5FMPA

Kstr, transcriptional repressor of cholesterol degradation in mycobacterium tuberculosis, bound to the dna operator
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
184
structure length
184
Chain Sequence
GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kstr, Transcriptional Repressor of Cholesterol Degradation in Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR KSTR
total genus 77
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fmpA00
4MK6A 2ZOZA 2QWTA 2DG8A 2X6OA 3SFIA 5IP6A 5F0CA 2FBQA 3ZQLA 1Z0XA 3G7RA 5HBUA 2QOPA 4GCTA 4MXMA 3PASA 5FKKA 4XK4A 4AUXA 3BR3A 5FMPA 2QIBA 3C2BA 4M3BA 2GUHA 2Y2ZA 5GPAA 2V57A 1T33A 3GEUA 1QPIA 3V6GA 1UI6A 3IH2A 3LSPA 1QVTA 5D18A 1JTYA 5H9TA 2XPWA 3HIMA 3LJLA 4CGRA 2YVEA 3F0CA 3LWJA 3PM1A 2OERA 2QKOA 1JUSA 2FD5A 2RAEA 4B1RA 2NP5A 5J1YA 3B81A 5F1JA 4JYKA 4PXIA 3G1MA 3V78A 3VVYA 5D1RA 2WV1A 3LOCA 2UXPA 2IAIA 2NX4A 2RHAA 3RD3A 3ZQGA 1ZK8A 2XB5A 1U9NA 3BCGA 2JK3A 4L62A 2G7SA 4M3GA 5K7ZA 1JUPA 5C4YA 5IPAA 3HGYA 4JKZA 5FKLA 3BT9A 3BR6A 3HTIA 3VP5A 5EYRA 3HTJA 3QPLA 3FK7A 3BTLA 3F1BA 2XGEA 3COLA 2HYJA 4NN1A 2ZB9A 4M3FA 3ANGA 2O7OA 1T56A 2F07A 2GFNA 3AQSA 4UDSA 4X1EA 4D7MA 3ZQHA 3Q0WA 4M3EA 3GZIA 3WHBA 3LHQA 3NNRA 3HTAA 3ZQIA 3E7QA 5FKMA 2OPTA 4D5FA 3G1LA 3IUVA 2G7GA 3MNLA 2UXUA 5IOZA 3WHCA 2QCOA 4AF5A 1RPWA 5IOYA 3O8HA 5FGLA 2NP3A 3QPSA 2OF7A 2ZCNA 3QBMA 1RKWA 5K7HA 2UXIA 3DCFA 3LSRA 3O60A 3BHQA 2IU5A 3BTIA 5F0HA 4I6ZA 2I10A 3EUPA 5EZGA 3HTHA 4B3AA 2RASA 5FKNA 2TCTA 4KWAA 2WGBA 4HKUA 2ZCXA 5FHPA 1VI0A 5HSZA 4GFKA 3DPJA 2YVHA 3RH2A 1U9OA 3HGGA 2FQ4A 2XPUA 2XRLA 4AC6A 2GENA 3ANPA 3QQAA 2NS8A 3C07A 2VPRA 2XPVA 3S5RA 3KKDA 5CXGA 2DTZA 5D19A 3BQZA 4D5CA 5DAJA 3BR2A 2O7TA 4D7NA 5K7FA 2HQ5A 3BTCA 5J1UA 4AC0A 1RKTA 3CDLA 5GP9A 4ACIA 3VW1A 1JUMA 4M3DA 2VKEA 3IH4A 3Q0UA 4ICHA 3BR1A 3VW2A 2REKA 5HAWA 2HXIA 5J3LA 3VVZA 3VUQA 2EH3A 2ID6A 3LSJA 3BR0A 4G12A 3VVXA 3PPBA 2PZ9A 3B6CA 1BJZA 2UXHA 2PBXA 4NELA 3T6NA 3G56A 2WUIA 3BNIA 3ON2A 3BTJA 4V2FA 3TP3A 5F0FA 2G3BA 3BQYA 1Z77A 3CCYA 5EFYA 1ZKGA 5F08A 2JJ7A 3Q3SA 4JL3A 2ID3A 3AQTA 4MO7A 2FX0A 3ON4A 2HYTA 5FKOA 3ZQFA 3BR5A 4W97A 2D6YA 3Q0VA 1ORKA 3HE0A 3VW0A 3G1OA 2GBYA 1A6IA 4YZEA 4GFLA 3FRQA 2XDNA 3FIWA 2FJ1A 1JTXA 3EGQA 3BRUA 3QKXA 3KKCA 1UI5A 3KZ9A 3KNWA 1QVUA 2G7LA 3CWRA 2HKUA 3NRGA 3O8GA 2Y30A 4ME9A 3VPRA 2XGCA 1JT6A 5CXIA 2ZCMA 1JT0A 4JNNA 5K58A 2Y31A 3P9TA 4V2GA 4ABZA 5J1RA 2UXOA 3VOXA 5GPCA 2W53A 2HXOA 3BJBA 3CRJA 4DW6A 3VOKA 3CJDA 3NXCA 2G0EA 5AQCA 3SDGA 4GCKA 3VIBA 2XGDA 3FK6A 5F27A 2IBDA 1SGMA 2Q24A 2X9DA 2IEKA 2NS7A 4I76A 4GCLA 5CW8A 3TP0A 2QTQA 2ZOYA 2VKVA 4W1UA 5F04A 3NPIA 2TRTA 3MVPA 3DEWA 2DG7A 5EZHA 3JSJA 3B6AA 2OI8A 3NI7A 3IH3A
chains in the Genus database with same CATH superfamily
4MK6A 2ZOZA 2QWTA 2DG8A 2X6OA 3SFIA 5IP6A 5F0CA 2FBQA 3ZQLA 3NS4A 1Z0XA 3G7RA 5HBUA 3DU6A 2QOPA 4GCTA 4MXMA 3PASA 5FKKA 4XK4A 4AUXA 3BR3A 5FMPA 2QIBA 3C2BA 4M3BA 2GUHA 2Y2ZA 5GPAA 2R7SA 2V57A 1T33A 3GEUA 3SWHA 1QPIA 3V6GA 1UI6A 3IH2A 3LSPA 1QVTA 5D18A 1JTYA 5H9TA 2XPWA 3HIMA 2R7RA 3LJLA 4OD5A 4CGRA 2R7WA 2YVEA 3F0CA 3LWJA 3PM1A 2OERA 2QKOA 1JUSA 2FD5A 4B1RA 2RAEA 2NP5A 4DVYP 5J1YA 3B81A 5F1JA 4JYKA 4PXIA 3G1MA 2B3WA 3V78A 3VVYA 5D1RA 2WV1A 3LOCA 2UXPA 2IAIA 4OD4A 2NX4A 2RHAA 3RD3A 3ZQGA 1ZK8A 2XB5A 1U9NA 3BCGA 2JK3A 4L62A 2G7SA 4M3GA 5K7ZA 1JUPA 5C4YA 5IPAA 3HGYA 4JKZA 5FKLA 2FJI1 3BT9A 4WIBA 2B1EA 3BR6A 3HTIA 3VP5A 5EYRA 3HTJA 3QPLA 3FK7A 3BTLA 3F1BA 2XGEA 3COLA 2HYJA 4NN1A 2ZB9A 4M3FA 3ANGA 2O7OA 4U9NA 1T56A 2F07A 2GFNA 3AQSA 4U9LA 4UDSA 4X1EA 4D7MA 3ZQHA 3Q0WA 4M3EA 3GZIA 3WHBA 3LHQA 3NNRA 3HTAA 3ZQIA 3E7QA 5FKMA 2OPTA 4D5FA 3G1LA 3IUVA 2G7GA 3MNLA 2UXUA 5IOZA 5CQGA 3WHCA 2QCOA 4AF5A 1RPWA 5IOYA 3O8HA 5FGLA 2YVXA 2NP3A 3QPSA 3VTIA 2OF7A 2ZCNA 3QBMA 1RKWA 5K7HA 2UXIA 3DCFA 3LSRA 3O60A 3BHQA 2IU5A 3BTIA 5F0HA 2I10A 4I6ZA 3EUPA 5EZGA 3HTHA 4B3AA 2RASA 5FKNA 2TCTA 4KWAA 2WGBA 4HKUA 2ZCXA 4IRVA 5FHPA 1VI0A 5HSZA 4GFKA 2R7XA 3DPJA 2YVHA 3RH2A 1U9OA 3HGGA 2FQ4A 2XPUA 2XRLA 4AC6A 2GENA 3ANPA 3QQAA 2R7QA 2NS8A 3C07A 2VPRA 2XPVA 3S5RA 3KKDA 5CXGA 2DTZA 5D19A 2PFVA 3BQZA 4D5CA 5DAJA 3BR2A 2O7TA 4D7NA 5K7FA 2HQ5A 3BTCA 5J1UA 4AC0A 1RKTA 3CDLA 5GP9A 4ACIA 3VW1A 2R7VA 1JUMA 4M3DA 2VKEA 3IH4A 3Q0UA 4ICHA 3BR1A 3VW2A 2REKA 4C2MA 5HAWA 2HXIA 5J3LA 3VVZA 3VUQA 2EH3A 2ID6A 3LSJA 3BR0A 4G12A 3VVXA 3PPBA 2PZ9A 3B6CA 1BJZA 2UXHA 3KYLA 2PBXA 4NELA 3T6NA 3G56A 2WUIA 3BNIA 2R7TA 3ON2A 3BTJA 4V2FA 3TP3A 5F0FA 2G3BA 3BQYA 1Z77A 3CCYA 5EFYA 1ZKGA 5F08A 2JJ7A 3Q3SA 3DU5A 4JL3A 2ID3A 3AQTA 4MO7A 2FX0A 3ON4A 2HYTA 2A2FX 5FKOA 3BR5A 3ZQFA 4W97A 2D6YA 3Q0VA 1ORKA 3HE0A 3VW0A 3G1OA 2GBYA 1A6IA 4YZEA 4GFLA 3FRQA 3K8PC 2XDNA 3FIWA 2FJ1A 1JTXA 3EGQA 3BRUA 3QKXA 3KKCA 1UI5A 3KZ9A 3KNWA 1QVUA 2G7LA 3CWRA 2HKUA 2ZY9A 3FHNA 3NRGA 3O8GA 2Y30A 4ME9A 3VPRA 2XGCA 1JT6A 5CXIA 2ZCMA 1JT0A 4JNNA 5K58A 2Y31A 3P9TA 4V2GA 4ABZA 5J1RA 2UXOA 3VOXA 5GPCA 2W53A 2HXOA 3BJBA 3CRJA 4DW6A 3VOKA 3CJDA 3NXCA 2G0EA 5AQCA 3SDGA 4GCKA 3VIBA 2XGDA 3FK6A 5F27A 2IBDA 1SGMA 2Q24A 2X9DA 2R7UA 2IEKA 2NS7A 4I76A 4GCLA 2R7OA 5CW8A 3TP0A 2QTQA 2ZOYA 2VKVA 4W1UA 5F04A 3NPIA 2TRTA 3MVPA 3DEWA 2DG7A 5EZHA 3JSJA 3B6AA 2OI8A 3NI7A 3IH3A
chains in the Genus database with same CATH topology
4MK6A 2ZOZA 2QWTA 2DG8A 2X6OA 3SFIA 5IP6A 5F0CA 2FBQA 3ZQLA 1Z0XA 3G7RA 5HBUA 2QOPA 4GCTA 4MXMA 3PASA 5FKKA 4XK4A 4AUXA 3BR3A 5FMPA 2QIBA 3C2BA 4M3BA 2GUHA 2Y2ZA 5GPAA 2V57A 1T33A 3GEUA 1QPIA 3V6GA 1UI6A 3IH2A 3LSPA 1QVTA 5D18A 1JTYA 5H9TA 2XPWA 3HIMA 3LJLA 4CGRA 2YVEA 3F0CA 3LWJA 3PM1A 2OERA 2QKOA 1JUSA 2FD5A 2RAEA 4B1RA 2NP5A 5J1YA 3B81A 5F1JA 4JYKA 4PXIA 3G1MA 3V78A 3VVYA 5D1RA 2WV1A 3LOCA 2UXPA 2IAIA 2NX4A 2RHAA 3RD3A 3ZQGA 1ZK8A 2XB5A 1U9NA 3BCGA 2JK3A 4L62A 2G7SA 4M3GA 5K7ZA 1JUPA 5C4YA 5IPAA 3HGYA 4JKZA 5FKLA 3BT9A 3BR6A 3HTIA 3VP5A 5EYRA 3HTJA 3QPLA 3FK7A 3BTLA 3F1BA 2XGEA 3COLA 2HYJA 4NN1A 2ZB9A 4M3FA 3ANGA 2O7OA 1T56A 2F07A 2GFNA 3AQSA 4UDSA 4X1EA 4D7MA 3ZQHA 3Q0WA 4M3EA 3GZIA 3WHBA 3LHQA 3NNRA 3HTAA 3ZQIA 3E7QA 5FKMA 2OPTA 4D5FA 3G1LA 3IUVA 2G7GA 3MNLA 2UXUA 5IOZA 3WHCA 2QCOA 4AF5A 1RPWA 5IOYA 3O8HA 5FGLA 2NP3A 3QPSA 2OF7A 2ZCNA 3QBMA 1RKWA 5K7HA 2UXIA 3DCFA 3LSRA 3O60A 3BHQA 2IU5A 3BTIA 5F0HA 4I6ZA 2I10A 3EUPA 5EZGA 3HTHA 4B3AA 2RASA 5FKNA 2TCTA 4KWAA 2WGBA 4HKUA 2ZCXA 5FHPA 1VI0A 5HSZA 4GFKA 3DPJA 2YVHA 3RH2A 1U9OA 3HGGA 2FQ4A 2XPUA 2XRLA 4AC6A 2GENA 3ANPA 3QQAA 2NS8A 3C07A 2VPRA 2XPVA 3S5RA 3KKDA 5CXGA 2DTZA 5D19A 3BQZA 4D5CA 5DAJA 3BR2A 2O7TA 4D7NA 5K7FA 2HQ5A 3BTCA 5J1UA 4AC0A 1RKTA 3CDLA 5GP9A 4ACIA 3VW1A 1JUMA 4M3DA 2VKEA 3IH4A 3Q0UA 4ICHA 3BR1A 3VW2A 2REKA 5HAWA 2HXIA 5J3LA 3VVZA 3VUQA 2EH3A 2ID6A 3LSJA 3BR0A 4G12A 3VVXA 3PPBA 2PZ9A 3B6CA 1BJZA 2UXHA 2PBXA 4NELA 3T6NA 3G56A 2WUIA 3BNIA 3ON2A 3BTJA 4V2FA 3TP3A 5F0FA 2G3BA 3BQYA 1Z77A 3CCYA 5EFYA 1ZKGA 5F08A 2JJ7A 3Q3SA 4JL3A 2ID3A 3AQTA 4MO7A 2FX0A 3ON4A 2HYTA 5FKOA 3ZQFA 3BR5A 4W97A 2D6YA 3Q0VA 1ORKA 3HE0A 3VW0A 3G1OA 2GBYA 1A6IA 4YZEA 4GFLA 3FRQA 2XDNA 3FIWA 2FJ1A 1JTXA 3EGQA 3BRUA 3QKXA 3KKCA 1UI5A 3KZ9A 3KNWA 1QVUA 2G7LA 3CWRA 2HKUA 3NRGA 3O8GA 2Y30A 4ME9A 3VPRA 2XGCA 1JT6A 5CXIA 2ZCMA 1JT0A 4JNNA 5K58A 2Y31A 3P9TA 4V2GA 4ABZA 5J1RA 2UXOA 3VOXA 5GPCA 2W53A 2HXOA 3BJBA 3CRJA 4DW6A 3VOKA 3CJDA 3NXCA 2G0EA 5AQCA 3SDGA 4GCKA 3VIBA 2XGDA 3FK6A 5F27A 2IBDA 1SGMA 2Q24A 2X9DA 2IEKA 2NS7A 4I76A 4GCLA 5CW8A 3TP0A 2QTQA 2ZOYA 2VKVA 4W1UA 5F04A 3NPIA 2TRTA 3MVPA 3DEWA 2DG7A 5EZHA 3JSJA 3B6AA 2OI8A 3NI7A 3IH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK6 A;  2ZOZ A;  2QWT A;  2DG8 A;  2X6O A;  3SFI A;  5IP6 A;  5F0C A;  2FBQ A;  3ZQL A;  1Z0X A;  3G7R A;  5HBU A;  2QOP A;  4GCT A;  4MXM A;  3PAS A;  5FKK A;  4XK4 A;  4AUX A;  3BR3 A;  5FMP A;  2QIB A;  3C2B A;  4M3B A;  2GUH A;  2Y2Z A;  5GPA A;  2V57 A;  1T33 A;  3GEU A;  1QPI A;  3V6G A;  1UI6 A;  3IH2 A;  3LSP A;  1QVT A;  5D18 A;  1JTY A;  5H9T A;  2XPW A;  3HIM A;  3LJL A;  4CGR A;  2YVE A;  3F0C A;  3LWJ A;  3PM1 A;  2OER A;  2QKO A;  1JUS A;  2FD5 A;  2RAE A;  4B1R A;  2NP5 A;  5J1Y A;  3B81 A;  5F1J A;  4JYK A;  4PXI A;  3G1M A;  3V78 A;  3VVY A;  5D1R A;  2WV1 A;  3LOC A;  2UXP A;  2IAI A;  2NX4 A;  2RHA A;  3RD3 A;  3ZQG A;  1ZK8 A;  2XB5 A;  1U9N A;  3BCG A;  2JK3 A;  4L62 A;  2G7S A;  4M3G A;  5K7Z A;  1JUP A;  5C4Y A;  5IPA A;  3HGY A;  4JKZ A;  5FKL A;  3BT9 A;  3BR6 A;  3HTI A;  3VP5 A;  5EYR A;  3HTJ A;  3QPL A;  3FK7 A;  3BTL A;  3F1B A;  2XGE A;  3COL A;  2HYJ A;  4NN1 A;  2ZB9 A;  4M3F A;  3ANG A;  2O7O A;  1T56 A;  2F07 A;  2GFN A;  3AQS A;  4UDS A;  4X1E A;  4D7M A;  3ZQH A;  3Q0W A;  4M3E A;  3GZI A;  3WHB A;  3LHQ A;  3NNR A;  3HTA A;  3ZQI A;  3E7Q A;  5FKM A;  2OPT A;  4D5F A;  3G1L A;  3IUV A;  2G7G A;  3MNL A;  2UXU A;  5IOZ A;  3WHC A;  2QCO A;  4AF5 A;  1RPW A;  5IOY A;  3O8H A;  5FGL A;  2NP3 A;  3QPS A;  2OF7 A;  2ZCN A;  3QBM A;  1RKW A;  5K7H A;  2UXI A;  3DCF A;  3LSR A;  3O60 A;  3BHQ A;  2IU5 A;  3BTI A;  5F0H A;  4I6Z A;  2I10 A;  3EUP A;  5EZG A;  3HTH A;  4B3A A;  2RAS A;  5FKN A;  2TCT A;  4KWA A;  2WGB A;  4HKU A;  2ZCX A;  5FHP A;  1VI0 A;  5HSZ A;  4GFK A;  3DPJ A;  2YVH A;  3RH2 A;  1U9O A;  3HGG A;  2FQ4 A;  2XPU A;  2XRL A;  4AC6 A;  2GEN A;  3ANP A;  3QQA A;  2NS8 A;  3C07 A;  2VPR A;  2XPV A;  3S5R A;  3KKD A;  5CXG A;  2DTZ A;  5D19 A;  3BQZ A;  4D5C A;  5DAJ A;  3BR2 A;  2O7T A;  4D7N A;  5K7F A;  2HQ5 A;  3BTC A;  5J1U A;  4AC0 A;  1RKT A;  3CDL A;  5GP9 A;  4ACI A;  3VW1 A;  1JUM A;  4M3D A;  2VKE A;  3IH4 A;  3Q0U A;  4ICH A;  3BR1 A;  3VW2 A;  2REK A;  5HAW A;  2HXI A;  5J3L A;  3VVZ A;  3VUQ A;  2EH3 A;  2ID6 A;  3LSJ A;  3BR0 A;  4G12 A;  3VVX A;  3PPB A;  2PZ9 A;  3B6C A;  1BJZ A;  2UXH A;  2PBX A;  4NEL A;  3T6N A;  3G56 A;  2WUI A;  3BNI A;  3ON2 A;  3BTJ A;  4V2F A;  3TP3 A;  5F0F A;  2G3B A;  3BQY A;  1Z77 A;  3CCY A;  5EFY A;  1ZKG A;  5F08 A;  2JJ7 A;  3Q3S A;  4JL3 A;  2ID3 A;  3AQT A;  4MO7 A;  2FX0 A;  3ON4 A;  2HYT A;  5FKO A;  3ZQF A;  3BR5 A;  4W97 A;  2D6Y A;  3Q0V A;  1ORK A;  3HE0 A;  3VW0 A;  3G1O A;  2GBY A;  1A6I A;  4YZE A;  4GFL A;  3FRQ A;  2XDN A;  3FIW A;  2FJ1 A;  1JTX A;  3EGQ A;  3BRU A;  3QKX A;  3KKC A;  1UI5 A;  3KZ9 A;  3KNW A;  1QVU A;  2G7L A;  3CWR A;  2HKU A;  3NRG A;  3O8G A;  2Y30 A;  4ME9 A;  3VPR A;  2XGC A;  1JT6 A;  5CXI A;  2ZCM A;  1JT0 A;  4JNN A;  5K58 A;  2Y31 A;  3P9T A;  4V2G A;  4ABZ A;  5J1R A;  2UXO A;  3VOX A;  5GPC A;  2W53 A;  2HXO A;  3BJB A;  3CRJ A;  4DW6 A;  3VOK A;  3CJD A;  3NXC A;  2G0E A;  5AQC A;  3SDG A;  4GCK A;  3VIB A;  2XGD A;  3FK6 A;  5F27 A;  2IBD A;  1SGM A;  2Q24 A;  2X9D A;  2IEK A;  2NS7 A;  4I76 A;  4GCL A;  5CW8 A;  3TP0 A;  2QTQ A;  2ZOY A;  2VKV A;  4W1U A;  5F04 A;  3NPI A;  2TRT A;  3MVP A;  3DEW A;  2DG7 A;  5EZH A;  3JSJ A;  3B6A A;  2OI8 A;  3NI7 A;  3IH3 A; 
#chains in the Genus database with same CATH topology
 4MK6 A;  2ZOZ A;  2QWT A;  2DG8 A;  2X6O A;  3SFI A;  5IP6 A;  5F0C A;  2FBQ A;  3ZQL A;  3NS4 A;  1Z0X A;  3G7R A;  5HBU A;  3DU6 A;  2QOP A;  4GCT A;  4MXM A;  3PAS A;  5FKK A;  4XK4 A;  4AUX A;  3BR3 A;  5FMP A;  2QIB A;  3C2B A;  4M3B A;  2GUH A;  2Y2Z A;  5GPA A;  2R7S A;  2V57 A;  1T33 A;  3GEU A;  3SWH A;  1QPI A;  3V6G A;  1UI6 A;  3IH2 A;  3LSP A;  1QVT A;  5D18 A;  1JTY A;  5H9T A;  2XPW A;  3HIM A;  2R7R A;  3LJL A;  4OD5 A;  4CGR A;  2R7W A;  2YVE A;  3F0C A;  3LWJ A;  3PM1 A;  2OER A;  2QKO A;  1JUS A;  2FD5 A;  4B1R A;  2RAE A;  2NP5 A;  4DVY P;  5J1Y A;  3B81 A;  5F1J A;  4JYK A;  4PXI A;  3G1M A;  2B3W A;  3V78 A;  3VVY A;  5D1R A;  2WV1 A;  3LOC A;  2UXP A;  2IAI A;  4OD4 A;  2NX4 A;  2RHA A;  3RD3 A;  3ZQG A;  1ZK8 A;  2XB5 A;  1U9N A;  3BCG A;  2JK3 A;  4L62 A;  2G7S A;  4M3G A;  5K7Z A;  1JUP A;  5C4Y A;  5IPA A;  3HGY A;  4JKZ A;  5FKL A;  2FJI 1;  3BT9 A;  4WIB A;  2B1E A;  3BR6 A;  3HTI A;  3VP5 A;  5EYR A;  3HTJ A;  3QPL A;  3FK7 A;  3BTL A;  3F1B A;  2XGE A;  3COL A;  2HYJ A;  4NN1 A;  2ZB9 A;  4M3F A;  3ANG A;  2O7O A;  4U9N A;  1T56 A;  2F07 A;  2GFN A;  3AQS A;  4U9L A;  4UDS A;  4X1E A;  4D7M A;  3ZQH A;  3Q0W A;  4M3E A;  3GZI A;  3WHB A;  3LHQ A;  3NNR A;  3HTA A;  3ZQI A;  3E7Q A;  5FKM A;  2OPT A;  4D5F A;  3G1L A;  3IUV A;  2G7G A;  3MNL A;  2UXU A;  5IOZ A;  5CQG A;  3WHC A;  2QCO A;  4AF5 A;  1RPW A;  5IOY A;  3O8H A;  5FGL A;  2YVX A;  2NP3 A;  3QPS A;  3VTI A;  2OF7 A;  2ZCN A;  3QBM A;  1RKW A;  5K7H A;  2UXI A;  3DCF A;  3LSR A;  3O60 A;  3BHQ A;  2IU5 A;  3BTI A;  5F0H A;  2I10 A;  4I6Z A;  3EUP A;  5EZG A;  3HTH A;  4B3A A;  2RAS A;  5FKN A;  2TCT A;  4KWA A;  2WGB A;  4HKU A;  2ZCX A;  4IRV A;  5FHP A;  1VI0 A;  5HSZ A;  4GFK A;  2R7X A;  3DPJ A;  2YVH A;  3RH2 A;  1U9O A;  3HGG A;  2FQ4 A;  2XPU A;  2XRL A;  4AC6 A;  2GEN A;  3ANP A;  3QQA A;  2R7Q A;  2NS8 A;  3C07 A;  2VPR A;  2XPV A;  3S5R A;  3KKD A;  5CXG A;  2DTZ A;  5D19 A;  2PFV A;  3BQZ A;  4D5C A;  5DAJ A;  3BR2 A;  2O7T A;  4D7N A;  5K7F A;  2HQ5 A;  3BTC A;  5J1U A;  4AC0 A;  1RKT A;  3CDL A;  5GP9 A;  4ACI A;  3VW1 A;  2R7V A;  1JUM A;  4M3D A;  2VKE A;  3IH4 A;  3Q0U A;  4ICH A;  3BR1 A;  3VW2 A;  2REK A;  4C2M A;  5HAW A;  2HXI A;  5J3L A;  3VVZ A;  3VUQ A;  2EH3 A;  2ID6 A;  3LSJ A;  3BR0 A;  4G12 A;  3VVX A;  3PPB A;  2PZ9 A;  3B6C A;  1BJZ A;  2UXH A;  3KYL A;  2PBX A;  4NEL A;  3T6N A;  3G56 A;  2WUI A;  3BNI A;  2R7T A;  3ON2 A;  3BTJ A;  4V2F A;  3TP3 A;  5F0F A;  2G3B A;  3BQY A;  1Z77 A;  3CCY A;  5EFY A;  1ZKG A;  5F08 A;  2JJ7 A;  3Q3S A;  3DU5 A;  4JL3 A;  2ID3 A;  3AQT A;  4MO7 A;  2FX0 A;  3ON4 A;  2HYT A;  2A2F X;  5FKO A;  3BR5 A;  3ZQF A;  4W97 A;  2D6Y A;  3Q0V A;  1ORK A;  3HE0 A;  3VW0 A;  3G1O A;  2GBY A;  1A6I A;  4YZE A;  4GFL A;  3FRQ A;  3K8P C;  2XDN A;  3FIW A;  2FJ1 A;  1JTX A;  3EGQ A;  3BRU A;  3QKX A;  3KKC A;  1UI5 A;  3KZ9 A;  3KNW A;  1QVU A;  2G7L A;  3CWR A;  2HKU A;  2ZY9 A;  3FHN A;  3NRG A;  3O8G A;  2Y30 A;  4ME9 A;  3VPR A;  2XGC A;  1JT6 A;  5CXI A;  2ZCM A;  1JT0 A;  4JNN A;  5K58 A;  2Y31 A;  3P9T A;  4V2G A;  4ABZ A;  5J1R A;  2UXO A;  3VOX A;  5GPC A;  2W53 A;  2HXO A;  3BJB A;  3CRJ A;  4DW6 A;  3VOK A;  3CJD A;  3NXC A;  2G0E A;  5AQC A;  3SDG A;  4GCK A;  3VIB A;  2XGD A;  3FK6 A;  5F27 A;  2IBD A;  1SGM A;  2Q24 A;  2X9D A;  2R7U A;  2IEK A;  2NS7 A;  4I76 A;  4GCL A;  2R7O A;  5CW8 A;  3TP0 A;  2QTQ A;  2ZOY A;  2VKV A;  4W1U A;  5F04 A;  3NPI A;  2TRT A;  3MVP A;  3DEW A;  2DG7 A;  5EZH A;  3JSJ A;  3B6A A;  2OI8 A;  3NI7 A;  3IH3 A; 
#chains in the Genus database with same CATH homology
 4MK6 A;  2ZOZ A;  2QWT A;  2DG8 A;  2X6O A;  3SFI A;  5IP6 A;  5F0C A;  2FBQ A;  3ZQL A;  1Z0X A;  3G7R A;  5HBU A;  2QOP A;  4GCT A;  4MXM A;  3PAS A;  5FKK A;  4XK4 A;  4AUX A;  3BR3 A;  5FMP A;  2QIB A;  3C2B A;  4M3B A;  2GUH A;  2Y2Z A;  5GPA A;  2V57 A;  1T33 A;  3GEU A;  1QPI A;  3V6G A;  1UI6 A;  3IH2 A;  3LSP A;  1QVT A;  5D18 A;  1JTY A;  5H9T A;  2XPW A;  3HIM A;  3LJL A;  4CGR A;  2YVE A;  3F0C A;  3LWJ A;  3PM1 A;  2OER A;  2QKO A;  1JUS A;  2FD5 A;  2RAE A;  4B1R A;  2NP5 A;  5J1Y A;  3B81 A;  5F1J A;  4JYK A;  4PXI A;  3G1M A;  3V78 A;  3VVY A;  5D1R A;  2WV1 A;  3LOC A;  2UXP A;  2IAI A;  2NX4 A;  2RHA A;  3RD3 A;  3ZQG A;  1ZK8 A;  2XB5 A;  1U9N A;  3BCG A;  2JK3 A;  4L62 A;  2G7S A;  4M3G A;  5K7Z A;  1JUP A;  5C4Y A;  5IPA A;  3HGY A;  4JKZ A;  5FKL A;  3BT9 A;  3BR6 A;  3HTI A;  3VP5 A;  5EYR A;  3HTJ A;  3QPL A;  3FK7 A;  3BTL A;  3F1B A;  2XGE A;  3COL A;  2HYJ A;  4NN1 A;  2ZB9 A;  4M3F A;  3ANG A;  2O7O A;  1T56 A;  2F07 A;  2GFN A;  3AQS A;  4UDS A;  4X1E A;  4D7M A;  3ZQH A;  3Q0W A;  4M3E A;  3GZI A;  3WHB A;  3LHQ A;  3NNR A;  3HTA A;  3ZQI A;  3E7Q A;  5FKM A;  2OPT A;  4D5F A;  3G1L A;  3IUV A;  2G7G A;  3MNL A;  2UXU A;  5IOZ A;  3WHC A;  2QCO A;  4AF5 A;  1RPW A;  5IOY A;  3O8H A;  5FGL A;  2NP3 A;  3QPS A;  2OF7 A;  2ZCN A;  3QBM A;  1RKW A;  5K7H A;  2UXI A;  3DCF A;  3LSR A;  3O60 A;  3BHQ A;  2IU5 A;  3BTI A;  5F0H A;  4I6Z A;  2I10 A;  3EUP A;  5EZG A;  3HTH A;  4B3A A;  2RAS A;  5FKN A;  2TCT A;  4KWA A;  2WGB A;  4HKU A;  2ZCX A;  5FHP A;  1VI0 A;  5HSZ A;  4GFK A;  3DPJ A;  2YVH A;  3RH2 A;  1U9O A;  3HGG A;  2FQ4 A;  2XPU A;  2XRL A;  4AC6 A;  2GEN A;  3ANP A;  3QQA A;  2NS8 A;  3C07 A;  2VPR A;  2XPV A;  3S5R A;  3KKD A;  5CXG A;  2DTZ A;  5D19 A;  3BQZ A;  4D5C A;  5DAJ A;  3BR2 A;  2O7T A;  4D7N A;  5K7F A;  2HQ5 A;  3BTC A;  5J1U A;  4AC0 A;  1RKT A;  3CDL A;  5GP9 A;  4ACI A;  3VW1 A;  1JUM A;  4M3D A;  2VKE A;  3IH4 A;  3Q0U A;  4ICH A;  3BR1 A;  3VW2 A;  2REK A;  5HAW A;  2HXI A;  5J3L A;  3VVZ A;  3VUQ A;  2EH3 A;  2ID6 A;  3LSJ A;  3BR0 A;  4G12 A;  3VVX A;  3PPB A;  2PZ9 A;  3B6C A;  1BJZ A;  2UXH A;  2PBX A;  4NEL A;  3T6N A;  3G56 A;  2WUI A;  3BNI A;  3ON2 A;  3BTJ A;  4V2F A;  3TP3 A;  5F0F A;  2G3B A;  3BQY A;  1Z77 A;  3CCY A;  5EFY A;  1ZKG A;  5F08 A;  2JJ7 A;  3Q3S A;  4JL3 A;  2ID3 A;  3AQT A;  4MO7 A;  2FX0 A;  3ON4 A;  2HYT A;  5FKO A;  3ZQF A;  3BR5 A;  4W97 A;  2D6Y A;  3Q0V A;  1ORK A;  3HE0 A;  3VW0 A;  3G1O A;  2GBY A;  1A6I A;  4YZE A;  4GFL A;  3FRQ A;  2XDN A;  3FIW A;  2FJ1 A;  1JTX A;  3EGQ A;  3BRU A;  3QKX A;  3KKC A;  1UI5 A;  3KZ9 A;  3KNW A;  1QVU A;  2G7L A;  3CWR A;  2HKU A;  3NRG A;  3O8G A;  2Y30 A;  4ME9 A;  3VPR A;  2XGC A;  1JT6 A;  5CXI A;  2ZCM A;  1JT0 A;  4JNN A;  5K58 A;  2Y31 A;  3P9T A;  4V2G A;  4ABZ A;  5J1R A;  2UXO A;  3VOX A;  5GPC A;  2W53 A;  2HXO A;  3BJB A;  3CRJ A;  4DW6 A;  3VOK A;  3CJD A;  3NXC A;  2G0E A;  5AQC A;  3SDG A;  4GCK A;  3VIB A;  2XGD A;  3FK6 A;  5F27 A;  2IBD A;  1SGM A;  2Q24 A;  2X9D A;  2IEK A;  2NS7 A;  4I76 A;  4GCL A;  5CW8 A;  3TP0 A;  2QTQ A;  2ZOY A;  2VKV A;  4W1U A;  5F04 A;  3NPI A;  2TRT A;  3MVP A;  3DEW A;  2DG7 A;  5EZH A;  3JSJ A;  3B6A A;  2OI8 A;  3NI7 A;  3IH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...