5FMPA

Kstr, transcriptional repressor of cholesterol degradation in mycobacterium tuberculosis, bound to the dna operator
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
184
structure length
184
Chain Sequence
b'GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR KSTR
publication title Kstr, Transcriptional Repressor of Cholesterol Degradation in Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 77
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fmpA00
3NNRA 2DG7A 3BCGA 3BR0A 5EZGA 2HQ5A 2OERA 4G12A 5F0HA 3GZIA 2F07A 3LJLA 3HTJA 4JL3A 2FBQA 3QBMA 2XPWA 2G3BA 2Y2ZA 3G1OA 3V78A 3VOXA 2VKEA 4GFLA 2ZCMA 3CRJA 5FKMA 5J1UA 3RH2A 3B6CA 3VW2A 2HYTA 3TP3A 3VW1A 4GCKA 5HBUA 1JTYA 3LHQA 4D7MA 2QKOA 3IH3A 2QWTA 3BQZA 3HE0A 3RD3A 1JUSA 5K7HA 5F0CA 2XPVA 3BR1A 2G0EA 2GENA 1VI0A 3IH4A 3PM1A 2O7OA 3GEUA 2GUHA 3G7RA 5FKOA 4B3AA 1BJZA 3KKCA 4MXMA 2XGDA 3VP5A 2VKVA 3WHBA 3ZQGA 3FK6A 3S5RA 2EH3A 2GBYA 3BT9A 2Y30A 4KWAA 3VVZA 2G7SA 2ID6A 2DG8A 1UI6A 2WUIA 1JTXA 4PXIA 5J3LA 2G7GA 3KKDA 3F0CA 3IH2A 1Z77A 5GP9A 4AUXA 2Q24A 1U9OA 3IUVA 3DCFA 2IEKA 2FQ4A 5FHPA 2TRTA 5GPAA 2WV1A 3FIWA 2NP3A 4W97A 1QVTA 2HXOA 3CDLA 2JK3A 5K58A 5CW8A 3VPRA 5EZHA 5FGLA 2XGEA 1RKWA 4MK6A 5D19A 3Q0UA 3G56A 4ACIA 2G7LA 3HIMA 3C2BA 1A6IA 3V6GA 2YVHA 2ZCNA 4W1UA 3BQYA 3B6AA 5EFYA 2WGBA 4ICHA 4GCTA 2NP5A 2NX4A 3BJBA 4NELA 3LWJA 5J1RA 5D1RA 3BR6A 2RHAA 5FKLA 1T33A 3HGGA 5HAWA 4HKUA 3HGYA 3Q0WA 2QTQA 1SGMA 5K7ZA 5K7FA 2ZOYA 4AF5A 3LSPA 1ORKA 1ZKGA 2UXHA 3FK7A 2OI8A 4JYKA 2RAEA 3QPLA 3O8HA 4AC0A 2OPTA 4B1RA 4CGRA 3ON2A 2IU5A 4JNNA 1JUPA 2REKA 4I6ZA 1U9NA 2FD5A 3NPIA 2HXIA 3CCYA 4M3BA 5F1JA 3C07A 3NXCA 3HTHA 3NRGA 2FX0A 5AQCA 3Q3SA 2OF7A 2HKUA 2XB5A 5FMPA 4V2FA 2XRLA 3VUQA 2UXOA 1JUMA 2XGCA 1UI5A 2IAIA 2ZOZA 4GFKA 3KZ9A 3JSJA 5GPCA 2O7TA 5CXGA 3ON4A 4DW6A 2VPRA 5DAJA 4ME9A 2QCOA 3BR2A 3LOCA 2IBDA 2X6OA 5F04A 1QPIA 1T56A 4NN1A 4D5CA 3ANGA 2DTZA 5IOZA 3BR3A 3ZQIA 3EGQA 5FKNA 3BHQA 4YZEA 2UXIA 4X1EA 3DPJA 3MVPA 2Y31A 5F0FA 2QOPA 2XPUA 2FJ1A 4V2GA 3BTIA 5D18A 2NS8A 3P9TA 3BR5A 3KNWA 5IPAA 4M3FA 5C4YA 3CWRA 5CXIA 3ZQLA 5H9TA 4ABZA 3HTIA 3HTAA 4MO7A 5F27A 3VW0A 4XK4A 4GCLA 4M3EA 2PZ9A 3VIBA 3BTLA 2ZCXA 3ZQHA 5FKKA 3BTJA 1RKTA 2W53A 1JT6A 3QQAA 3EUPA 4D5FA 2PBXA 3WHCA 3QKXA 1JT0A 5J1YA 2D6YA 2YVEA 3E7QA 2I10A 3VVXA 2UXPA 3FRQA 3G1MA 2NS7A 2RASA 2GFNA 5EYRA 1ZK8A 4AC6A 4M3GA 3B81A 1RPWA 4M3DA 5F08A 3F1BA 3Q0VA 3CJDA 2XDNA 3SFIA 3PASA 3O8GA 2X9DA 3T6NA 3AQSA 5HSZA 1QVUA 3MNLA 3ZQFA 3BNIA 4L62A 3TP0A 3VVYA 3DEWA 3QPSA 2QIBA 2UXUA 3VOKA 2ID3A 3PPBA 5IP6A 3G1LA 2HYJA 5IOYA 2V57A 3ANPA 3SDGA 3O60A 3LSJA 3NI7A 4JKZA 2ZB9A 4D7NA 4I76A 3COLA 3LSRA 2JJ7A 2TCTA 3BTCA 1Z0XA 3AQTA 4UDSA 3BRUA
chains in the Genus database with same CATH superfamily
3NNRA 2DG7A 3BCGA 3BR0A 5EZGA 2HQ5A 2OERA 2FJI1 4G12A 2B1EA 5F0HA 3GZIA 2F07A 3LJLA 3HTJA 4JL3A 2FBQA 3QBMA 2XPWA 2G3BA 2Y2ZA 3G1OA 3V78A 3VOXA 2VKEA 4GFLA 2ZCMA 3CRJA 5FKMA 5J1UA 3RH2A 2R7UA 3B6CA 3VW2A 2HYTA 3TP3A 3VW1A 4GCKA 2R7WA 5HBUA 1JTYA 3LHQA 4D7MA 2QKOA 3IH3A 2QWTA 3BQZA 3HE0A 3RD3A 1JUSA 5K7HA 5F0CA 2XPVA 3BR1A 2G0EA 2GENA 1VI0A 3IH4A 5CQGA 3PM1A 2O7OA 3GEUA 2GUHA 3G7RA 5FKOA 4B3AA 1BJZA 3KKCA 4MXMA 2XGDA 3VP5A 2VKVA 3WHBA 3ZQGA 3FK6A 3S5RA 2EH3A 2GBYA 3BT9A 2Y30A 4KWAA 3VVZA 2G7SA 2ID6A 2DG8A 1UI6A 2WUIA 1JTXA 4PXIA 5J3LA 2G7GA 3KKDA 3F0CA 3IH2A 1Z77A 5GP9A 4AUXA 2Q24A 2R7VA 1U9OA 3IUVA 3DCFA 2IEKA 2FQ4A 4OD5A 5FHPA 2TRTA 5GPAA 2WV1A 3FIWA 2NP3A 4W97A 1QVTA 2HXOA 3CDLA 2JK3A 5K58A 5CW8A 3VPRA 5EZHA 3K8PC 5FGLA 2XGEA 1RKWA 4MK6A 5D19A 3Q0UA 3G56A 4ACIA 2G7LA 3HIMA 3C2BA 1A6IA 2YVXA 3V6GA 2YVHA 2ZCNA 4W1UA 3BQYA 2R7TA 3B6AA 5EFYA 2WGBA 4ICHA 4GCTA 2NP5A 2NX4A 3BJBA 4NELA 3LWJA 5J1RA 2ZY9A 5D1RA 3BR6A 2RHAA 5FKLA 1T33A 3HGGA 5HAWA 4U9NA 4HKUA 3HGYA 3Q0WA 2QTQA 1SGMA 5K7ZA 5K7FA 2ZOYA 4AF5A 3LSPA 1ORKA 2PFVA 1ZKGA 2UXHA 3FK7A 2OI8A 4JYKA 2RAEA 3QPLA 3O8HA 4AC0A 2OPTA 4B1RA 4CGRA 3ON2A 2IU5A 4JNNA 1JUPA 2REKA 4I6ZA 1U9NA 2FD5A 3NPIA 2HXIA 3CCYA 4M3BA 5F1JA 3C07A 3NXCA 3HTHA 3NRGA 2FX0A 5AQCA 3Q3SA 3SWHA 2OF7A 2HKUA 2XB5A 2B3WA 5FMPA 4V2FA 2XRLA 3VUQA 2R7RA 2UXOA 1JUMA 2XGCA 1UI5A 2IAIA 2ZOZA 4GFKA 3KZ9A 3JSJA 5GPCA 2O7TA 5CXGA 3ON4A 4DW6A 4U9LA 2VPRA 5DAJA 4ME9A 2QCOA 3BR2A 3LOCA 2IBDA 2X6OA 5F04A 1QPIA 4IRVA 1T56A 4NN1A 4D5CA 3ANGA 2DTZA 5IOZA 3BR3A 3ZQIA 3EGQA 5FKNA 3FHNA 3BHQA 3DU5A 4YZEA 2UXIA 4X1EA 3DPJA 3MVPA 2Y31A 5F0FA 2QOPA 2XPUA 2FJ1A 4V2GA 3BTIA 5D18A 2NS8A 3P9TA 3BR5A 3KNWA 5IPAA 4M3FA 5C4YA 3CWRA 5CXIA 3ZQLA 4DVYP 5H9TA 4ABZA 3HTIA 3HTAA 4MO7A 5F27A 3VW0A 4XK4A 4GCLA 4M3EA 2PZ9A 3VIBA 3BTLA 2ZCXA 3ZQHA 5FKKA 3BTJA 2R7SA 1RKTA 2W53A 1JT6A 3QQAA 3EUPA 4D5FA 2PBXA 3WHCA 3QKXA 4WIBA 1JT0A 2A2FX 5J1YA 2D6YA 2YVEA 3E7QA 2I10A 3VVXA 2UXPA 3FRQA 3G1MA 2NS7A 2RASA 2GFNA 5EYRA 1ZK8A 4AC6A 4M3GA 3B81A 1RPWA 4M3DA 5F08A 3F1BA 3Q0VA 3CJDA 2XDNA 3SFIA 3PASA 3KYLA 3O8GA 2X9DA 3T6NA 3AQSA 5HSZA 1QVUA 3MNLA 3ZQFA 3BNIA 4OD4A 4L62A 3TP0A 3VVYA 3DEWA 3QPSA 2R7XA 2QIBA 2UXUA 3VOKA 2ID3A 3PPBA 2R7OA 5IP6A 3G1LA 4C2MA 2HYJA 5IOYA 3VTIA 2V57A 3ANPA 3SDGA 3O60A 3NS4A 2R7QA 3LSJA 3NI7A 4JKZA 2ZB9A 3DU6A 4D7NA 4I76A 3COLA 3LSRA 2JJ7A 2TCTA 3BTCA 1Z0XA 3AQTA 4UDSA 3BRUA
chains in the Genus database with same CATH topology
3NNRA 2DG7A 3BCGA 3BR0A 5EZGA 2HQ5A 2OERA 4G12A 5F0HA 3GZIA 2F07A 3LJLA 3HTJA 4JL3A 2FBQA 3QBMA 2XPWA 2G3BA 2Y2ZA 3G1OA 3V78A 3VOXA 2VKEA 4GFLA 2ZCMA 3CRJA 5FKMA 5J1UA 3RH2A 3B6CA 3VW2A 2HYTA 3TP3A 3VW1A 4GCKA 5HBUA 1JTYA 3LHQA 4D7MA 2QKOA 3IH3A 2QWTA 3BQZA 3HE0A 3RD3A 1JUSA 5K7HA 5F0CA 2XPVA 3BR1A 2G0EA 2GENA 1VI0A 3IH4A 3PM1A 2O7OA 3GEUA 2GUHA 3G7RA 5FKOA 4B3AA 1BJZA 3KKCA 4MXMA 2XGDA 3VP5A 2VKVA 3WHBA 3ZQGA 3FK6A 3S5RA 2EH3A 2GBYA 3BT9A 2Y30A 4KWAA 3VVZA 2G7SA 2ID6A 2DG8A 1UI6A 2WUIA 1JTXA 4PXIA 5J3LA 2G7GA 3KKDA 3F0CA 3IH2A 1Z77A 5GP9A 4AUXA 2Q24A 1U9OA 3IUVA 3DCFA 2IEKA 2FQ4A 5FHPA 2TRTA 5GPAA 2WV1A 3FIWA 2NP3A 4W97A 1QVTA 2HXOA 3CDLA 2JK3A 5K58A 5CW8A 3VPRA 5EZHA 5FGLA 2XGEA 1RKWA 4MK6A 5D19A 3Q0UA 3G56A 4ACIA 2G7LA 3HIMA 3C2BA 1A6IA 3V6GA 2YVHA 2ZCNA 4W1UA 3BQYA 3B6AA 5EFYA 2WGBA 4ICHA 4GCTA 2NP5A 2NX4A 3BJBA 4NELA 3LWJA 5J1RA 5D1RA 3BR6A 2RHAA 5FKLA 1T33A 3HGGA 5HAWA 4HKUA 3HGYA 3Q0WA 2QTQA 1SGMA 5K7ZA 5K7FA 2ZOYA 4AF5A 3LSPA 1ORKA 1ZKGA 2UXHA 3FK7A 2OI8A 4JYKA 2RAEA 3QPLA 3O8HA 4AC0A 2OPTA 4B1RA 4CGRA 3ON2A 2IU5A 4JNNA 1JUPA 2REKA 4I6ZA 1U9NA 2FD5A 3NPIA 2HXIA 3CCYA 4M3BA 5F1JA 3C07A 3NXCA 3HTHA 3NRGA 2FX0A 5AQCA 3Q3SA 2OF7A 2HKUA 2XB5A 5FMPA 4V2FA 2XRLA 3VUQA 2UXOA 1JUMA 2XGCA 1UI5A 2IAIA 2ZOZA 4GFKA 3KZ9A 3JSJA 5GPCA 2O7TA 5CXGA 3ON4A 4DW6A 2VPRA 5DAJA 4ME9A 2QCOA 3BR2A 3LOCA 2IBDA 2X6OA 5F04A 1QPIA 1T56A 4NN1A 4D5CA 3ANGA 2DTZA 5IOZA 3BR3A 3ZQIA 3EGQA 5FKNA 3BHQA 4YZEA 2UXIA 4X1EA 3DPJA 3MVPA 2Y31A 5F0FA 2QOPA 2XPUA 2FJ1A 4V2GA 3BTIA 5D18A 2NS8A 3P9TA 3BR5A 3KNWA 5IPAA 4M3FA 5C4YA 3CWRA 5CXIA 3ZQLA 5H9TA 4ABZA 3HTIA 3HTAA 4MO7A 5F27A 3VW0A 4XK4A 4GCLA 4M3EA 2PZ9A 3VIBA 3BTLA 2ZCXA 3ZQHA 5FKKA 3BTJA 1RKTA 2W53A 1JT6A 3QQAA 3EUPA 4D5FA 2PBXA 3WHCA 3QKXA 1JT0A 5J1YA 2D6YA 2YVEA 3E7QA 2I10A 3VVXA 2UXPA 3FRQA 3G1MA 2NS7A 2RASA 2GFNA 5EYRA 1ZK8A 4AC6A 4M3GA 3B81A 1RPWA 4M3DA 5F08A 3F1BA 3Q0VA 3CJDA 2XDNA 3SFIA 3PASA 3O8GA 2X9DA 3T6NA 3AQSA 5HSZA 1QVUA 3MNLA 3ZQFA 3BNIA 4L62A 3TP0A 3VVYA 3DEWA 3QPSA 2QIBA 2UXUA 3VOKA 2ID3A 3PPBA 5IP6A 3G1LA 2HYJA 5IOYA 2V57A 3ANPA 3SDGA 3O60A 3LSJA 3NI7A 4JKZA 2ZB9A 4D7NA 4I76A 3COLA 3LSRA 2JJ7A 2TCTA 3BTCA 1Z0XA 3AQTA 4UDSA 3BRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNR A;  2DG7 A;  3BCG A;  3BR0 A;  5EZG A;  2HQ5 A;  2OER A;  4G12 A;  5F0H A;  3GZI A;  2F07 A;  3LJL A;  3HTJ A;  4JL3 A;  2FBQ A;  3QBM A;  2XPW A;  2G3B A;  2Y2Z A;  3G1O A;  3V78 A;  3VOX A;  2VKE A;  4GFL A;  2ZCM A;  3CRJ A;  5FKM A;  5J1U A;  3RH2 A;  3B6C A;  3VW2 A;  2HYT A;  3TP3 A;  3VW1 A;  4GCK A;  5HBU A;  1JTY A;  3LHQ A;  4D7M A;  2QKO A;  3IH3 A;  2QWT A;  3BQZ A;  3HE0 A;  3RD3 A;  1JUS A;  5K7H A;  5F0C A;  2XPV A;  3BR1 A;  2G0E A;  2GEN A;  1VI0 A;  3IH4 A;  3PM1 A;  2O7O A;  3GEU A;  2GUH A;  3G7R A;  5FKO A;  4B3A A;  1BJZ A;  3KKC A;  4MXM A;  2XGD A;  3VP5 A;  2VKV A;  3WHB A;  3ZQG A;  3FK6 A;  3S5R A;  2EH3 A;  2GBY A;  3BT9 A;  2Y30 A;  4KWA A;  3VVZ A;  2G7S A;  2ID6 A;  2DG8 A;  1UI6 A;  2WUI A;  1JTX A;  4PXI A;  5J3L A;  2G7G A;  3KKD A;  3F0C A;  3IH2 A;  1Z77 A;  5GP9 A;  4AUX A;  2Q24 A;  1U9O A;  3IUV A;  3DCF A;  2IEK A;  2FQ4 A;  5FHP A;  2TRT A;  5GPA A;  2WV1 A;  3FIW A;  2NP3 A;  4W97 A;  1QVT A;  2HXO A;  3CDL A;  2JK3 A;  5K58 A;  5CW8 A;  3VPR A;  5EZH A;  5FGL A;  2XGE A;  1RKW A;  4MK6 A;  5D19 A;  3Q0U A;  3G56 A;  4ACI A;  2G7L A;  3HIM A;  3C2B A;  1A6I A;  3V6G A;  2YVH A;  2ZCN A;  4W1U A;  3BQY A;  3B6A A;  5EFY A;  2WGB A;  4ICH A;  4GCT A;  2NP5 A;  2NX4 A;  3BJB A;  4NEL A;  3LWJ A;  5J1R A;  5D1R A;  3BR6 A;  2RHA A;  5FKL A;  1T33 A;  3HGG A;  5HAW A;  4HKU A;  3HGY A;  3Q0W A;  2QTQ A;  1SGM A;  5K7Z A;  5K7F A;  2ZOY A;  4AF5 A;  3LSP A;  1ORK A;  1ZKG A;  2UXH A;  3FK7 A;  2OI8 A;  4JYK A;  2RAE A;  3QPL A;  3O8H A;  4AC0 A;  2OPT A;  4B1R A;  4CGR A;  3ON2 A;  2IU5 A;  4JNN A;  1JUP A;  2REK A;  4I6Z A;  1U9N A;  2FD5 A;  3NPI A;  2HXI A;  3CCY A;  4M3B A;  5F1J A;  3C07 A;  3NXC A;  3HTH A;  3NRG A;  2FX0 A;  5AQC A;  3Q3S A;  2OF7 A;  2HKU A;  2XB5 A;  5FMP A;  4V2F A;  2XRL A;  3VUQ A;  2UXO A;  1JUM A;  2XGC A;  1UI5 A;  2IAI A;  2ZOZ A;  4GFK A;  3KZ9 A;  3JSJ A;  5GPC A;  2O7T A;  5CXG A;  3ON4 A;  4DW6 A;  2VPR A;  5DAJ A;  4ME9 A;  2QCO A;  3BR2 A;  3LOC A;  2IBD A;  2X6O A;  5F04 A;  1QPI A;  1T56 A;  4NN1 A;  4D5C A;  3ANG A;  2DTZ A;  5IOZ A;  3BR3 A;  3ZQI A;  3EGQ A;  5FKN A;  3BHQ A;  4YZE A;  2UXI A;  4X1E A;  3DPJ A;  3MVP A;  2Y31 A;  5F0F A;  2QOP A;  2XPU A;  2FJ1 A;  4V2G A;  3BTI A;  5D18 A;  2NS8 A;  3P9T A;  3BR5 A;  3KNW A;  5IPA A;  4M3F A;  5C4Y A;  3CWR A;  5CXI A;  3ZQL A;  5H9T A;  4ABZ A;  3HTI A;  3HTA A;  4MO7 A;  5F27 A;  3VW0 A;  4XK4 A;  4GCL A;  4M3E A;  2PZ9 A;  3VIB A;  3BTL A;  2ZCX A;  3ZQH A;  5FKK A;  3BTJ A;  1RKT A;  2W53 A;  1JT6 A;  3QQA A;  3EUP A;  4D5F A;  2PBX A;  3WHC A;  3QKX A;  1JT0 A;  5J1Y A;  2D6Y A;  2YVE A;  3E7Q A;  2I10 A;  3VVX A;  2UXP A;  3FRQ A;  3G1M A;  2NS7 A;  2RAS A;  2GFN A;  5EYR A;  1ZK8 A;  4AC6 A;  4M3G A;  3B81 A;  1RPW A;  4M3D A;  5F08 A;  3F1B A;  3Q0V A;  3CJD A;  2XDN A;  3SFI A;  3PAS A;  3O8G A;  2X9D A;  3T6N A;  3AQS A;  5HSZ A;  1QVU A;  3MNL A;  3ZQF A;  3BNI A;  4L62 A;  3TP0 A;  3VVY A;  3DEW A;  3QPS A;  2QIB A;  2UXU A;  3VOK A;  2ID3 A;  3PPB A;  5IP6 A;  3G1L A;  2HYJ A;  5IOY A;  2V57 A;  3ANP A;  3SDG A;  3O60 A;  3LSJ A;  3NI7 A;  4JKZ A;  2ZB9 A;  4D7N A;  4I76 A;  3COL A;  3LSR A;  2JJ7 A;  2TCT A;  3BTC A;  1Z0X A;  3AQT A;  4UDS A;  3BRU A; 
#chains in the Genus database with same CATH topology
 3NNR A;  2DG7 A;  3BCG A;  3BR0 A;  5EZG A;  2HQ5 A;  2OER A;  2FJI 1;  4G12 A;  2B1E A;  5F0H A;  3GZI A;  2F07 A;  3LJL A;  3HTJ A;  4JL3 A;  2FBQ A;  3QBM A;  2XPW A;  2G3B A;  2Y2Z A;  3G1O A;  3V78 A;  3VOX A;  2VKE A;  4GFL A;  2ZCM A;  3CRJ A;  5FKM A;  5J1U A;  3RH2 A;  2R7U A;  3B6C A;  3VW2 A;  2HYT A;  3TP3 A;  3VW1 A;  4GCK A;  2R7W A;  5HBU A;  1JTY A;  3LHQ A;  4D7M A;  2QKO A;  3IH3 A;  2QWT A;  3BQZ A;  3HE0 A;  3RD3 A;  1JUS A;  5K7H A;  5F0C A;  2XPV A;  3BR1 A;  2G0E A;  2GEN A;  1VI0 A;  3IH4 A;  5CQG A;  3PM1 A;  2O7O A;  3GEU A;  2GUH A;  3G7R A;  5FKO A;  4B3A A;  1BJZ A;  3KKC A;  4MXM A;  2XGD A;  3VP5 A;  2VKV A;  3WHB A;  3ZQG A;  3FK6 A;  3S5R A;  2EH3 A;  2GBY A;  3BT9 A;  2Y30 A;  4KWA A;  3VVZ A;  2G7S A;  2ID6 A;  2DG8 A;  1UI6 A;  2WUI A;  1JTX A;  4PXI A;  5J3L A;  2G7G A;  3KKD A;  3F0C A;  3IH2 A;  1Z77 A;  5GP9 A;  4AUX A;  2Q24 A;  2R7V A;  1U9O A;  3IUV A;  3DCF A;  2IEK A;  2FQ4 A;  4OD5 A;  5FHP A;  2TRT A;  5GPA A;  2WV1 A;  3FIW A;  2NP3 A;  4W97 A;  1QVT A;  2HXO A;  3CDL A;  2JK3 A;  5K58 A;  5CW8 A;  3VPR A;  5EZH A;  3K8P C;  5FGL A;  2XGE A;  1RKW A;  4MK6 A;  5D19 A;  3Q0U A;  3G56 A;  4ACI A;  2G7L A;  3HIM A;  3C2B A;  1A6I A;  2YVX A;  3V6G A;  2YVH A;  2ZCN A;  4W1U A;  3BQY A;  2R7T A;  3B6A A;  5EFY A;  2WGB A;  4ICH A;  4GCT A;  2NP5 A;  2NX4 A;  3BJB A;  4NEL A;  3LWJ A;  5J1R A;  2ZY9 A;  5D1R A;  3BR6 A;  2RHA A;  5FKL A;  1T33 A;  3HGG A;  5HAW A;  4U9N A;  4HKU A;  3HGY A;  3Q0W A;  2QTQ A;  1SGM A;  5K7Z A;  5K7F A;  2ZOY A;  4AF5 A;  3LSP A;  1ORK A;  2PFV A;  1ZKG A;  2UXH A;  3FK7 A;  2OI8 A;  4JYK A;  2RAE A;  3QPL A;  3O8H A;  4AC0 A;  2OPT A;  4B1R A;  4CGR A;  3ON2 A;  2IU5 A;  4JNN A;  1JUP A;  2REK A;  4I6Z A;  1U9N A;  2FD5 A;  3NPI A;  2HXI A;  3CCY A;  4M3B A;  5F1J A;  3C07 A;  3NXC A;  3HTH A;  3NRG A;  2FX0 A;  5AQC A;  3Q3S A;  3SWH A;  2OF7 A;  2HKU A;  2XB5 A;  2B3W A;  5FMP A;  4V2F A;  2XRL A;  3VUQ A;  2R7R A;  2UXO A;  1JUM A;  2XGC A;  1UI5 A;  2IAI A;  2ZOZ A;  4GFK A;  3KZ9 A;  3JSJ A;  5GPC A;  2O7T A;  5CXG A;  3ON4 A;  4DW6 A;  4U9L A;  2VPR A;  5DAJ A;  4ME9 A;  2QCO A;  3BR2 A;  3LOC A;  2IBD A;  2X6O A;  5F04 A;  1QPI A;  4IRV A;  1T56 A;  4NN1 A;  4D5C A;  3ANG A;  2DTZ A;  5IOZ A;  3BR3 A;  3ZQI A;  3EGQ A;  5FKN A;  3FHN A;  3BHQ A;  3DU5 A;  4YZE A;  2UXI A;  4X1E A;  3DPJ A;  3MVP A;  2Y31 A;  5F0F A;  2QOP A;  2XPU A;  2FJ1 A;  4V2G A;  3BTI A;  5D18 A;  2NS8 A;  3P9T A;  3BR5 A;  3KNW A;  5IPA A;  4M3F A;  5C4Y A;  3CWR A;  5CXI A;  3ZQL A;  4DVY P;  5H9T A;  4ABZ A;  3HTI A;  3HTA A;  4MO7 A;  5F27 A;  3VW0 A;  4XK4 A;  4GCL A;  4M3E A;  2PZ9 A;  3VIB A;  3BTL A;  2ZCX A;  3ZQH A;  5FKK A;  3BTJ A;  2R7S A;  1RKT A;  2W53 A;  1JT6 A;  3QQA A;  3EUP A;  4D5F A;  2PBX A;  3WHC A;  3QKX A;  4WIB A;  1JT0 A;  2A2F X;  5J1Y A;  2D6Y A;  2YVE A;  3E7Q A;  2I10 A;  3VVX A;  2UXP A;  3FRQ A;  3G1M A;  2NS7 A;  2RAS A;  2GFN A;  5EYR A;  1ZK8 A;  4AC6 A;  4M3G A;  3B81 A;  1RPW A;  4M3D A;  5F08 A;  3F1B A;  3Q0V A;  3CJD A;  2XDN A;  3SFI A;  3PAS A;  3KYL A;  3O8G A;  2X9D A;  3T6N A;  3AQS A;  5HSZ A;  1QVU A;  3MNL A;  3ZQF A;  3BNI A;  4OD4 A;  4L62 A;  3TP0 A;  3VVY A;  3DEW A;  3QPS A;  2R7X A;  2QIB A;  2UXU A;  3VOK A;  2ID3 A;  3PPB A;  2R7O A;  5IP6 A;  3G1L A;  4C2M A;  2HYJ A;  5IOY A;  3VTI A;  2V57 A;  3ANP A;  3SDG A;  3O60 A;  3NS4 A;  2R7Q A;  3LSJ A;  3NI7 A;  4JKZ A;  2ZB9 A;  3DU6 A;  4D7N A;  4I76 A;  3COL A;  3LSR A;  2JJ7 A;  2TCT A;  3BTC A;  1Z0X A;  3AQT A;  4UDS A;  3BRU A; 
#chains in the Genus database with same CATH homology
 3NNR A;  2DG7 A;  3BCG A;  3BR0 A;  5EZG A;  2HQ5 A;  2OER A;  4G12 A;  5F0H A;  3GZI A;  2F07 A;  3LJL A;  3HTJ A;  4JL3 A;  2FBQ A;  3QBM A;  2XPW A;  2G3B A;  2Y2Z A;  3G1O A;  3V78 A;  3VOX A;  2VKE A;  4GFL A;  2ZCM A;  3CRJ A;  5FKM A;  5J1U A;  3RH2 A;  3B6C A;  3VW2 A;  2HYT A;  3TP3 A;  3VW1 A;  4GCK A;  5HBU A;  1JTY A;  3LHQ A;  4D7M A;  2QKO A;  3IH3 A;  2QWT A;  3BQZ A;  3HE0 A;  3RD3 A;  1JUS A;  5K7H A;  5F0C A;  2XPV A;  3BR1 A;  2G0E A;  2GEN A;  1VI0 A;  3IH4 A;  3PM1 A;  2O7O A;  3GEU A;  2GUH A;  3G7R A;  5FKO A;  4B3A A;  1BJZ A;  3KKC A;  4MXM A;  2XGD A;  3VP5 A;  2VKV A;  3WHB A;  3ZQG A;  3FK6 A;  3S5R A;  2EH3 A;  2GBY A;  3BT9 A;  2Y30 A;  4KWA A;  3VVZ A;  2G7S A;  2ID6 A;  2DG8 A;  1UI6 A;  2WUI A;  1JTX A;  4PXI A;  5J3L A;  2G7G A;  3KKD A;  3F0C A;  3IH2 A;  1Z77 A;  5GP9 A;  4AUX A;  2Q24 A;  1U9O A;  3IUV A;  3DCF A;  2IEK A;  2FQ4 A;  5FHP A;  2TRT A;  5GPA A;  2WV1 A;  3FIW A;  2NP3 A;  4W97 A;  1QVT A;  2HXO A;  3CDL A;  2JK3 A;  5K58 A;  5CW8 A;  3VPR A;  5EZH A;  5FGL A;  2XGE A;  1RKW A;  4MK6 A;  5D19 A;  3Q0U A;  3G56 A;  4ACI A;  2G7L A;  3HIM A;  3C2B A;  1A6I A;  3V6G A;  2YVH A;  2ZCN A;  4W1U A;  3BQY A;  3B6A A;  5EFY A;  2WGB A;  4ICH A;  4GCT A;  2NP5 A;  2NX4 A;  3BJB A;  4NEL A;  3LWJ A;  5J1R A;  5D1R A;  3BR6 A;  2RHA A;  5FKL A;  1T33 A;  3HGG A;  5HAW A;  4HKU A;  3HGY A;  3Q0W A;  2QTQ A;  1SGM A;  5K7Z A;  5K7F A;  2ZOY A;  4AF5 A;  3LSP A;  1ORK A;  1ZKG A;  2UXH A;  3FK7 A;  2OI8 A;  4JYK A;  2RAE A;  3QPL A;  3O8H A;  4AC0 A;  2OPT A;  4B1R A;  4CGR A;  3ON2 A;  2IU5 A;  4JNN A;  1JUP A;  2REK A;  4I6Z A;  1U9N A;  2FD5 A;  3NPI A;  2HXI A;  3CCY A;  4M3B A;  5F1J A;  3C07 A;  3NXC A;  3HTH A;  3NRG A;  2FX0 A;  5AQC A;  3Q3S A;  2OF7 A;  2HKU A;  2XB5 A;  5FMP A;  4V2F A;  2XRL A;  3VUQ A;  2UXO A;  1JUM A;  2XGC A;  1UI5 A;  2IAI A;  2ZOZ A;  4GFK A;  3KZ9 A;  3JSJ A;  5GPC A;  2O7T A;  5CXG A;  3ON4 A;  4DW6 A;  2VPR A;  5DAJ A;  4ME9 A;  2QCO A;  3BR2 A;  3LOC A;  2IBD A;  2X6O A;  5F04 A;  1QPI A;  1T56 A;  4NN1 A;  4D5C A;  3ANG A;  2DTZ A;  5IOZ A;  3BR3 A;  3ZQI A;  3EGQ A;  5FKN A;  3BHQ A;  4YZE A;  2UXI A;  4X1E A;  3DPJ A;  3MVP A;  2Y31 A;  5F0F A;  2QOP A;  2XPU A;  2FJ1 A;  4V2G A;  3BTI A;  5D18 A;  2NS8 A;  3P9T A;  3BR5 A;  3KNW A;  5IPA A;  4M3F A;  5C4Y A;  3CWR A;  5CXI A;  3ZQL A;  5H9T A;  4ABZ A;  3HTI A;  3HTA A;  4MO7 A;  5F27 A;  3VW0 A;  4XK4 A;  4GCL A;  4M3E A;  2PZ9 A;  3VIB A;  3BTL A;  2ZCX A;  3ZQH A;  5FKK A;  3BTJ A;  1RKT A;  2W53 A;  1JT6 A;  3QQA A;  3EUP A;  4D5F A;  2PBX A;  3WHC A;  3QKX A;  1JT0 A;  5J1Y A;  2D6Y A;  2YVE A;  3E7Q A;  2I10 A;  3VVX A;  2UXP A;  3FRQ A;  3G1M A;  2NS7 A;  2RAS A;  2GFN A;  5EYR A;  1ZK8 A;  4AC6 A;  4M3G A;  3B81 A;  1RPW A;  4M3D A;  5F08 A;  3F1B A;  3Q0V A;  3CJD A;  2XDN A;  3SFI A;  3PAS A;  3O8G A;  2X9D A;  3T6N A;  3AQS A;  5HSZ A;  1QVU A;  3MNL A;  3ZQF A;  3BNI A;  4L62 A;  3TP0 A;  3VVY A;  3DEW A;  3QPS A;  2QIB A;  2UXU A;  3VOK A;  2ID3 A;  3PPB A;  5IP6 A;  3G1L A;  2HYJ A;  5IOY A;  2V57 A;  3ANP A;  3SDG A;  3O60 A;  3LSJ A;  3NI7 A;  4JKZ A;  2ZB9 A;  4D7N A;  4I76 A;  3COL A;  3LSR A;  2JJ7 A;  2TCT A;  3BTC A;  1Z0X A;  3AQT A;  4UDS A;  3BRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...