5FMPA

Kstr, transcriptional repressor of cholesterol degradation in mycobacterium tuberculosis, bound to the dna operator
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
184
structure length
184
Chain Sequence
GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR KSTR
publication title Kstr, Transcriptional Repressor of Cholesterol Degradation in Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 77
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5fmpA00
3TP3A 1U9NA 1ZK8A 5D18A 5IP6A 2UXUA 2WV1A 4ABZA 3PPBA 3V78A 4GCKA 3CJDA 2G7SA 3LOCA 3O60A 5D19A 2XGEA 3HTIA 3HTJA 3BRUA 2IAIA 2GUHA 2PZ9A 3VPRA 3VP5A 3LSJA 2QKOA 3KKCA 1JT6A 1JTYA 4AC6A 4I6ZA 3G1LA 4V2GA 3ANGA 5F08A 3VW2A 3LSPA 4JNNA 2HKUA 4G12A 5FKOA 3BCGA 4M3EA 3ZQFA 3VVXA 4KWAA 3LWJA 5CXGA 4JKZA 4D5FA 3SDGA 2GENA 4M3BA 3ON2A 2O7OA 1T56A 2VKEA 3B6AA 5F1JA 2Y31A 2UXPA 2NS7A 4MO7A 2UXHA 3T6NA 2JK3A 4HKUA 2GBYA 2HYTA 5AQCA 2HYJA 2VPRA 3Q0UA 2VKVA 1ZKGA 3BTCA 4JL3A 5GP9A 5HSZA 4W1UA 1U9OA 3KZ9A 1A6IA 2OI8A 3GZIA 2FD5A 3DEWA 1JTXA 5J3LA 1VI0A 4ME9A 4X1EA 3VIBA 3Q0WA 2JJ7A 2GFNA 5FKNA 5K7ZA 3RD3A 4AF5A 5F04A 3VW1A 2XB5A 5CXIA 3MNLA 2I10A 2REKA 3WHBA 1SGMA 3O8GA 4AC0A 4CGRA 3BR0A 5FKKA 3BR5A 4GFKA 5K7FA 3SFIA 3G1MA 2WGBA 2WUIA 2FJ1A 2Q24A 4DW6A 4ICHA 3RH2A 2X6OA 5K7HA 3F0CA 5FKLA 2PBXA 4UDSA 5EZHA 2EH3A 3FIWA 3NNRA 3NPIA 3CDLA 2X9DA 2ZB9A 5J1UA 4MK6A 1UI5A 5HAWA 3IUVA 1ORKA 3VUQA 3BNIA 3V6GA 2QWTA 2XPWA 3BR6A 3CRJA 2HXOA 5IPAA 2QTQA 3LSRA 3BTIA 4W97A 2F07A 3BTJA 5IOYA 3S5RA 1RPWA 2XRLA 4JYKA 5FMPA 3G1OA 1JUPA 3QBMA 5J1RA 2XDNA 3KNWA 3G56A 3LJLA 2FX0A 2V57A 2QOPA 4GCLA 5DAJA 2DG7A 3CCYA 2OPTA 3DCFA 3QPSA 2XGDA 3E7QA 3MVPA 2DTZA 2OERA 3VOXA 4M3DA 2TCTA 3ON4A 3HTHA 3VOKA 3B6CA 5FKMA 4D7NA 2W53A 3ZQGA 2UXOA 2HXIA 4I76A 2ZCXA 5F27A 2ZOZA 3NXCA 5J1YA 2RASA 1QPIA 2ZCNA 3HGYA 3Q3SA 4AUXA 5GPAA 3BQZA 2UXIA 3O8HA 4B1RA 3BHQA 2NS8A 2ZCMA 3PM1A 2IU5A 2TRTA 3HTAA 3IH4A 1JUSA 5D1RA 3F1BA 5C4YA 4YZEA 2HQ5A 3HIMA 3AQTA 3NI7A 3Q0VA 4GFLA 3HE0A 2IBDA 3PASA 2G0EA 5CW8A 2YVEA 4D5CA 4GCTA 5HBUA 4NN1A 5FGLA 5IOZA 2FQ4A 3P9TA 1QVUA 3EUPA 2G3BA 2YVHA 3AQSA 3GEUA 4B3AA 3BR1A 3IH3A 2O7TA 1T33A 3FRQA 1RKTA 4L62A 5FHPA 3CWRA 3ZQHA 2Y2ZA 4M3GA 5F0FA 3NRGA 4D7MA 2OF7A 1Z77A 2XPUA 2IEKA 4XK4A 2FBQA 5EFYA 2ID3A 3G7RA 4V2FA 2ID6A 2G7LA 3TP0A 3B81A 3BT9A 3LHQA 5F0CA 2QIBA 4M3FA 3WHCA 2RHAA 3VVZA 5GPCA 3HGGA 3BJBA 5EYRA 1Z0XA 3BQYA 3JSJA 2NP5A 5H9TA 2Y30A 4PXIA 1JUMA 3BR3A 3VW0A 3C2BA 4MXMA 4ACIA 5F0HA 5K58A 1BJZA 3ZQLA 1RKWA 1JT0A 3FK7A 5EZGA 1UI6A 2XGCA 3KKDA 3ZQIA 4NELA 3DPJA 2QCOA 2RAEA 3VVYA 2XPVA 3FK6A 2G7GA 3COLA 1QVTA 3ANPA 2D6YA 2DG8A 3C07A 3QKXA 3QQAA 3QPLA 3EGQA 3IH2A 3BR2A 2ZOYA 2NX4A 3BTLA 2NP3A
chains in the Genus database with same CATH superfamily
3TP3A 1U9NA 1ZK8A 5D18A 5IP6A 2UXUA 2WV1A 4ABZA 3PPBA 3V78A 4GCKA 3CJDA 2G7SA 3LOCA 3O60A 5D19A 2XGEA 3HTIA 3HTJA 3BRUA 2IAIA 2R7SA 2GUHA 3DU6A 2PZ9A 3VPRA 3VP5A 3LSJA 2QKOA 3KKCA 1JT6A 1JTYA 4AC6A 4I6ZA 3G1LA 4V2GA 5CQGA 3ANGA 3K8PC 5F08A 3VW2A 3LSPA 4JNNA 2HKUA 4G12A 5FKOA 3BCGA 4M3EA 3ZQFA 3VVXA 4KWAA 3SWHA 3LWJA 5CXGA 4WIBA 4JKZA 4D5FA 3SDGA 2YVXA 2GENA 4M3BA 3ON2A 2O7OA 1T56A 2VKEA 3B6AA 5F1JA 2Y31A 4OD5A 2UXPA 2NS7A 4MO7A 2UXHA 3T6NA 2JK3A 4HKUA 2PFVA 2GBYA 2HYTA 5AQCA 2HYJA 2VPRA 3Q0UA 2VKVA 1ZKGA 3BTCA 4JL3A 5GP9A 5HSZA 4W1UA 2FJI1 1U9OA 3KZ9A 1A6IA 2R7QA 2OI8A 3GZIA 2FD5A 3DEWA 1JTXA 5J3LA 1VI0A 4ME9A 4X1EA 3VIBA 3Q0WA 2JJ7A 2GFNA 5FKNA 3NS4A 5K7ZA 3RD3A 4AF5A 5F04A 3VW1A 2XB5A 5CXIA 3MNLA 2I10A 2REKA 3WHBA 4C2MA 1SGMA 3O8GA 4U9NA 4AC0A 4CGRA 3BR0A 5FKKA 3BR5A 4GFKA 5K7FA 3SFIA 3G1MA 2WGBA 2WUIA 2FJ1A 2Q24A 4DW6A 4ICHA 3RH2A 2X6OA 5K7HA 3F0CA 5FKLA 2PBXA 4UDSA 5EZHA 2EH3A 3FIWA 3NNRA 3NPIA 3CDLA 2X9DA 2ZB9A 5J1UA 4MK6A 1UI5A 5HAWA 3IUVA 1ORKA 3VUQA 3BNIA 3V6GA 2QWTA 2XPWA 3BR6A 3CRJA 2HXOA 5IPAA 2QTQA 4U9LA 3LSRA 3BTIA 4W97A 2F07A 3BTJA 5IOYA 3S5RA 1RPWA 2XRLA 4JYKA 5FMPA 3G1OA 2R7VA 1JUPA 3QBMA 5J1RA 2XDNA 3KNWA 3G56A 3LJLA 2FX0A 2V57A 2QOPA 2B3WA 4GCLA 5DAJA 2DG7A 3FHNA 3CCYA 2OPTA 3DCFA 3QPSA 2XGDA 3E7QA 3MVPA 2DTZA 2OERA 3VOXA 4M3DA 2TCTA 3ON4A 3HTHA 2B1EA 3VOKA 3B6CA 2R7RA 5FKMA 4D7NA 2W53A 3ZQGA 2UXOA 2HXIA 4I76A 2ZCXA 5F27A 2ZOZA 3NXCA 5J1YA 2RASA 1QPIA 2ZCNA 3HGYA 3Q3SA 4AUXA 5GPAA 3BQZA 2UXIA 2A2FX 3O8HA 4B1RA 3BHQA 2NS8A 2ZCMA 3PM1A 2IU5A 2R7XA 2TRTA 3HTAA 3IH4A 1JUSA 5D1RA 3F1BA 5C4YA 4YZEA 2HQ5A 3HIMA 3AQTA 3NI7A 3Q0VA 4GFLA 3HE0A 2IBDA 3PASA 2G0EA 5CW8A 2R7UA 2YVEA 4D5CA 4IRVA 4GCTA 5HBUA 4NN1A 5FGLA 5IOZA 2FQ4A 3P9TA 1QVUA 3EUPA 3DU5A 2G3BA 2YVHA 3AQSA 3GEUA 4B3AA 3BR1A 3IH3A 2O7TA 1T33A 3FRQA 1RKTA 4L62A 5FHPA 3CWRA 3ZQHA 2Y2ZA 4M3GA 5F0FA 3NRGA 4D7MA 2OF7A 1Z77A 2XPUA 3KYLA 2IEKA 4XK4A 2FBQA 5EFYA 2ID3A 3G7RA 4V2FA 2ID6A 2G7LA 3TP0A 3B81A 3BT9A 3LHQA 5F0CA 2QIBA 4M3FA 3WHCA 2RHAA 3VVZA 5GPCA 3HGGA 3BJBA 5EYRA 1Z0XA 3BQYA 4OD4A 3JSJA 2R7TA 2NP5A 5H9TA 2Y30A 4PXIA 1JUMA 3BR3A 3VW0A 3C2BA 2R7WA 4MXMA 4ACIA 5F0HA 2ZY9A 5K58A 1BJZA 3ZQLA 1RKWA 1JT0A 3FK7A 5EZGA 1UI6A 2XGCA 3KKDA 3ZQIA 4NELA 2R7OA 3DPJA 2QCOA 2RAEA 3VVYA 2XPVA 3FK6A 2G7GA 3COLA 1QVTA 3ANPA 2D6YA 3VTIA 2DG8A 3C07A 3QKXA 3QQAA 3QPLA 4DVYP 3EGQA 3IH2A 3BR2A 2ZOYA 2NX4A 3BTLA 2NP3A
chains in the Genus database with same CATH topology
3TP3A 1U9NA 1ZK8A 5D18A 5IP6A 2UXUA 2WV1A 4ABZA 3PPBA 3V78A 4GCKA 3CJDA 2G7SA 3LOCA 3O60A 5D19A 2XGEA 3HTIA 3HTJA 3BRUA 2IAIA 2GUHA 2PZ9A 3VPRA 3VP5A 3LSJA 2QKOA 3KKCA 1JT6A 1JTYA 4AC6A 4I6ZA 3G1LA 4V2GA 3ANGA 5F08A 3VW2A 3LSPA 4JNNA 2HKUA 4G12A 5FKOA 3BCGA 4M3EA 3ZQFA 3VVXA 4KWAA 3LWJA 5CXGA 4JKZA 4D5FA 3SDGA 2GENA 4M3BA 3ON2A 2O7OA 1T56A 2VKEA 3B6AA 5F1JA 2Y31A 2UXPA 2NS7A 4MO7A 2UXHA 3T6NA 2JK3A 4HKUA 2GBYA 2HYTA 5AQCA 2HYJA 2VPRA 3Q0UA 2VKVA 1ZKGA 3BTCA 4JL3A 5GP9A 5HSZA 4W1UA 1U9OA 3KZ9A 1A6IA 2OI8A 3GZIA 2FD5A 3DEWA 1JTXA 5J3LA 1VI0A 4ME9A 4X1EA 3VIBA 3Q0WA 2JJ7A 2GFNA 5FKNA 5K7ZA 3RD3A 4AF5A 5F04A 3VW1A 2XB5A 5CXIA 3MNLA 2I10A 2REKA 3WHBA 1SGMA 3O8GA 4AC0A 4CGRA 3BR0A 5FKKA 3BR5A 4GFKA 5K7FA 3SFIA 3G1MA 2WGBA 2WUIA 2FJ1A 2Q24A 4DW6A 4ICHA 3RH2A 2X6OA 5K7HA 3F0CA 5FKLA 2PBXA 4UDSA 5EZHA 2EH3A 3FIWA 3NNRA 3NPIA 3CDLA 2X9DA 2ZB9A 5J1UA 4MK6A 1UI5A 5HAWA 3IUVA 1ORKA 3VUQA 3BNIA 3V6GA 2QWTA 2XPWA 3BR6A 3CRJA 2HXOA 5IPAA 2QTQA 3LSRA 3BTIA 4W97A 2F07A 3BTJA 5IOYA 3S5RA 1RPWA 2XRLA 4JYKA 5FMPA 3G1OA 1JUPA 3QBMA 5J1RA 2XDNA 3KNWA 3G56A 3LJLA 2FX0A 2V57A 2QOPA 4GCLA 5DAJA 2DG7A 3CCYA 2OPTA 3DCFA 3QPSA 2XGDA 3E7QA 3MVPA 2DTZA 2OERA 3VOXA 4M3DA 2TCTA 3ON4A 3HTHA 3VOKA 3B6CA 5FKMA 4D7NA 2W53A 3ZQGA 2UXOA 2HXIA 4I76A 2ZCXA 5F27A 2ZOZA 3NXCA 5J1YA 2RASA 1QPIA 2ZCNA 3HGYA 3Q3SA 4AUXA 5GPAA 3BQZA 2UXIA 3O8HA 4B1RA 3BHQA 2NS8A 2ZCMA 3PM1A 2IU5A 2TRTA 3HTAA 3IH4A 1JUSA 5D1RA 3F1BA 5C4YA 4YZEA 2HQ5A 3HIMA 3AQTA 3NI7A 3Q0VA 4GFLA 3HE0A 2IBDA 3PASA 2G0EA 5CW8A 2YVEA 4D5CA 4GCTA 5HBUA 4NN1A 5FGLA 5IOZA 2FQ4A 3P9TA 1QVUA 3EUPA 2G3BA 2YVHA 3AQSA 3GEUA 4B3AA 3BR1A 3IH3A 2O7TA 1T33A 3FRQA 1RKTA 4L62A 5FHPA 3CWRA 3ZQHA 2Y2ZA 4M3GA 5F0FA 3NRGA 4D7MA 2OF7A 1Z77A 2XPUA 2IEKA 4XK4A 2FBQA 5EFYA 2ID3A 3G7RA 4V2FA 2ID6A 2G7LA 3TP0A 3B81A 3BT9A 3LHQA 5F0CA 2QIBA 4M3FA 3WHCA 2RHAA 3VVZA 5GPCA 3HGGA 3BJBA 5EYRA 1Z0XA 3BQYA 3JSJA 2NP5A 5H9TA 2Y30A 4PXIA 1JUMA 3BR3A 3VW0A 3C2BA 4MXMA 4ACIA 5F0HA 5K58A 1BJZA 3ZQLA 1RKWA 1JT0A 3FK7A 5EZGA 1UI6A 2XGCA 3KKDA 3ZQIA 4NELA 3DPJA 2QCOA 2RAEA 3VVYA 2XPVA 3FK6A 2G7GA 3COLA 1QVTA 3ANPA 2D6YA 2DG8A 3C07A 3QKXA 3QQAA 3QPLA 3EGQA 3IH2A 3BR2A 2ZOYA 2NX4A 3BTLA 2NP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP3 A;  1U9N A;  1ZK8 A;  5D18 A;  5IP6 A;  2UXU A;  2WV1 A;  4ABZ A;  3PPB A;  3V78 A;  4GCK A;  3CJD A;  2G7S A;  3LOC A;  3O60 A;  5D19 A;  2XGE A;  3HTI A;  3HTJ A;  3BRU A;  2IAI A;  2GUH A;  2PZ9 A;  3VPR A;  3VP5 A;  3LSJ A;  2QKO A;  3KKC A;  1JT6 A;  1JTY A;  4AC6 A;  4I6Z A;  3G1L A;  4V2G A;  3ANG A;  5F08 A;  3VW2 A;  3LSP A;  4JNN A;  2HKU A;  4G12 A;  5FKO A;  3BCG A;  4M3E A;  3ZQF A;  3VVX A;  4KWA A;  3LWJ A;  5CXG A;  4JKZ A;  4D5F A;  3SDG A;  2GEN A;  4M3B A;  3ON2 A;  2O7O A;  1T56 A;  2VKE A;  3B6A A;  5F1J A;  2Y31 A;  2UXP A;  2NS7 A;  4MO7 A;  2UXH A;  3T6N A;  2JK3 A;  4HKU A;  2GBY A;  2HYT A;  5AQC A;  2HYJ A;  2VPR A;  3Q0U A;  2VKV A;  1ZKG A;  3BTC A;  4JL3 A;  5GP9 A;  5HSZ A;  4W1U A;  1U9O A;  3KZ9 A;  1A6I A;  2OI8 A;  3GZI A;  2FD5 A;  3DEW A;  1JTX A;  5J3L A;  1VI0 A;  4ME9 A;  4X1E A;  3VIB A;  3Q0W A;  2JJ7 A;  2GFN A;  5FKN A;  5K7Z A;  3RD3 A;  4AF5 A;  5F04 A;  3VW1 A;  2XB5 A;  5CXI A;  3MNL A;  2I10 A;  2REK A;  3WHB A;  1SGM A;  3O8G A;  4AC0 A;  4CGR A;  3BR0 A;  5FKK A;  3BR5 A;  4GFK A;  5K7F A;  3SFI A;  3G1M A;  2WGB A;  2WUI A;  2FJ1 A;  2Q24 A;  4DW6 A;  4ICH A;  3RH2 A;  2X6O A;  5K7H A;  3F0C A;  5FKL A;  2PBX A;  4UDS A;  5EZH A;  2EH3 A;  3FIW A;  3NNR A;  3NPI A;  3CDL A;  2X9D A;  2ZB9 A;  5J1U A;  4MK6 A;  1UI5 A;  5HAW A;  3IUV A;  1ORK A;  3VUQ A;  3BNI A;  3V6G A;  2QWT A;  2XPW A;  3BR6 A;  3CRJ A;  2HXO A;  5IPA A;  2QTQ A;  3LSR A;  3BTI A;  4W97 A;  2F07 A;  3BTJ A;  5IOY A;  3S5R A;  1RPW A;  2XRL A;  4JYK A;  5FMP A;  3G1O A;  1JUP A;  3QBM A;  5J1R A;  2XDN A;  3KNW A;  3G56 A;  3LJL A;  2FX0 A;  2V57 A;  2QOP A;  4GCL A;  5DAJ A;  2DG7 A;  3CCY A;  2OPT A;  3DCF A;  3QPS A;  2XGD A;  3E7Q A;  3MVP A;  2DTZ A;  2OER A;  3VOX A;  4M3D A;  2TCT A;  3ON4 A;  3HTH A;  3VOK A;  3B6C A;  5FKM A;  4D7N A;  2W53 A;  3ZQG A;  2UXO A;  2HXI A;  4I76 A;  2ZCX A;  5F27 A;  2ZOZ A;  3NXC A;  5J1Y A;  2RAS A;  1QPI A;  2ZCN A;  3HGY A;  3Q3S A;  4AUX A;  5GPA A;  3BQZ A;  2UXI A;  3O8H A;  4B1R A;  3BHQ A;  2NS8 A;  2ZCM A;  3PM1 A;  2IU5 A;  2TRT A;  3HTA A;  3IH4 A;  1JUS A;  5D1R A;  3F1B A;  5C4Y A;  4YZE A;  2HQ5 A;  3HIM A;  3AQT A;  3NI7 A;  3Q0V A;  4GFL A;  3HE0 A;  2IBD A;  3PAS A;  2G0E A;  5CW8 A;  2YVE A;  4D5C A;  4GCT A;  5HBU A;  4NN1 A;  5FGL A;  5IOZ A;  2FQ4 A;  3P9T A;  1QVU A;  3EUP A;  2G3B A;  2YVH A;  3AQS A;  3GEU A;  4B3A A;  3BR1 A;  3IH3 A;  2O7T A;  1T33 A;  3FRQ A;  1RKT A;  4L62 A;  5FHP A;  3CWR A;  3ZQH A;  2Y2Z A;  4M3G A;  5F0F A;  3NRG A;  4D7M A;  2OF7 A;  1Z77 A;  2XPU A;  2IEK A;  4XK4 A;  2FBQ A;  5EFY A;  2ID3 A;  3G7R A;  4V2F A;  2ID6 A;  2G7L A;  3TP0 A;  3B81 A;  3BT9 A;  3LHQ A;  5F0C A;  2QIB A;  4M3F A;  3WHC A;  2RHA A;  3VVZ A;  5GPC A;  3HGG A;  3BJB A;  5EYR A;  1Z0X A;  3BQY A;  3JSJ A;  2NP5 A;  5H9T A;  2Y30 A;  4PXI A;  1JUM A;  3BR3 A;  3VW0 A;  3C2B A;  4MXM A;  4ACI A;  5F0H A;  5K58 A;  1BJZ A;  3ZQL A;  1RKW A;  1JT0 A;  3FK7 A;  5EZG A;  1UI6 A;  2XGC A;  3KKD A;  3ZQI A;  4NEL A;  3DPJ A;  2QCO A;  2RAE A;  3VVY A;  2XPV A;  3FK6 A;  2G7G A;  3COL A;  1QVT A;  3ANP A;  2D6Y A;  2DG8 A;  3C07 A;  3QKX A;  3QQA A;  3QPL A;  3EGQ A;  3IH2 A;  3BR2 A;  2ZOY A;  2NX4 A;  3BTL A;  2NP3 A; 
#chains in the Genus database with same CATH topology
 3TP3 A;  1U9N A;  1ZK8 A;  5D18 A;  5IP6 A;  2UXU A;  2WV1 A;  4ABZ A;  3PPB A;  3V78 A;  4GCK A;  3CJD A;  2G7S A;  3LOC A;  3O60 A;  5D19 A;  2XGE A;  3HTI A;  3HTJ A;  3BRU A;  2IAI A;  2R7S A;  2GUH A;  3DU6 A;  2PZ9 A;  3VPR A;  3VP5 A;  3LSJ A;  2QKO A;  3KKC A;  1JT6 A;  1JTY A;  4AC6 A;  4I6Z A;  3G1L A;  4V2G A;  5CQG A;  3ANG A;  3K8P C;  5F08 A;  3VW2 A;  3LSP A;  4JNN A;  2HKU A;  4G12 A;  5FKO A;  3BCG A;  4M3E A;  3ZQF A;  3VVX A;  4KWA A;  3SWH A;  3LWJ A;  5CXG A;  4WIB A;  4JKZ A;  4D5F A;  3SDG A;  2YVX A;  2GEN A;  4M3B A;  3ON2 A;  2O7O A;  1T56 A;  2VKE A;  3B6A A;  5F1J A;  2Y31 A;  4OD5 A;  2UXP A;  2NS7 A;  4MO7 A;  2UXH A;  3T6N A;  2JK3 A;  4HKU A;  2PFV A;  2GBY A;  2HYT A;  5AQC A;  2HYJ A;  2VPR A;  3Q0U A;  2VKV A;  1ZKG A;  3BTC A;  4JL3 A;  5GP9 A;  5HSZ A;  4W1U A;  2FJI 1;  1U9O A;  3KZ9 A;  1A6I A;  2R7Q A;  2OI8 A;  3GZI A;  2FD5 A;  3DEW A;  1JTX A;  5J3L A;  1VI0 A;  4ME9 A;  4X1E A;  3VIB A;  3Q0W A;  2JJ7 A;  2GFN A;  5FKN A;  3NS4 A;  5K7Z A;  3RD3 A;  4AF5 A;  5F04 A;  3VW1 A;  2XB5 A;  5CXI A;  3MNL A;  2I10 A;  2REK A;  3WHB A;  4C2M A;  1SGM A;  3O8G A;  4U9N A;  4AC0 A;  4CGR A;  3BR0 A;  5FKK A;  3BR5 A;  4GFK A;  5K7F A;  3SFI A;  3G1M A;  2WGB A;  2WUI A;  2FJ1 A;  2Q24 A;  4DW6 A;  4ICH A;  3RH2 A;  2X6O A;  5K7H A;  3F0C A;  5FKL A;  2PBX A;  4UDS A;  5EZH A;  2EH3 A;  3FIW A;  3NNR A;  3NPI A;  3CDL A;  2X9D A;  2ZB9 A;  5J1U A;  4MK6 A;  1UI5 A;  5HAW A;  3IUV A;  1ORK A;  3VUQ A;  3BNI A;  3V6G A;  2QWT A;  2XPW A;  3BR6 A;  3CRJ A;  2HXO A;  5IPA A;  2QTQ A;  4U9L A;  3LSR A;  3BTI A;  4W97 A;  2F07 A;  3BTJ A;  5IOY A;  3S5R A;  1RPW A;  2XRL A;  4JYK A;  5FMP A;  3G1O A;  2R7V A;  1JUP A;  3QBM A;  5J1R A;  2XDN A;  3KNW A;  3G56 A;  3LJL A;  2FX0 A;  2V57 A;  2QOP A;  2B3W A;  4GCL A;  5DAJ A;  2DG7 A;  3FHN A;  3CCY A;  2OPT A;  3DCF A;  3QPS A;  2XGD A;  3E7Q A;  3MVP A;  2DTZ A;  2OER A;  3VOX A;  4M3D A;  2TCT A;  3ON4 A;  3HTH A;  2B1E A;  3VOK A;  3B6C A;  2R7R A;  5FKM A;  4D7N A;  2W53 A;  3ZQG A;  2UXO A;  2HXI A;  4I76 A;  2ZCX A;  5F27 A;  2ZOZ A;  3NXC A;  5J1Y A;  2RAS A;  1QPI A;  2ZCN A;  3HGY A;  3Q3S A;  4AUX A;  5GPA A;  3BQZ A;  2UXI A;  2A2F X;  3O8H A;  4B1R A;  3BHQ A;  2NS8 A;  2ZCM A;  3PM1 A;  2IU5 A;  2R7X A;  2TRT A;  3HTA A;  3IH4 A;  1JUS A;  5D1R A;  3F1B A;  5C4Y A;  4YZE A;  2HQ5 A;  3HIM A;  3AQT A;  3NI7 A;  3Q0V A;  4GFL A;  3HE0 A;  2IBD A;  3PAS A;  2G0E A;  5CW8 A;  2R7U A;  2YVE A;  4D5C A;  4IRV A;  4GCT A;  5HBU A;  4NN1 A;  5FGL A;  5IOZ A;  2FQ4 A;  3P9T A;  1QVU A;  3EUP A;  3DU5 A;  2G3B A;  2YVH A;  3AQS A;  3GEU A;  4B3A A;  3BR1 A;  3IH3 A;  2O7T A;  1T33 A;  3FRQ A;  1RKT A;  4L62 A;  5FHP A;  3CWR A;  3ZQH A;  2Y2Z A;  4M3G A;  5F0F A;  3NRG A;  4D7M A;  2OF7 A;  1Z77 A;  2XPU A;  3KYL A;  2IEK A;  4XK4 A;  2FBQ A;  5EFY A;  2ID3 A;  3G7R A;  4V2F A;  2ID6 A;  2G7L A;  3TP0 A;  3B81 A;  3BT9 A;  3LHQ A;  5F0C A;  2QIB A;  4M3F A;  3WHC A;  2RHA A;  3VVZ A;  5GPC A;  3HGG A;  3BJB A;  5EYR A;  1Z0X A;  3BQY A;  4OD4 A;  3JSJ A;  2R7T A;  2NP5 A;  5H9T A;  2Y30 A;  4PXI A;  1JUM A;  3BR3 A;  3VW0 A;  3C2B A;  2R7W A;  4MXM A;  4ACI A;  5F0H A;  2ZY9 A;  5K58 A;  1BJZ A;  3ZQL A;  1RKW A;  1JT0 A;  3FK7 A;  5EZG A;  1UI6 A;  2XGC A;  3KKD A;  3ZQI A;  4NEL A;  2R7O A;  3DPJ A;  2QCO A;  2RAE A;  3VVY A;  2XPV A;  3FK6 A;  2G7G A;  3COL A;  1QVT A;  3ANP A;  2D6Y A;  3VTI A;  2DG8 A;  3C07 A;  3QKX A;  3QQA A;  3QPL A;  4DVY P;  3EGQ A;  3IH2 A;  3BR2 A;  2ZOY A;  2NX4 A;  3BTL A;  2NP3 A; 
#chains in the Genus database with same CATH homology
 3TP3 A;  1U9N A;  1ZK8 A;  5D18 A;  5IP6 A;  2UXU A;  2WV1 A;  4ABZ A;  3PPB A;  3V78 A;  4GCK A;  3CJD A;  2G7S A;  3LOC A;  3O60 A;  5D19 A;  2XGE A;  3HTI A;  3HTJ A;  3BRU A;  2IAI A;  2GUH A;  2PZ9 A;  3VPR A;  3VP5 A;  3LSJ A;  2QKO A;  3KKC A;  1JT6 A;  1JTY A;  4AC6 A;  4I6Z A;  3G1L A;  4V2G A;  3ANG A;  5F08 A;  3VW2 A;  3LSP A;  4JNN A;  2HKU A;  4G12 A;  5FKO A;  3BCG A;  4M3E A;  3ZQF A;  3VVX A;  4KWA A;  3LWJ A;  5CXG A;  4JKZ A;  4D5F A;  3SDG A;  2GEN A;  4M3B A;  3ON2 A;  2O7O A;  1T56 A;  2VKE A;  3B6A A;  5F1J A;  2Y31 A;  2UXP A;  2NS7 A;  4MO7 A;  2UXH A;  3T6N A;  2JK3 A;  4HKU A;  2GBY A;  2HYT A;  5AQC A;  2HYJ A;  2VPR A;  3Q0U A;  2VKV A;  1ZKG A;  3BTC A;  4JL3 A;  5GP9 A;  5HSZ A;  4W1U A;  1U9O A;  3KZ9 A;  1A6I A;  2OI8 A;  3GZI A;  2FD5 A;  3DEW A;  1JTX A;  5J3L A;  1VI0 A;  4ME9 A;  4X1E A;  3VIB A;  3Q0W A;  2JJ7 A;  2GFN A;  5FKN A;  5K7Z A;  3RD3 A;  4AF5 A;  5F04 A;  3VW1 A;  2XB5 A;  5CXI A;  3MNL A;  2I10 A;  2REK A;  3WHB A;  1SGM A;  3O8G A;  4AC0 A;  4CGR A;  3BR0 A;  5FKK A;  3BR5 A;  4GFK A;  5K7F A;  3SFI A;  3G1M A;  2WGB A;  2WUI A;  2FJ1 A;  2Q24 A;  4DW6 A;  4ICH A;  3RH2 A;  2X6O A;  5K7H A;  3F0C A;  5FKL A;  2PBX A;  4UDS A;  5EZH A;  2EH3 A;  3FIW A;  3NNR A;  3NPI A;  3CDL A;  2X9D A;  2ZB9 A;  5J1U A;  4MK6 A;  1UI5 A;  5HAW A;  3IUV A;  1ORK A;  3VUQ A;  3BNI A;  3V6G A;  2QWT A;  2XPW A;  3BR6 A;  3CRJ A;  2HXO A;  5IPA A;  2QTQ A;  3LSR A;  3BTI A;  4W97 A;  2F07 A;  3BTJ A;  5IOY A;  3S5R A;  1RPW A;  2XRL A;  4JYK A;  5FMP A;  3G1O A;  1JUP A;  3QBM A;  5J1R A;  2XDN A;  3KNW A;  3G56 A;  3LJL A;  2FX0 A;  2V57 A;  2QOP A;  4GCL A;  5DAJ A;  2DG7 A;  3CCY A;  2OPT A;  3DCF A;  3QPS A;  2XGD A;  3E7Q A;  3MVP A;  2DTZ A;  2OER A;  3VOX A;  4M3D A;  2TCT A;  3ON4 A;  3HTH A;  3VOK A;  3B6C A;  5FKM A;  4D7N A;  2W53 A;  3ZQG A;  2UXO A;  2HXI A;  4I76 A;  2ZCX A;  5F27 A;  2ZOZ A;  3NXC A;  5J1Y A;  2RAS A;  1QPI A;  2ZCN A;  3HGY A;  3Q3S A;  4AUX A;  5GPA A;  3BQZ A;  2UXI A;  3O8H A;  4B1R A;  3BHQ A;  2NS8 A;  2ZCM A;  3PM1 A;  2IU5 A;  2TRT A;  3HTA A;  3IH4 A;  1JUS A;  5D1R A;  3F1B A;  5C4Y A;  4YZE A;  2HQ5 A;  3HIM A;  3AQT A;  3NI7 A;  3Q0V A;  4GFL A;  3HE0 A;  2IBD A;  3PAS A;  2G0E A;  5CW8 A;  2YVE A;  4D5C A;  4GCT A;  5HBU A;  4NN1 A;  5FGL A;  5IOZ A;  2FQ4 A;  3P9T A;  1QVU A;  3EUP A;  2G3B A;  2YVH A;  3AQS A;  3GEU A;  4B3A A;  3BR1 A;  3IH3 A;  2O7T A;  1T33 A;  3FRQ A;  1RKT A;  4L62 A;  5FHP A;  3CWR A;  3ZQH A;  2Y2Z A;  4M3G A;  5F0F A;  3NRG A;  4D7M A;  2OF7 A;  1Z77 A;  2XPU A;  2IEK A;  4XK4 A;  2FBQ A;  5EFY A;  2ID3 A;  3G7R A;  4V2F A;  2ID6 A;  2G7L A;  3TP0 A;  3B81 A;  3BT9 A;  3LHQ A;  5F0C A;  2QIB A;  4M3F A;  3WHC A;  2RHA A;  3VVZ A;  5GPC A;  3HGG A;  3BJB A;  5EYR A;  1Z0X A;  3BQY A;  3JSJ A;  2NP5 A;  5H9T A;  2Y30 A;  4PXI A;  1JUM A;  3BR3 A;  3VW0 A;  3C2B A;  4MXM A;  4ACI A;  5F0H A;  5K58 A;  1BJZ A;  3ZQL A;  1RKW A;  1JT0 A;  3FK7 A;  5EZG A;  1UI6 A;  2XGC A;  3KKD A;  3ZQI A;  4NEL A;  3DPJ A;  2QCO A;  2RAE A;  3VVY A;  2XPV A;  3FK6 A;  2G7G A;  3COL A;  1QVT A;  3ANP A;  2D6Y A;  2DG8 A;  3C07 A;  3QKX A;  3QQA A;  3QPL A;  3EGQ A;  3IH2 A;  3BR2 A;  2ZOY A;  2NX4 A;  3BTL A;  2NP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...