5FNZA

F206w mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
338
structure length
328
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGWPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
molecule tags Transferase
source organism Corynebacterium ammoniagenes
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
total genus 99
structure length 328
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fnzA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fnzA01
1T6ZA 3DPIA 3IMGA 4PBRA 1WKBA 3A04A 1J1ZA 3SZGA 1T9GS 2PXHA 3P0IA 4ZT5A 2PG3A 1JILA 1EXDA 1H3EA 1TYDE 3A05A 4DDMA 3DO8A 3IOEA 3A4IA 1MBZA 1T6XA 4EG4A 1EFVB 4J75A 3IVCA 4YBRA 1MB9A 2QUHA 1EUYA 3TQOA 1WXGA 2E0IA 5TRDA 1ULHA 4OJMX 1TEZA 4ARIA 4PBSA 2WQ7A 2BTEA 2AKEA 1V8FA 1R6TA 1WXFA 2JAXA 1MRZA 1IQRA 1J1UA 2OYNA 1Q19A 1WZ2A 1K4KA 1N3LA 1OD6A 1U7DA 2DETA 3FH0A 3NBAA 1KQPA 1NB9A 2WB2A 4EG7A 4MUNA 4R2MA 1MAWA 1WJGA 5DK4A 1TYBE 2YY5A 4ZT3A 3CA8A 1QRUA 4MW6A 1GTSA 3A2KA 4R0NA 4KPUA 2DEUA 1ZH6A 4G5YA 4HPWA 1TYCA 4EG6A 1O0BA 1GTRA 1I6MA 4L2IB 3KT0A 1NSYA 4QRDA 3H05A 1QJCA 3COWA 3P0JA 5DEOA 4CT0A 1XJQA 4NDAA 2ZUEA 3ND5A 2J09A 3PXUA 4AQ7A 1LW7A 1M1ZA 4ZT4A 1EJ2A 4L2IA 2DXIA 1GLNA 2GM3A 3RHSA 3G59A 4YP6A 2YWBA 4F3RA 5JBNA 3VRHA 1XNHA 3L93A 5LLTA 1O95D 3Q12A 2WSIA 5HG0A 2WQ6A 2IJGX 1GPMA 3HV0A 3QE4A 1N06A 1N2EA 3COVA 2CV1A 1N2BA 4ZT6A 2QJFA 3FOCA 3HZRA 1A8HA 1R6UA 2VBUA 1MB2A 1JEEA 3JXEA 1F9AA 2V0GA 2JANA 3Q10A 4YMIA 2P3MA 3ZIUA 3FETA 3SDBA 1NUUA 3ZXIA 2X0KA 4NATA 5F23A 3ILVA 1UFVA 1N75A 2HZ7A 4X0EA 3IH5A 1M83A 1H1TA 4H3SA 1NUSA 5J5AA 5A8AA 2AZXA 3QTTA 1X8XA 1O0CA 2HGZA 4CDNA 1HYBA 3X1KA 2QUIA 1VBMA 1Y42X 5A88A 3MLAA 3GLVA 3ZUGA 3AKZA 4DE5A 3UC5A 4MUIA 2CYCA 4HJXA 2VXOA 3N9IA 2A1UB 4G6ZA 1YUNA 4MVCA 2RE8A 3ZJTA 3G6KA 4MW4A 3H99A 4U63A 4ZT2A 1JIIA 1TQ8A 3SP1A 1N78A 2J08A 1EE1A 2PFSA 1PFWA 4FZJA 1MC1A 1NUTA 2VBSA 1YULA 2H29A 2J07A 2I1LA 4MUGA 3AL0C 1M8PA 3CLTD 4JXXA 1KKUA 1KORA 2A86A 2E18A 4DDKA 3C8ZA 2X1LA 1O97C 1K4MA 3IMCA 1IHOA 1N2IA 2X3FA 3N8HA 3CVWA 4MQ6A 4JXZA 1EFPA 2CFOA 1KH2A 1WQ4A 1OWMA 4MW5A 1O6BA 4I6JA 4MULA 3VGJA 4HJRA 5DASA 1JIJA 1JHDA 2GOYA 3DV2A 5A89A 3ELBA 5IHXA 1JEDA 3CVVA 1NURA 2PZ8A 4MW1A 4ND6A 3AG6A 1G59A 3RK1A 1GN8A 3SYTA 3CR8A 2VTBA 1F7UA 3S3TA 1N08A 3INNA 4ND7A 1N2OA 1OBCA 1I6LA 1N1DA 3FG9A 5H7XA 1ILEA 2DR2A 2DLCX 4ZCQA 3PRHA 1O96B 4AS1A 3D6VA 5TGTA 1J09A 1Q15A 3ISJA 1K97A 2YXNA 4K0RA 2CV2A 3LE8A 1T9GR 2QJTA 5KWVA 3N05A 3ND6A 1VBNA 4PY2A 4F4HA 3AFHA 4ZCPA 2V0CA 1JIKA 1K92A 4EGAA 3CLUD 1NB0A 3CLRD 3RK0A 1QTQA 3F3MA 3UMVA 4MW2A 1QQTA 3CLSC 1NUPA 4MW7A 1S4MA 3FNRA 3TQIA 1V47A 3FHJA 3MMXA 1TFUA 2CUZA 2OV4A 3P0HA 3UY4A 2JA2A 3HMQA 3CVUA 2G36A 4OUDB 3SEQA 4MVYA 4Q16A 4EG3A 3FIUA 4XFDA 1T6YA 1WQ3A 4JZYA 1PFUA 2AG6A 2A4MA 4JYZA 3K32A 3RBAA 1EFPB 5TEWA 1ZJWA 4YP7A 4S1OA 4MWDA 1FFYA 1IH8A 1WY5A 2D54A 4MUJA 1YI8A 2CV0A 5LM3A 4J76A 3COZA 1P4MA 2PZAA 3I05A 4OUDA 1D2RA 2QUKA 1MOPA 4XSVA 1YIAA 3PNBA 3U1VA 1KH1A 3TNJA 4A91A 4ARCA 4EG8A 3HGMA 4MUEA 1M8JA 4BWVA 1MJHA 1IRXA 3IODA 3Q4GA 2QJOA 1QNFA 1MAUA 1SURA 3UOWA 1OBHA 4DDHA 1U7XA 3P52A 1KAMA 1U0BB 4NX2A 1WOYA 1IQ0A 3KT3A 1IFXA 4MW9A 3IVXA 3SEZA 3L92A 4MUFA 2A7XA 1COZA 3KT6A 3CVXA 5LFAA 1PFVA 5EKDA 4DNXA 4EF6A 1PG0A 1N2HA 5AHWA 2VBVA 3UK2A 3MLBA 2H2AA 3LCJA 2D5BA 1JZQA 2E21A 1F7VA 1JECA 3IUEA 2CSXA 1NYLA 4MVWA 1O5TA 4NZPA 4MUKA 5H16A 4MWBA 4RUKA 2CT8A 1Q11A 5TS2A 3K9WA 1OWNA 1U3CA 1JMVA 1I2DA 4U7JA 1R6XA 4YP5A 5J58A 1FYDA 1KP2A 4Q93A 3PNYA 4EG5A 1JZSA 3E27A 4MAFA 1KH3A 3KT8A 1KAQA 3QTBA 3X1MA 2GKSA 1X6VA 2A1TS 3GMIA 3OP1A 1WXEA 1ZH0A 1O96A 3ZGZA 1NP7A 2O5RA 1KQNA 3SZ3A 4UZFA 3N2YA 2IELA 4E1AA 3IUBA 4CQNA 5J59A 3D6UA 1TYAE 2DERA 1I6KA 2E89A 3LOQA 1QRSA 5HUHA 3M5WA 1U3DA 1OWLA 2C5SA 3ZJUA 3IOBA 4DJAA 1G8FA 1XNJA 5FNZA 1EUQA 5KCMA 3CLRC 4WSOA 1J70A 3ZJVA 4GU5A 2R5WA 3FWKA 3IOCA 5HUJA 4KR7A 3AG5A 1H3FA 1N2JA 2QUJA 5BNZA 1PG2A 5K0SA 2A1TR 5FO1A 4G5FA 4CDMA 2B7LA 4KR6A 2XRZA 4MVXA 1KQOA 2DUMA 4K03A 1JGTA 1RQGA 3NV7A 4MW0A 2EL7A 3H9BA 4DLPA 4ZT7A 3DLAA 3GUZA 1KR2A 2J4DA 1GZUA 1IVSA 1J20A 1M8FA 2HMAA 1OWPA 3CLTC 3RJZA 2J5BA 1M8GA 2D13A 1EFVA 3BL5A 3COYA 4KKVA 2RD2A 3BNWA 4RPIA 1CT9A 2A88A 3NBKA 4NAUA 4ZCSA 3FY4A 1GAXA 2EJCA 4TS1A 2Z08A 3IVGA 2NSYA 3TZLA 1G8HA 2QTNA 4I6GA 1WXIA 1O97D 4GRIA 1QRTA 5K0TA 1NZJA 2PIDA 4EG1A 3G5AA 4WNYA 2BYTA 2OQ2A 1LI5A 3PNVA 1G8GA 1QU2A 1P7PA 3ND7A 3H97A 3IDFA 3X1JA 1M8KA 1J21A 1LI7A 1WXHA 4QREA 1F4LA 1OWOA 3KFLA 2XRYA 2ZUFA 4KPUB 2QTRA 3HFJA 2X1MA 3CVYA 1VBKA 4MUHA 2IP1A 4MLPA 1XNGA 2O8VA 1ZUNA 4KR9A 3FDXA 3MXTA 3HL4A 1YIDA 4NAHA 3IMEA 2CYAA 3TS1A 3AIIA 4XFJA 2VBTA 3TZEA 4R2LA 4JFAA 2VTBB 1NUQA 2QTMA 3RFFA 1PFYA 1H3NA 4MWEA 2ZP1A 1QU3A 1N07A 2A1UA 1YUMA 4ZCRA 1NI5A 1VL2A 3FI0A 3CTAA 1O94D 2CYBA 2NZ2A 1BS2A 5FO0A 2TS1A 3OTWA 1KP3A 1B6TA 5IJXA 4ZCTA 2YWCA 4P2BA 4MWCA 1N77A 1O95C 5TEVA 4EFKA 1Q77A 1N05A 2PZBA 1O94C 2A84A 2Z09A 3VU8A 1N2GA 3CLSD 3ZXSA 1DNPA 1Q9SA 3H9CA 4QBTA 4U8HA 1IQUA 1VLHA 2Z3VA 5DB4A 3MUEA 4PBTA 4I6EA 4HK4A 5KHAA 2DPLA 4UZEA 3CLUC
chains in the Genus database with same CATH superfamily
3CUUA 4N7BA 3IMGA 3OE4A 2DYKA 4M4SA 3RR2A 5BR1A 3ZY4A 3H1FA 4TRJA 1CFZA 2ZYRA 4TS9A 4B43A 1VQKB 4C21A 3ADDA 2QUBA 4HLCA 5FBRB 4BMCA 5EKTA 4QFCA 1IXKA 5A6SA 5KHOC 4E22A 4BNGA 1MBZA 3R0XA 3TFWA 3P27A 1Z6TA 1MO4A 2VK4A 2ZBRA 3UAWA 4UHHA 5JNUA 3EVEA 4X6XA 1L8LA 1ZZGA 2QLFA 3OOSA 1CNFA 4PF1A 3GFBA 1LH0A 1C2TA 1K7YA 1N0HA 4M87A 3K0SA 4Q9KA 1IPFA 4IDPA 5ELMA 2IH2A 2NSHA 2W4QA 4RD3A 3CH7A 4JBHA 5FPTA 1WG8A 5CR9A 3MTBA 4JBLA 4KB5A 2XXBA 4RTMA 1E89A 1DFIA 1TA0A 2FWPA 2WKPA 1RYHA 3OAAD 4FOPA 2ZROA 3IL2A 5IH3A 2BHTA 2OYNA 1WMBA 2BTOA 3FHLA 3ZZMA 3AH8A 4CKXA 1UMCB 4J6EA 3TLMA 2EL9A 1OD6A 3ED5A 3F4BA 4B6SA 5C1PA 1WCYA 2JIZA 5EKSA 4UOZA 1NOKA 4MUNA 5BSUA 2J9RA 4PGGA 4ZOBA 4JLMA 2P79A 2CK3A 4W63A 3R6WA 3RVNA 3SQMA 1EFRD 2HLNA 3K35A 3PJGA 3QPVA 3CA8A 5HIAA 4JI4B 5GMOA 4G9BA 2PE3A 1H4TA 3GA7A 3R44A 4D5EA 5JXIA 1XF9A 1I3MA 2XGOA 4YTEA 1YRAA 3TCKA 2NO7A 3C45A 3T5DA 4OB7A 2I34A 1RAGA 5AW5A 2ON6A 1B6GA 2Q1TA 4EKIA 4LF4B 3C74A 1I6MA 4NBTA 2GJAA 5TMPA 2G9UA 2PJDA 4DNTB 2QTFA 2H16A 1Z17A 3L7BA 2OK7A 1VE3A 4KQ1A 1DIOB 4BQRA 3CSDA 1XJQA 3NXSA 4QPJC 3MTAA 3WYDA 3HCRA 1IUNA 4NDAA 2VUIB 2ZT7A 3UT6A 1HH4A 2FOXA 1HL3A 1G17A 1UJCA 2HQOA 4YWJA 4UDNA 4O2AB 1FYEA 4D2IA 4WAUA 3GXBA 1RCFA 5I9BA 5AVRA 1OU4A 1UBRS 4YIHA 1C1XB 3T3IA 5JLJA 4ZCLA 1QB7A 3A37A 3IV7A 5JTTA 4OBBA 3V80A 3MTGA 4A0HA 4BXOA 1ZI8A 1NP3A 2AFHA 4J91A 3ROEA 4MUYA 2XQFA 2ZRMA 3Q2OA 2BM1A 2ZTGA 3NDBB 2X4DA 2POCA 2ZJ6A 1GD1O 5B6IA 2R6JA 3QMMA 3HJBA 4NC9A 3TLZA 4ND2A 1NJ5A 1ZK4A 2IIBA 2P7IA 4DYVA 5LJLA 3EPLA 4X7MA 1VLOA 1GGMA 1PNOA 3LH5A 3OMXA 2XECA 3DT8A 4YJ2B 4D9CA 1EQUA 4BTVA 1EX6A 4O5AA 3VZQA 1H2YA 3JXEA 1A71A 4HB2A 4QRHA 2P3MA 1N8SA 2XLBA 4FDMA 1YU6A 5LP6C 2PYZA 3UGJA 3F6EX 4Q4HB 4YJFB 4JYCA 3CNLA 5HF9A 3TLAA 4TTTS 2HSJA 2PXXA 4BV8A 3B70A 1UP4A 1RJ9B 3KB2A 4HE6A 1TLTA 4XVHA 3ZW9A 2Z9CA 3D5EA 4KAJA 1WF6A 1O5IA 2GEBA 3GBSA 3QTTA 4XTRA 3ZZ1A 3GLIE 3M6MD 1SU7A 3OY2A 1VBMA 1Z4PX 3KB8A 3P5SA 1R8JA 4U7PB 3CCVB 1J22A 5A88A 4UW9A 1DQZA 4AYXA 2PGIA 4MJ3A 4NEGA 2CXRA 1RQ7A 3M4NA 4IVQA 1AQYA 3JAWB 1GPH1 4JVNA 1JAHA 4LJSA 2JIMA 4MIOA 4EHHA 3KSAC 2PWBA 5JJBA 5ECWA 3N9IA 2JDID 4P6VF 2VPPA 3ANSA 2VDKB 5DO9A 4YS6A 2HHHB 4GBGA 1SRRA 3FOBA 2RE8A 2WAMA 5JD3A 3SYKA 1XLTC 1ULZA 1NNEA 4EM6A 1DTSA 4UMFA 3ESQA 4G5GA 4WUVA 3WKAA 3DOOA 1KP9A 2E4VA 3FPGA 5KVSA 2JLYA 4FGUA 1YR8A 2VBSA 3O95A 4HVCA 5H4GA 2WMDA 3H6GA 1GN9A 3BSWA 3CLTD 1KKUA 1RJWA 1KAHA 3PYMA 3ZV6A 3C8ZA 3JSAA 3Q5GA 4JL6A 4KGXA 3D02A 2RONA 3QPAA 5B7PA 2CUKA 1YVPA 4OXKA 3BWMA 1XQ9A 4JGBA 4C1BA 5L4NA 3E1SA 3I4CA 1JR2A 4AY3A 4C3ZA 2V3WA 3ETDA 3GJXC 5DMXA 3NX4A 5DHUA 3WDMA 4XLAA 1ES9A 2RGGA 4B09A 3A4VA 1M2JA 3IP3A 2EYUA 2BP7A 3L8HA 3LTEA 4OAOA 2WZNA 5DASA 1JIJA 4M1SA 7YASA 5KDDA 1OYWA 3R3XA 4FN4A 3RFVA 4A2PA 1E3EA 4CIYA 4I4CA 2QSJA 3E3LA 4H3HB 4JLUA 4QSHA 3VR3A 2XWBF 4RACA 5LBUA 1EFDN 1UOPA 1V8OA 3LRPA 1THGA 3QLVA 2JLRA 3Q87B 1BCRB 4W82A 2ZSAA 1L4GA 3AG6A 3RK1A 1MIOA 1XXHE 2WSYB 5BYKA 1Z56C 2BH9A 1ORDA 2CFIA 4ZOLF 4EJSB 4N3GA 2VDUE 1PJAA 3VYUB 4W1SA 4DPKA 4B17A 3PDWA 1RZVA 4WZTA 1QBGA 3BILA 1NVMB 1NRWA 2QEXB 1G6Q1 2EFJA 5LD2B 4RGBA 1Q15A 1KYQA 3NNDA 2BGGA 2TMYA 2O14A 1VPDA 1US8A 2YXNA 2JI8A 3FOFC 2OXRA 2QRUA 4JD5A 2RKWA 3BS4A 1MXFA 1SCJA 3ANLA 4TWBA 3QBDA 2P62A 5KYWA 4O4IF 4A26A 4RZ3A 2FZVA 4PWYA 1PJTA 2B4RO 3GJRA 4DRZA 3WYBA 4PS0A 2IEYA 5I7EA 2D1SA 3UK1A 3G0DA 1XRLA 5B3KA 4L15A 3B1JA 3VOAA 4HDRB 2DLNA 4MJLA 2VPQA 3BD8A 3TDKA 4Q3EA 3HN2A 1CUHA 1Y63A 2VTVA 1Z6XA 1DEHA 1X7ZB 3E7XA 1ZD9A 4C9BA 3DTYA 2EGUA 4W8GA 2G5PA 3HJCA 2A0FA 3V7WA 1CUXA 2P0EA 3CKMA 3M9WA 3S2FA 1DE0A 2O8DB 2YHAA 3DSRA 1RE1A 1BCSA 2V97A 3KEGA 3KU4A 2ZYVX 4OUDB 3KPWA 4JJ4A 4POAA 3H3FA 1L7OA 1EUDA 2CXUA 2OCXA 2VHUA 2ENUA 2J67A 4GKVA 4RD4A 2VNAA 2C8KA 1XEAA 2O2DA 2VF7A 3NBQA 3R3ZA 3SKXA 1XQBA 1V1JA 2JRCA 4BWGA 2B6HA 4K2AA 3ZCQA 4ECAA 1RIIA 3FFBA 4IQFA 2BM0A 1A97A 3MBIA 1E6UA 4N0QA 4HGZA 3CF4A 3PPIA 4GZLA 1EA7A 1UM8A 3I6MA 3PLNA 2HU5A 1FFXB 3CM0A 1KAOA 4KEAA 3TZQA 2QUKA 4JCCA 4KI0A 3NHFA 3UJCA 2MR6A 2I67A 5EZYF 4DANA 2KWIA 3EFOB 1YIAA 4CTMA 4A91A 1KH1A 4ZDJA 5DYTA 1A1VA 2I1QA 4V02A 4ZTZB 2D62A 4MVJI 5TNXA 2AE2A 4IIJA 4J0FA 4GLJA 4MUEA 3ICOA 2Z6UA 3IUYA 4O4LA 4US2R 4BEBA 3T7AA 4QVJA 1ST3A 3KOMA 2Z1MA 3PFKA 2HFKA 2UV8A 4K9KA 1KOJA 4PTZA 1HO3A 4TXHA 4WXEA 3PRYA 2FPGB 1N6LA 3UOWA 3V48A 5KX5F 3ES9A 1C50A 1N7JA 3Q0TA 3VM6A 4MIEA 5DTQA 1WKCA 3IR7A 1AOXA 1J5PA 1IQ0A 4LTNA 4RVDA 3L0OA 5LR6A 3NVAA 3L92A 3Q41A 1VMIA 2JEYA 2AQIA 4MUFA 4TKVA 5BSHA 2CVFA 1JVSA 2HTEA 2GUWA 1YA8A 3H84A 4QPZA 1GSAA 1PG0A 3D8RA 3DAHA 4Y2JA 4KK3A 1QRRA 5D7NA 5EP4A 1JSXA 1H5UA 1JLRA 4FCWA 1UM9B 2PH3A 3AYZB 3P26A 1EFRA 1ZNWA 3TMKA 1JZQA 2IZZA 2BF7A 3HMKA 2HCBA 2LV8A 2QP4A 4HYEA 3QX9A 3KJGA 4Y0VA 1RM3A 4XAQA 1A27A 1N1EA 3NYIA 1MN6A 2JJ2D 4ZALA 2ZBGA 5HOQA 4HDQB 1GCIA 2C9YA 2ZDHA 3C7TA 5LA6F 4D8XA 2X5XA 4ETIA 4DCTA 3WA7A 4QASA 1BYUA 3K9WA 4Q19A 3PC3A 5FPQA 2FDRA 4P25A 3KQMA 4G1MB 5MGBA 3V9AA 1ZWLA 5IEJA 4E0BA 3NIBA 4DG9A 4XOPA 4P0TA 3NRJA 4MQFB 1KH3A 4QXAA 2CGEA 3I04A 2K6GA 3AB7A 1GL7A 5ELLA 2QDXA 3KSZO 2CLKB 2BEWA 5CLQA 3F6BX 4BLUA 3FRIA 5ALMA 5HDBB 1CUUA 3SJZA 2B94A 2FWJA 2Q9AA 4QOSA 2Y76A 5IUJC 2O20A 4GEKA 4A6DA 2WWTA 3WLHA 2FFRA 1GRRA 2VATA 4QWMA 4GXQA 4OXQA 4L28A 4PCUA 3GJ3A 2Q5HA 1SCAA 1UF9A 3I04M 3NKLA 2IPXA 1U2ZA 3DBRB 4YJ3F 3M34A 3Q7SA 1H5QA 5EIFA 3SQOA 3EYAA 1JDBC 1I6KA 1LUAA 4FDAA 4XA8A 3RSZA 1S01A 1XEWY 1AHNA 4RYLA 5F2OA 1D8AA 1CU1A 3RD5A 4QXOA 2XTNA 1SXIA 2FEPA 1SKUA 3HDHA 4EWLA 2WPDA 1ZM9A 2IOYA 2WJ3A 2XMGA 3U26A 3AZPA 2WYUA 3Q3EA 4GPD1 4IDDA 4P93A 2C31A 1FS4A 2X2OA 2IXGA 3VDQA 1WBDA 3IOMA 2V7GA 4NAVA 3TJMA 4B7CA 4QELA 4GU5A 5IDXA 1Y1LA 4NWIA 3C8MA 4BMOB 2MOKA 1CXZA 4A8HA 4WIAA 4YRFA 1KYTA 5EAIA 4CLXA 3EFBA 2C59A 1XZPA 1YBFA 3F0TA 3MERA 4YMTA 4QFDA 3WYGA 3ET4A 5J2UF 2D6FA 1UBGA 1PE0A 2ZAMA 3QLEA 4OQYA 3VZDA 1KI2A 3JD0A 3LUHA 4IUCS 4QQKA 4URYR 2QZSA 3E9ZA 2ZJZA 2Y6VA 2I3BA 2I4LA 4G84A 1V4BA 3I1YA 4QATA 2DUMA 2PFKA 3IHWA 1MIOB 3L6DA 5B64A 2E4XA 3M6UA 4M7PA 5KI6A 3IPLA 4FFRA 2KBEA 4MRPA 5UKDA 5COQA 3MG9A 3VHXA 2WF7A 4UNSA 3MC1A 5DBEX 2EKPA 3ZQKA 3QMPA 5MF6A 3DLAA 3GH1A 1DBPA 1RAAA 4R1TA 4WZAB 1U0RA 3GUZA 1RHJA 1Y8QB 2HIMA 2P2ZA 5CYFA 4DCNA 1ZVJA 2DR3A 4RVGA 3ZK9A 1KI9A 5JDCA 2ZIXA 4D8VA 3FMPB 1Z16A 3AV0B 3CB4A 1T34A 3HP4A 2DG2A 1JPJA 1TIPA 4IIFA 2AMYA 2ZIFA 2ZSBA 1G7RA 1IXZA 1D2EA 2Z6VA 5GONB 1NXOA 1CT9A 4E33A 1OY1A 3QM1A 5JZ9A 4MVJD 4ZCSA 5JQGB 5IYPA 3VPAA 1QX3A 1VIYA 2REXB 2XT0A 3MINA 4DZRA 3O38A 4FNOA 3PDIA 1E9SA 4BBJA 1FUEA 5CIQA 4HAOA 2EGHA 4TT8A 2BCEA 1BEZA 2TMGA 1RXVA 4R1QA 4N5HX 2PX2A 4LSWA 2PJUA 2PUVA 4F5YA 4KBYA 4PO3X 1QG4A 2BFDA 2P4SA 1OI4A 3D1JA 3RJMA 4B3HA 1L7XA 4IO0A 5I9SA 2DIEA 3N0RA 1M10A 2AR7A 2XXJA 4UUBA 3ZI7A 1ZIYA 4ZP1A 1Y48E 3JD1A 4LRYA 2HHCA 2VSOA 4O4JA 5BMVF 4P86A 4P3KA 3FBTA 2OORA 3LHFA 4OHRA 3UK0A 3CVYA 4GPTA 4I1RA 1L5KA 3AX6A 1NWHA 4H3KB 3CRNA 3UA4A 1ARZA 2EX4A 1W93A 3K5IA 5F76A 3A6GA 2FPOA 5HZMA 4TVKA 2P0AA 2FZWA 2W6PA 1EQ2A 1EVJA 1SBTA 1WO8A 2XNKA 4INAA 4RTPA 3FZEA 3QBVA 2Q50A 1N8TA 4Z2YA 1BZYA 5AO9A 1SG0A 4CKEB 2DPHA 1ZICA 4CXMA 1T4DA 2FNAA 3PHBE 3PZRA 5CG1A 3MGKA 3AINA 3TW8B 4UDOA 2OBYA 5HRAA 1TEVA 3D31A 2DX7A 1PKVA 2AOUB 3DDOA 4M7RA 1VE6A 4FE4A 4GVLA 4PIPA 4ZGQB 7GPBA 2H5IA 1E59A 5KDOA 4RQBA 1MC5A 1SXGA 3ND8A 3CTMA 3I83A 4KG7A 3WNVA 1QFZA 2QAJA 1RQLA 4YP9A 1VHTA 1ZVKA 2IS4A 2CYBA 3TIGA 1RI3A 4A4DA 4X8MA 4RF3A 1QZ3A 1PKEA 2FW1A 4YACA 2BMFA 2YWRA 2VYVD 3AVQA 3F47A 4RHUA 4RLQA 3ANMA 3YASA 4WEOA 1S2OA 4D0NA 4FU0A 4Q1BA 3NEPX 1W85B 4JELA 5AJXA 1F17A 1T3HA 3OLQA 3L8MA 3EXHC 4IEIA 5JH7F 1XNQB 5H1YA 4XNFA 4JGGA 5BN4B 1Z83A 2QPOA 4M0EA 2QN7A 1E2KA 3BF7A 5CX4A 4X1YB 3KBBA 3E5NA 3B89A 3ORRA 5CA1A 2CF4A 3HB9A 3UMSA 5FHRA 1VGQA 1M76A 1RM0A 5F35A 4M0DA 5K45A 4ACBA 1FPQA 4P3IA 5KHAA 5BRAA 2YWFA 1EUCA 2C2GA 4WA8A 5C8YB 2YNMA 2CJXA 4JLJA 3VKFA 3A04A 1BO6A 7REQA 1UBEA 1L5QA 2GT1A 3GUVA 5A4FS 4H1UA 5LZ7A 1B73A 3OOHA 3F9RA 5ICSA 1UPXA 2PXHA 4FOLA 2Z04A 1V37A 3NCTA 1PVVA 2PG3A 2XJ4A 3FSRA 4JNCA 2WZBA 4BWFB 2EZ8A 1H42A 1G3QA 3WQQA 5K3AA 3UYKA 1W48A 2FFJA 3LA8A 3SF0A 4NY1A 2GILA 2ZJ3A 1BVYF 4R8RA 2OZLB 5TQ0A 3TBFA 3FPBA 3A6KA 1JRLA 2FY8A 4IZOA 3H5AA 3T8YA 1XVLA 2R7AA 1Q1EA 1H2WA 1VJ0A 1F6DA 5BV1A 1MVLA 5JYDA 4UUAA 5HDQA 3MBOA 4Y0AA 3BH0A 4RD1A 4FIDA 4IYJA 4N49A 2OP1A 3RWBA 2LBPA 4J1NA 3WB0A 2WZPP 3RUCA 3WJ2A 1TM5E 3DR5A 4V0OA 2UVPA 2GHRA 1V1MB 4RM0A 5A9TA 1KRHA 4FE7A 2ONJA 3T54A 4CODB 4G0VA 1F5NA 3RFTA 4NE9A 3OF3A 1X1DA 3Q9SA 5L45A 1CERA 1C3EA 3I2GA 3HP1A 3T7KA 4KFTA 3NHZA 1MNAA 5JMOA 4YQFA 2BAGA 1AN9A 3V3TA 4GG1A 2ZJ0A 2ZJYA 5I3CA 5JSFA 3V4SA 3QGMA 3SHTA 3WHKA 4IJMA 4D9KA 2ZSIA 4ER5A 3CKLA 3RUEA 5I01A 1Z12A 3EQ8A 1PGQA 2GAJA 1YS6A 2X9GA 4NCXA 1P75A 3BD9A 3C1OA 3ZWCA 1LNQA 3NTRA 4ZVSA 2VDNB 5HCUA 4XDYA 4IMIB 5BP7A 4UPDA 4EFDA 5IAAA 3U49A 1GZ6A 4DPMA 3OC6A 2A1IA 4DDVA 2FPXA 3L0ZA 1EESA 2AUTA 2SHKA 1SXJD 3GVJA 4EQ6B 5BSRA 5J47A 2KMLA 3T1VA 5BT8A 3RY8A 2H4WA 1T3ZA 2BZGA 2B4QA 3O4HA 3I72A 3JZFA 4JI0B 4AQ7A 4OLFA 4ATNA 3LO8A 2OD2A 1NY6A 2QORA 2R97A 5GGYA 3PKJA 1M2OA 2X19A 2GXSA 3WWPA 2FCAA 3B2QA 2OYCA 1DAIA 1O4WA 3NV9A 5C80A 4BLRA 1TK3A 3JU4A 2NZUG 1OT3A 4IKEA 1VHWA 2ZKIA 2NU7A 3RO7A 1B6SA 5EC8A 4KOEC 1FX0B 1RE0A 2AH5A 2BEWB 3MRVA 1RBYA 1Q0TA 4RW0A 2OWEA 3OM9A 1WQ1R 1F0KA 1KTVA 2D4HA 3KTOA 4OGLA 5CRIA 4NJEB 4RF5A 4PSVA 1WEHA 1XALA 4MHOA 2C61A 2DJ5A 3FBGA 5IC6A 2ZRIA 3Q7IA 2R84A 3L06A 4H77A 4M9CA 3W90A 3WYCA 4QUAA 1G3IA 2HDOA 4KAAA 2NO6A 1X92A 4NBNA 1L5VA 2HB6A 2DKNA 1GZHB 3G4SB 2DQKA 3LDAA 2PL3A 2Q5FA 3DA8A 1C2YA 3OCZA 4GGPA 4JLAA 1CR1A 3UJ6A 4BNKA 5KS2A 4KPEC 2G72A 1WZNA 4WY2A 5TDHA 3SKBA 3QVGB 2YZGA 3SNKA 2GRAA 5I47A 2B7BA 2FVYA 3L0YA 4EX7A 3QWIA 4OP3A 3UHOA 5DU2A 1LV7A 4U7FA 1RWWA 3SEJA 1RVDA 1MEJA 3D3WA 4RQUA 1Y5LA 4OFWA 1P73A 3ZUGA 5DW3A 2ZWPA 4BP8A 1BC5A 1JHOA 1UKEA 2V6JA 4PQFA 3Q39A 2PPLA 4WKNA 4AL4A 4UFPA 1TZKA 4CIWA 1INLA 2IDKA 2IZ5A 2YS7A 3QNWA 3VH4A 2A1UB 2AN4A 4U2BA 1QG2A 4G5QA 4YA6A 1GUDA 5K0NA 1Q1NA 1KJZA 2O8EB 1J4AA 4IFEA 5F33A 1SQ5A 721PA 2LNDA 4OKIA 5ALDA 3VAAA 2CDRA 2GB4A 4O4LB 4FEEA 5FJIA 3RSQA 2MU1A 1RVV1 2Z4TA 1RI1A 5EG5A 3SC2A 2QMHA 3SFTA 2JASA 3UKOA 5A62A 3HEMA 2J4FA 4MUGA 5FI5A 1QHYA 1UKZA 3RS8A 3DZGA 4EMUA 1KORA 5G41A 5DM60 1VSVA 3B1KA 1CQIA 3G7UA 1L7BA 3DE0X 2PZFA 2XA1A 3BWYA 1W85A 1NRKA 3A10A 3LP5A 3T94A 4Q7QA 1L3BA 1N2IA 1ZUNB 1P2DA 1QV6A 2XNDD 4B2IA 1KNXA 1PDOA 3NDIA 4TN5A 4DJ5X 4DG8A 4AC9A 4RJ2A 4TX1A 2ZT5A 4QPDA 3OUTA 5LZ2A 3CUKA 2VK1A 1ZM7A 2DPMA 4S1NA 1NBOA 3NTXA 4QHTA 5AW4A 4XMYA 2R1ZA 4DC0A 4EEZA 1GG9A 2Y1EA 4HQLA 5M34A 4DEYA 1FIUA 2BMWA 2JCSA 1JEDA 1MA3A 4HNAA 4ZI7A 1E60A 1E1RA 2D2EA 3UHPA 3KKQA 1WP9A 1QGUA 1Q82D 2JI7A 4G25A 2IYWA 4RETA 5C7YA 4CUJA 5BQ5A 2GNPA 2XGGA 2PM8A 2HLPA 4F60A 2I80A 2PVPA 2ZSHA 3IBSA 1N1DA 4NZNA 3TIXB 3EY4A 2AFIA 1GCGA 1YFKA 3GJ0A 5HA5A 4CN8A 3I1FA 1QCYA 3GGPA 3VSCA 2W8BA 2CV2A 4Z1MA 3QVKA 4IIUA 3LE8A 1USVA 2YWGA 2JGMA 4KIWA 3GHHA 4E09A 3TW0A 1VZ2A 1XGKA 3QIAA 3AR7A 1Z4IA 3L3BA 3N05A 5KYWB 3K5HA 4IM7A 4OF4A 3WP0A 4DNPA 4YUYA 1IN8A 4NMXB 5DI9A 2KLHA 2ECOA 1XRQA 4P36A 2NQTA 5DH9A 1NB0A 4CMHA 4GVXA 1UQUA 1H8ED 3ZY3A 3F6PA 3D81A 1Z6PA 4IZIA 4LJ8A 3DF7A 3LLVA 4J2HA 1RSZA 2QEQA 1NF9A 2Z2XA 3IIMA 3KSMA 3R5FA 4Z3DA 5TSDA 2AMVA 2XCQA 1OI3A 2EQAA 2CFRA 3GDFA 4UTZA 3ROPA 4LXUA 2P5TB 4Y2QA 4ENQA 1MVOA 2WNIA 3RIXA 5HXBA 1ZW1A 1D2AA 3HCEA 4KMMA 1X38A 3RSGA 3NVKI 1HNZB 4Z4ZA 1QCCA 4Z4QA 1U4OA 1DEXA 2ZREA 5E9AA 4DCJA 1U8AA 1ZC3A 4MWGA 1TCCA 4KKUA 3IP5A 4U7GA 1I3NA 2MHCA 1XBTA 3E9YA 2ZR7A 5JZSA 1MX3A 1U65A 2X8JA 1T3SA 7MHTA 1SGWA 1UDRA 3GU3A 3NORA 1MX9A 2RHBA 2WP0A 4JJIA 1ZIOA 2PV7A 2D7JA 5IJAA 4XXHA 1ZJWA 3SAJA 2QYHA 4JU8A 1L8QA 3HSYA 4J76A 4ZDKA 5FOUA 2Z4RA 1JHQA 3CE9A 2ZI3A 4JLBA 1Z2NX 4R1OA 5D3MA 5DKFA 1HDYA 2UDPA 4UKDA 2OE2A 4Q0MA 2A5DA 1NBWB 2ZJ2A 5B7NA 2AN3A 1KO4A 2DQZA 4KQGA 1C8LA 2YVKA 4MQLA 4XM0A 4A5OA 1P60A 2FWNA 1T2CA 4OHFA 2B1GA 1PJZA 3GAZA 5J3OA 2OXEA 4MV4A 4G1BA 4YCJA 4OTZA 1A5TA 4GX1A 1AGYA 1OBHA 4XD7A 1PVDA 2WG1A 3I37X 1KZGB 2R4TA 4HZUB 2IXBA 3RTGA 5I7RA 2ZOSA 4ZANA 1ACMA 1B41A 3TQQA 3GVLA 4YELA 2QLBA 3L9WA 1XTZA 3R23A 4XQ9A 1XYGA 3TPCA 821PA 1ZRSA 3RIGA 3UJNA 1A9SA 4MB6A 2QYOA 2VJMA 3K8YA 4O4JF 1OC2A 4AY5A 5BMVA 2IBSA 2VRWA 1GG8A 1RRKA 5K0GA 4RADA 5EKDA 4LV6A 2FN7A 1OIVA 3HVUA 4C5AA 4EVRA 2R4UA 2C77A 3NH9A 4C5CA 2H1RA 3TH5A 3CNOA 2XBLA 4V0LA 1RJ9A 2Z83A 3R74A 4W9MC 1GRQA 2XH8A 2GQFA 5JNSA 3QITA 3AESA 2PA3A 4KHZA 2Q1WA 3T9CA 3Q8XB 2GCNA 4FONA 1B8UA 4RGVA 2P9QA 3LVRE 2OQVA 3VBEA 5H16A 3LT0A 3M2PA 1LW6E 4R7ZA 2V7WA 1V7PC 3DDSA 1J49A 1CUAA 1HY3A 2GD2A 4I1VA 2YZKA 3GLHB 1DRJA 3PFFA 1GPKA 1J9GA 5FUWA 3NUZA 4DK1A 2V7EA 2JLVA 3GVCA 1EDZA 4AICA 1R0WA 1CD5A 2O8FB 1K8YB 1KAQA 1LX7A 2AHOA 4JLSA 3VI3B 2K2QB 3VZBA 1VSQA 2V4ZA 4LYJA 4CMEC 2FMIA 2GKSA 3I5AA 2P91A 3IB6A 1RWOA 3L18A 3TIIA 2RH8A 4PINA 3BXPA 5T8KC 1ENZA 1QIEA 1YS2X 4BO5A 4YCAA 2XPCA 3WQRA 3ZGZA 3DCIA 5U4XA 4NZZA 1BU8A 2Q2OA 3IUJA 4BUCA 5B3JC 3HUFA 2QQ0A 1OVGA 2IBMA 3L79A 1ZK0A 1QOZA 1J0XO 3VNBA 2WU4A 4C2TA 2C3MA 2BJWA 5HK8A 4X92A 1A88A 3X43A 3T4EA 4MOWA 3LUKA 3KU1A 1YMQA 4YY3B 5J2UA 4ZGWA 1KFKB 1OWLA 2J5RA 2L69A 2ESRA 4V0KA 3I9V1 3AK4A 3L6OO 5B4UA 3DL0A 2D0DA 1UM9A 3CN7A 4PC3A 1D2MA 4XJSA 2H7CA 4B4DA 3G8DA 3R5KA 3K1TA 2PUWA 1RXUA 1NG1A 2PL5A 1NU8A 2ZRPA 3BQMB 3ETCA 5KCMA 1QUEA 1Z37A 4OQFA 3OZWA 2XMCA 1WIWA 5SZJA 2XZDA 3PPVA 4IRMA 2ZXHA 1PHRA 3VNRA 3VSBA 3ABZA 3OE1A 3IP9A 1XRMA 4NMMA 3AG5A 3K70D 4NZMA 2IIQA 2QU8A 1YS9A 2QUJA 3IELA 4G23A 2E1RA 4RL4A 5BNZA 6REQA 3QVGA 2UYCA 3Q6QA 1JHAA 1JS1X 3IEUA 2H85A 2X13A 4EARA 5EY5B 1CY7A 1PJLA 1J8MF 5T3YA 2JLQA 2FMUA 4F1JA 4QXQA 4UZUA 3HE3A 2P90A 4IVPA 5T4EA 3H65A 2ZTNA 2HT6A 4ZOCA 3PGJA 5K0LA 1JQDA 1WE2A 3GCWA 3CISA 2Q3HA 3QKWA 1JHMA 1PSZA 4DLPA 1ZMTA 4X00A 2QM7A 5BQXA 1S0UA 4JK3A 3AHGA 5AXAA 5CK5A 2RHGB 3C24A 3OU6A 3GSIA 1PX2A 1HDIA 4G0MA 3TPFA 2VT7A 4YO7A 5KMGB 2C9OA 3RJZA 2J3IA 4YUVA 3PIDA 1P62B 1E2IA 2Z9BA 4RNDB 1VQ7B 4V0SA 5B1IA 1PR0A 1SCBA 2B4KA 5K0BA 4NV0A 3FY4A 3TZLA 3BFJA 3I32A 3ISXA 2ACEA 2YJNA 3L7NA 3RYIB 2C2HA 1I3CA 3LX4A 3H19A 5J9FA 2JGDA 4HAIA 2JI6A 4RZUA 3BERA 5CIWA 5AK4A 4D0LB 1SZCA 2AJDA 2O0HA 1B0AA 1RD4A 2WWGA 5HKBA 1HL7A 2DBQA 2HU2A 2EZ9A 3ELDA 1RAFA 2A0WA 3QE2A 2VHZA 2BZ0A 2YV5A 4MUAA 4N8DA 5CVTA 1ZEJA 2CRVA 3OFJA 4L5CA 3ILXA 4P7GA 2NNLD 4G67A 3A6ZA 4HIZA 1DLIA 3AETB 4KWIA 1YKFA 3G8BA 2YUTA 1BDHA 4YAKA 2IZOA 2REQB 2ZYSA 3DD1A 4Z7JA 5THXA 4U2DA 3LLCA 1CUYA 3MXTA 4F8EA 5KSOA 4WKCA 3WGNA 4FMDB 4P3PA 2NUPA 2VP2A 3BXEA 3W7AA 4JMPA 4CU5A 4WA7A 1WSAA 5JZMA 2I1VB 3OSZA 1QHEA 3AIIA 5GM1A 2NV6A 4M76B 4XFJA 2VBTA 5KVVA 4WLUA 1AVTA 4LQDA 1G18A 5KAMA 2BF4A 5CD9A 2ZZQA 5JVDA 2V65A 1CETA 1ZOIA 1QOPB 4KMSA 5CUQA 4UU1A 1NN5A 1ZJJA 1T0JB 4QUZA 3AKYA 3L0DA 3WFJA 4EL0A 1PSWA 2VZEA 1SU4A 3DLPX 3P71T 1H93A 4MWEA 3PEYA 1U7TA 2HOQA 3GFRA 1AN0A 3F7MA 4MROA 5DHPA 5SYAA 1ZD8A 4OD0A 2WJ6A 4ZCRA 1KI6A 2P41A 2A30A 3GMSA 3HA7A 2GD0A 2JC3A 2PRSA 3DHNA 1V95A 1EM8A 4O4HF 4OHXA 2Q7OE 3GAMA 1C4OA 3CTAA 1MB0A 3NHSA 4HAUA 4LJ9A 3RAJA 3SZUA 3WSVA 4DARA 4BO4A 3V8QA 3H1GA 4LVNA 5DP1A 5LZ4A 1CQWA 3OPNA 1UOEA 4J6FA 4FFOA 4CM9A 2GCGA 1YR6A 3IJRA 3UXMA 2CFCA 3I5MA 4CLRA 4MWCA 1NVXQ 4WKGA 2GVZC 3K2IA 4PYQA 2VEDA 3ZVRA 1U8YA 2JA1A 4D6XA 1RAEA 3UXYA 4NZOA 4G1UC 5HWSA 3UXHA 3LFHA 1SOAA 4KXXA 3G9ZA 1WBJB 4FCCA 1DNPA 4URHA 1PT5A 2FRVA 4JI2B 1WA5A 4AG6A 5JCZA 2ZYHA 1TCVA 1GADO 2FG7C 1F0NA 2I3DA 3I53A 4N01A 1GAQA 3GJ8A 4GWLA 2ZBUA 1BTOA 4NRDA 3RSLA 1I7NA 3H0KA 4MYRA 4DQKA 1QP0A 5HZHA 3WTBA 4ENRA 2DPLA 1R8SA 2AQKA 3K1AA 4LBVA 3OLZA 4GMXA 3RK4A 3A9VA 3E9QA 1D6NA 2UVDA 2CJPA 3I2JA 4M7WA 1W5SA 2IE0A 3WLKX 3RYFA 2P2GA 1DTWB 3HU1A 1Y9JA 2NNWB 5JAQA 5BYBA 3L41A 3SGLA 3WJ7A 1GTG1 1SOMA 3BFVA 4IS2A 3M5PA 4GPIB 4DOMA 1RT9A 4RHFA 1K8RA 3TUZC 3VFDA 3N2NA 5ALHA 2VAPA 1SCQA 3KQVA 3JQFA 1TADA 2UZ1B 2GHTA 1D2CA 2B21A 3DHEA 4M8LA 3I45A 4OL9A 5E4JA 3CINA 4XOTA 3L2OB 4F1WA 5LB2A 1XLWA 1FQKA 1BXRA 1M1KD 1DAPA 4JVSB 2PS3A 3L1IA 5TPZD 4HY3A 4IINA 2YHIB 3ASVA 3DOEA 4MR8A 4N39A 3B6ZA 4L51A 4P35A 4ROXA 2HA7A 2XYQA 1PL6A 3HNPA 2VSYA 4Q7EA 2AZDA 5C0OE 1WZ2A 1U7DA 3MCWA 3ZJ4A 1KRXA 2XUZA 1NJ1A 3KZNA 3NWPA 5KTNA 1Y1KE 1MAWA 1H8HA 1DOZA 3ZHQA 5EJ4A 3VA7A 4NESA 4ARZA 2E1BA 4WCVA 5LQSA 3K8QA 3P94A 1GRNA 4DCSA 3SLKA 4IQ8A 4DIFA 4JI8B 5B5SA 2I6TA 1E7RA 1S7GA 4LQLA 4CWAA 4I9GA 1YDEA 2SICE 1CZLA 3ONUA 1H2EA 3I2KA 3D7MA 4G5SA 4CVNA 1UIMA 2REBA 4XGNA 1X3SA 5ICFA 5ITZA 4PO8A 4Y30A 4EG6A 5IANA 1VJGA 4CT4B 1DJQA 4D0SA 4EGSA 2WINI 4LPSA 2J7PA 1KI1A 1IATA 4UEOA 1Y1SA 5CM9C 2JFUA 1G9SA 3CLKA 2FG6C 5KNCH 4OVKA 3ZZ0A 5IKMA 3W8NA 2YIDA 2OPBA 3JYHA 4O2BB 5CLIA 2D7DA 4BZQA 3WWDA 2Z4SA 3HVJA 3ZD9A 4B31A 7MDHA 4DQLA 4KVFA 2I9KA 1D5CA 1W46A 3DJFA 4OREX 2I3GA 2OB1A 3CCUB 1E1CB 1NXSA 3IVAA 4ND4A 1OLUB 4UBMA 5A7GA 4E4YA 1IMJA 5I48A 4WACA 5CFQA 4LY9A 4X7RA 2N3ZA 1YDGA 3NBFA 4D80A 2ORED 2WMOB 421PA 3OPOA 5HG0A 2BBSA 4B48A 2PSHA 2C8VA 4ZYTA 3GLGA 2Q5JA 2IPLA 2D00A 4YRCA 1NW5A 2J0VA 2Q4EA 3I9JA 2WSSA 3FBWA 1WZEA 3PC8C 5CCXA 3CNNA 1TKRA 2Q3LA 5K3OA 2FPLA 2DSNA 3UXEA 4D98A 2DPYA 1DUSA 4CN9A 3KVRA 3SWWA 1TO1E 2D2FA 4ZARA 5JQWA 1VG8A 3C3JA 4ZV4A 3GP5A 8MHTA 4RLHA 3EAFA 1NUUA 1GQFA 3KKLA 2BGJA 5ILQA 3U09A 3DH0A 3BQ9A 5EMKA 1MORA 4BPRA 5JYEA 2L17A 3ET5A 4YQZA 1XMQB 2JPDA 6LDHA 3TOZA 1YQTA 2ONYA 4BWYA 5JEDA 1T4GA 1JFTA 4QT4A 3WC4A 4HSGA 3JARB 1UQTA 2QNBA 1CUEA 1ZOLA 1LJUA 1VBFA 4OXXA 1VYHA 4IXNA 4W8OA 4EPXA 1JDNA 1FNSA 4F5EA 1XAGA 2R48A 1R0ZA 1BOOA 2WM2A 5ARDA 1PUJA 1BWPA 4CKBB 3UNXA 2HA2A 4LG1A 4LDAA 3PGMA 3WGHA 4LJRA 3LHDA 1V11A 2CBGA 2C9BA 2PZEA 3EIEA 1N33B 1Z2OX 2P7HA 4Z54A 4HJXA 1BFUA 3JQAD 3ON5A 4N5DA 4OATA 3LCMA 1FJ2A 2GRJA 2HX1A 3CPJB 4UZSA 1FQJA 3DUWA 2O54A 3GRPA 5FLYA 4BRZA 3SP1A 4F4DA 1E61A 1FSZA 1ZC4A 3PVDA 4LTMA 4ZYLA 4PSCA 4WE3A 1SPXA 4KO8A 4AY2A 5A02A 4Y9DA 3E1GA 4TLLB 5FNVA 3FLAA 2EKQA 3BWCA 5JWRA 1E2BA 1UBJS 2YC4C 4U8GA 5HXAA 5DTEA 1NDHA 3TI9A 1OB2A 1U0JA 3A1EA 1TVMA 1Z4MA 4K6CA 4Y1RB 3JPYA 3STXA 1UKCA 2R65A 1E96A 2VPZA 3C8DA 4ZZ0A 1EFUA 2ZRFA 4KGVA 1AY0A 5IKOA 4BJ3A 2QXTA 2XQJA 3OIWA 1KOLA 5EMJA 4MITA 4PZYA 4XDZA 2AZMA 4MQFA 3AO0B 3ROMA 3GRUA 5A9SA 5CPFA 5JUWA 4TYNA 2X8AA 1HKHA 3NBYC 1VQ1A 2QG6A 4JDUA 2QR3A 3EOBI 1G2OA 2CF5A 1SCUA 2QZPA 2DPXA 2QHXA 2ZWVA 4IVRA 4N9WA 5KSPA 4Q01A 1WR8A 2AW3A 4JA2A 1PW5A 1KK2A 4E5YA 1S3SA 1WHTA 2Q5IA 1DJNA 3M6AA 4YYZA 5JSZA 1YRLA 2F3SA 4EI7A 1K8QA 3JY6A 1H6AA 4IIJF 1PJ4A 1KJIA 3F7OA 5TGZA 4JI6B 4ENPA 1I6LA 1U98A 1XMJA 1Q7YD 2ID9A 1WY7A 2ZRBA 1O96B 3U6BA 1O0SA 2QBYB 4DCMA 4U3JA 5JS6A 4RMIA 5BR4A 1D4OA 2J31A 2QL6A 1ZJ6A 2R96A 4KTTE 3CX6A 2GJ8A 3D6HA 5EWLB 5AM2A 2HQ1A 1A8SA 2R00C 2QRMA 2GDJA 3CKYA 3HCAA 3JQ8B 5KNDH 4S05A 3MXOA 5KKNB 2KHZA 5EWLA 1T26A 4RA9B 1C3OA 5HFJA 3SHFA 3LZDA 2JHGA 2ZL7A 4PQRA 5TIIA 1S5PA 4CMBA 4MGZR 3EK2A 1LJ8A 3IO5A 1TAHA 1A8QA 2FN3A 4XKJA 4UM9B 1ISJA 2GBPA 2H48A 4MW2A 2UXCB 4EUSA 1MDBA 1RRFA 4KV9A 4RVOA 4EB6A 2ZSDA 1GNLA 4DB4A 3FUXA 1OXKB 1R10A 4X7BA 4JB2A 2JLZA 1W76A 3I56B 1KFJB 2HGSA 3OJXA 1RLJA 2VKQA 2VN8A 2CL6X 3ZHUA 3MUFA 2GREA 5HBRA 3U9LA 3IVRA 2WV7A 3ZGLA 4OHMA 1QQAA 4K6OA 1B2LA 3O1IC 3WV5A 4TTAA 4MTLA 1VQPB 2HIAA 1C80A 4R01A 4TUYB 3GYGA 4NV3A 4BNWA 3RBAA 1QHSA 1T4BA 2ATIA 5IKXA 3O90A 5IDWA 4YP7A 2OLKA 4ZU1X 1XMOB 2XYPA 3F5DA 1NVTA 3FNBA 2R60A 1P5HA 1ZMRA 1OREA 5DLPA 4FYWA 4DIOA 4UHBA 4OUDA 4UQLA 3GVHA 1SKMA 2JCBA 3FKSD 1ID8A 1L5YA 2FSIA 3WGGA 3BPSA 4CM5A 3ZWPA 2VJPA 3AL3A 4A6XA 3GVPA 5CA0A 4EG8A 1J00A 4DLKA 1M8JA 1QPBA 3IQIX 1MJHA 4FSXA 4BWVA 2VCEA 4ZAVA 3INGA 5JS8A 4ESVA 4BQSA 3UOGA 2Q2QA 3WRYC 2RAFA 3PD0A 2EYQA 2IYTA 4Z4EA 4KQ9A 5EQDA 3VC1A 1XXHA 5JLAA 2PWAA 3OKPA 2FHPA 1PKXA 3WB1A 1N5DA 2B2XA 3QV1A 3W8FA 3GCGA 2Y68A 4MW9A 2WD8A 3VO9A 4JHLA 3TB4A 3LDGA 1XJ0A 4NDNE 1WCXA 4J2TA 1KZ6A 2VYCA 3T9FA 4P31A 1FP4B 2JN9A 2FWBA 4HE5A 2YR0A 3EGOA 5EUBA 3TOXA 1SC4A 1YAJA 4KQWA 3ZOZA 1ZHHA 1Z6ZA 3ZU4A 5DWDA 1J2TA 2NO1A 4G4SO 3QRWA 2DU8A 2F48A 4AUEA 2FSGA 5FWXA 3WYAA 1WMEA 1SBCA 3IUMA 5EJ7A 3K5WA 1JYEA 1F7VA 5FWYA 4FXPA 1XWIA 3KHUA 3AFNA 3LOUA 1QHFA 1TO2E 5IYQA 3CEHA 3OH8A 3P9NA 4M0LA 2HREA 4MUKA 4NOLA 4WBSA 4X3CA 4Z0NA 3JQFC 3L1VA 4B4VA 3O26A 4KU4A 5TS2A 4XJTA 2EBUA 3CNEA 3IRUA 3IKLA 4J1SA 4LRXA 5T67A 4B3IA 1FMCA 1OLSA 4X62B 3WBJA 1I1NA 3K20A 2ODEA 3WSTA 1GFIA 5D6NA 4D56A 3FGOA 1QX4A 2YRFA 5CH3A 1O89A 2WU8A 5I8WA 4A8JC 5FBLB 1ZD2P 4Q39A 4LX0A 1KEPA 2IVFA 3JQ8A 4LRQA 1OBVA 2I4TA 3DOFA 1Z7YA 1X87A 2X8JB 1KJQA 2C5EA 3DVQX 3GBVA 4P7BA 1CDDA 3KOYA 2X5NA 1ZP6A 4NCHA 3Q8KA 1OH8A 1FYXA 1FQOA 1EZ1A 1E66A 1KY5A 1KDZA 1XZIA 3O03A 4RVHA 4UNPA 4UZFA 1M1YB 1XD2A 2XB4A 3N2YA 4KJXA 3U3ZA 1ZIDA 5IT4A 4LF7B 4V0QA 1Q0ZA 4FTWA 3G02A 2K2WA 4GGOA 2IPMA 3JZIA 1OAOC 2ZSFA 5HF5A 4R2HA 5FOTA 1ML4A 2YZ2A 4HAVA 4E5MA 1G9TA 2DY0A 2MSCB 1S1MA 1QRSA 5SYNA 2BEUA 4YHBA 5H3LA 3SZOA 1TKCA 3UCEA 4FFBA 2XF8A 4XKWA 2CHEA 4BECA 4DJAA 3ZJUA 1YRQA 2BFFA 2YFYA 1YJ8A 5GINE 4EZBA 1J97A 1RKUA 3UEOA 2ZPTX 4JUCA 1J2JA 5L3RA 5FT9A 1C30B 4C4ZA 3WYEA 5KOIA 2JVKA 3K05A 3NFYA 4WSOA 3PFIA 2ZCJA 3ZDAA 4LDQA 2OAP1 1XJWA 1DKPA 2RH5A 2ZIGA 3LT1A 1X42A 2C07A 2HK7A 4JS0A 4PNHA 5FLEX 3CCMB 3ZQUA 4RDHA 3PJDA 4GSLA 4XN0A 1LEHA 1I80A 2VNSA 1CB7A 1TQHA 4HWTA 4ZCIA 2FW9A 3D3NA 4F9TA 5K0SA 2C0PA 4HUQB 4X60A 5JCJD 4M9ZA 4PHFA 4YR9A 1SXPA 3X1WA 2XNDA 4JLVA 3CH6A 3MFYA 2B7LA 5WRFA 3G89A 4FMCB 3NR2A 2FPUA 1L8AA 1NW9B 2W2MA 2Y66A 4J7CA 5C8XA 1EIWA 1UBNA 1WW3A 3P32A 3PB3A 2YN4A 4KAFA 5EXXA 3U7IA 2F43A 3W06A 1FJXA 3H9BA 2OBXA 2WOJA 3N70A 4HH3C 5K3CA 4Z4IA 3H6KA 1C9MA 3IPYA 1YHQB 1F2UA 1W94A 1A9ZA 2DECA 2HL6A 1YHNA 3MQFA 1CUFA 4TL7A 5DS0A 3VX4A 4H0NA 4A82A 4MPDA 3HEBA 3PNQA 4KQMA 5JPIA 1EX1A 5AXBA 3TDNA 1HV8A 2QUZA 3IT1A 5AVJA 5T4HA 4B6JA 5MDHA 4BHTA 4PZZA 5FR2A 3UB3A 2XADA 1Q2XA 3TEJA 4PPNA 4C78A 3UMRA 5C32A 4IDEA 2RI0A 4WLVA 5K7SA 2Y1LA 3GIWA 4FFNA 5HEKA 1KQ3A 1YHZA 1TC1A 3JU3A 1S2NA 1KEWA 1NL3A 4RMHA 2FR8C 3I6YA 3F8TA 2CL7X 2H3EA 1G8HA 2NSYA 4WOKA 4EMBA 1Y33E 5IXJA 1ZSNA 1XYVA 3WGVA 4GRIA 4H6VA 2EZUA 1HNXB 1B93A 3RPEA 2QLTA 2QW8A 3IEXA 1FS6A 3CIFA 1I33A 4IW3B 1SVSA 2L18A 1L5LA 2Z1NA 4EPWA 4ZA2A 4TZ6A 4JASB 2MSEB 4RO0A 1G8GA 1M6YA 1SCIA 4DW8A 2A9FA 4G3XA 1FW8A 2P2SA 5EJ8A 3IDFA 2ZTVA 3AJ9A 3P9KA 3VZPA 3WIUA 2QGNA 4R9VA 3G0BA 5E4TA 2O3RA 1KZ9A 4D3ZA 2C7RA 1WXHA 3ZE8A 5EWJB 5D1HA 1HX7A 2HO4A 3U4IA 3NBUA 1QKKA 2VWPA 2LDXA 2A0XA 4L72A 3GIRA 3LA6A 4PZAA 3ABQB 4NG4A 3IQZA 2P2LA 2WJAA 5IFKA 1EP3B 1G2PA 3AHEA 4B2YA 4Z5XA 1B3RA 1DCFA 1YR2A 5IUNC 1JDTA 3RVQA 3QBJA 2Y71A 3UJ8A 1QR6A 4FNGA 1CW2B 1XQVA 4PEVA 4PSKA 3IMEA 3SSNA 1CLUA 2CLMB 1NLYA 1YRWA 4G4IA 4TTIA 4G1FA 4H1TA 3ZW7A 1DSSG 2HY7A 1QG0A 2ZVDA 2FG5A 3DP9A 2WUVA 3LX8A 3R3WA 5A9RA 3HKCB 3X44A 3TTXA 4BLPA 2X58A 5KWJA 4WINA 2JLCA 1PWEA 2HLHA 1IPEA 3AF1A 3GFGA 4RM2A 3WB2A 4XI9A 1S2LA 5AM1A 5BN1A 3I52A 4Q3AA 5EJ2A 5KQSA 4BIMA 4V1CI 3EDYA 2ZQZA 3N8IA 2ZIVB 1XVTA 5K6TA 4TV9B 1WSWA 2P68A 3DW3X 4X7EA 3CZMA 4IFTA 1PK9A 3WMRA 1NIJA 1IU9A 1LPAB 3CV3A 1VL2A 2NUPB 4KO2S 3VC3A 5KTTA 3CWZA 3OEYA 2IUTA 1LWNA 4AJOA 1Y4ZA 3E9MA 1DARA 2GF0A 5T5QA 3PTZA 5IJXA 4UBJA 4OKSA 2ACVA 5DZSA 4LWPA 3QVSA 1EH5A 1N77A 1GZVA 1O95C 1O9GA 2OFOA 1SCDA 1EVZA 1XVUA 1RXSA 4OQQA 5KVQA 1YLOA 4C4RA 1Y3FE 1Z5OA 3IBTA 2NVUB 5ADUS 3FWNA 2C2XA 1L4NA 3ZXSA 3WLSA 2GD1O 2XXAA 2LPMA 2KM1A 1Z82A 2BIFA 2IDJA 4BLOA 3CJQA 3HJNA 3U39A 3LC1O 3ZDRA 1X7GA 4IMRA 1QG6A 1UAGA 1U9JA 3O91A 1BW9A 4FXOA 2N9UA 4CGZA 2W6IA 1YDHA 3B82A 1ZUWA 2OOKA 4W4TA 2ATVA 2WTUA 1TE2A 2W11A 4RZQA 2V59A 2M6KA 1G1AA 1I2BA 1JILA 3ZE2B 2IKQA 2WICA 3HYCA 3KEQA 4Z4CA 3CPSA 3QSYA 4DWJA 6GPBA 3IAFA 4I50A 2FQXA 3BYZA 2F59A 3OQIB 1PV4A 1R5BA 2QUHA 3JQ7A 2QSYA 2IHVA 2Q5LA 4K8RB 2QRPA 3HKEA 3TAXA 4JI3B 1WX1A 3QNUA 5DYYA 4TMWA 3CRQA 3DMYA 1O5OA 4WV3A 3RVPA 2KVOA 4TV9A 5C4IA 2R11A 2AIRA 4QYTA 4RFSB 5EUCA 3DONA 3H8VA 3ZV5A 5JNLA 1TEZA 1SQ0A 2QX8A 4ZVUA 3BHIA 1GYPA 3A31A 2F3RA 2CK3D 4F2GA 3D4BA 4E2YA 1IY9A 2FQ1A 1QHGA 1ZRHA 4FMPA 4MDEA 2FP4B 3SMQA 3WKEA 4BNHA 1GFZA 2PZGA 3DVLA 4OGKA 1NNSA 5E3HA 1IXRC 1CFJA 4CEJA 1XC7A 4HXGA 4AZ3B 4R4JA 4RVSA 1NMXA 1VQ4B 2NV0A 4EG7A 1XDGA 1ECJA 4XWKA 2GM4A 4WKPA 4FLFA 1ZKDA 1ZS9A 5HILA 3W3ZB 5BN3B 1WSBA 2J3EA 5K2OA 1B26A 2Z30A 2XDAA 3HC7A 2ZRJA 2W8ZA 4EL5A 1QRUA 2GYVA 3BMQB 5KWIA 2VSNA 1DKLA 4CTJA 1OI2A 1P6XA 2DEUA 3KV1A 1W2WB 3CX7A 2OY0A 2OKGA 3REFA 2O8BB 1YR3A 3H0CA 5JIBA 1R0RE 4QYXA 1M6EX 4KE8A 4UD2A 3D6NB 5D85A 1TDJA 1MHPA 4L2IB 3A1DA 4ISBA 4TT3D 5JSYA 1JAXA 3F90A 3GO4A 3E3MA 1K08A 5G0SA 1CDZA 2HMUA 2ID4A 1NM5A 3UANA 4TMYA 5REQA 1JAZA 3B3QA 5AT1A 5FTMA 5HFNA 2O4UX 4BAUA 4EENA 5C5CA 2R1UA 2FWIA 3I2YX 3IP8A 1G4HA 2NQ8A 4KR3A 1TIBA 3QKRB 4KYIB 1YB1A 4M36A 3U4AA 3QBTA 3LPMA 4G5HA 1IAQA 3G59A 2I2DA 2PQMA 5HMLA 2D5AA 5AVZA 1LRJA 4IIVA 3GJYA 1SXJB 1ZXLA 5KOYA 5K0CA 1XNHA 1LPOA 5EHNA 3F9IA 3LUBA 5CITA 4PYMA 5BYJA 1E3SA 4DFDA 3CUWA 1YZLA 4H2DA 5JH7B 1HFJA 5HQJA 1E1MA 2X0JA 5KTRA 2OV2A 4FWTA 1UPUA 1V2GA 4IO1A 1SKQA 1SZDA 1N9GA 4IDFA 3HNRA 4RM3A 5DOVA 4I5DA 1Q14A 1F2UB 5CNKA 4BAGA 1WKVA 4HEQA 2I6UA 4UU7A 4XEHA 3C5HA 4AJ2A 4C01A 5AH0A 1CR4A 4FJ1A 4HV4A 2HPHA 5LB4A 1J2UA 2PKRA 2VRBA 3QOFA 3EAQA 2Y1CA 5IDYA 1GRVA 3LBIA 3PHLA 3I5YA 4E5NA 4RF4A 5ITVA 4JQZA 4ARVA 2HMTA 3NKVA 2I4IA 1DBWA 3NHBA 4LPKA 4OFBA 4W7SA 1X8XA 1LK0A 3KJXA 2R6HA 3SS9X 1HYBA 3LSTA 3EXAA 5AKJA 1FEZA 4F92B 2RH4A 1RLTA 3X3HA 4BNYA 3A3GA 3HYRA 5KNCA 3GEGA 3SYMA 1XZAA 2FPIA 3GEEA 3LY8A 3R7WA 3WK8A 2QRGA 1GSIA 4MKGA 5CT5A 3KQUA 4FR2A 1XTTA 1XZ8A 2HSEA 4G8CA 4ND5A 5TE9A 3AR3A 3EGXB 4CJXA 2NO0A 1DX4A 1GPJA 4IGFA 4Q9JA 3R8CA 4YYEA 4JBIA 3C3EA 2GZDA 1DAOA 4BO8A 5IHPA 1CVLA 2ERYA 2G08A 3IV6A 3ONFA 3FZYA 2YCLA 1EFHA 4MDHA 2Q7XA 3A3BA 5F2EA 2YDXA 4L73A 4YXWA 1GJRA 1K2WA 2ISCA 4E5SA 5DXJA 1X1CA 3AL0C 2GWHA 3RQIA 3FGZA 2E18A 3T3PB 1C41A 2VWQA 3NUGA 5I9TA 3AY0A 4DDKA 5KYYA 5JU6A 1KU6A 1SUSA 2OILA 3FPEA 4OFZA 4R54A 3I0NA 1C0LA 1V9CA 5JNWA 5JQGA 4BO2A 2ZIAA 1QVFB 1NJGA 3JZAA 1JXAA 1F1BA 1Y8RA 2I76A 5KYVA 1J8QA 4DSTA 1U4SA 3E2MA 2GLUA 2CFOA 4FIZA 4GLOA 4M46A 4MQ4A 5FTWA 3HDQA 3RNLA 4R0MA 3K94A 4ESEA 4DV2B 2QN6A 2BJVA 3OHMA 4I6JA 4MW5A 2YASA 2H92A 4YI5A 2AOXA 3OT5A 2WM8A 1QIJA 4M86A 5F4JA 1IM5A 1U1DA 4QOEA 5L3QA 4X8IA 1EUZA 3AUFA 1B2RA 3DM5A 1T5TA 4LIPD 2APJA 3M6VA 4G9EA 2GPWA 1FTGA 4ZVTA 3G9TA 4MGKR 1U9CA 2SECE 1T8YA 1M7GA 2H2DA 2W6QA 3D8TA 3CQ9A 4FYHA 4ZOAA 4RTSA 2VTBA 2GF2A 2ZVJA 3MJRA 4I14A 1F7UA 3RRJA 1GR1A 1AQUA 1N2OA 4OJQA 1F6BA 2FSVA 5K3SA 3W5AA 2DR2A 4HX5A 2OBLA 4J2OA 4Q82A 1J1IA 5JXJA 5KUTA 1GG2A 1YZGA 3LM8A 1EGAA 2Z2JA 1E2GA 2QXYA 2RI1A 3KUXA 1VPVA 1YZTA 1ZBQA 2RHDA 1UP6A 3CCCA 2H07A 4G63A 2WWHA 4ENTA 3OEED 1F0YA 1YQUA 2M1ZA 3KCQA 2JFWA 1W0JA 1WSVA 5CAEA 2Y93A 3BH7A 3P9SA 4LN1A 3MMZA 4OQLA 5IW8A 3FYTA 4MAAA 4GZ3A 3K5PA 3EIQA 5JYBA 1Y4SA 3SLGA 3COPA 3OIFA 2Q2WA 4D0GA 3S68A 1E2UA 2GVNA 4D1YA 4TL9A 1ZUHA 3K96A 3PQ2A 2CNKA 3U9TA 3DW1X 2QOEA 3MMXA 4IMPA 1DIBA 2JBHA 4RZ2A 1TVKA 1GM5A 4HN2A 1Z3IX 3VU1A 4A92A 4W8HA 2VHYA 5E3JA 3TLYA 4OQDA 1E99A 4Y2GA 2IEAA 1E77A 4Q16A 4UTXA 2HNKA 2JJ2A 2AE1A 3JS5A 2AK3A 2GI4A 1WUYA 4ETWA 4MCIA 2DHDA 1WXXA 4E3WA 1T1RA 1EE2A 3T7EA 4FYPA 1TCAA 5LZ5A 3S99A 4GQIA 1TQDA 2V7PA 1LNSA 1LC3A 3B38A 3QU7A 3B7GA 3KKEA 1ZN9A 3KJNA 4PYNA 2NGRA 1LDMA 3U13A 2DFNA 4WNAB 5FEMA 2PZAA 1Q22A 4B5KA 1Q84A 1JYFA 2RHRA 5TQVA 3IAXA 3V7YA 3SYNA 1MQ8B 4C14A 4TXJA 1GTJ1 4I99A 4MQBA 1J0CA 2H6EA 3SC2B 2VVTA 4FK8A 3O21A 3HBLA 5I3ZA 4YR7A 1ADBA 2XT9A 8GPBA 1EG2A 2BGLA 1IIRA 5F21A 5IBPA 1PJCA 1NC1A 1PJ8A 1WCIB 3ZLTA 1OX4B 4PHCA 1UMKA 2HJGA 2PWYA 4N6GA 5LLDA 1AB6A 2Q46A 1W9HA 3VR0A 5DFAA 1A3CA 1RHKA 3A28A 2BFEB 3S5UA 4PABA 2VBVA 3ETGA 5CB6A 1QLJA 1ORWA 1BOFA 2VXCA 1W5BA 1OLSB 3JQ9A 2P9CA 3OZFA 4TOIA 4XJXA 2EBFX 3EH1A 1QYVA 5EKXA 4X6YA 3M6IA 1QO7A 1SBZA 3UTDA 2JGFA 1KMNA 4FEYA 1LPNA 5IT5A 1JXOA 1ADCA 3ZKWB 4GKAA 3BD6A 4M38A 3SXJA 1Q1ZA 3QW4B 1QFSA 1D6MA 1Q11A 2IIVA 2ZJ5A 2QI9C 2PX4A 4I5GA 1U3CA 1CUSA 1P6UA 3WBKA 3IPRA 4JC4A 4MX8A 2QRVB 4PPQA 1L5ZA 2WT8A 4GMHA 1R6XA 2O57A 2G77B 2V31A 4O1MA 5TS3A 3RRMA 4GQNA 4BO3A 5EJEA 5FUVA 2PKQP 2XVYA 1YVRA 4MWTA 3PT9A 5LA6A 2ILTA 3Q3VA 4FGSA 3KE8A 4J3JA 1CYDA 2DP4E 2PL9A 1BHQ1 4KUGA 3PK0A 4TMVA 2DOKA 4AROA 3QV2A 4LV8B 4IDGA 2QMEA 1MMFB 1PUXA 3OP1A 4ZVVA 3SBDA 5BOSB 1RLIA 1X7WA 2I4NA 2IODA 1IBLB 1N32B 4URZR 1EUDB 2FP3A 1QIHA 2XNHA 3EFHA 2O6HA 4L7QA 1RWXA 2GS9A 5GJCA 1S96A 4K9DA 4US1R 5AKLA 1Y6GA 3EW9A 4OHKA 3IUBA 1R74A 4ZGGA 2D74A 1TYAE 2YCBA 4US0R 1NDQA 4RULA 5CA0B 4Q4JB 4QARA 2B82A 1UDCA 2JCXA 3Q85A 4CFZA 4YRPA 2N1MA 3K3PA 2P6OA 5SY4A 4DBLC 3NHPA 4AQDA 1QDLB 3H2BA 3RODA 4DY4A 3U7FB 1Z07A 2OB2A 5KX5A 1N36B 1U28C 3UW1A 4UEJA 4DMLA 5KEIA 5IABA 1MKYA 3PS9A 5E2AA 1LLFA 1WM1A 3EARA 5FNZA 1A4RA 1DWOA 2ZBEA 2COEA 3P2JA 3BHNA 4XLZA 5H70A 1KMHA 3RC1A 1GNPA 5K8VA 1KBZA 3HADA 4ZN6A 1G63A 1M1NB 3QU4A 4DM7A 3ZQ6A 3OKAA 2HF2A 4H27A 3FWKA 3IGFA 4LYAA 3ZGXA 5EHGA 1US8B 3C7CB 2YV3A 3H1BA 1BG6A 3KJQA 1JNYA 5LBTA 4XARA 5J3JA 1CQIB 3N2LA 3L7LA 3SF8B 1PG2A 2OSBA 1N8RD 3ADCA 3IA2A 3KQKA 1IYZA 5CHYA 1KWGA 5D2CA 4YRJA 2R1TB 3U4CA 4JL5A 5EPUA 4C6RA 3OZBA 2Y77A 3JALB 3O1HB 4FOTA 5AVYA 3D6MA 1P6QA 4N8SA 1OGIA 2K4MA 1A98A 3NV7A 4EEKA 3W9SA 3OOWA 4BMPB 3WRXA 3KQLA 3U44B 1A9QA 2PX5A 3H11A 4S0ZA 7ABPA 1F8GA 1L5FA 1POXA 2F8MA 3LNTA 4OHBA 2HEGA 2CLHB 2P75A 4GMGA 4BX2A 2ZT8A 5A0TA 4V0NA 5JD4A 4IILA 5EP2A 3KQNA 3EBLA 3EF3A 1TTQB 4LHWA 4EHNA 2OBRA 3P8ZA 2B0CA 2O6LA 3Q72A 4OP1A 1YK0A 3LBYA 1VKNA 3E8XA 4GKKB 1FK8A 1NPDA 2NADA 2FV8A 3COYA 1M2KA 2WI8A 4KKVA 3D7LA 3BBPA 1ACJA 5AKIA 3EZ7A 2GHIA 3NCHA 4LZNA 5ED4A 1DP4A 1HMYA 4B6QA 4WXPA 1GNRA 1U81A 2OC4A 4HEHA 1I1OA 1LF0A 1M67A 1W88A 2H17A 2V74B 2W6JD 3D8NA 2R00A 1AUQA 2ZSUA 4TM8A 4P3OA 2C88A 4RK7A 4K1LA 5ULLA 4Y2TA 3RT1A 5BWBA 4UBOA 3W4KA 3AJ8A 4HN4B 3AXTA 5L53A 4L3VA 3R2JA 1A7AA 1FE8A 1IK4A 2FZ4A 1ZI6A 2VJQA 4J43A 1I4TD 3PVCA 4PC7A 4LJYA 4QUGA 2FMTA 2MDTA 4BCCA 3ZR4B 1KD1D 4RC9A 1JJFA 1M5UA 4G37A 3H97A 4GSKA 2X2FA 4Q1CA 2AD5A 4CIVA 3AIMA 3QOYA 1C8KA 2CLCX 4C20A 4JP2A 4ER0A 1X8KA 1PFGA 2WJGA 2ZE6A 4BX3A 1PCXA 1HFWA 2VDLB 2DCMA 3QK7A 4IVNA 4QREA 5AM0A 4YCCA 3RUDA 1DDOA 3HZZA 3PQ5A 4KPUB 1LPPA 2JFYA 2L42A 4RK6A 1VMEA 5L46A 3E1KA 4LZLA 2BMEA 1RKXA 3BXOA 4LGVA 1E1DA 3GGSA 4MLPA 1PUIA 4I4TA 4AN1A 4BNDA 3EQ2A 2ZIZA 1VL5A 1JR3A 3RKRA 5ALYA 4X85A 2WWXA 2ZUBA 2ZVQX 2AG1A 4PXAA 2WP8J 3WSWA 4C7KA 5IT0A 2P4QA 1M2OB 4BC0A 2CYAA 2YJGA 2FPKA 1F2DA 2CWWA 4W6QA 2GJKA 2CHUA 2WF8A 1Y1TA 1O9BA 1JLKA 4R2LA 3V55A 4JFAA 3FCOA 3ZKAA 4UAGA 2QD4A 2E87A 1PFYA 2ZPUA 3FWHA 3KR1A 3LC7O 4W9NA 5L3ZA 4RPDA 1MB4A 1LRLA 2FRDC 4ZJUA 3R7BA 1KERA 5JJLA 4ZOLB 4ES6A 4ZMSA 5CXXA 4CG1A 1KVSA 5FUXA 4BX9A 1V4NA 2ETXA 1GCAA 4I3HA 1O94D 4NU6A 3UH0A 4B2PA 3VU9A 3NVMB 3FMVA 4HXFB 4K88A 4RH3A 1J24A 2ZUVA 4YRQA 5A1TA 4FPXA 5CCBA 1I01A 1PZEA 4F4IA 2PZKA 3RYFB 2W9XA 3K0FB 1BXGB 5FB3A 3VMMA 4AQYB 1R15A 2WSLA 3ROZA 4L22A 1J0BA 4KUEA 3ZGYA 4C6TB 3CR3C 1G19A 3DAFA 2ZTLA 4RPJA 2HJHA 4Q9AA 4UEKA 1AS0A 4IIXA 4BE7B 2AJTA 2W5UA 1E0JA 1NXWA 4UU8A 1K9SA 3BVPA 3ORHA 4ZAGA 3KUUA 1L1EA 3NEYA 3RF7A 1I4DD 5J2TF 5T7BA 5DW0A 4MCAA 4UZEA 4EMSA 3CUVA 1G8KA 3ZD6A 2IU4A 5GY7A 2YN2A 2NUTA 3ZLVA 2OAGA 1QQ6A 2G1KA 3O8OB 4ABTA 4NFSA 5HE8A 1XQYA 5F9HA 2PYDA 1PR3A 1YAHA 1P1IA 3G1WA 3VAYA 2WEKA 3A4IA 3MJEA 2B1JA 4V2UA 1U0GA 3FGPA 4BVGA 1EDDA 4GRDA 2B5WA 3BGSA 3NE5B 2WHRA 4LZJA 2OHGA 5FA5A 3VR4D 4NVRA 3KC2A 1T8RA 3NHMA 4OPVA 1KVUA 4UVEA 3TCNA 3KJFA 1G60A 3ENVA 1U2DA 1JF8A 1PS8A 1SXJE 2X7XA 2CMGA 3ONNA 4Z4SA 5EP3A 2I2XB 1XO1A 2WB4A 2QT9A 2DHEA 1CF2O 2VYFA 4K46A 2Q5QA 1DXHA 3NJ8A 5F78A 1YVDA 5IK2A 3UG6A 4KK4A 3PQ3A 5LFAA 3TIVA 4G4SP 2H59A 1AZTA 3NT5A 4X20A 4CCAA 2XHZA 5KTKA 4R2MA 3PE3A 1OH7A 1M2EA 3SE7A 2PIAA 4IF4A 2Q29A 4QG7A 8AT1A 1DAMA 2DBZA 1ETHA 4BMVA 1Q95A 2GYWA 1EVYA 1Z75A 4I50B 4N6NA 1KI4A 2IY9A 4R68A 3UATA 1B15A 2AXNA 2CLOB 2O5VA 4KRGA 3MAJA 4W1QA 4ZAWA 4OK3A 1H1DA 2N47A 3H17A 3HS3A 1GL3A 3PWSA 3GEHA 4MRVA 2BJHA 1KJWA 4QBHA 3WIVA 1SQGA 4XR4A 1SD1A 1T6NA 4PLVA 4XB2A 2HTFA 3ACBA 4QA9A 4U2FA 2BFCA 1V4VA 4AJKA 3HPRA 2AW5A 3DWFA 2VP5A 4BS9A 3GJ5A 5E8RA 4RAQA 5B2FA 4U2KA 4L07A 2BKXA 1Y98A 3GWGA 2DMRA 3M3PA 2A0KA 3OICA 4DIDA 2B8NA 3NOXA 1O95A 4HEA6 1LI4A 2VLBA 4M89A 3ZY5A 4B9AA 2PJZA 3BC9A 2BGIA 3LQ4A 3IXLA 3EVFA 4F5DA 1YUBA 5J2TB 3MJSA 5M04A 1N9KA 4M9SA 1ZI9A 1UD3A 2EZTA 3OD1A 3MTDA 3VX3A 5K4AA 2K87A 4B82A 1JEAA 4PYLA 3IUQA 3FUTA 4JBXA 1KEEB 4G5XA 3QX3A 1OXTA 1TT5A 2WSIA 1UJNA 3NAGA 3T7IA 1XKLA 3E9CA 1NXVA 2R8PA 3NETA 1AKRA 3HV0A 4OJKA 4PG8A 3C3AA 2VH2A 2VA8A 4QGSA 1R7RA 3H0EA 2PPVA 1NN1A 1TVCA 3O3CA 2PNJA 4ZT6A 5K0JA 1BRTA 4B79A 4CMAA 5ALFA 2VF4X 3LT4A 3TTYA 4L5AA 2OAEA 4HQ0A 4V38A 1BD4A 2C9CA 4JYMA 1TF7A 1C81A 1KEZA 6ABPA 5TARA 3E2PA 3SDBA 4PLTA 1X15A 3OZ7A 1YJXA 4DLAA 2XVMA 1W0KA 1DQNA 1HQKA 1P9LA 1Z7EA 3SQXA 5F23A 3ILVA 2BRUC 5I4BA 3CF2A 2HRRA 3OJLA 1CPYA 1IXYA 2G40A 3LXUX 3NBMA 4XCVA 1PV2A 3WLLA 2WTMA 4GD3Q 3JR7A 4NNPA 5J5AA 4FXUA 1TAGA 3QA9A 2O8NA 3HFRA 5B2ZA 4CLOB 3TRDA 2BHSA 5BORA 4D3FA 2Q3EA 3H9EO 1UR5A 1Y42X 4B9EA 3PL1A 3SHVA 4DMUB 3MLAA 3GLVA 1KHHA 3LXMA 2C2ZA 3EZNA 1J2YA 3WGUA 2GNAA 1OIWA 3QXXA 4DREA 3PQEA 1GCOA 2XDWA 3TRJA 4CEJB 3FCAA 1DG3A 2QJWA 1HQCA 2VXOA 2WZCA 2XOEA 2Y1KA 4RIIA 1J33A 4UNQA 3EULA 5ALRA 3IBGA 4BNJA 1GA6A 2BV3A 4K40A 2A7QA 1KHTA 4WK2B 4DM4A 3BCDA 3R09A 1PTKA 1MXHA 3T06B 1N5LA 5B1YA 2IHJA 4E5VA 5F7JA 2XCUA 1MFPA 1EE1A 1XELA 2YV2A 2AEMA 3CCJB 5FQNA 1YULA 4DWWA 2WFMA 1VJDA 5AQ1A 1E5QA 3RG2A 4PANA 3S44A 2JATA 1ULBA 2XD4A 3M2TA 4A03A 1HG0A 4BO6A 5I5GA 3DKRA 3RT7A 1L4MA 3VR5H 5HZBA 5CX1B 1NMZA 1SNYA 1XA4A 1C7JA 3OQIA 1KEKA 2GA8A 4O1IA 1T9ZA 2H1WA 3IUNA 4GR9A 1P7CA 2PSEA 4QTXA 1WDLA 3BGVA 1KH2A 3T9EA 4M49A 3HWRA 1H69A 3RTEA 3FW1A 2GPAA 5EVCA 3GF4A 2BCGY 2GF9A 4FQ5A 1IEVA 2G1UA 4OIMA 5BW5A 1JFFA 2A9KA 3RYHB 1IWBB 3VH2A 2XE7A 4DLVA 2BD0A 4WVLA 3RYCA 3K73O 4MV7A 4E5DA 4TWZA 4FR0A 3HZHA 4B3MB 3ZVKA 3HJUA 2EWVA 4C88A 2FZGA 4O63O 3NHAA 3AUUA 4JVOA 4W1PA 4M0UA 2RGBA 3OJ0A 4RF2A 1XN4A 1XE1A 3M4XA 5LNK1 2W98A 1N08A 4X9XA 1UADA 1VG9B 2BFCB 1JA0A 4WERA 3WOHA 3EGDB 3FMFA 2EHJA 3ISVA 1C8VB 4OQXA 3TR0A 1ILEA 1CRWG 2VNHA 1UWVA 2IYLD 1EBBA 3NEJA 4GX2A 2WIJA 1ZUIA 3TW6A 2RJNA 4UTOA 1RHUA 1MH9A 4YAWA 3MD9A 2WF5A 1NLZA 2JGEA 3ZI4A 4AMBA 3MHTA 5L3VA 2HQSA 4RANA 2EP5A 2QMYA 1RTKA 4CNQA 2Y1WA 4ZCPA 4FS8A 3TSZA 2V0CA 5CH5A 5F7OA 1DRVA 2FK7A 1DMRA 2GEUA 1F2TA 3D4PA 3TLCA 1E2FA 4KN5A 3H8SA 1IOVA 1QRAA 4NJOA 4XX1A 3TZCA 4ARSA 1GPUA 1UDBA 4ZVNA 4Z4YA 2NSDA 3SVZA 4OB8A 1RI2A 1SVNA 1FA9A 2J3DA 1VFPA 2HIHA 4C05A 1VXRA 1GIAA 3B9PA 1TFUA 2GR9A 5FBVB 4WN3A 3UAOA 3PVSA 3PUMA 1IBCA 1KC1A 1ZCZA 3CVUA 2Y2VA 4NCNA 1FRZA 3R3SA 1V45E 3PHCA 1CZUA 1G6KA 1JI3A 2VP0A 1NVUQ 2A3NA 3GBPA 4JY7A 3W9YA 4EG3A 4F5ZA 2VC2B 3FZNA 5A3QA 2E5LB 2K5UA 5JW6A 1C0PA 1I4WA 1XP8A 3EN0A 2PSDA 4BASA 4QGHA 4OX9Y 1EFPB 1Z4NA 2JHPA 1PWYE 3TR5A 3DTVA 1QFXA 2JEOA 4KUHA 4RHCA 5LYJB 4FGZA 2OGZA 4NFLA 3MW8A 5EWJA 1MT3A 2FPPA 3PFHA 4JT9A 3SJAA 3W2EA 1P4MA 5J40A 3WLNA 2XUAA 3ASQA 2XZLA 1ORTA 3F6RA 1D2RA 1T4CB 1Y6QA 4PRZA 3VUEA 1U2PA 1I32A 2W70A 1YACA 5A4IS 1YBHA 3OIUA 2GZ2A 3F6YA 1U7HA 1YJ9B 1V3UA 4I36A 5KYTA 2VF8A 4Q3BA 1BXKA 1DXQA 2R1TA 1WD7A 3DE6X 3U0BA 2B7CA 5ALOA 1KFEB 3W2GA 4IIGA 1L4YA 3O2SB 5FWXB 1FYWA 1I0IA 3LKDA 4KIGA 4NENB 4B87A 5JYCA 2HCFA 3LQEA 3S2IA 1RFLA 1XLVA 1T0BA 1GSHA 1IFXA 4LCEA 3CMEB 1JR3E 3AP2A 4C2UA 3D6AA 1QLHA 2VJYA 3ABSB 3KJIA 4PAMA 3SICE 4EVIA 4HFMA 3BGOS 4M0FA 1N7HA 4REOA 3GROA 5HBGA 1AA9A 1N2HA 1CVRA 4TQAA 1IBRA 2UYGA 2R8ZA 3IBYA 4PQGA 4W5WA 4CMEA 1SZJG 1OAAA 1QTNA 4KH0A 4M9UA 3SQNA 1LCIA 1PNVA 1RIFA 2YHBA 2GKOA 2EFGA 2O0LA 1ACLA 2G4LA 2WYWA 2BMDA 3DL7A 1NYLA 4MK4A 4U02A 4KDRA 4MR7B 4Q4JA 3JQGB 3KZMA 1GGEA 3OA2A 4RUKA 1RCUA 2C29D 2NT4A 3ZDZB 1G5FA 2I6FA 2J9FB 4Z9BA 1RDFA 2I2WA 2ZJBA 2QKYA 4J9UE 4XPZA 5JMWA 1VLQA 3F6CA 4YP5A 2IHNA 2XCIA 3UMJA 1JP7A 5JCP<