B;  1U4Q A;  2ZM8 A;  3CML A;  5IHY A;  2Q9Q C;  3HKD E;  3WAJ A;  5LOV E;  2K24 A;  2W62 A;  5LGU B;  3NBX X;  3HR0 A;  3KVB A;  1IJ5 A;  2CEA A;  3PDY A;  4O2B E;  3N2G E;  3CQG B;  4X1K E;  2HPJ A;  4CI3 B;  2L8K A;  4IE5 A;  2JQQ A;  1MMA A;  4PW8 A;  2V1D B;  1MIV A;  3AAI A;  1BR0 A;  1SA0 E;  3OBV E;  4OK0 A;  4IE6 A;  3CKD A;  4V1A v;  5EK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...