5FNXA

Crystal structure at ph 9.0 of a potato sti-kunitz bi-functional inhibitor of serine and aspartic proteases in space group p4322 and ph 9.0
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
185
structure length
185
Chain Sequence
b'PLPKPVLDTNGKELNPDSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADNSYFKIVKSSKIGYNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALVNKNPLDVLFQEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POTATO STI-KUNITZ BI-FUNCTIONAL INHIBITOR E3AD_N19D
publication title Structures of a bi-functional Kunitz-type STI family inhibitor of serine and aspartic proteases: Could the aspartic protease inhibition have evolved from a canonical serine protease-binding loop?
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 27
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5fnxA00
2KI6B 4QBVA 1AF9A 4IY8A 2VUAA 2VXTI 1DJSB 2VU9A 3AH4A 4HJJA 1IT0A 2HZ9A 3FUQA 4J2YA 1Z2VA 2LIQA 2D7RA 4GOYA 3IM5A 3BAOA 4I0YA 4I96A 3WMVA 4EEEB 3BAHA 1UPSA 4LO0C 4ZFYB 4D0TA 4I4UA 4XFSA 2FFVA 2D22A 1BLDA 2K4AB 1W3FA 3S8JA 3IIRA 3PUBA 4LO7B 4X3AA 3AZWA 3ILAA 4II0A 1QXMA 4QKRA 4I4XA 5F8SA 3AKGA 1T4QA 1DIWA 4J2XA 4QD2B 1HWOB 2GZBA 4ZFWB 2ERMA 3RTIB 1OQLB 2D43A 5B2HA 4LO3A 4I4SA 4IZXA 4OW4A 1E0OA 1YBIA 5JMCA 1YTOA 1SR4C 3ZC8A 3PMEA 4EFPA 3N7MA 2E4MA 2NYYA 1T9FA 3S8KA 3UJ0A 2AXMA 2ET2A 2KH2A 2WBCA 3N7JA 3AKIA 4QD2C 3VUOA 1PC8B 4IONA 4QBCA 1EPWA 3HOMA 1FN0A 3IAGC 5FZUA 3PG0A 4HA2A 1RMLA 1K5UA 1AFCA 3O4DA 3CA3A 3FJAA 4TLPA 5BP5C 2Y9FA 4HR6C 4OWKA 4KC3A 4IQPA 2DS0A 3CQAA 1HWPB 2NM1A 4OUJA 1DZDA 1ITBA 1S0GA 1GGPB 5JLVA 3LLPA 4LO1A 3A21A 2Y9GA 3A23A 3AJ6A 4ZGRB 3R4SA 3ZXDA 1NUNA 4Q9PA 3W9TA 3RMYA 2RQ9A 3BA7A 3VT0A 2QYIB 3ZX7A 1BA7A 1AVAC 1S0EA 2ZR1B 3E8LC 4I7IA 1WBCA 1L2HA 3UD8A 1ONKB 1ABRB 3BA4A 4EB2B 3FFZA 2VSEA 3FJKA 1CE7B 4OWLA 1FGAA 3CA4A 1PUUB 1RZOB 3NBEA 2K8RA 1G9AA 4KEKA 1F31A 2IWTB 3OJMA 3JUTA 1N4KA 3VSFA 4I4PA 1TFMB 3OGFA 1DQOA 2BEBA 1PZZA 1AVWB 3Q7YA 4G9MA 1HWNB 1R8OA 2RSTA 2WRYA 2F2FA 4EFQA 4JRAA 2RG9B 3FJEA 1S0CA 5F8WA 2FDBM 1TOOA 3FJHA 4D8HA 2I1BA 5BVPI 3TC2A 1G82A 1SZ6B 2AQZA 4J23B 3HALA 1IHKA 2KKIA 3AJ5A 3MPPG 3AZVA 4Q91A 4G6JA 3O3QA 3QYDA 1TP0A 4I3NA 3FJBA 3CRGA 3I2AA 3N0KA 5EHAA 3K1XA 2VXRA 1DQGA 1IILA 3PHZA 1DZCA 4ISRA 4P6AA 4A7KA 5DZUA 4USOA 4I2SA 4QKSA 1S0FA 1G9BA 3N7LA 1XHBA 4ZBVB 3F62B 4LO0A 3WO3A 2DREA 4XFTA 3CAHA 2UUSA 1WBAA 1YF8B 3CU1B 3BAQA 3BA5A 5BXRA 1BFGA 3HN1A 3FJFA 1XZZA 1FWUA 3BRFA 2DRYA 5F8YA 5FNWA 4QALA 3V0BA 3OBTA 3CA1A 3NBCA 2NVHA 4LO7C 4P0JA 2X2SA 3EF2A 4IY9A 3RTJB 1HIBA 3LTQA 4A7ZA 1BFCA 3AH2A 4LO2A 4Q9GA 3HMYA 4G9NA 4LO3C 3FGMA 1EVTA 1IOBA 1HCDA 1FV2A 1SR4A 1JTCA 3A22A 4ENDA 3BAGA 4AN6A 3P53A 1DLLA 1JY0A 2BFHA 1NZKA 3ZXGA 2AAIB 1AVXB 4KBBA 2L5XA 4IZEA 1WD4A 4PC4A 3VT2A 3NBDA 1V6WA 5BXTA 3R4UA 3VT1A 1FV3A 2ZQOA 1S0BA 1VCLA 3P6JA 2D1ZA 3WINC 1MD6A 1P63A 2HWAA 4GP0A 4Z9WB 3I29B 3I2XA 6I1BA 4H9WA 3V0AB 1ISZA 2D23A 3NBNA 4A7YA 4JKQA 1PUMB 1TIEA 3N7KA 4LO1C 1KNMA 1M2TB 4ZA3B 4XFUA 3BRDA 2NP0A 3BRGC 2FGFA 3O49A 3V0AA 4J2SA 3C9ZA 5G00A 4I1BA 3H6RB 1ISYA 3VWCA 5D61A 1HCEA 4Z8SB 3F1RA 4I4YA 5FZYA 3AKHA 3BTAA 1YXWA 3H6RA 2MLLB 3VSZA 3OJ2A 4ISQA 2HW9A 4I4QA 5GAQA 1JT5A 3OBRA 1JT3A 3FJCA 4KEJA 2Z49A 3FUOA 3OGGA 1DFQA 4I6IA 3ZC9A 4JKXB 2MIBA 1S0LA 3FJDA 1RY7A 2QN4A 4DENA 2Y9XE 5E24E 3CA5A 1D0HA 5HPZA 3HSMA 3CA0A 2YUGA 2NZ9A 5FNXA 2DRZA 4D0ZA 2F2FC 1BASA 5DVHA 1CVSA 2Y9WC 4FVVA 5BXSA 1JQZA 2D44A 4LO8B 5BQUA 3NJ5A 3UD9A 2D20A 3IM6A 4AN7B 2Q3NB 3BADA 4L4HA 4ZKTB 3B9UA 1AXMA 3UJ4A 1ILR1 4OEFA 3SNVA 1G9DA 4X37A 3H6SE 4DEPA 3T8SA 4G1RA 2P23A 3O4OA 2VLCA 1J0SA 1S0DA 4I37A 3UDAA 4KEIA 3V0BB 2AFGA 2ESUA 4OWJA 3VEQA 2BEAA 1R8NA 3BX1C 2K43A 1RG8A 2KI4A 4P0LA 1ISXA 5DUYA 1QQKA 3HBWA 3KMVA 4JQ0A 4I4OA 1JT7A 3BB2A 3POKA 3RMXA 3CRIA 1JLXA 3FJ9A 1EYLA 1K5VA 3RSJA 2XOAA 3O4BA 2MC2A 2VSAA 1IRAX 5DSSB 1V6VA 1PWAA 9ILBA 1Z4SA 5BOWA 2Q9XA 3H6QA 4X38A 1YYNA 1HWMB 4H04A 3BAUA 4LO2C 2E4MC 4JPZA 4EFRA 1II4A 3AKFA 1IJTA 2M49A 4J2KA 1W3GA 3IM7A 5D63A 4EKXB 1ISWA 3BAVA 3WO4A 1JLYA 4F83A 3O5WB 1I1BA 1QQLA 5EC5A 3CA6A 2GO2A 3JRRA 4P0KA 5BP5A 3AH1A 1ISVA 1FMZA 4I8MA 4USPA 31BIA 1BFBA 5D62A 1DFCA 4ZFUB 1XG6A 1G9CA 3D7WB 1BFFA 4JP0A 4X39A 1FWVA 1Q04A 3WINA 1TWEA 3FJIA 4XKIA 2NTDA 1JT4A 3QR5A 1MC9A 5FZZA 4R6UB 1I1EA 1HKNA 2KLLA 1Z0HA 4YOLA 4GAFA 3FJJA 3OJVA 4F34A 3CRHA 4L4IA 2D24A 1W3AA 2F8XC 4JAWA 4G6MA 1FMMS 3V79C 1M16A 1BLAA 2FFUA 1XYFA 3WA1A 4IYBA 3UD7A 1V6UA 2FO1A 41BIA 3O4AA 4QC4A 4CJMA 1A8DA 2LIEA 3Q7XA 3O4CA 1WD3A 5I1BA 2J3PA 4ZOTA 4ZLBB 1V6XA 3WMUA 2ZQNA 4GAIA 4OEEA 2P39A 3Q7WA 1EV2A 7I1BA 2HWMA 2D7IA 3A07A 1Q1UA 4OEGA 1Q03A 2IHOA 1FQ9A 1IRPA 1AVUA 5BXPA 3O44A 2X2TA 4QO3A 4GP3A 4I4VA 1TWMA 4I1EA 1TTUA 4WBCA 3P6IA 3WO2A 4GOVA 2Z48A 3MALA 5F90A 5EG6C 1BARA 4IHZA 21BIA 4I4RA 5BQUC 8I1BA 2R9KB 4FGFA 3FJ8A 4DCKC
chains in the Genus database with same CATH superfamily
2KI6B 4QBVA 1AF9A 4IY8A 2VUAA 2VXTI 1DJSB 2VU9A 3AH4A 4HJJA 1IT0A 2HZ9A 3FUQA 4J2YA 1Z2VA 2LIQA 2D7RA 4GOYA 3IM5A 3BAOA 4I0YA 4I96A 3WMVA 4EEEB 3BAHA 1UPSA 4LO0C 4ZFYB 4D0TA 4I4UA 4XFSA 2FFVA 2D22A 1BLDA 2K4AB 1W3FA 3S8JA 3IIRA 3PUBA 4LO7B 4X3AA 3AZWA 3ILAA 4II0A 1QXMA 4QKRA 4I4XA 5F8SA 3AKGA 1T4QA 1DIWA 4J2XA 4QD2B 1HWOB 2GZBA 4ZFWB 2ERMA 3RTIB 1OQLB 2D43A 5B2HA 2NS2A 4LO3A 4I4SA 4IZXA 4OW4A 1E0OA 1YBIA 5JMCA 1YTOA 1SR4C 3ZC8A 3PMEA 4EFPA 3N7MA 2E4MA 2NYYA 1T9FA 3S8KA 3UJ0A 2AXMA 2ET2A 2KH2A 2WBCA 3N7JA 3AKIA 4QD2C 3VUOA 1PC8B 4IONA 4QBCA 1EPWA 3HOMA 1FN0A 3IAGC 5FZUA 3PG0A 4HA2A 1RMLA 1K5UA 1AFCA 3O4DA 3CA3A 3FJAA 4TLPA 5BP5C 2Y9FA 4HR6C 4OWKA 4H75A 4KC3A 4IQPA 2DS0A 3CQAA 1HWPB 2NM1A 4OUJA 1DZDA 1ITBA 1S0GA 1GGPB 5JLVA 3LLPA 4LO1A 3A21A 2Y9GA 3A23A 3AJ6A 4ZGRB 3R4SA 3ZXDA 1NUNA 4Q9PA 3W9TA 3RMYA 2RQ9A 3BA7A 3VT0A 2QYIB 3ZX7A 1BA7A 1AVAC 1S0EA 2ZR1B 3E8LC 4I7IA 1WBCA 1L2HA 3UD8A 1ONKB 1ABRB 3BA4A 4EB2B 3FFZA 2VSEA 3FJKA 1CE7B 4OWLA 1FGAA 3CA4A 1PUUB 1RZOB 3NBEA 2K8RA 1G9AA 4KEKA 1F31A 2IWTB 3OJMA 3JUTA 1N4KA 3VSFA 4I4PA 1TFMB 3OGFA 1DQOA 2BEBA 1PZZA 1AVWB 3Q7YA 4G9MA 1HWNB 1R8OA 2RSTA 2WRYA 2F2FA 4EFQA 4JRAA 2RG9B 3FJEA 1S0CA 5F8WA 2FDBM 1TOOA 3FJHA 4D8HA 2I1BA 5BVPI 3TC2A 1G82A 1SZ6B 2AQZA 4J23B 3HALA 1IHKA 2KKIA 3AJ5A 3MPPG 3AZVA 4Q91A 4G6JA 3O3QA 3QYDA 1TP0A 4I3NA 3FJBA 3CRGA 3I2AA 3N0KA 5EHAA 3K1XA 2VXRA 1DQGA 1IILA 3PHZA 1DZCA 4ISRA 4P6AA 4A7KA 5DZUA 4USOA 4I2SA 4QKSA 1S0FA 1G9BA 3N7LA 1XHBA 4ZBVB 3F62B 4LO0A 3WO3A 2DREA 4XFTA 3CAHA 2UUSA 1WBAA 1YF8B 3CU1B 3BAQA 3BA5A 5BXRA 1BFGA 3HN1A 3FJFA 1XZZA 1FWUA 3BRFA 2DRYA 5F8YA 5FNWA 4QALA 3V0BA 3OBTA 3CA1A 3NBCA 2NVHA 4LO7C 4P0JA 2X2SA 3EF2A 4IY9A 3RTJB 1HIBA 3LTQA 4A7ZA 1BFCA 3AH2A 4LO2A 4Q9GA 3HMYA 4G9NA 4LO3C 3FGMA 1EVTA 1IOBA 1HCDA 1FV2A 1SR4A 1JTCA 3A22A 4ENDA 3BAGA 4AN6A 3P53A 1DLLA 1JY0A 2BFHA 1NZKA 3ZXGA 2AAIB 1AVXB 4KBBA 2L5XA 4IZEA 1WD4A 4PC4A 3VT2A 3NBDA 4MZFB 1V6WA 5BXTA 3R4UA 3VT1A 1FV3A 2ZQOA 1S0BA 1VCLA 3P6JA 2D1ZA 3WINC 1MD6A 1P63A 2HWAA 4GP0A 4Z9WB 3I29B 3I2XA 6I1BA 4H9WA 3V0AB 1ISZA 2D23A 3NBNA 4A7YA 4JKQA 1PUMB 1TIEA 3N7KA 4LO1C 1KNMA 1M2TB 4ZA3B 4XFUA 3BRDA 2NP0A 3BRGC 2FGFA 3O49A 3V0AA 4J2SA 3C9ZA 5G00A 4I1BA 3H6RB 1ISYA 3VWCA 5D61A 1HCEA 4Z8SB 3F1RA 4I4YA 5FZYA 3AKHA 3BTAA 4MZHA 1YXWA 3H6RA 2MLLB 3VSZA 3OJ2A 4ISQA 2HW9A 4I4QA 5GAQA 1JT5A 3OBRA 1JT3A 3FJCA 4KEJA 2Z49A 3FUOA 3OGGA 1DFQA 4I6IA 3ZC9A 4JKXB 2MIBA 1S0LA 4MZGB 3FJDA 1RY7A 2QN4A 4DENA 2Y9XE 5E24E 3CA5A 1D0HA 5HPZA 3HSMA 3CA0A 2YUGA 2NZ9A 5FNXA 2DRZA 4D0ZA 2F2FC 1BASA 5DVHA 1CVSA 2Y9WC 4FVVA 5BXSA 1JQZA 2D44A 4LO8B 5BQUA 3NJ5A 3UD9A 2D20A 3IM6A 4AN7B 2Q3NB 3BADA 4L4HA 4ZKTB 3B9UA 1AXMA 3UJ4A 1ILR1 4OEFA 3SNVA 1G9DA 4X37A 3H6SE 4DEPA 3T8SA 4G1RA 2P23A 3O4OA 2VLCA 1J0SA 1S0DA 4I37A 3UDAA 4KEIA 3V0BB 2AFGA 2ESUA 4OWJA 3VEQA 2BEAA 1R8NA 3BX1C 2K43A 1RG8A 2KI4A 4P0LA 1ISXA 5DUYA 1QQKA 3HBWA 3KMVA 4JQ0A 4I4OA 1JT7A 3BB2A 3POKA 3RMXA 3CRIA 1JLXA 3FJ9A 1EYLA 1K5VA 3RSJA 2XOAA 3O4BA 2MC2A 2VSAA 1IRAX 5DSSB 1V6VA 1PWAA 9ILBA 1Z4SA 5BOWA 2Q9XA 3H6QA 4X38A 1YYNA 1HWMB 4H04A 4UY4A 3BAUA 4LO2C 2E4MC 4JPZA 4EFRA 1II4A 3AKFA 1IJTA 2M49A 4J2KA 1W3GA 3IM7A 5D63A 4EKXB 1ISWA 3BAVA 3WO4A 1JLYA 4F83A 3O5WB 1I1BA 1QQLA 5EC5A 3CA6A 2GO2A 3JRRA 4P0KA 5BP5A 3AH1A 1ISVA 1FMZA 4I8MA 4USPA 31BIA 1BFBA 5D62A 1DFCA 4ZFUB 1XG6A 1G9CA 3D7WB 1BFFA 4JP0A 4X39A 1FWVA 1Q04A 3WINA 1TWEA 3FJIA 4XKIA 2NTDA 1JT4A 3QR5A 1MC9A 5FZZA 4R6UB 1I1EA 1HKNA 2KLLA 1Z0HA 4YOLA 4GAFA 3FJJA 3OJVA 4F34A 3CRHA 4L4IA 2D24A 1W3AA 2F8XC 4JAWA 4G6MA 1FMMS 3V79C 1M16A 1BLAA 2FFUA 1XYFA 3WA1A 4IYBA 3UD7A 1V6UA 2FO1A 41BIA 3O4AA 4QC4A 4CJMA 1A8DA 2LIEA 3Q7XA 3O4CA 1WD3A 5I1BA 2J3PA 4ZOTA 4ZLBB 1V6XA 3WMUA 2ZQNA 4GAIA 4OEEA 2P39A 3Q7WA 1EV2A 7I1BA 2HWMA 2D7IA 3A07A 1Q1UA 4OEGA 1Q03A 2IHOA 1FQ9A 1IRPA 1AVUA 5BXPA 3O44A 2X2TA 4QO3A 4GP3A 4I4VA 1TWMA 4I1EA 1TTUA 4WBCA 3P6IA 3WO2A 4GOVA 2Z48A 3MALA 5F90A 5EG6C 1BARA 4IHZA 21BIA 4I4RA 5BQUC 8I1BA 2R9KB 4FGFA 3FJ8A 4DCKC
chains in the Genus database with same CATH topology
2KI6B 4QBVA 1AF9A 4IY8A 2VUAA 2VXTI 1DJSB 2VU9A 3AH4A 4HJJA 1IT0A 2HZ9A 3FUQA 4J2YA 1Z2VA 2LIQA 2D7RA 4GOYA 3IM5A 3BAOA 4I0YA 4I96A 3WMVA 4EEEB 3BAHA 1UPSA 4LO0C 4ZFYB 4D0TA 4I4UA 4XFSA 2FFVA 2D22A 1BLDA 2K4AB 1W3FA 3S8JA 3IIRA 3PUBA 4LO7B 4X3AA 3AZWA 3ILAA 4II0A 1QXMA 4QKRA 4I4XA 5F8SA 3AKGA 1T4QA 1DIWA 4J2XA 4QD2B 1HWOB 2GZBA 4ZFWB 2ERMA 3RTIB 1OQLB 2D43A 5B2HA 2NS2A 4LO3A 4I4SA 4IZXA 4OW4A 1E0OA 1YBIA 5JMCA 1YTOA 1SR4C 3ZC8A 3PMEA 4EFPA 3N7MA 2E4MA 2NYYA 1T9FA 3S8KA 3UJ0A 2AXMA 2ET2A 2KH2A 2WBCA 3N7JA 3AKIA 4QD2C 3VUOA 1PC8B 4IONA 4QBCA 1EPWA 3HOMA 1FN0A 3IAGC 5FZUA 3PG0A 4HA2A 1RMLA 1K5UA 1AFCA 3O4DA 3CA3A 3FJAA 4TLPA 5BP5C 2Y9FA 4HR6C 4OWKA 4H75A 4KC3A 4IQPA 2DS0A 3CQAA 1HWPB 2NM1A 4OUJA 1DZDA 1ITBA 1S0GA 1GGPB 5JLVA 3LLPA 4LO1A 3A21A 2Y9GA 3A23A 3AJ6A 4ZGRB 3R4SA 3ZXDA 1NUNA 4Q9PA 3W9TA 3RMYA 2RQ9A 3BA7A 3VT0A 2QYIB 3ZX7A 1BA7A 1AVAC 1S0EA 2ZR1B 3E8LC 4I7IA 1WBCA 1L2HA 3UD8A 1ONKB 1ABRB 3BA4A 4EB2B 3FFZA 2VSEA 3FJKA 1CE7B 4OWLA 1FGAA 3CA4A 1PUUB 1RZOB 3NBEA 2K8RA 1G9AA 4KEKA 1F31A 2IWTB 3OJMA 3JUTA 1N4KA 3VSFA 4I4PA 1TFMB 3OGFA 1DQOA 2BEBA 1PZZA 1AVWB 3Q7YA 4G9MA 1HWNB 1R8OA 2RSTA 2WRYA 2F2FA 4EFQA 4JRAA 2RG9B 3FJEA 1S0CA 5F8WA 2FDBM 1TOOA 3FJHA 4D8HA 2I1BA 5BVPI 3TC2A 1G82A 1SZ6B 2AQZA 4J23B 3HALA 1IHKA 2KKIA 3AJ5A 3MPPG 3AZVA 4Q91A 4G6JA 3O3QA 3QYDA 1TP0A 4I3NA 3FJBA 3CRGA 3I2AA 3N0KA 5EHAA 3K1XA 2VXRA 1DQGA 1IILA 3PHZA 1DZCA 4ISRA 4P6AA 4A7KA 5DZUA 4USOA 4I2SA 4QKSA 1S0FA 1G9BA 3N7LA 1XHBA 4ZBVB 3F62B 4LO0A 3WO3A 2DREA 4XFTA 3CAHA 2UUSA 1WBAA 1YF8B 3CU1B 3BAQA 3BA5A 5BXRA 1BFGA 3HN1A 3FJFA 1XZZA 1FWUA 3BRFA 2DRYA 5F8YA 5FNWA 4QALA 3V0BA 3OBTA 3CA1A 3NBCA 2NVHA 4LO7C 4P0JA 2X2SA 3EF2A 4IY9A 3RTJB 1HIBA 3LTQA 4A7ZA 1BFCA 3AH2A 4LO2A 4Q9GA 3HMYA 4G9NA 4LO3C 3FGMA 1EVTA 1IOBA 1HCDA 1FV2A 1SR4A 1JTCA 3A22A 4ENDA 3BAGA 4AN6A 3P53A 1DLLA 1JY0A 2BFHA 1NZKA 3ZXGA 2AAIB 1AVXB 4KBBA 2L5XA 4IZEA 1WD4A 4PC4A 3VT2A 3NBDA 4MZFB 1V6WA 5BXTA 3R4UA 3VT1A 1FV3A 2ZQOA 1S0BA 1VCLA 3P6JA 2D1ZA 3WINC 1MD6A 1P63A 2HWAA 4GP0A 4Z9WB 3I29B 3I2XA 6I1BA 4H9WA 3V0AB 1ISZA 2D23A 3NBNA 4A7YA 4JKQA 1PUMB 1TIEA 3N7KA 4LO1C 1KNMA 1M2TB 4ZA3B 4XFUA 3BRDA 2NP0A 3BRGC 2FGFA 3O49A 3V0AA 4J2SA 3C9ZA 5G00A 4I1BA 3H6RB 1ISYA 3VWCA 5D61A 1HCEA 4Z8SB 3F1RA 4I4YA 5FZYA 3AKHA 3BTAA 4MZHA 1YXWA 3H6RA 2MLLB 3VSZA 3OJ2A 4ISQA 2HW9A 4I4QA 5GAQA 1JT5A 3OBRA 1JT3A 3FJCA 4KEJA 2Z49A 3FUOA 3OGGA 1DFQA 4I6IA 3ZC9A 4JKXB 2MIBA 1S0LA 4MZGB 3FJDA 1RY7A 2QN4A 4DENA 2Y9XE 5E24E 3CA5A 1D0HA 5HPZA 3HSMA 3CA0A 2YUGA 2NZ9A 5FNXA 2DRZA 4D0ZA 2F2FC 1BASA 5DVHA 1CVSA 2Y9WC 4FVVA 5BXSA 1JQZA 2D44A 4LO8B 5BQUA 3NJ5A 3UD9A 2D20A 3IM6A 4AN7B 2Q3NB 3BADA 4L4HA 4ZKTB 3B9UA 1AXMA 3UJ4A 1ILR1 4OEFA 3SNVA 1G9DA 4X37A 3H6SE 4DEPA 3T8SA 4G1RA 2P23A 3O4OA 2VLCA 1J0SA 1S0DA 4I37A 3UDAA 4KEIA 3V0BB 2AFGA 2ESUA 4OWJA 3VEQA 2BEAA 1R8NA 3BX1C 2K43A 1RG8A 2KI4A 4P0LA 1ISXA 5DUYA 1QQKA 3HBWA 3KMVA 4JQ0A 4I4OA 1JT7A 3BB2A 3POKA 3RMXA 3CRIA 1JLXA 3FJ9A 1EYLA 1K5VA 3RSJA 2XOAA 3O4BA 2MC2A 2VSAA 1IRAX 5DSSB 1V6VA 1PWAA 9ILBA 1Z4SA 5BOWA 2Q9XA 3H6QA 4X38A 1YYNA 1HWMB 4H04A 4UY4A 3BAUA 4LO2C 2E4MC 4JPZA 4EFRA 1II4A 3AKFA 1IJTA 2M49A 4J2KA 1W3GA 3IM7A 5D63A 4EKXB 1ISWA 3BAVA 3WO4A 1JLYA 4F83A 3O5WB 1I1BA 1QQLA 5EC5A 3CA6A 2GO2A 3JRRA 4P0KA 5BP5A 3AH1A 1ISVA 1FMZA 4I8MA 4USPA 31BIA 1BFBA 5D62A 1DFCA 4ZFUB 1XG6A 1G9CA 3D7WB 1BFFA 4JP0A 4X39A 1FWVA 1Q04A 3WINA 1TWEA 3FJIA 4XKIA 2NTDA 1JT4A 3QR5A 1MC9A 5FZZA 4R6UB 1I1EA 1HKNA 2KLLA 1Z0HA 4YOLA 4GAFA 3FJJA 3OJVA 4F34A 3CRHA 4L4IA 2D24A 1W3AA 2F8XC 4JAWA 4G6MA 1FMMS 3V79C 1M16A 1BLAA 2FFUA 1XYFA 3WA1A 4IYBA 3UD7A 1V6UA 2FO1A 41BIA 3O4AA 4QC4A 4CJMA 1A8DA 2LIEA 3Q7XA 3O4CA 1WD3A 5I1BA 2J3PA 4ZOTA 4ZLBB 1V6XA 3WMUA 2ZQNA 4GAIA 4OEEA 2P39A 3Q7WA 1EV2A 7I1BA 2HWMA 2D7IA 3A07A 1Q1UA 4OEGA 1Q03A 2IHOA 1FQ9A 1IRPA 1AVUA 5BXPA 3O44A 2X2TA 4QO3A 4GP3A 4I4VA 1TWMA 4I1EA 1TTUA 4WBCA 3P6IA 3WO2A 4GOVA 2Z48A 3MALA 5F90A 5EG6C 1BARA 4IHZA 21BIA 4I4RA 5BQUC 8I1BA 2R9KB 4FGFA 3FJ8A 4DCKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 B;  4QBV A;  1AF9 A;  4IY8 A;  2VUA A;  2VXT I;  1DJS B;  2VU9 A;  3AH4 A;  4HJJ A;  1IT0 A;  2HZ9 A;  3FUQ A;  4J2Y A;  1Z2V A;  2LIQ A;  2D7R A;  4GOY A;  3IM5 A;  3BAO A;  4I0Y A;  4I96 A;  3WMV A;  4EEE B;  3BAH A;  1UPS A;  4LO0 C;  4ZFY B;  4D0T A;  4I4U A;  4XFS A;  2FFV A;  2D22 A;  1BLD A;  2K4A B;  1W3F A;  3S8J A;  3IIR A;  3PUB A;  4LO7 B;  4X3A A;  3AZW A;  3ILA A;  4II0 A;  1QXM A;  4QKR A;  4I4X A;  5F8S A;  3AKG A;  1T4Q A;  1DIW A;  4J2X A;  4QD2 B;  1HWO B;  2GZB A;  4ZFW B;  2ERM A;  3RTI B;  1OQL B;  2D43 A;  5B2H A;  4LO3 A;  4I4S A;  4IZX A;  4OW4 A;  1E0O A;  1YBI A;  5JMC A;  1YTO A;  1SR4 C;  3ZC8 A;  3PME A;  4EFP A;  3N7M A;  2E4M A;  2NYY A;  1T9F A;  3S8K A;  3UJ0 A;  2AXM A;  2ET2 A;  2KH2 A;  2WBC A;  3N7J A;  3AKI A;  4QD2 C;  3VUO A;  1PC8 B;  4ION A;  4QBC A;  1EPW A;  3HOM A;  1FN0 A;  3IAG C;  5FZU A;  3PG0 A;  4HA2 A;  1RML A;  1K5U A;  1AFC A;  3O4D A;  3CA3 A;  3FJA A;  4TLP A;  5BP5 C;  2Y9F A;  4HR6 C;  4OWK A;  4KC3 A;  4IQP A;  2DS0 A;  3CQA A;  1HWP B;  2NM1 A;  4OUJ A;  1DZD A;  1ITB A;  1S0G A;  1GGP B;  5JLV A;  3LLP A;  4LO1 A;  3A21 A;  2Y9G A;  3A23 A;  3AJ6 A;  4ZGR B;  3R4S A;  3ZXD A;  1NUN A;  4Q9P A;  3W9T A;  3RMY A;  2RQ9 A;  3BA7 A;  3VT0 A;  2QYI B;  3ZX7 A;  1BA7 A;  1AVA C;  1S0E A;  2ZR1 B;  3E8L C;  4I7I A;  1WBC A;  1L2H A;  3UD8 A;  1ONK B;  1ABR B;  3BA4 A;  4EB2 B;  3FFZ A;  2VSE A;  3FJK A;  1CE7 B;  4OWL A;  1FGA A;  3CA4 A;  1PUU B;  1RZO B;  3NBE A;  2K8R A;  1G9A A;  4KEK A;  1F31 A;  2IWT B;  3OJM A;  3JUT A;  1N4K A;  3VSF A;  4I4P A;  1TFM B;  3OGF A;  1DQO A;  2BEB A;  1PZZ A;  1AVW B;  3Q7Y A;  4G9M A;  1HWN B;  1R8O A;  2RST A;  2WRY A;  2F2F A;  4EFQ A;  4JRA A;  2RG9 B;  3FJE A;  1S0C A;  5F8W A;  2FDB M;  1TOO A;  3FJH A;  4D8H A;  2I1B A;  5BVP I;  3TC2 A;  1G82 A;  1SZ6 B;  2AQZ A;  4J23 B;  3HAL A;  1IHK A;  2KKI A;  3AJ5 A;  3MPP G;  3AZV A;  4Q91 A;  4G6J A;  3O3Q A;  3QYD A;  1TP0 A;  4I3N A;  3FJB A;  3CRG A;  3I2A A;  3N0K A;  5EHA A;  3K1X A;  2VXR A;  1DQG A;  1IIL A;  3PHZ A;  1DZC A;  4ISR A;  4P6A A;  4A7K A;  5DZU A;  4USO A;  4I2S A;  4QKS A;  1S0F A;  1G9B A;  3N7L A;  1XHB A;  4ZBV B;  3F62 B;  4LO0 A;  3WO3 A;  2DRE A;  4XFT A;  3CAH A;  2UUS A;  1WBA A;  1YF8 B;  3CU1 B;  3BAQ A;  3BA5 A;  5BXR A;  1BFG A;  3HN1 A;  3FJF A;  1XZZ A;  1FWU A;  3BRF A;  2DRY A;  5F8Y A;  5FNW A;  4QAL A;  3V0B A;  3OBT A;  3CA1 A;  3NBC A;  2NVH A;  4LO7 C;  4P0J A;  2X2S A;  3EF2 A;  4IY9 A;  3RTJ B;  1HIB A;  3LTQ A;  4A7Z A;  1BFC A;  3AH2 A;  4LO2 A;  4Q9G A;  3HMY A;  4G9N A;  4LO3 C;  3FGM A;  1EVT A;  1IOB A;  1HCD A;  1FV2 A;  1SR4 A;  1JTC A;  3A22 A;  4END A;  3BAG A;  4AN6 A;  3P53 A;  1DLL A;  1JY0 A;  2BFH A;  1NZK A;  3ZXG A;  2AAI B;  1AVX B;  4KBB A;  2L5X A;  4IZE A;  1WD4 A;  4PC4 A;  3VT2 A;  3NBD A;  1V6W A;  5BXT A;  3R4U A;  3VT1 A;  1FV3 A;  2ZQO A;  1S0B A;  1VCL A;  3P6J A;  2D1Z A;  3WIN C;  1MD6 A;  1P63 A;  2HWA A;  4GP0 A;  4Z9W B;  3I29 B;  3I2X A;  6I1B A;  4H9W A;  3V0A B;  1ISZ A;  2D23 A;  3NBN A;  4A7Y A;  4JKQ A;  1PUM B;  1TIE A;  3N7K A;  4LO1 C;  1KNM A;  1M2T B;  4ZA3 B;  4XFU A;  3BRD A;  2NP0 A;  3BRG C;  2FGF A;  3O49 A;  3V0A A;  4J2S A;  3C9Z A;  5G00 A;  4I1B A;  3H6R B;  1ISY A;  3VWC A;  5D61 A;  1HCE A;  4Z8S B;  3F1R A;  4I4Y A;  5FZY A;  3AKH A;  3BTA A;  1YXW A;  3H6R A;  2MLL B;  3VSZ A;  3OJ2 A;  4ISQ A;  2HW9 A;  4I4Q A;  5GAQ A;  1JT5 A;  3OBR A;  1JT3 A;  3FJC A;  4KEJ A;  2Z49 A;  3FUO A;  3OGG A;  1DFQ A;  4I6I A;  3ZC9 A;  4JKX B;  2MIB A;  1S0L A;  3FJD A;  1RY7 A;  2QN4 A;  4DEN A;  2Y9X E;  5E24 E;  3CA5 A;  1D0H A;  5HPZ A;  3HSM A;  3CA0 A;  2YUG A;  2NZ9 A;  5FNX A;  2DRZ A;  4D0Z A;  2F2F C;  1BAS A;  5DVH A;  1CVS A;  2Y9W C;  4FVV A;  5BXS A;  1JQZ A;  2D44 A;  4LO8 B;  5BQU A;  3NJ5 A;  3UD9 A;  2D20 A;  3IM6 A;  4AN7 B;  2Q3N B;  3BAD A;  4L4H A;  4ZKT B;  3B9U A;  1AXM A;  3UJ4 A;  1ILR 1;  4OEF A;  3SNV A;  1G9D A;  4X37 A;  3H6S E;  4DEP A;  3T8S A;  4G1R A;  2P23 A;  3O4O A;  2VLC A;  1J0S A;  1S0D A;  4I37 A;  3UDA A;  4KEI A;  3V0B B;  2AFG A;  2ESU A;  4OWJ A;  3VEQ A;  2BEA A;  1R8N A;  3BX1 C;  2K43 A;  1RG8 A;  2KI4 A;  4P0L A;  1ISX A;  5DUY A;  1QQK A;  3HBW A;  3KMV A;  4JQ0 A;  4I4O A;  1JT7 A;  3BB2 A;  3POK A;  3RMX A;  3CRI A;  1JLX A;  3FJ9 A;  1EYL A;  1K5V A;  3RSJ A;  2XOA A;  3O4B A;  2MC2 A;  2VSA A;  1IRA X;  5DSS B;  1V6V A;  1PWA A;  9ILB A;  1Z4S A;  5BOW A;  2Q9X A;  3H6Q A;  4X38 A;  1YYN A;  1HWM B;  4H04 A;  3BAU A;  4LO2 C;  2E4M C;  4JPZ A;  4EFR A;  1II4 A;  3AKF A;  1IJT A;  2M49 A;  4J2K A;  1W3G A;  3IM7 A;  5D63 A;  4EKX B;  1ISW A;  3BAV A;  3WO4 A;  1JLY A;  4F83 A;  3O5W B;  1I1B A;  1QQL A;  5EC5 A;  3CA6 A;  2GO2 A;  3JRR A;  4P0K A;  5BP5 A;  3AH1 A;  1ISV A;  1FMZ A;  4I8M A;  4USP A;  31BI A;  1BFB A;  5D62 A;  1DFC A;  4ZFU B;  1XG6 A;  1G9C A;  3D7W B;  1BFF A;  4JP0 A;  4X39 A;  1FWV A;  1Q04 A;  3WIN A;  1TWE A;  3FJI A;  4XKI A;  2NTD A;  1JT4 A;  3QR5 A;  1MC9 A;  5FZZ A;  4R6U B;  1I1E A;  1HKN A;  2KLL A;  1Z0H A;  4YOL A;  4GAF A;  3FJJ A;  3OJV A;  4F34 A;  3CRH A;  4L4I A;  2D24 A;  1W3A A;  2F8X C;  4JAW A;  4G6M A;  1FMM S;  3V79 C;  1M16 A;  1BLA A;  2FFU A;  1XYF A;  3WA1 A;  4IYB A;  3UD7 A;  1V6U A;  2FO1 A;  41BI A;  3O4A A;  4QC4 A;  4CJM A;  1A8D A;  2LIE A;  3Q7X A;  3O4C A;  1WD3 A;  5I1B A;  2J3P A;  4ZOT A;  4ZLB B;  1V6X A;  3WMU A;  2ZQN A;  4GAI A;  4OEE A;  2P39 A;  3Q7W A;  1EV2 A;  7I1B A;  2HWM A;  2D7I A;  3A07 A;  1Q1U A;  4OEG A;  1Q03 A;  2IHO A;  1FQ9 A;  1IRP A;  1AVU A;  5BXP A;  3O44 A;  2X2T A;  4QO3 A;  4GP3 A;  4I4V A;  1TWM A;  4I1E A;  1TTU A;  4WBC A;  3P6I A;  3WO2 A;  4GOV A;  2Z48 A;  3MAL A;  5F90 A;  5EG6 C;  1BAR A;  4IHZ A;  21BI A;  4I4R A;  5BQU C;  8I1B A;  2R9K B;  4FGF A;  3FJ8 A;  4DCK C; 
#chains in the Genus database with same CATH topology
 2KI6 B;  4QBV A;  1AF9 A;  4IY8 A;  2VUA A;  2VXT I;  1DJS B;  2VU9 A;  3AH4 A;  4HJJ A;  1IT0 A;  2HZ9 A;  3FUQ A;  4J2Y A;  1Z2V A;  2LIQ A;  2D7R A;  4GOY A;  3IM5 A;  3BAO A;  4I0Y A;  4I96 A;  3WMV A;  4EEE B;  3BAH A;  1UPS A;  4LO0 C;  4ZFY B;  4D0T A;  4I4U A;  4XFS A;  2FFV A;  2D22 A;  1BLD A;  2K4A B;  1W3F A;  3S8J A;  3IIR A;  3PUB A;  4LO7 B;  4X3A A;  3AZW A;  3ILA A;  4II0 A;  1QXM A;  4QKR A;  4I4X A;  5F8S A;  3AKG A;  1T4Q A;  1DIW A;  4J2X A;  4QD2 B;  1HWO B;  2GZB A;  4ZFW B;  2ERM A;  3RTI B;  1OQL B;  2D43 A;  5B2H A;  2NS2 A;  4LO3 A;  4I4S A;  4IZX A;  4OW4 A;  1E0O A;  1YBI A;  5JMC A;  1YTO A;  1SR4 C;  3ZC8 A;  3PME A;  4EFP A;  3N7M A;  2E4M A;  2NYY A;  1T9F A;  3S8K A;  3UJ0 A;  2AXM A;  2ET2 A;  2KH2 A;  2WBC A;  3N7J A;  3AKI A;  4QD2 C;  3VUO A;  1PC8 B;  4ION A;  4QBC A;  1EPW A;  3HOM A;  1FN0 A;  3IAG C;  5FZU A;  3PG0 A;  4HA2 A;  1RML A;  1K5U A;  1AFC A;  3O4D A;  3CA3 A;  3FJA A;  4TLP A;  5BP5 C;  2Y9F A;  4HR6 C;  4OWK A;  4H75 A;  4KC3 A;  4IQP A;  2DS0 A;  3CQA A;  1HWP B;  2NM1 A;  4OUJ A;  1DZD A;  1ITB A;  1S0G A;  1GGP B;  5JLV A;  3LLP A;  4LO1 A;  3A21 A;  2Y9G A;  3A23 A;  3AJ6 A;  4ZGR B;  3R4S A;  3ZXD A;  1NUN A;  4Q9P A;  3W9T A;  3RMY A;  2RQ9 A;  3BA7 A;  3VT0 A;  2QYI B;  3ZX7 A;  1BA7 A;  1AVA C;  1S0E A;  2ZR1 B;  3E8L C;  4I7I A;  1WBC A;  1L2H A;  3UD8 A;  1ONK B;  1ABR B;  3BA4 A;  4EB2 B;  3FFZ A;  2VSE A;  3FJK A;  1CE7 B;  4OWL A;  1FGA A;  3CA4 A;  1PUU B;  1RZO B;  3NBE A;  2K8R A;  1G9A A;  4KEK A;  1F31 A;  2IWT B;  3OJM A;  3JUT A;  1N4K A;  3VSF A;  4I4P A;  1TFM B;  3OGF A;  1DQO A;  2BEB A;  1PZZ A;  1AVW B;  3Q7Y A;  4G9M A;  1HWN B;  1R8O A;  2RST A;  2WRY A;  2F2F A;  4EFQ A;  4JRA A;  2RG9 B;  3FJE A;  1S0C A;  5F8W A;  2FDB M;  1TOO A;  3FJH A;  4D8H A;  2I1B A;  5BVP I;  3TC2 A;  1G82 A;  1SZ6 B;  2AQZ A;  4J23 B;  3HAL A;  1IHK A;  2KKI A;  3AJ5 A;  3MPP G;  3AZV A;  4Q91 A;  4G6J A;  3O3Q A;  3QYD A;  1TP0 A;  4I3N A;  3FJB A;  3CRG A;  3I2A A;  3N0K A;  5EHA A;  3K1X A;  2VXR A;  1DQG A;  1IIL A;  3PHZ A;  1DZC A;  4ISR A;  4P6A A;  4A7K A;  5DZU A;  4USO A;  4I2S A;  4QKS A;  1S0F A;  1G9B A;  3N7L A;  1XHB A;  4ZBV B;  3F62 B;  4LO0 A;  3WO3 A;  2DRE A;  4XFT A;  3CAH A;  2UUS A;  1WBA A;  1YF8 B;  3CU1 B;  3BAQ A;  3BA5 A;  5BXR A;  1BFG A;  3HN1 A;  3FJF A;  1XZZ A;  1FWU A;  3BRF A;  2DRY A;  5F8Y A;  5FNW A;  4QAL A;  3V0B A;  3OBT A;  3CA1 A;  3NBC A;  2NVH A;  4LO7 C;  4P0J A;  2X2S A;  3EF2 A;  4IY9 A;  3RTJ B;  1HIB A;  3LTQ A;  4A7Z A;  1BFC A;  3AH2 A;  4LO2 A;  4Q9G A;  3HMY A;  4G9N A;  4LO3 C;  3FGM A;  1EVT A;  1IOB A;  1HCD A;  1FV2 A;  1SR4 A;  1JTC A;  3A22 A;  4END A;  3BAG A;  4AN6 A;  3P53 A;  1DLL A;  1JY0 A;  2BFH A;  1NZK A;  3ZXG A;  2AAI B;  1AVX B;  4KBB A;  2L5X A;  4IZE A;  1WD4 A;  4PC4 A;  3VT2 A;  3NBD A;  4MZF B;  1V6W A;  5BXT A;  3R4U A;  3VT1 A;  1FV3 A;  2ZQO A;  1S0B A;  1VCL A;  3P6J A;  2D1Z A;  3WIN C;  1MD6 A;  1P63 A;  2HWA A;  4GP0 A;  4Z9W B;  3I29 B;  3I2X A;  6I1B A;  4H9W A;  3V0A B;  1ISZ A;  2D23 A;  3NBN A;  4A7Y A;  4JKQ A;  1PUM B;  1TIE A;  3N7K A;  4LO1 C;  1KNM A;  1M2T B;  4ZA3 B;  4XFU A;  3BRD A;  2NP0 A;  3BRG C;  2FGF A;  3O49 A;  3V0A A;  4J2S A;  3C9Z A;  5G00 A;  4I1B A;  3H6R B;  1ISY A;  3VWC A;  5D61 A;  1HCE A;  4Z8S B;  3F1R A;  4I4Y A;  5FZY A;  3AKH A;  3BTA A;  4MZH A;  1YXW A;  3H6R A;  2MLL B;  3VSZ A;  3OJ2 A;  4ISQ A;  2HW9 A;  4I4Q A;  5GAQ A;  1JT5 A;  3OBR A;  1JT3 A;  3FJC A;  4KEJ A;  2Z49 A;  3FUO A;  3OGG A;  1DFQ A;  4I6I A;  3ZC9 A;  4JKX B;  2MIB A;  1S0L A;  4MZG B;  3FJD A;  1RY7 A;  2QN4 A;  4DEN A;  2Y9X E;  5E24 E;  3CA5 A;  1D0H A;  5HPZ A;  3HSM A;  3CA0 A;  2YUG A;  2NZ9 A;  5FNX A;  2DRZ A;  4D0Z A;  2F2F C;  1BAS A;  5DVH A;  1CVS A;  2Y9W C;  4FVV A;  5BXS A;  1JQZ A;  2D44 A;  4LO8 B;  5BQU A;  3NJ5 A;  3UD9 A;  2D20 A;  3IM6 A;  4AN7 B;  2Q3N B;  3BAD A;  4L4H A;  4ZKT B;  3B9U A;  1AXM A;  3UJ4 A;  1ILR 1;  4OEF A;  3SNV A;  1G9D A;  4X37 A;  3H6S E;  4DEP A;  3T8S A;  4G1R A;  2P23 A;  3O4O A;  2VLC A;  1J0S A;  1S0D A;  4I37 A;  3UDA A;  4KEI A;  3V0B B;  2AFG A;  2ESU A;  4OWJ A;  3VEQ A;  2BEA A;  1R8N A;  3BX1 C;  2K43 A;  1RG8 A;  2KI4 A;  4P0L A;  1ISX A;  5DUY A;  1QQK A;  3HBW A;  3KMV A;  4JQ0 A;  4I4O A;  1JT7 A;  3BB2 A;  3POK A;  3RMX A;  3CRI A;  1JLX A;  3FJ9 A;  1EYL A;  1K5V A;  3RSJ A;  2XOA A;  3O4B A;  2MC2 A;  2VSA A;  1IRA X;  5DSS B;  1V6V A;  1PWA A;  9ILB A;  1Z4S A;  5BOW A;  2Q9X A;  3H6Q A;  4X38 A;  1YYN A;  1HWM B;  4H04 A;  4UY4 A;  3BAU A;  4LO2 C;  2E4M C;  4JPZ A;  4EFR A;  1II4 A;  3AKF A;  1IJT A;  2M49 A;  4J2K A;  1W3G A;  3IM7 A;  5D63 A;  4EKX B;  1ISW A;  3BAV A;  3WO4 A;  1JLY A;  4F83 A;  3O5W B;  1I1B A;  1QQL A;  5EC5 A;  3CA6 A;  2GO2 A;  3JRR A;  4P0K A;  5BP5 A;  3AH1 A;  1ISV A;  1FMZ A;  4I8M A;  4USP A;  31BI A;  1BFB A;  5D62 A;  1DFC A;  4ZFU B;  1XG6 A;  1G9C A;  3D7W B;  1BFF A;  4JP0 A;  4X39 A;  1FWV A;  1Q04 A;  3WIN A;  1TWE A;  3FJI A;  4XKI A;  2NTD A;  1JT4 A;  3QR5 A;  1MC9 A;  5FZZ A;  4R6U B;  1I1E A;  1HKN A;  2KLL A;  1Z0H A;  4YOL A;  4GAF A;  3FJJ A;  3OJV A;  4F34 A;  3CRH A;  4L4I A;  2D24 A;  1W3A A;  2F8X C;  4JAW A;  4G6M A;  1FMM S;  3V79 C;  1M16 A;  1BLA A;  2FFU A;  1XYF A;  3WA1 A;  4IYB A;  3UD7 A;  1V6U A;  2FO1 A;  41BI A;  3O4A A;  4QC4 A;  4CJM A;  1A8D A;  2LIE A;  3Q7X A;  3O4C A;  1WD3 A;  5I1B A;  2J3P A;  4ZOT A;  4ZLB B;  1V6X A;  3WMU A;  2ZQN A;  4GAI A;  4OEE A;  2P39 A;  3Q7W A;  1EV2 A;  7I1B A;  2HWM A;  2D7I A;  3A07 A;  1Q1U A;  4OEG A;  1Q03 A;  2IHO A;  1FQ9 A;  1IRP A;  1AVU A;  5BXP A;  3O44 A;  2X2T A;  4QO3 A;  4GP3 A;  4I4V A;  1TWM A;  4I1E A;  1TTU A;  4WBC A;  3P6I A;  3WO2 A;  4GOV A;  2Z48 A;  3MAL A;  5F90 A;  5EG6 C;  1BAR A;  4IHZ A;  21BI A;  4I4R A;  5BQU C;  8I1B A;  2R9K B;  4FGF A;  3FJ8 A;  4DCK C; 
#chains in the Genus database with same CATH homology
 2KI6 B;  4QBV A;  1AF9 A;  4IY8 A;  2VUA A;  2VXT I;  1DJS B;  2VU9 A;  3AH4 A;  4HJJ A;  1IT0 A;  2HZ9 A;  3FUQ A;  4J2Y A;  1Z2V A;  2LIQ A;  2D7R A;  4GOY A;  3IM5 A;  3BAO A;  4I0Y A;  4I96 A;  3WMV A;  4EEE B;  3BAH A;  1UPS A;  4LO0 C;  4ZFY B;  4D0T A;  4I4U A;  4XFS A;  2FFV A;  2D22 A;  1BLD A;  2K4A B;  1W3F A;  3S8J A;  3IIR A;  3PUB A;  4LO7 B;  4X3A A;  3AZW A;  3ILA A;  4II0 A;  1QXM A;  4QKR A;  4I4X A;  5F8S A;  3AKG A;  1T4Q A;  1DIW A;  4J2X A;  4QD2 B;  1HWO B;  2GZB A;  4ZFW B;  2ERM A;  3RTI B;  1OQL B;  2D43 A;  5B2H A;  2NS2 A;  4LO3 A;  4I4S A;  4IZX A;  4OW4 A;  1E0O A;  1YBI A;  5JMC A;  1YTO A;  1SR4 C;  3ZC8 A;  3PME A;  4EFP A;  3N7M A;  2E4M A;  2NYY A;  1T9F A;  3S8K A;  3UJ0 A;  2AXM A;  2ET2 A;  2KH2 A;  2WBC A;  3N7J A;  3AKI A;  4QD2 C;  3VUO A;  1PC8 B;  4ION A;  4QBC A;  1EPW A;  3HOM A;  1FN0 A;  3IAG C;  5FZU A;  3PG0 A;  4HA2 A;  1RML A;  1K5U A;  1AFC A;  3O4D A;  3CA3 A;  3FJA A;  4TLP A;  5BP5 C;  2Y9F A;  4HR6 C;  4OWK A;  4H75 A;  4KC3 A;  4IQP A;  2DS0 A;  3CQA A;  1HWP B;  2NM1 A;  4OUJ A;  1DZD A;  1ITB A;  1S0G A;  1GGP B;  5JLV A;  3LLP A;  4LO1 A;  3A21 A;  2Y9G A;  3A23 A;  3AJ6 A;  4ZGR B;  3R4S A;  3ZXD A;  1NUN A;  4Q9P A;  3W9T A;  3RMY A;  2RQ9 A;  3BA7 A;  3VT0 A;  2QYI B;  3ZX7 A;  1BA7 A;  1AVA C;  1S0E A;  2ZR1 B;  3E8L C;  4I7I A;  1WBC A;  1L2H A;  3UD8 A;  1ONK B;  1ABR B;  3BA4 A;  4EB2 B;  3FFZ A;  2VSE A;  3FJK A;  1CE7 B;  4OWL A;  1FGA A;  3CA4 A;  1PUU B;  1RZO B;  3NBE A;  2K8R A;  1G9A A;  4KEK A;  1F31 A;  2IWT B;  3OJM A;  3JUT A;  1N4K A;  3VSF A;  4I4P A;  1TFM B;  3OGF A;  1DQO A;  2BEB A;  1PZZ A;  1AVW B;  3Q7Y A;  4G9M A;  1HWN B;  1R8O A;  2RST A;  2WRY A;  2F2F A;  4EFQ A;  4JRA A;  2RG9 B;  3FJE A;  1S0C A;  5F8W A;  2FDB M;  1TOO A;  3FJH A;  4D8H A;  2I1B A;  5BVP I;  3TC2 A;  1G82 A;  1SZ6 B;  2AQZ A;  4J23 B;  3HAL A;  1IHK A;  2KKI A;  3AJ5 A;  3MPP G;  3AZV A;  4Q91 A;  4G6J A;  3O3Q A;  3QYD A;  1TP0 A;  4I3N A;  3FJB A;  3CRG A;  3I2A A;  3N0K A;  5EHA A;  3K1X A;  2VXR A;  1DQG A;  1IIL A;  3PHZ A;  1DZC A;  4ISR A;  4P6A A;  4A7K A;  5DZU A;  4USO A;  4I2S A;  4QKS A;  1S0F A;  1G9B A;  3N7L A;  1XHB A;  4ZBV B;  3F62 B;  4LO0 A;  3WO3 A;  2DRE A;  4XFT A;  3CAH A;  2UUS A;  1WBA A;  1YF8 B;  3CU1 B;  3BAQ A;  3BA5 A;  5BXR A;  1BFG A;  3HN1 A;  3FJF A;  1XZZ A;  1FWU A;  3BRF A;  2DRY A;  5F8Y A;  5FNW A;  4QAL A;  3V0B A;  3OBT A;  3CA1 A;  3NBC A;  2NVH A;  4LO7 C;  4P0J A;  2X2S A;  3EF2 A;  4IY9 A;  3RTJ B;  1HIB A;  3LTQ A;  4A7Z A;  1BFC A;  3AH2 A;  4LO2 A;  4Q9G A;  3HMY A;  4G9N A;  4LO3 C;  3FGM A;  1EVT A;  1IOB A;  1HCD A;  1FV2 A;  1SR4 A;  1JTC A;  3A22 A;  4END A;  3BAG A;  4AN6 A;  3P53 A;  1DLL A;  1JY0 A;  2BFH A;  1NZK A;  3ZXG A;  2AAI B;  1AVX B;  4KBB A;  2L5X A;  4IZE A;  1WD4 A;  4PC4 A;  3VT2 A;  3NBD A;  4MZF B;  1V6W A;  5BXT A;  3R4U A;  3VT1 A;  1FV3 A;  2ZQO A;  1S0B A;  1VCL A;  3P6J A;  2D1Z A;  3WIN C;  1MD6 A;  1P63 A;  2HWA A;  4GP0 A;  4Z9W B;  3I29 B;  3I2X A;  6I1B A;  4H9W A;  3V0A B;  1ISZ A;  2D23 A;  3NBN A;  4A7Y A;  4JKQ A;  1PUM B;  1TIE A;  3N7K A;  4LO1 C;  1KNM A;  1M2T B;  4ZA3 B;  4XFU A;  3BRD A;  2NP0 A;  3BRG C;  2FGF A;  3O49 A;  3V0A A;  4J2S A;  3C9Z A;  5G00 A;  4I1B A;  3H6R B;  1ISY A;  3VWC A;  5D61 A;  1HCE A;  4Z8S B;  3F1R A;  4I4Y A;  5FZY A;  3AKH A;  3BTA A;  4MZH A;  1YXW A;  3H6R A;  2MLL B;  3VSZ A;  3OJ2 A;  4ISQ A;  2HW9 A;  4I4Q A;  5GAQ A;  1JT5 A;  3OBR A;  1JT3 A;  3FJC A;  4KEJ A;  2Z49 A;  3FUO A;  3OGG A;  1DFQ A;  4I6I A;  3ZC9 A;  4JKX B;  2MIB A;  1S0L A;  4MZG B;  3FJD A;  1RY7 A;  2QN4 A;  4DEN A;  2Y9X E;  5E24 E;  3CA5 A;  1D0H A;  5HPZ A;  3HSM A;  3CA0 A;  2YUG A;  2NZ9 A;  5FNX A;  2DRZ A;  4D0Z A;  2F2F C;  1BAS A;  5DVH A;  1CVS A;  2Y9W C;  4FVV A;  5BXS A;  1JQZ A;  2D44 A;  4LO8 B;  5BQU A;  3NJ5 A;  3UD9 A;  2D20 A;  3IM6 A;  4AN7 B;  2Q3N B;  3BAD A;  4L4H A;  4ZKT B;  3B9U A;  1AXM A;  3UJ4 A;  1ILR 1;  4OEF A;  3SNV A;  1G9D A;  4X37 A;  3H6S E;  4DEP A;  3T8S A;  4G1R A;  2P23 A;  3O4O A;  2VLC A;  1J0S A;  1S0D A;  4I37 A;  3UDA A;  4KEI A;  3V0B B;  2AFG A;  2ESU A;  4OWJ A;  3VEQ A;  2BEA A;  1R8N A;  3BX1 C;  2K43 A;  1RG8 A;  2KI4 A;  4P0L A;  1ISX A;  5DUY A;  1QQK A;  3HBW A;  3KMV A;  4JQ0 A;  4I4O A;  1JT7 A;  3BB2 A;  3POK A;  3RMX A;  3CRI A;  1JLX A;  3FJ9 A;  1EYL A;  1K5V A;  3RSJ A;  2XOA A;  3O4B A;  2MC2 A;  2VSA A;  1IRA X;  5DSS B;  1V6V A;  1PWA A;  9ILB A;  1Z4S A;  5BOW A;  2Q9X A;  3H6Q A;  4X38 A;  1YYN A;  1HWM B;  4H04 A;  4UY4 A;  3BAU A;  4LO2 C;  2E4M C;  4JPZ A;  4EFR A;  1II4 A;  3AKF A;  1IJT A;  2M49 A;  4J2K A;  1W3G A;  3IM7 A;  5D63 A;  4EKX B;  1ISW A;  3BAV A;  3WO4 A;  1JLY A;  4F83 A;  3O5W B;  1I1B A;  1QQL A;  5EC5 A;  3CA6 A;  2GO2 A;  3JRR A;  4P0K A;  5BP5 A;  3AH1 A;  1ISV A;  1FMZ A;  4I8M A;  4USP A;  31BI A;  1BFB A;  5D62 A;  1DFC A;  4ZFU B;  1XG6 A;  1G9C A;  3D7W B;  1BFF A;  4JP0 A;  4X39 A;  1FWV A;  1Q04 A;  3WIN A;  1TWE A;  3FJI A;  4XKI A;  2NTD A;  1JT4 A;  3QR5 A;  1MC9 A;  5FZZ A;  4R6U B;  1I1E A;  1HKN A;  2KLL A;  1Z0H A;  4YOL A;  4GAF A;  3FJJ A;  3OJV A;  4F34 A;  3CRH A;  4L4I A;  2D24 A;  1W3A A;  2F8X C;  4JAW A;  4G6M A;  1FMM S;  3V79 C;  1M16 A;  1BLA A;  2FFU A;  1XYF A;  3WA1 A;  4IYB A;  3UD7 A;  1V6U A;  2FO1 A;  41BI A;  3O4A A;  4QC4 A;  4CJM A;  1A8D A;  2LIE A;  3Q7X A;  3O4C A;  1WD3 A;  5I1B A;  2J3P A;  4ZOT A;  4ZLB B;  1V6X A;  3WMU A;  2ZQN A;  4GAI A;  4OEE A;  2P39 A;  3Q7W A;  1EV2 A;  7I1B A;  2HWM A;  2D7I A;  3A07 A;  1Q1U A;  4OEG A;  1Q03 A;  2IHO A;  1FQ9 A;  1IRP A;  1AVU A;  5BXP A;  3O44 A;  2X2T A;  4QO3 A;  4GP3 A;  4I4V A;  1TWM A;  4I1E A;  1TTU A;  4WBC A;  3P6I A;  3WO2 A;  4GOV A;  2Z48 A;  3MAL A;  5F90 A;  5EG6 C;  1BAR A;  4IHZ A;  21BI A;  4I4R A;  5BQU C;  8I1B A;  2R9K B;  4FGF A;  3FJ8 A;  4DCK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...