5FO0A

D298e mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
334
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFESVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
molecule tags Transferase
source organism Corynebacterium ammoniagenes
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
total genus 97
structure length 334
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo0A01
4ZT6A 4MLPA 3CVWA 3NV7A 2HZ7A 1IQ0A 3NBAA 5K0TA 4KPUB 3BL5A 2QTMA 4MUKA 4U63A 4X0EA 1NUUA 3FWKA 1EFVA 1N78A 4RPIA 1TQ8A 1IH8A 1N06A 1PFYA 2D5BA 2B7LA 4FZJA 2DEUA 4MUHA 3IVGA 4EG6A 1LI7A 3IOBA 4XSVA 1NUQA 4HPWA 1EUQA 1OD6A 3LOQA 3ISJA 5KCMA 2YXNA 4I6JA 3IODA 2E0IA 5H16A 4DE5A 2QUIA 4JXXA 1JEEA 1GTRA 3FH0A 2A86A 3PXUA 1COZA 4MW5A 1G8FA 4EG3A 4GRIA 3ZJVA 2AG6A 5FNZA 4L2IB 3LE8A 1I6LA 1VBNA 5J59A 1ILEA 1J1UA 2AZXA 1WY5A 3X1KA 2PIDA 2DUMA 3HFJA 3PRHA 4MUIA 1HYBA 1MB2A 1NI5A 2A84A 3G59A 3PNBA 4I6EA 1M8KA 4KPUA 3H9CA 5TEWA 3A2KA 3HGMA 4MVYA 1LW7A 1O97D 3AL0C 1TFUA 1D2RA 2E21A 4ZCQA 4I6GA 1N05A 1O94D 4GU5A 4AQ7A 3P0IA 4KKVA 1JHDA 4EGAA 5K0SA 4KR6A 1N2IA 3FETA 3OP1A 3AIIA 3DV2A 1BS2A 4EG4A 2X1MA 1JZQA 3HMQA 2QUHA 4E1AA 3SYTA 3VU8A 4K0RA 1KH2A 2A1UB 1OWLA 4YP6A 2QJOA 1J1ZA 5H7XA 2VBTA 3COYA 4ARIA 1N08A 1OBCA 3DPIA 3PNYA 5TEVA 1N75A 1J20A 3IMGA 3KFLA 1TEZA 1A8HA 4PBTA 1QRUA 4F3RA 1XNHA 2J09A 3ILVA 4MW2A 4HJRA 3F3MA 2RD2A 1F7VA 1Q11A 4QREA 1ZH6A 3MLBA 4YBRA 1UFVA 4A91A 2WB2A 4MW7A 2DPLA 3IOCA 3P0HA 2O8VA 1NB9A 3INNA 4J76A 3RK0A 4MWCA 1OWPA 3COWA 2QUJA 1GLNA 1JEDA 1N2HA 2XRZA 2QTNA 4MAFA 1P7PA 1TYAE 3KT8A 3CVXA 4G5FA 1O0CA 5A8AA 4MVWA 2DERA 3N05A 3MXTA 1OWOA 1FYDA 1N07A 5J5AA 2IP1A 1DNPA 4UZEA 4JFAA 2D13A 3ND7A 1JIKA 5HG0A 2VXOA 4ZT3A 1QJCA 3IUEA 1S4MA 1O0BA 3COZA 2DXIA 4CQNA 3CLSD 3ZXIA 2DR2A 1MAUA 3K9WA 1O94C 2RE8A 1N2OA 4G5YA 3CLRC 2WSIA 5FO0A 1H3EA 1CT9A 3L92A 1WJGA 2CT8A 4WNYA 3UY4A 1Y42X 4PBRA 4DDKA 2Z09A 1T9GS 2WQ6A 1YI8A 1OWMA 3CA8A 3IDFA 4ZCRA 3ZJTA 1OWNA 1MBZA 4PBSA 3CLUD 1M8PA 3A05A 1JMVA 4NDAA 3KT3A 5F23A 1Q15A 1Q9SA 2X3FA 1N1DA 1WOYA 2CV0A 1PFVA 5TS2A 4ND7A 4YP5A 3AFHA 3IH5A 1EUYA 2PXHA 3KT6A 1KP3A 3A4IA 2CYCA 1IFXA 3PNVA 1F9AA 1NZJA 1VBKA 1SURA 2Z08A 3AKZA 3L93A 4CT0A 5J58A 5KWVA 2VTBA 1FFYA 3ELBA 3H99A 1NURA 1EFVB 2V0GA 1PG0A 3H05A 1MJHA 4YP7A 2GKSA 1WXGA 3P52A 1LI5A 4PY2A 1KQOA 2ZUEA 1O6BA 3RBAA 4RUKA 3CLRD 2QUKA 2PG3A 2E18A 4G6ZA 1GTSA 3G5AA 1IQRA 4JZYA 1M8GA 1JIJA 4KR7A 4MUGA 1QU3A 1JGTA 4EG8A 1R6TA 2A1TR 1YUMA 2ZP1A 1I6KA 1MOPA 1O97C 4ZT7A 3TZEA 1X8XA 1GPMA 2CV1A 2OV4A 4ZCSA 1H3NA 1PFUA 2ZUFA 1NUTA 3VRHA 2A88A 3I05A 1QRSA 1F7UA 3HV0A 4MUEA 4DDMA 4H3SA 4DNXA 4CDMA 3VGJA 4MUJA 3A04A 3SEZA 3ND6A 3N8HA 2A1TS 4OUDB 1I2DA 1J70A 4EFKA 2PZAA 3U1VA 1O5TA 1T6ZA 4MWBA 4ZT4A 3CTAA 1N3LA 3CLSC 1XNGA 2GM3A 5FO1A 1EFPA 5HUJA 1NP7A 2A4MA 1WZ2A 2R5WA 4QBTA 3LCJA 4P2BA 1OBHA 3DLAA 3C8ZA 5LFAA 2X1LA 3K32A 1GAXA 3FG9A 4MUNA 3CVVA 1ZJWA 2QTRA 1NUPA 1P4MA 2HGZA 2A1UA 1QNFA 3JXEA 4R0NA 4JYZA 2CUZA 1K4MA 1JECA 2CYAA 5IJXA 3IMCA 3CVUA 3GLVA 1WXHA 4UZFA 1MAWA 3IOEA 2JANA 1GN8A 1K4KA 3CR8A 1T9GR 3HZRA 3N2YA 1WXEA 3Q12A 4ZT5A 2J08A 1M83A 4NAHA 4R2MA 3SP1A 3RFFA 2IELA 3Q4GA 1K92A 1NSYA 3M5WA 2VBSA 4MWEA 2WQ7A 4AS1A 2IJGX 3FHJA 3NBKA 4MVXA 3QE4A 3X1MA 3AG5A 3ZGZA 4MW1A 3TZLA 1ZUNA 1T6YA 1T6XA 5A89A 1EJ2A 3HL4A 4MW0A 1IHOA 1N2JA 5LLTA 3TS1A 3IVXA 5DASA 4MW6A 2NSYA 4YMIA 2OQ2A 1KAQA 1ZH0A 2J5BA 4F4HA 3CLUC 2D54A 4NZPA 1IVSA 1YUNA 1J09A 4EG1A 4ZT2A 2CSXA 1U0BB 1H1TA 1VL2A 1X6VA 2HMAA 2PZ8A 1KP2A 1MC1A 1G8GA 4XFJA 3ND5A 2TS1A 1TYDE 1WQ3A 3FY4A 4J75A 4ND6A 4MVCA 2YY5A 3ZXSA 2OYNA 3CVYA 1G59A 2DETA 2XRYA 1IQUA 3DO8A 2O5RA 3ZJUA 2EL7A 1KQPA 2AKEA 5A88A 2J4DA 4ZCPA 3G6KA 3ZIUA 2YWBA 3MUEA 2NZ2A 3H9BA 2PZBA 1O96B 5KHAA 1KAMA 4MW9A 1N77A 1KQNA 4S1OA 2VTBB 1GZUA 1TYCA 4HJXA 4QRDA 1EFPB 1U7DA 1JIIA 2CYBA 1M1ZA 1QU2A 1RQGA 3RHSA 2CV2A 3MLAA 2P3MA 1F4LA 3S3TA 3IMEA 1QRTA 5TGTA 1VBMA 2YWCA 1M8FA 1N2BA 1YIAA 1R6UA 4U7JA 4NX2A 1WKBA 2G36A 3SDBA 3QTBA 1EE1A 1V47A 4JXZA 1PFWA 1M8JA 4OUDA 1JILA 3FIUA 3OTWA 3COVA 1Q77A 3UMVA 4BWVA 4MW4A 2BTEA 1R6XA 4ARCA 2DLCX 1V8FA 4DJAA 2JAXA 2QJTA 2EJCA 4ZCTA 1NYLA 5TRDA 1JZSA 1NB0A 4XFDA 3UC5A 3X1JA 3ZUGA 3SEQA 3GUZA 1WQ4A 4MULA 1QQTA 2QJFA 3UK2A 3RK1A 3CLTD 3D6UA 3FDXA 3D6VA 1O95C 1KKUA 1TYBE 3IVCA 4CDNA 1VLHA 1WXIA 1EXDA 3AG6A 4EF6A 3QTTA 2I1LA 4OJMX 1U3DA 5LM3A 1NUSA 1KH1A 1N2GA 1N2EA 2PFSA 1H3FA 4MWDA 1MB9A 4HK4A 3SZ3A 3RJZA 5DEOA 4NATA 2H2AA 1G8HA 3MMXA 1Q19A 5DK4A 1YIDA 2V0CA 4MUFA 1U7XA 4EG7A 1MRZA 2GOYA 3CLTC 4DLPA 1ULHA 1J21A 3TNJA 1KORA 2H29A 4K03A 2Z3VA 1IRXA 1YULA 3H97A 4DDHA 3IUBA 3TQOA 2CFOA 5EKDA 3Q10A 1K97A 4KR9A 2BYTA 5JBNA 2J07A 1B6TA 1O96A 3GMIA 3E27A 1I6MA 2VBUA 4Q16A 2C5SA 4WSOA 3P0JA 4TS1A 4R2LA 5BNZA 1XNJA 3BNWA 1XJQA 3KT0A 4MQ6A 2JA2A 1U3CA 2A7XA 1KR2A 1WXFA 5DB4A 5IHXA 5HUHA 1QTQA 3FI0A 2E89A 2X0KA 3TQIA 1O95D 1PG2A 3FOCA 3N9IA 4EG5A 4NAUA 5AHWA 4L2IA 1KH3A 3FNRA 4U8HA 3SZGA 4Q93A 2VBVA 3UOWA
chains in the Genus database with same CATH superfamily
1P9RA 3NM5A 1OH5A 4E03A 4ZGQB 2FJPA 2EQAA 3JSAA 4OGKA 2ZI7A 1ZD2P 1P7WA 5CFZA 1V5IA 3AI7A 4R2XA 1YQQA 3O95A 4B8YA 3EVEA 1A2KC 1NQXA 2NIPA 4O2BB 4X0EA 2JS7A 3LPMA 2OXTA 2WYRA 2I9KA 4JT2A 1M54A 1OC2A 3H1EA 4JMLA 4JBLA 3ZI0A 4EGFA 1FYFA 3K53A 5KDLA 4FYXA 1HKHA 1L5WA 2HNAA 3WHIA 1V16A 2WUDA 1PJ5A 5HBRA 2XV1A 3AJ9A 2YWEA 3FTNA 4INPA 4BE7B 3HKEA 2ZR8A 2QM3A 2ZRLA 4NNJA 5FI3A 3SY8A 4ZC1A 4JT8A 5TE9A 1HQKA 2OBFA 2VWHA 4QE3A 1U0FA 1OD6A 4G0UA 4DW8A 2YASA 1OLSB 5KZMB 4QELA 3C4JA 5JV5A 1Z17A 2PFGA 1X2EA 4PVDA 3UMCA 3LNTA 1JHQA 3TFOA 1GU0A 3A8KA 3OPNA 5KTKA 2V4DA 3H5VA 2AG6A 3ND9A 3QKSA 1CE8B 4Q3LA 3TN7A 2CVQA 2VXYA 1GAWA 2YINC 2Q6OA 1I1QB 4J3JA 4O2RA 5HR5A 2HB6A 4YIKA 2JFXA 3B8EA 4IILA 2I7VA 3SPXA 4DIUA 3SVTA 3MLEA 5KMGB 1NRJB 1FMJA 2J8ZA 1OC4A 3BWEA 5HILA 1M2OB 2WAYA 2ZJ2A 3EE6A 3FAZA 2GKOA 1FQOA 4Y2PA 3R5SA 1K86A 1J00A 2FEXA 3HBFA 2DJIA 4EFNA 1BXRB 2GEUA 4KIJA 4L8JA 2AUTA 4RNCA 2I8CA 4R7ZA 4AF8A 2XD9A 3CIFA 1M74A 1SZPA 3HYTA 5IF9A 5DKFA 3DCJA 3ED1A 5FOSA 5FTMA 2WMDA 3BOSA 4X7RA 1H2EA 4YFYA 1BS2A 2WILA 2RSLA 1L8OA 2XE6A 1UIRA 3PRKE 1L7OA 3EZYA 3I73A 1T2CA 5T4HA 2ZTLA 5ICCA 2P5YA 2A1UB 4Q3EA 4S04A 1UJMA 2B6HA 2CFIA 3OPYA 2VQEB 1EE2A 4DLSA 5CX1A 4KI0A 3RR2A 5K3EA 3S81A 4ERNA 4A8JC 4YO7A 3C6MA 4S2UA 1RT9A 3EPRA 4CM4B 4K81B 4JI4B 4L74A 3CP8A 1VPDA 3S8YA 4N7RA 1TAQA 4JK3A 1H9CA 2YS7A 3CCVB 1UZAA 4X8IA 2VK8A 3DMNA 3EMBA 3KCNA 3UXEA 2RGCA 3UUFA 4L7QA 3OIDA 4CF7A 1HTTA 1VXOA 2J09A 4L15A 2MCFA 2Q9BA 2F8LA 1KS2A 2BEWB 1ORHA 2JGKA 2PS1A 2YZKA 4TQ9A 4QLBA 1M0TA 2VF4X 3AESA 5JHGB 4R8KA 3ASYA 1L5OA 2Q07A 1T3GA 4JLAA 2V9CA 3P0HA 1G19A 5TX7A 1K5GA 5AK4A 1OXBB 3BJRA 3JQGA 4QO7A 3RK0A 3CCLB 4O2BA 1G9SA 3KTOA 1KQGA 5CA0A 1DCFA 2FRXA 3KT8A 4TM8A 4HO1X 2IUYA 1RYNA 3U56A 3FNQA 1QCZA 5JBQA 4A16A 1UFOA 2BFEB 3F6RA 3N05A 4XKJA 1Z8FA 3QK7A 4J43A 4IIEA 1IWBB 1FYDA 4MSUA 4RE5A 1U04A 5D7NA 5J5AA 3D2AA 2DWPA 2W4MA 3U4IA 2E4WA 5B1SA 4GXQA 4WK4B 3FPAA 3OE7A 5L7WA 3ICVA 1SWWA 4WLVA 5ER6A 2WWHA 4R9VA 2WHPA 2FEAA 2RHWA 4E5PA 3EXHC 1MB0A 4BNLA 3E58A 4CTKA 4TTPA 4JLMA 1SPXA 2AG1A 4PEVA 1XTZA 4C4SA 3DMFA 2DXIA 4DVGA 5CDYA 4OGLA 3DG9A 5IEBA 2XIQA 3NVMB 4EEKA 2A14A 1ZMRA 2Z83A 4MA0A 5I4KA 5K0NA 2FB9A 1WD7A 2RC5A 2JGRA 2WFLB 4MV8A 1EGAA 1G38A 4LMAA 3CUYA 1OLOA 1NVVR 1PWXA 4KGZA 3KTAA 2H2FA 4LI0A 1LWNA 3K0AA 2Y93A 3LPNA 3EXFA 3MFQA 1Z22A 2UXCB 3E61A 1AQIA 3HZZA 1CX9B 1Y42X 3OUUA 1F2DA 3VI3B 3WL7A 3X1DA 5KHOC 5KYNA 3D4LA 1T9GS 3MWKA 4GWGA 1TM7E 4HSEA 4XN0A 3G71B 3P9IA 1Y5RA 2YYYA 2JFGA 2ZANA 1MBZA 1YHQB 2DTDA 2P65A 1E6KA 4G0PA 2YX1A 1WNFA 1M8PA 2W2KA 1Q6YA 4IMIB 2CDAA 2BM0A 3JQQA 1L4BA 1N6LA 1NKVA 1QQ5A 1O6ZA 1V7CA 2ZPUA 3MW8A 3N59A 3Q3IA 3QVTA 1Z0FA 4K9KA 4MRNA 3RLFA 3TOXA 1U7UA 1WOYA 2WTMA 3HA2A 3P9XA 1CQPA 4PQFA 2X8KA 4RZSA 5HCIA 5ICGA 1DBWA 4WNAA 4N6GA 5LU8A 3KT6A 1LKZA 1XLWA 5KJEA 5HE8A 5LMUB 4PLVA 1ZVQA 3WB0A 4DQ0A 1CQIB 3V42A 4XQ0A 3JVEA 4DBLE 1TO6A 5DW3A 4YRNA 1NNLA 2JLSA 3CKKA 2LW7A 1OT5A 4N5MA 1SZCA 3H11A 1U5CA 3REFA 3GLGA 3FTEA 3KYCA 4LI3X 4O4JA 4CMHA 4UQLA 2REQA 1T8UA 3S1AB 1YDFA 2XWSA 4ZDWA 5LQKA 4BEBA 3V6MA 4DMKA 2GO7A 3D0QA 4Z7OB 1NTRA 2I6GA 3WMGA 2W48A 3N5CA 1DWUA 4U00A 3OQBA 2XAUA 4LYEA 5HP4A 2A0YA 1JXQA 1SU7A 5AKYA 3TDKA 2CNDA 4Q7EA 2OAGA 1O6BA 1N5KA 2GYYA 1YJCA 4H1TA 4BX2A 1XN4A 4QAQA 4BVFA 4HB4A 4WJKB 3ADOA 3JD1A 1QONA 2AC7A 2QVGA 1ADYA 2WJ3A 2ODTX 3E82A 4QFMA 3PFWO 3V00A 5IJ9A 3G5AA 1WDWB 3G3EA 4FSHA 2AN1A 5BV1A 5BQPA 2FSHA 3TTXA 3B1JA 4JDUA 1Z2OX 4MUGA 2P3OA 3PXCX 3WJAA 1M73E 4D3SA 3W5DA 1UBUS 2FAXA 3QYFA 4NWIA 4P6VF 2ZP1A 1ETHA 4BPRA 1MOPA 3PI6A 4GMXA 5HQ3A 1QOPB 4OHMA 3M49A 1LLQA 1RDFA 1VKRA 5DCLA 4KP7A 3BZUA 4MVJM 3RIXA 4ZCSA 4CFYA 1AKRA 1H3NA 3MFYA 1H22A 2YXPX 5JCPA 3CNEA 5CH5A 5FT9A 3FTFA 2VP2A 4H4CA 1HFEL 1W6RA 1C81A 2EGGA 2F3RA 3EIXA 1C14A 5AOBA 3BTUA 3B5IA 2JLYA 3DAGA 5DLQC 1C2YA 2Q7DA 1QR2A 1H4SA 1MAHA 3ND6A 4B4KA 5B7GA 3C8UA 3B6EA 5EJEA 3SQNA 1P0CA 3OICA 4LNUB 4BC1A 3UPTA 3FDFA 1XJCA 2PT5A 2X6XA 1OA0A 1SQ5A 2QRJA 3GG2A 4JR0A 5B3JA 3T5CA 5K2MA 2FJ0A 1A9OA 2QUAA 2NTEA 1XLVA 3ANXA 4LXUA 4PLZA 2V7PA 5JXIA 2BHSA 4MQLA 2WLTA 1V1JA 1X19A 1OBHA 1S7GA 1TCBA 4MKZA 3KQKA 1EU1A 1ZGBA 1T36B 4LFCB 3H2ZA 3TTWA 1UAAA 4GKKB 2PKQO 4H3HB 3GY0A 3DKKA 2XA1A 4PV7A 2C2ZA 5D3ZA 4CCYA 1DRKA 2HGZA 4QYSA 3T1YB 3V8VA 5B5SA 2IBTA 4AECA 4MA4A 1E2MA 4HMPA 2ZWAA 2AXPA 5D6OA 1XAGA 4BFUA 3JQ7B 3EF3A 2YH2A 4DMMA 4UUMA 1WBDA 3A9RA 3HB4X 3ADKA 1K66A 4ZI7A 3U5ZB 1CEEA 2WM2A 2BGIA 1T9GR 1V8PA 1GPH1 1QUEA 2XYHA 5C1PA 4RGBA 2P78A 4HYEA 5E1MA 1FJGB 3CXRA 3PSAA 4GLFA 4RETA 3B6KA 2F1RA 1AGYA 4KBGA 1TM5E 3B48A 2BFMA 5TIIA 2B9EA 3RFFA 3Q4GA 4WN3A 1E9EA 4MGIR 1X15A 1LTQA 3LG2A 1AGRA 1E2QA 3TGLA 4HRAA 1P1IA 1T15A 1J9ZA 3QTLA 4QAJA 4XPIB 4KJXA 3ZGZA 2X15A 3MN1A 3PEFA 4Q1EA 1CQJA 3NHRA 3P9YA 1WZCA 5E9AA 4IKEA 2M1ZA 3D4IA 5ERGB 4MS1A 3TS1A 2C4KA 3IVXA 5WRFA 1OX4B 4OXQA 3MJEA 2JAOA 4ONEA 4BO0A 3PHGA 4DWOA 1EVQA 1V8OA 5KU7A 3G89A 4O2AB 4PZZA 2QD2A 2YY6A 4B34A 4MJ3A 4NFLA 1E4OA 2F43A 2ZE8A 2AOUB 2C61A 2GZAA 4HEHA 2WDPA 5EVJA 2Q9UA 2GAOA 2RGDA 4DLYA 2QG4A 1V0FA 5HIAA 3NBZC 5DJ5A 1ADBA 2ZYRA 4OHFA 4JP8A 3T1OA 3KC2A 3UV3A 4WY2A 3CSUA 2PH1A 3VBCA 1HPLA 3O1LA 2F3UA 3IEIA 1KZ4A 3OWHA 4FEGA 1BMQA 4G1FA 2OYNA 6PFKA 3A8TA 1EK1A 1GCUA 3RSFA 5IAJA 5DHUA 2ZITA 2EDAA 2VLBA 1U2DA 5FJJA 5LCXA 3ZJUA 5BMVB 5A5GA 1RBMA 1LBHA 1HWYA 2FNAA 3UHPA 3VO2A 1HT1E 2OO3A 2XRFA 2O14A 3DXFA 4G26A 3F4LA 2QRMA 4F1JA 3JS5A 2A92A 5FWDA 4EKNB 3HU2A 3JQFC 5DBGA 3BILA 4RA6B 4EBBA 5EXEA 5EGNA 4P5PA 4RKRA 4L16A 4U5XA 4AJJA 2WNIA 4EHBA 2F8SA 2C5LA 1MXFA 3DYBA 3MQ2A 2PUCA 1YA4A 4XWYA 4BN5A 4C5CA 1WMSA 2ZDHA 3HN6A 2AG8A 4FBGA 1NJ5A 1FFHA 1P1RA 3WGVA 4OREX 4IP0A 4M54A 4PG8A 3GFGA 4GF5A 1F4LA 3S3TA 5FUVA 2N42A 3EFOB 3AI1A 4FCVA 1M2VA 1XMXA 2EIHA 2IYPA 3Q9NA 3TQSA 3UB4A 2PMKA 3CKMA 3VNUA 3MCVA 3ZEAA 3V32A 3ZY2A 4WLEA 3DFZA 2XMDA 4G2TA 2EAUA 4TMFA 4XCQA 4Y2TA 4PN7A 4PQRA 2WLSA 4MK4A 4TXLA 2GBIA 3QTBA 4GD3Q 5A4MS 1Y9EA 1E3WB 3SLRA 2O0KA 3V4OA 4EELA 5L6MB 1H66A 2JGAA 4DJFC 2YDXA 2JGJA 3EIWA 2O8BA 2NU6A 1H8EA 3TBHA 1EVKA 1LJUA 1M67A 3BORA 4CRWB 3Q87B 5CVEA 1U2PA 1YMQA 1M1YB 2QV7A 6ADHA 4YJ2F 1XD2A 1WU8A 2AV6A 3CNHA 2OLEA 4JLPA 5CJPA 4EJ0A 4J2HA 1JEYB 5E9QA 1PO7A 4ZC8A 1JR2A 2QRQA 2ZI3A 1JB9A 4BO6A 4J7UA 2R3SA 1BWRA 2C03A 1XMQB 5K51A 2NYRA 3CLTD 4OATA 1X1EA 3DVQX 5I48A 4JDPA 4WASA 1TTHA 3E3AA 2AR9A 1IPEA 3BCHA 1KKUA 2OM6A 2X9QA 3A4VA 3DDOA 1RYDA 1ECBA 3W05A 2Z98A 4I19A 2VT3A 1KH1A 3GGOA 3SXUB 3DZJA 3LWNA 1RQ7A 2A5DA 4YFVA 4BX3A 5CDFE 4PC2A 5DYYA 3WJ1A 1LQTA 2EX0A 2FX5A 4EMUA 3GLGE 4NH0A 1ZGHA 4MWDA 1UM9B 4MDFA 2AR0A 2CBGA 2CBXA 1JI3A 4NECA 1AKYA 4NATA 2H2AA 3OT4A 1DT5A 1ISIA 1U65A 1VMAA 3K1YA 5LJLA 3W5IA 1E59A 1YIDA 4UHKA 5CYOA 4R7TA 2Z8YM 4JOCA 4EHJA 4WCFB 5KWJA 2G4VA 4Z4EA 3B78A 1K88A 4YAIA 3IAS6 4Y2XA 2IVZA 1UMDA 4I55B 4JP1A 1G7TA 4RV5A 4TRRA 3PRYA 2K5UA 5ENZA 2GCNA 3I32A 2KJQA 1TRKA 3CONA 4FGSA 2HSWA 4G84A 1TUEA 3DWIA 5CLLA 4HLUC 4RZUA 1T5OA 3JZDA 4KR9A 2PFKA 4BV2A 1B6TA 3EZNA 4HVCA 4MWZA 2JLVA 4RFSA 4AY4A 4M1ZA 5CLHA 2C3UA 4HLNA 1MA0A 1Z7WA 2V7QD 5FWYB 3HXOA 1T3LA 3EC2A 3D6AA 5SZJA 2G8NA 3EZ2A 2X41A 4YJ2A 1U3CA 1I13A 1QS0A 1VCIA 3WB2A 4CDRA 5JJLA 5IHXA 1KTIA 1KXJA 1KYYA 2E89A 4ZV4A 1N57A 3NBMA 1JDZA 2WV7A 4FP9A 4WTOA 1K3FA 3TQIA 4CL3A 4IHKA 2Q6VA 1K9SA 1DIGA 2Q62A 4D02A 1GFSA 3WQHA 1RHJA 2QVZX 1V71A 1ORRA 2VQSA 3GPCA 2O50A 4NAUA 1PWYE 3CPJB 4MS4B 5FAKA 4MDEA 2A9RA 2PRYA 5A7GA 3VKVA 2JD0A 2X22A 3AW8A 3Q6MA 2VBVA 1XTPA 1YB7A 1NY5A 3HN2A 1VGRA 3K1TA 4Q1DA 4REQA 2EKDA 2L17A 4HZIA 4HDSB 4X6LA 5ECGC 5DE3A 3ZCPA 4CUZA 5HWSA 1ZJZA 4NE7A 3DHWC 2QNIA 3FUTA 5A0TA 3H9QA 4ZCLA 1ONBA 2JJ1A 3JQ8A 1E92A 3C3DA 4GGMX 4X60A 4V1CA 5EIEA 1Z0KA 4GO1A 3MJTA 4IDGA 4FN5A 3O74A 2F64A 1NUUA 3NWEA 3ICOA 2BGKA 1XK7A 1C1YA 3NGXA 4H6VA 4RPIA 2YWGA 4NS4A 3R6JA 4RDCA 2W6JD 1RRCA 1GCOA 1TM4E 1M1UA 3AU9A 5D3KA 3GUCA 1Z45A 3TD2A 3V33A 3U44A 1II0A 2A0FA 1GPNA 4FDMA 3EVGA 3O4FA 1JV2B 4JAVC 4KX5A 4GI2A 2NNWB 1IBMB 2FN7A 4C04A 3I30X 1UKYA 1S9HA 4XSVA 3O2QB 1NUQA 2GF2A 2FXIA 1KR5A 1R64A 2PL3A 5IX8A 3BGIA 3H9JA 1ZD8A 3WGOA 1FP4A 5J35A 1UBLS 2I4OA 4EHDA 2P11A 1NMYA 1U1CA 3JZAA 3FI9A 3R4CA 3PDWA 4HWSA 4OI2A 4C6TA 5BSXA 3ADDA 3FH0A 2HK8A 1JIXA 4DGSA 3KTDA 5EJ9A 1W8DA 1E2LA 1OIVA 1J2RA 2O57A 2OHIA 3QH4A 4G01B 2RK6A 4J7XA 4OA8A 4RJLA 2DPGA 2N1BA 1CRQA 2RHLA 3U62A 1SKAA 1SIUA 3K9FC 1XF1A 3N2IA 4EY8A 2CLHB 1QGOA 4RY2A 2PGOA 2ZB3A 4J29A 5JNLA 1VQ9B 1PX0A 2WBLC 2YXDA 4JMPA 4MEAA 3MRSA 5LMNB 3R41A 3HRHA 4M1EA 4UNNA 5KKNB 5TT1A 5GADl 1EB8A 5B7PA 3OG9A 4R0MA 3RNOA 3CCQB 3FKSA 2C7BA 3A2KA 1XIVA 1Z3CA 1U98A 2XYRA 1F2UB 2HIHA 2ZXFA 1YQEA 3D3EA 2OTJB 1SUDA 3I01A 1NNEA 3HNOA 1XTTA 3M9LA 5CK5A 2JI4A 2IDMA 1JLKA 3RSLA 1LJLA 2POCA 3VU9A 1G4UR 2GJ4A 1ENOA 2YV5A 2FEPA 4Q6BA 1G9XA 2IGBA 1JZQA 4GS5A 3N7TA 4Z4WA 1NV9A 5DK6A 2ISCA 2ODWA 3X1WA 2KM1A 4FYWA 3GRYA 1YJ8A 4ZIRA 3C8HA 1B2RA 1VLVA 2PXXA 3LLSA 4H08A 3AL3A 1E77A 1XMSA 1EB9A 3OH8A 1RQNA 3EB9A 4ARIA 1AT1A 4ZHSA 3G82C 2C57A 3M6XA 2PGXA 3DE6X 3KR0A 3CC2B 2H4ZA 4AWXA 4AMZA 5L40A 2GT1A 2G71A 3UT5B 2X8WA 4DG8A 3LPLA 9LDBA 4QFDA 3HCWA 1WAMA 4OPSA 3O75A 2XQFA 2CXTA 4ND1A 3ITDA 5DNWA 4KKXB 5EP1A 2BEWA 3EIHA 1XCJA 1Y5MA 4JOSA 3SEAA 1U8CB 4PONA 2PLFA 2FHPA 1NW7A 5IYZA 1E6WA 4CMEC 3DB2A 1CFJA 1NA5A 1SIOA 1WD5A 4C29A 2C3YA 1C3EA 2PX5A 1HDZA 2CZQA 2MIIA 2R2GA 2IXDA 2RAFA 4E5YA 2HCJB 2VSQA 5AK6A 4GR5A 5JSYA 1X7WA 1NLUA 1EIZA 1W5SA 2CFTA 3INNA 3NHBA 2WM9B 3VHQA 1JVSA 1BE8A 1PJ3A 1U3UA 5ALUA 2JKYA 1F5SA 4EB8A 1AXRA 2OHXA 5CR9A 2IY7A 3G68A 4FKBA 2VJMB 1Z5OA 1P61B 5J4YA 4QU0A 1PLKA 3FCAA 1TJPB 1XMPA 3OZBA 1DXOA 2P2YA 4G65A 2Q6TA 3GZNA 2QD1A 5ICFA 5ARBA 3I9FA 4MV6A 2A59A 4YH1A 1JKIA 1U2ZA 2GJAA 1DJPA 1VPEA 1JHXA 3B2QA 1X80B 1ZZEA 2HSZA 4CLEA 1XSEA 3KJZA 3WA7A 1NOIA 3F6YA 3C7TA 5HG0A 3ONEA 4TQAA 1KDVA 1F4VA 4XW2A 2P75A 2Y0PA 1XHFA 1XQBA 2D5AA 4M87A 1C9KA 2A8YA 2HLDA 4UQPA 3V1MA 3VC1A 4AULA 4FHZA 4GYJA 5A5FA 1EEHA 1RI2A 1O0BA 1JU3A 5EFOA 2WJ4A 1Z4MA 3ZYZA 5ELMA 5AESA 2DFLA 3UKOA 1YS6A 3IQEA 2CJXA 1E4EA 1PGQA 1IY2A 3K9WA 2IXAA 3OTHA 4HAYA 1CQXA 5DFAA 3SZMA 3OKAA 5L3RA 1FPQA 4HC4A 5HZMA 1XD9A 5IVPA 1DO8A 5JRDS 5BVGB 5M3BA 4PC3A 1D2MA 1DKUA 1RP7A 2AWNA 1DV2A 1HI9A 4QTYA 2RHDA 4S1NA 1B93A 2C2BA 4L27A 4URFA 5C7LO 4IQ0A 4V1CI 1UK7A 3MOGA 1OWMA 1VQ4B 3LL4A 3QFSA 2X23A 4MQEA 4ZCRA 2C2HA 3D8BA 1QH8B 5AHXA 1K7YA 1A95A 2WZBA 2CLFB 2XGGA 3LOPA 2BBOA 2OHJA 3GJXC 1YFJA 3QIAA 3CYFA 3N07A 4NAVA 5CYFA 4E7PA 2X2OA 1XZCA 3UATA 3MGBA 1ZGZA 3C3BA 3QITA 4WRRA 4GDMA 2YMLA 2FSIA 3MT0A 5HKBA 1T1SA 3SICE 4N3CA 3ZK9A 2D7CA 3KOUA 4LRQA 1ADFA 3YASA 1PVVA 1QHEA 2FPPB 4Z9BA 4HLDA 5B6IA 1ZCAA 5FNVF 5BPHA 5CVTA 1BMFD 5KTRA 1EFUA 3C3KA 4ZEXA 1R5NA 4YGYA 1XVAA 4HGZA 1RZRD 1FFYA 3CTPA 1SQ6A 1U9IC 2F67A 2HPAA 2P27A 3H05A 4XORA 3DZKA 2CDCA 3KKQA 3KKZA 3I6ZA 3QOFA 2XDWA 4O33A 4X3PA 4YP7A 5A6SB 2R6CA 2HQBA 2ZU6A 3AZQA 4RENA 3Q8LA 1FNBA 2CW5A 2FOIA 4BVAA 4J16C 4HAXA 2WYOA 3R76A 4ECAA 1IHPA 2IU6A 3PDIB 1O6CA 5IYQA 2ZL6A 3C6ZA 4KDRA 4U7HA 2R00A 3RS8A 3VYSB 1E9SA 2G09A 2QTCA 2BMVA 3DZCA 3QMVA 2VQFB 3HVIA 3TDNA 4HAUA 5F1PA 5LXTF 5K4HA 4O63O 2ES4A 3EY9A 4AJOA 1DJMA 4HIZA 3K30A 4LC0A 2YJ5A 4IIDA 3FPCA 3USES 2MTBA 1FBNA 1ABEA 1KBQA 3BCFA 3CZPA 3MM4A 3LW8A 2AQIA 2D0PB 2J46A 3AFMA 2BUCA 3AI2A 4HDKB 1X2BA 4NNOA 2O2SA 1DC4A 2LIVA 2GFQA 3I9V6 1C3OB 1NC3A 2QMOA 2YUIA 4LTNA 3WGYA 2DR0A 3LBHA 1M34B 3UZUA 9GPBA 2P4SA 1XTSA 2GPYA 2A58A 1MC8A 3PXGA 4DADA 5BURA 2A35A 1RJ9B 2ZS9A 1CKEA 3E1KA 4WNAB 5JAZA 2JBHA 4P3KA 3WA6A 3I1JA 1SULA 2HO4A 4QGBA 1XDBA 2FMTA 5CEFA 3MXOA 2O8NA 5DM60 2IX3A 4HDCA 1EWYA 1PJ4A 2PR2A 3EGWA 4P5EA 2BKLA 1Z5GA 2UUBB 1J23A 1JIVA 4KE7A 1TF2A 5I45A 2B98A 3WOVA 2UDPA 4L8YA 4YMSA 4OI0A 1DXHA 3E18A 2F3SA 2HXSA 2RH8A 2Z8YA 1MB4A 3SZRA 4F2PA 3HWWA 4C4YA 5KOHB 1VLMA 1XE3A 3EFHA 3HCFA 3KL4A 1SM4A 1S2IA 1RYEA 2DGDA 2PKRA 4X07A 3PNLA 1TRHA 5HMLA 4EBFA 1KOGA 1XWWA 2NXJA 3R5XA 4PAWA 5DYGA 2OZKA 1RKVA 2H9AA 2DVMA 1Q91A 2UVQA 3FZQA 5CITA 3TRKA 4OX9Y 4NZ9A 5K4AA 1JG6A 1MD9A 4JUCA 2ZIUB 4WKOA 3VJKA 3C3JA 5BOSA 5F23A 5G0TA 3WR5A 4EUKA 3OPMA 1G8YA 1IUKA 2XMPA 4HI0E 4IOLA 5JCOA 1QWOA 3AJ8A 4GSLA 4JB8A 2UUCB 3PXAA 1WXHA 1D8AA 3T1TA 3ROPA 3W06A 4Z6KA 3K72B 4HVAA 3UG6A 1HVXA 3FYUA 5BWNA 3AMVA 3N7AA 4QOJA 4FMBB 3A3NA 1RI1A 4X7FA 1Q21A 5JT1A 3QUBA 4KAXA 5EHGA 4X94A 3L8HA 3HYRA 2P35A 1P2GA 3KELA 2Q0SA 1B8UA 2AJBA 3JYNA 1XXLA 1C3VA 4D9NA 3KEQA 5JZOA 4FSDA 3TRDA 4HWKA 1I36A 2DHCA 4N18A 4MIOA 3IPLA 4UNQA 3FHJA 3D81A 4QBKA 1H4TA 2KYRA 1NJGA 3I45A 3SSAA 3X1MA 1XRQA 1I3LA 2JFPA 3GT0A 3UMGA 5GZ3A 5GOTA 1C50A 4NEGA 4K6FA 1L9KA 1T6XA 1KI9A 2YQZA 3OTQA 1M2HA 1ORIA 3ZV4A 2ZGVA 1ESCA 3FSEA 3GT3A 4TV9B 1ZK4A 2VHVA 4I1YA 5ILQA 2XLBA 2ZULA 2OTCA 1KK2A 4A8JA 3UA4A 4K1XA 2E37A 2JFWA 4LXHA 4NG4A 3WLNA 2F7SA 4L5JA 3TQFA 1F8FA 4KE8A 4O59O 3GNQA 3JYOA 1H93A 4K86A 3CCSB 2IIBA 2X1VA 1MTZA 1O9GA 4HQ0A 4ZT2A 2BSAA 5BWMA 5A0FA 3BF8A 3SJBA 3V8PA 4Y1FA 3OBBA 4KCGA 2NO7A 4FR0A 3L7YA 5AKHA 2EW8A 3T4UA 4MR8B 3ZJ5A 2HU2A 3QYPA 2GMWA 1ID8A 2H1SA 5EJGA 4OOEA 2PEZA 3BJEA 2QPLA 2JFOA 3BFPA 3QPDA 1E9CA 1G5TA 5THQA 2GBLA 1M34A 1RKBA 1AM4D 2GXSA 2JAQA 2HQ1A 5E1BA 4RULA 4CF6A 1VMKA 1KC8D 3IUMA 4RHUA 4G23A 1M2FA 2XRYA 4EUSA 4F85A 3WIUA 2UU9B 5C0OE 3CPSA 2O8EB 1CS0B 2YJNA 1XVUA 3GIRA 2PXCA 2B4QA 4MUBA 1CZOA 4BGIA 1JDUA 4Z1MD 1LA2A 2ONKA 2PDAA 3I53A 4HUQB 4V2IA 1WO8A 5E4FA 1TVCA 4FFOA 1FSGA 4ISBA 4N5NA 4A0HA 2PLWA 3RS7A 5B1EA 1YZUA 2OO7A 4QX6A 2PKXA 1L1QA 1SBYA 3DBOB 1UF9A 1ZEJA 4LYYA 4MP6A 3AETB 2Z2XA 4JEHA 4RLHA 4GOOD 3N0WA 2Z43A 3E2PA 4OHCA 2BC9A 1MAAA 2R4UA 1E2UA 1KMIY 3WYEA 2VJDA 4WLNA 4A6PA 2LTAA 2GN6A 1EG2A 3S2FA 1UK6A 2CHGA 1TYZA 3IBSA 4DSNA 4HTAA 4HQKA 3AB7A 1S02A 4JIMA 4Y3UA 3X2FA 1R8YA 1M1ZA 3Q6IA 2F1OA 4YJFA 3RHSA 1ZOPA 5JH7B 5AIBA 3RTAA 1AGNA 4JLKA 4KXMA 4I7EA 1TD9A 4R4JA 2JZOA 3QOWA 4DA4A 1SZDA 1Q57A 5TGTA 3B38A 3VO9A 2NV4A 3ICWA 1GKYA 1NNSA 3RC8A 4KDCA 5CNIA 2VA8A 1LSSA 1Z83A 3HDYA 3ANYB 3K1AB 2BM1A 2H11A 5SZKB 1PTJA 3EQ8A 1OGIA 5FV4A 2CRVA 3RASA 4BBZA 1E1KA 1SO8A 3DAPA 3FGNA 4K87A 3LZCA 2IYUA 2QPTA 3DLPX 1JILA 1BWSA 4IV0A 4TL6A 4UD2A 1ZBQA 1EMDA 2RG7A 4G0YA 4Y2UA 3COVA 4OIMA 3TRJA 3ZZ1A 4DB4A 5L4NA 1V8FA 1ZWLA 3OLWA 2UVPB 4FW9A 1OU4A 3LV8A 1NYLA 1RXSA 2DBVO 1DC5A 2AK3A 4WGGA 1G7CA 4E0BA 1AQJA 3FHTA 3FBTA 4F9EA 3E5NA 3QI2A 1Q1AA 4C78A 4WCVA 1R0WA 1ODFA 2ETXA 2QMUA 4RCYA 1G17A 4WZZA 1E79A 4LZJA 2NP7A 5JRJA 4MLZA 1I1OA 2EKBA 4NCHA 1VKOA 2QXTA 1W73A 1KOFA 2AXNA 5JYCA 3D6VA 2K4MA 5F35A 4AROA 3ESDA 4RXMA 1TYBE 4RTJA 3IVCA 1GG5A 3LL7A 2OB1A 4P2NA 5JSHA 3W79A 4B83A 4QU8A 1E18A 3IA7A 1RJWA 1NJ1A 4LRXA 2I7DA 1KFBB 3ZCXA 3JVDA 5DHFA 3EZ6A 4AJEA 3MT9A 4XZ3A 4E5SA 2GVNA 3ANTA 1SVSA 4X0CA 5FL7A 4R0VA 4RL6A 1RLJA 1P1FA 1R8SA 1A5BB 2VDPB 2YC4C 3HBNA 1XV5A 2FGJA 3H4TA 1NIJA 3D4OA 3TAXA 3QX8A 1E9BA 1ZHOA 1Z08A 2ZE7A 3DUFA 1W75A 4D6PA 3UO8B 1GGVA 1PQUA 2WT8A 2YXLA 1P80A 2G5CA 2VWGA 3CEMA 4LY6A 4NFYA 1HDYA 5DN9A 4ZU1X 3OJXA 3CBGA 1R15A 4H7DA 4R1QA 3VJLA 1LFAA 1STOA 3KNZA 4ITRC 3PX7A 3GFOA 1X1TA 1NFQA 2ZREA 3QBTA 3ZBPA 3U4MA 2TYSB 1RAAA 3VMFA 1T9KA 4CMEA 2I4IA 2JZNA 1S96A 2CE2X 1XKTA 4J0CA 3U7HB 4UASA 1EFAA 4QHTA 2XUOA 3OMWA 3G5TA 1P9OA 3CZ4A 1F8GA 3DXZA 4YALA 1Z5UA 4AYTA 2JCVA 4JBNA 2WU8A 2YVUA 3FSGD 3VYRB 1PQWA 1WUKS 3ABRB 4JROA 4B87A 3RHTA 5AXDA 3KP1A 1JU9A 3G9QA 1L4YA 2WYVA 3VZPA 4BUJA 1CIPA 4MQ6A 5HM8A 1GZ5A 1KY3A 5K3OA 1BWPA 1FTSA 4D4IA 5B6JA 1UBNA 2J0EA 4DNFA 1COWA 4D92A 1VQKB 2WWFA 1KK1A 1U1EA 3NXSA 2FETA 4JC8A 3ENQA 4X8LA 1YOBA 3SX0A 4M1YA 1SCDA 1YAJA 2AFVA 4RESA 1QHGA 1DG9A 2C42A 3QU5A 4L2IA 3LNCA 3K0KA 3AUFA 4RPHA 2ORVA 1XHLA 4Q93A 3ROFA 3KV3O 3UWMA 3W5AA 4I4CA 4UHFA 4V0RA 2WR8A 4PFSA 1TM1E 2PX6A 1RFLA 3IPYA 2CHEA 5TMEA 3VZQA 1J4AA 4JP2A 5A04A 2XUGA 3T5AA 2XPCA 4PNHA 5KKCA 4I1PA 1Z6AA 2BI4A 2H8GA 4WA8A 3BL5A 5EIHA 1GILA 2I76A 3LPDA 4C3UA 1EFVA 1HEYA 1JSCA 2PWZA 4LYFA 1S6YA 4PO8A 1N5OX 1XCBA 3KB1A 5A4KA 4WINA 2P7HA 5LPNA 4YAFA 1PJ7A 1N06A 5DCWA 4XGQA 4IVQA 3C1TA 2VJLA 4FNOA 4BNZA 2JIQA 1QMGA 4MHSA 5ALZA 3KD3A 3OM8A 4PX2A 1LI7A 2W2LD 5LDGA 1BHQ1 4AZVA 4B46A 2QD3A 5AP9A 8ABPA 1EUQA 1NBMD 1W4ZA 3HO8A 5AK5A 3RIYA 5IT5A 1UEJA 1WA5A 4I6JA 5K0JA 1Z38A 2E0IA 1I33A 5B1DA 4ZAYA 3CGWA 1EXWA 2KHZA 3IQGX 3UAOA 4XGRA 3GJ6A 4G81A 4OXNA 3UBTA 1E0AA 5DEIA 4Z4YA 1GITA 4IX9A 2ZBDA 4BMXA 1COZA 2G28A 4ZOEA 3KXLA 2YFKA 1LY1A 4WY5A 2ZZNA 3ZBQA 3QFTA 5FNZA 3GFRA 2ZUSA 1J2YA 6GPBA 4DV5B 4CEIB 2ZYDA 4N3NA 1X1QA 4O29A 2PKWA 4U0JA 4R2WA 2XUKA 3V8BA 4HBGA 3X1KA 4B3HA 3COSA 1Q6ZA 4D80A 1OV4A 4RDJA 3V76A 2QR5A 2TMYA 2ANBA 3JARA 1HYBA 3DDHA 5K3BA 4N0DA 2V1XA 3P0EA 2C4MA 2WABA 1M8KA 4M55A 5B12A 4QOIA 2XYGA 4M0PA 1J0BA 5LB2A 2R7LA 5K6RA 3P9RA 1L5MA 1ZJYA 2C2YA 1IN4A 4V24A 3DOJA 1XMVA 3FZEA 1MMFB 1YK0A 4OXXA 2NV0A 5DM4A 1ZSYA 5K0SA 3NOQA 3EA0A 4LHZA 4HEA6 5F7OA 4YC7A 1C7ZA 3REQA 4RVFA 3W8NA 2O07A 1VYUA 4XMYA 1U4SA 3ZV5A 4K0RA 1GQSA 5HCNA 1IBLB 3TNFA 4BTLA 1FW6A 2OCXA 1YZHA 4TWRA 2AB0A 2AN5A 3RVSA 2JLRA 3LUPA 2I1WA 3CHYA 4AJLA 4BLSA 5F9FA 4F56A 1J9EA 4KLAA 4LVUA 4C87A 5FJIA 1BGVA 2MJLA 3DEZA 3M2PA 2XBLA 4F9FA 2G1JA 3I8OA 1TZMA 2H4JA 4JELA 3HG7A 6CHYA 3U6BA 1K63A 2D8MA 4EQZA 3NDRA 3FUCA 4YMGA 1Q7GA 3KB6A 4C0KA 1T24A 1FNDA 1QG4A 3BB1A 3F3MA 2FU5C 1E32A 3JVUA 5EHIA 5I5GA 4B7ZA 5CT5A 2HC9A 4X71A 2ZATA 4HGQA 3RUPA 2DPLA 1N5IA 4C4AA 4RFSB 2ZYAA 1Z5PA 2CF6A 2CKMA 3CRMA 3RS2A 2CJPA 1ZI8A 1IZ0A 3NT5A 1XXHA 1P9NA 4ARVA 1N5DA 1T4BA 3PQ8A 3AKEA 3OX2A 3OPOA 4X24A 1P7PA 5TPWA 4GOLD 3RW9A 3GA0A 1SC4A 5EKSA 2BM9A 4S2EA 5TGDA 3TXXA 4TYNA 3EFOA 1E99A 1KMQA 3LECA 2I78A 3QWBA 1PEAA 3WRVA 1V2GA 1XQ6A 1XQ1A 3AH8A 4N48A 3RTCA 4AI6A 1JAIA 5JOQA 3LKBA 1BHO1 3PC7A 3V8RA 3PC6A 3IP5A 4GPZA 3H2JA 1PW5A 2RIPA 2OCDA 2R47A 4MOWA 4OXYA 4QXOA 1F4PA 1H5QA 1UBTS 5D5HA 3U3JA 3WK9A 1YVRA 5CXXA 4YELA 4Q9LA 3UTDA 3OP4A 3LY9A 1W85B 3Q41A 3QLEA 2XNDA 2R79A 3F7OA 1C2TA 2QAGA 3FWYA 1A1VA 1ZUHA 1Z06A 3SAJA 1J56A 5C7YA 2ZBEA 2AT1A 2G06A 3B1XA 4C2UA 1R88A 1TECE 3JQEA 1AGXA 5AI0A 2I6UA 2KE5A 3PHCA 3C1UA 4LGCA 1JXMA 2IH4A 1I10A 4HG2A 5C7IO 5EQJB 4KVZA 3THSA 5JC8A 4ZTBA 5FB3A 3TL6A 2JI8A 3CR7A 1QIGA 1S8OA 4GVPA 5CLJA 2Z09A 1IBRA 3ZXYA 1ECJA 1YI8A 4AZ3B 3TF5A 2NMVA 3AF6A 2P2CA 5COAA 1OWNA 1SVNA 4RQTA 3S99A 1EJ6A 2ZCUA 1DIHA 1G42A 2WTXA 1J0DA 2W4QA 4Y6PA 2Q46A 4EEZA 1K9VF 3IH5A 1J2JA 1DHTA 3I6IA 4L5IA 5EN4A 3O4VA 2Y1EA 3H5NA 2YHBA 3H84A 1RRFA 1I80A 4RANA 5F78A 1IXZA 1GKIA 4IMJB 2GLXA 1FOEB 1F9AA 1ECPA 1NZJA 2HM7A 2OBMA 4QBGB 3F96A 3B20A 3T3PB 1YB6A 2J4CA 3A37A 3NDJA 5CEJA 4DV3B 1BVRA 3L8FA 4S24A 3LGSA 1ZDMA 3ET4A 3I09A 5HKKA 2FN8A 3OHSX 3ROKA 4B75A 1W0KA 1D07A 4PZDA 4GKVA 3T3GA 2ZBPA 1EFVB 2MYUA 1N9KA 2P2NA 4OOFA 3FMVA 3QP9A 4OHBA 3L84A 4WZAB 4MV9A 3IBGA 2FWJA 1P62B 4WH0A 1SNYA 1Z2PX 1MRNA 1BKDR 3INRA 3KYIB 3K0AB 4QFBA 1NDUA 3UAWA 4DJDC 4FMCF 3PIDA 5IN4A 1XJWA 5K3SA 4B82A 1JEYA 3B1ZA 4FFVA 1AQNA 2Y4OA 1FP2A 2O48X 3R1IA 2IYLD 1CNEA 3BVPA 1FFCA 4OJQA 2ODEA 4QSMA 2J9FB 4Y9DA 3RWOA 1ZR2A 1LH0A 2JGIA 3WLLA 4NZZA 3W8RA 4B9AA 5A5EA 2VATA 3OT1B 4OXIA 4BUZA 4N3AA 1V1MB 4KR7A 3T5PA 4F7DA 2EJBA 1XAHA 2ATCA 1YUMA 2Q29A 3MS2A 4MHTA 3IUPA 3AEYA 1N1GA 2W2MA 5DTQA 4POAA 3RJ9A 1UD4A 1QP8A 1PCXA 2WIKA 3ZJYA 3L0CA 4AJIA 4YPVA 5KNDH 5FWNA 1PR9A 3D7NA 4PPYA 2BKXA 2BFDA 3IHKA 2OZPA 3CH7A 4QUHA 3R7AA 2XCOA 3QVVA 3Q2KA 3HV0A 2NVWA 4NQZA 1PHRA 3F8TA 1ZCJA 5ALMA 1S7CA 1EJBA 3V4VB 2UYCA 4CTJA 4NDNE 4L50A 3RKUA 3IKTA 3E22B 2P9ZA 1PK9A 1FDTA 3GMTA 4HNQA 3UA3A 4HHEA 3JD4A 2ESRA 1Q81D 3O8DA 3QBVA 4IG4A 4K6CA 1X7YA 3MHPA 4GI5A 4JD5A 3WRYC 1P1KA 2QTVB 2Q3LA 4YXWD 3E84A 3V5NA 4MWBA 2VJNA 4CMIB 2IXTA 1DJOA 4EY6A 1SG6A 5K0CA 3LBIA 1EWRA 1AU9A 1XNGA 1YGYA 4FJ0A 3Q38A 2PRJA 3GPBA 3RRJA 2KPOA 2PMEA 3ZHVA 4CKWA 3UXHA 4IJ5A 5HUJA 1Q7RA 1WZ2A 3LVQE 3JSXA 4ZVLA 1LBQA 4M88A 3OOWA 4H6WA 5LZ7A 3VPHA 5JJ5A 4XWWA 4QEKA 4RPGA 2VWQA 3WL6A 2BR3A 1L4EA 3IQIX 2Q2WA 2ZB4A 4MKFA 5SYAA 3HEMA 2AQHA 2HCBA 4I3FA 2ZUUA 2M6LA 1US8A 4W5OA 2NQTA 4N7BA 1Q17A 3UG7A 1W9HA 3HCBA 3WP1B 4C0JA 3G79A 5ITSA 2VDJA 2A1UA 4R0NA 1GFIA 3EXIB 1WB4A 2HNBA 5BR1A 5BV0A 1TEHA 4I0WB 1CEYA 2WIGA 3OA0A 3IMCA 3QY9A 1PR2A 3UYKA 5AJWA 1ZCFA 1TJ4A 4XLEA 4HXGA 1IJEA 4K6KA 4KI7A 3UJBA 5D1NA 3UHOA 5GOZA 3QF4B 4YDRA 3G2OA 4AF7A 2O8FB 4MINA 3R3WA 4MVJH 2FWPA 2Z04A 3TKYA 4AKTA 4DC9A 5B2FA 1NVXQ 2QX7A 2WU4A 3PNKA 5CDGA 5KI6A 2J9ZB 2DFTA 3CVOA 5K0GA 3MJ4A 1FVOA 3N2ZB 5L3QA 5HF6A 1A9XA 2J3HA 1T10A 1U0SY 3LWZA 3R24A 5AN9A 2D9RA 3HBAA 3MILA 4CYMA 1TJYA 1SCNE 3W6PA 3TD9A 3IBTA 3PP8A 1M1NA 2EYUA 2I66A 5F5XA 3W6ZA 3P94A 1BD3A 4WZAA 4CMIA 3ZDZB 5BWLA 1FFXA 2IDZA 2BONA 3O4JA 1PQ4A 1HSOA 1KTVA 3BDAA 5CVJA 2PM8A 1EVJA 1O03A 3GRAA 1AKEA 4Q12A 4RVNA 5LQNA 1LRKA 3GFBA 1EZZA 3E5MA 2H9YA 1TMKA 2PXAA 4IGKA 5K09A 1CJKC 1H2BA 2WJGA 1ZH0A 4L0QA 3BMOB 3CZCA 1N6OA 3L1HA 4WT7A 4LJKA 1CZNA 1KJYA 2XXAA 4U7WA 4FU0A 1YUNA 1N8RD 2DB3A 3HCDA 1HE5A 1UINA 2VZ8A 2O3QA 3PA6A 1YR8A 3CZ9A 3DM5A 4FC7A 4RELA 5EWMA 2PJZA 3ZR4B 3SWWA 4J49A 3SC3A 2AHOA 3WNVA 3WWPA 3QV1A 4OM8A 3GAMA 2EBHX 2A9JA 5BSRA 1MZPA 2AD5A 3AHEA 2WP0A 1L5KA 4BN0A 4C20A 4JHXA 1YS4A 4Q6WA 3N3BC 2X5KO 1W35A 3MZ0A 4MVCA 4YS6A 4FE3A 3DZBA 1CU1A 2G5PA 3N6VA 4KKUA 1ETUA 3IP1A 3ECCA 1V3VA 4R1PA 4OK6A 3I64A 5JXHA 4BNHA 1NVAA 1FTGA 3WMXA 3L7JA 3SJAA 1U1GA 1Y8RB 3H1TA 4K9NA 3EOZA 2OAP1 3ESRA 4W6ZA 2Q4OA 3ORYA 3TW4A 5BN5A 5DM70 5I9SA 2ZCVA 4ZI7B 1S89A 1HH4A 2ISQA 3BY1A 4TRJA 3EZ9A 4MRPA 3UT0A 4ARBA 1VHJA 3ZVLA 1N77A 2OXEA 7REQA 3O7WA 2LDBA 1SXHA 4B3IA 3V97A 3HJBA 3H1PA 3TFQA 3VOSA 3ZG6A 3OURA 2IHNA 3U39A 5U9CA 5LYJF 1Z37A 1HSZA 1WXWA 2A33A 2DX7A 2CLSA 2IWHA 4RH0A 3SHOA 2UUOA 5IC5A 4FLMA 4W7HA 4GP9A 4WQMA 2CV2A 3AWDA 4NULA 3TTYA 2PV0A 2WI8A 3FB1A 1NI4B 3CS3A 3ECAA 2RGXA 1TLFA 3GHHA 3HEAA 3LSYA 3SYKA 4AXXA 4OOXA 1GGKA 1WZNA 3WAKA 4BKRA 1DC6A 4DSTA 1T9CA 2TMDA 4RFVA 4BLOA 3U19A 3D2LA 2PX3A 1YITB 1WKBA 4KLRA 3ZHXA 4D3YA 4ZODA 2HCFA 4Z0NA 1PT8A 1XKQA 5BN4A 1DHRA 2NUTB 4M6WA 5B1YA 4RA9A 4UHEA 2KB0A 1DAIA 1I4EB 2RH9B 3BJIC 3GEBA 3F1KA 3ZGNA 2X8JA 3BL6A 3GCWA 5JJIA 4B74A 2GZMA 1XRPA 2HA7A 3W1EA 4BBAA 4LF8B 1PVOA 2J9GA 2ZJ1A 4A0RA 1I8DA 1T0IA 2Q5JA 1Y1RA 2XB8A 1MJ5A 2BMFA 2Q5IA 2ONCA 3WQSB 5IJZA 5EA2A 1XRSB 4ADSG 4BRWA 1OFUX 4LZLA 1KYWA 4UU0A 5IPFA 5SZIA 1FFXB 4YP1A 1P77A 5BOSB 3K6JA 3IX7A 3AOEC 5FBLB 5LSAA 5ED4A 1YGPA 1WPXA 4L8GA 4ZTZB 2ZRAA 1EZ4A 1V1MA 1NC1A 3R3ZA 4F4CA 2I1LA 2Z57A 1UMBB 2Z6UA 3GVKA 4UEKA 3A1EA 4KXVA 4LECA 1DZ3A 4NE9A 4F0JA 3QENA 4AP9A 1MB9A 5B1HA 1DLIA 4MVJD 3GZNB 3QVGB 3HXKA 3LLVA 1FTWA 2BFPA 1A7AA 3LW7A 1YRBA 4R1NA 5F2KA 3OAAA 4OLAA 1TU4A 5DMXA 4N54A 4WCFC 1PSZA 1UUFA 4E21A 3PK0A 4X7MA 5DXJA 3CLKA 2HK6A 2ZQYA 4RK6A 5LP6B 4IWYA 4G7WA 1P0PA 1DU4A 4V38A 1TCUA 2E6UX 2ZVQX 3VSBA 4E3ZA 1M1KD 4KWHA 3FPPA 2BFAA 4YRSA 4NCNA 2EV9A 1NHWA 1UT8A 1AMUA 1KORA 2JCYA 3PA1A 2PZMA 4LRWA 2Q7OE 3RRFA 3IUBA 1BDIA 2YUTA 1PNVA 3BMCB 5ITZB 2HDNB 3SOZA 2YIMA 2OG1A 4NBWA 3TLAA 5K2OA 2AK2A 1NATA 3TLBA 4LAFA 3DXYA 3P0JA 4MVJA 5FA5A 2DWQA 4EPYA 3PUHA 4JLNA 1E8MA 3MD9A 4BP8A 3G1TA 1A4XA 1JSXA 1RVDA 4TUYF 5HXAA 5LWHA 1E64A 1KARA 1ZD9A 2OKCA 4CE6A 4DRZA 2VCEA 4P8RA 1WZEA 1KK0A 3PICA 4YJGB 3SE7A 4WKBA 1L0BA 2ZRQA 2HU7A 1L5SA 3I01M 3UWSA 4CM7A 1YS7A 2AEMA 1I7SB 5EIWA 4LOAA 3PEYA 2O3SA 4EB3A 3GJ5A 4O5OA 4FYJA 1SBTA 3BK2A 1MO5A 3U3ZA 4PX9A 3HA7A 1KY5A 1TA4A 4S1WA 1KH3A 1YB2A 2JLZA 1NVWQ 4LISA 3SQLA 5BUCA 4OAQA 2NO0A 3BXXA 4A03A 1KVUA 3W9SA 3VSDA 1J99A 4Q3NA 2ABWA 3TM4A 4BQPA 1MO2A 2R1TA 4ZT6A 4G4JA 1C1XA 2CXPA 1WY7A 3WLQA 1IN1A 1UD8A 2BV3A 1AVTA 1FXSA 2B4TO 5CCXA 4LF4B 1EUCA 1ISSA 1R10A 2CMGA 3UK0A 3KSDO 1QFZA 3CH4B 3BHNA 1Z4LA 3PL5A 5L3ZA 3D7MA 4P22A 1NONA 4A6XA 4KIFA 3RQIA 4IX1A 3VNVA 1BYIA 4P34A 3UK6A 3RSQA 1LVGA 3DHNA 4XWAA 2JIOA 1ZR4A 3H6GA 2BPOA 1K5DA 4IHAA 3C5HA 4EG6A 2C94A 3GCGA 4G97A 4AG5A 2CMKA 2NN3C 4OUKX 3DR5A 1Z36A 1P4GA 3WGHA 1UPAA 1W1UA 5CT8A 2ZOSA 1N34B 3GYGA 3AJDA 2QT1A 1E60A 3ZH2A 3DJFA 1QVVA 2JB9A 2GN0A 5CLGA 4C76A 3U7QB 4QQRA 1JEQA 1W0KD 1CY2A 1Y1KE 2R2AA 3KJGA 3N6RA 2H0QA 5BPFA 2HQRA 1N92A 2PSJA 3KBOA 4O08A 4QGAA 3P2EA 2G5TA 2PMFA 1TGYA 1TZ2A 5HYVA 1T9ZA 3HO6A 5JANA 4A4DA 4A1FA 2D8AA 2QL5A 5JAQA 2ENWA 1QE3A 4HWRA 1VQNB 1Y5IA 1YZFA 3FOWA 2J3JA 1HTWA 1X0VA 3N2KA 1J8YF 1K5HA 4IUCS 1A1SA 4WFKA 1NBAA 1F14A 3RVBA 1P0QA 3PNBA 3PZBA 1ZKMA 4L73A 1OFUA 3EMKA 4EF4A 1GEEA 3NTLA 2V4UA 3LBYA 3H5LA 3BMXA 4KXNA 3G0OA 4FD3A 4MZDA 3VSAA 4KR6A 4GP6A 1FSPA 4V0ME 2FSSA 3B1VA 4O6VA 4BMNA 5LBTA 1S3IA 1EEXB 4E1AA 2Q28A 4U7PB 4CMJA 1R6AA 2ZAGA 4G4SP 1AN9A 5MF6A 3CZRA 1LPAB 4M8NE 1W36D 3KWFA 2HU5A 3WLTA 2HUNA 2X6WA 3QW4B 3GP5A 3COYA 3GLFE 3CUUA 5DGIA 1XZFA 4P83A 2CXRA 4JLJA 5LQCA 1CUVA 1U9CA 4EA8A 5TV2A 1TMOA 3BIJA 4L9RA 1L1RA 1VFPA 2AYYA 2I8LA 3H42B 3NEPX 5E0KB 5B58T 3WYCA 2O8DB 4R6WA 3C3XA 3S70A 3TR6A 3CQ9A 2NU8A 4U3JB 1ANKA 1F2TA 1KMMA 3ZHQA 2OKGA 3RUHA 3WGIA 1QCDA 3UB2A 4Z4ZA 3KKOA 4J6EA 4M8IA 2J3IA 3KEMA 5G0SA 1LTKA 1AE1A 4WV3A 3VSCA 5G1NA 2YWRA 4IM7A 2O9JA 4QDTA 4PLHA 3TSZA 4WESB 1QH8A 4C7KA 3OJOA 1OKKA 2CD9A 3O2SB 5TDHA 3D31A 3E81A 1CERA 4JBYA 4LSMA 4TL8A 4KRXA 2C2OA 5BOVA 2BE9A 2ZIGA 2JW5A 4UE2A 4PO9A 4XR4A 4OLFA 1HYHA 2YHIA 4HNTA 2BVNA 5LIRA 1GGNA 3THYB 3O3MB 1JL3A 1Y33E 2VDMB 4ZZ1A 1QE5A 4GLBA 2BJVA 4P36A 1DNPA 3E9DA 2AUNA 4KXQA 4NSNA 2VXOA 1NXSA 2UZ4A 1PE0A 1VL5A 1FS6A 2P40A 3I92A 4YQEA 3KSBC 3O21A 4DCNA 3OQNA 1G1AA 3IKVA 1GCAA 3LAWA 4WWVA 4DMUB 2YBDA 2VDVE 2RBKA 1RLOA 3CLSD 4B0PA 3TLZA 3O8LA 2HK7A 3RF7A 4A15A 3SE0A 3BKXA 1THTA 1N2OA 5MDHA 4Z51A 1SG0A 1UXIA 4Q4CA 5A2QA 1KO4A 4A6DA 3O91A 1IONA 1CSEE 3A8IA 3EXG2 4IEIA 2VXBA 2G07A 3OPQA 2P3SA 4ASUD 2RKOA 4BBJA 1ZCBA 4IDQA 2QN9A 1JH8A 3G9XA 4B5LA 4CTMA 4W6QA 1V4BA 4E51A 1GA4A 5K03A 1J5EB 2FWIA 4EFLA 2VJBA 1WKCA 3RARA 1XN1A 2PKYX 1CR2A 4O25A 3WIEA 3NDPA 4MR7B 1B6GA 3NHYA 4HXEB 4RHXA 4AJ1A 4FHFA 4Z1OA 2VJQA 2QTWB 3W2HA 3EDRA 3H4IA 2H0AA 2NO9A 4U0KA 3DTVB 4D4MA 1K6XA 4BP1A 1EX9A 2R6JA 5JW6A 3Q40A 5D87A 2PBZA 2ZZEA 1WE2A 1HDXA 1RIFA 1RXEA 4RIFA 4BGEA 4ZXPA 1VF7A 2C4VA 1S2OA 2WNHA 1ZNYA 3OTOB 3NM4A 4ZVMA 1B1AA 2XWQA 3TQQA 1P2BA 2B5WA 3ASTA 2J3MA 2LE0A 4FX2A 5CPBA 1E5DA 4OO3A 5DLDA 1PVDA 2AKYA 5KTMA 3L2OB 3Q0EA 2COKA 3U0BA 3FPGA 2Q3FA 3MSCA 4BQEA 3ZW7A 1DV1A 4FDTA 3RHZA 2CC2A 2BFBA 4NONA 2ASEA 4LV8B 3PFGA 2O2YA 2GO1A 1U9ZA 1BFUA 3DZ8A 3TLKA 1U6JA 4XRGA 3O1JC 5K99A 1LK5A 5J43A 1XEWY 3D2BA 1K5PA 1K7XB 3I04M 1TUIA 3L8DA 3S1LA 3JQ9C 3GQVA 1YZNA 1JDVA 2HAEA 3BIWA 2GF0A 2QUKA 4Q21A 3COJA 2E18A 3W7AA 4EL0A 2P8JA 3C14C 2YZMA 5HK8A 1SUPA 1UBRS 4AMVA 4D3FA 4XKWA 2GJRA 3AKDA 3B9QA 3DKRA 2GFHA 1ZGGA 4YMHA 3TVTA 3ZDEA 4DBLC 1USKA 3HN7A 3N8KA 5IRCD 2O05A 1E1RD 1FIUA 3P4XA 4CLOB 1UD5A 1C1HA 2EW2A 3PHJA 2V6BA 1SC1A 1WCWA 2H7XA 3INTA 3HU5A 1YHYA 4XAQA 2B8WA 3NNDA 2OECA 2V4ZA 4TPKA 3IAM6 5KX5B 2WWWA 3BA6A 3G2NA 5ALLA 1OLXA 4KPYA 2H65A 3QFCA 3IUQA 1O54A 3LDAA 4MKIA 2VYVD 4Q39A 1JKJA 5D00A 4BKQA 4C0LA 2QYHA 1LPNA 1E0JA 3QGMA 121PA 4Q4JA 3TQCA 5I7VA 2PD4A 3A31A 5KOJB 3RADC 1H8HA 4F1KA 1ZWKA 5FDFA 3KUKA 3PVCA 5JY6A 1FL9A 2WAXA 3KAKA 1O5TA 4OHRA 2GN8A 1OGYA 4TT8A 4Z2YA 1YBVA 2N9UA 1JHRA 2INGX 3V8MA 3TKAA 2Z1MA 5LUAA 3H2IA 4EJMA 3AI3A 4MVJI 4LC1A 4JL5A 3ZZTA 1VIYA 2P6UA 4OSPA 2PKCA 4FGLA 4QBTA 4YLEA 2D7DA 3ETEA 1I9CA 5EWMB 3CNQS 4AJ4A 4B0OA 5ECDA 1Y6JA 3IIIA 1V35A 4BKOA 1XALA 3V9PA 3C8ZA 5LFAA 1EPUA 1W6UA 2BZSA 3C39A 4FOOA 4Q66C 2VH1A 2X0EA 3R8XA 3WYFA 4AO8A 1E3TA 5AM4A 4EMTA 1ZHFA 5EWLA 5FOTA 1QYXA 1K7SN 1L7EA 3RTGA 3FNFA 4D79A 5A03A 1UOPA 3L02A 2E1PA 3U7JA 3E4CA 1A3CA 1I32A 2I2BA 1IJFA 2OGZA 3PNOA 4IDFA 3FCOA 3THWB 4KL8S 2XGSA 3OPYI 2F59A 4PLCA 4RY9A 5DF1A 2G82A 4KMOA 5A71A 1OXXK 2F4VB 1R6VA 4PFQA 1WB6A 5DYTA 1W25A 3JY6A 4I08A 2AJDA 3I3OA 3RVRA 3KJXA 3H19A 4CZ2A 2ENUA 2YW9A 1QG2A 1NW4A 5CYGA 3BAFA 3ZW9A 5GONB 2W93A 4JJFA 4WERA 1P17A 1P5JA 3P9ZA 4AN0A 4LYDA 4DIFA 4RKFA 4TMXA 1NQ5A 1DMRA 3HM9A 5FPSA 1G5IA 1HZJA 2PLRA 4FFWA 2X77A 4UAUA 5LKAA 1X3LA 4M37A 5F7XA 1C30B 3MINB 1I4TD 5FBQB 5EJ2A 3LHKA 4OHPA 3TEMA 2FDXA 2BISA 1D4AA 3NXKA 5ARCA 4JI1B 1N3IA 3WWYA 2JRCA 3ZBTA 4QXMA 3F3KA 4FR2A 4ND4A 1DAMA 5AM5A 4D4JA 4GQAA 2NSYA 4IQ4A 2WVJA 1XK6A 1KAQA 4O1MA 3NCTA 2Y99A 3BQNB 1W5TA 4AG6A 4BFVA 3T7CA 4ACBA 2D54A 4E5UA 1VL8A 3FWZA 3UT6A 2WJJA 4F60A 4TVSA 4P0PB 1P1JA 3M1LA 1XA4A 4Y1EA 1U0BB 1PJSA 1I1HA 5EZ6B 1AQ6A 3CG0A 1SU6A 3RT1A 2FXVA 3RJTA 3NWPA 4DEYA 4RKEA 1S8FA 1W4BA 1IXRC 3D3WB 1Y3AA 3GRPA 2AXQA 3K15A 4O4IA 1N6IA 2E48A 1TYDE 1F12A 2O2XA 4GX2A 4F1WA 1M0SA 3QY0A 1T6NA 3T4XA 2J7KA 2AGVA 3N86A 2H0RA 4UTRA 1HDOA 1PGOA 1YBAA 1BS9A 1E7RA 1T4MA 3LWDA 3PX2A 5JAHA 3K8YA 4ZI5A 4TL9A 3RC1A 4KXFB 4PLYA 1X86B 1GFWA 3KQNA 2WYWA 3BD8A 1SXGA 2WSSD 4Q7MB 3KZCA 3JQRA 1OW3B 2H08A 2JAPA 1D09A 4L72A 5BVGA 3UJ3X 2FCRA 3NS7A 4PHCA 1SVLA 1NJFA 3F4BA 3TTTA 3KR9A 3ZY5A 3EQ6A 1A27A 1BTOA 5BN5B 1QPZA 3GJSA 2IYYA 1KQNA 3TAHA 5CIQA 3FPBA 3JALB 3RRYA 4PS0A 1SG9A 1UPBA 3KFVA 4TVBA 2ZYTX 3HZOA 4FCCA 2GESA 4ABYA 3GVPA 4IIHA 4LPKA 4TQGA 4YPFA 5AVSA 1B23P 1E7QA 4TV8F 4B7AA 3ZY6A 4B8WA 3ITKA 5G0WA 1IXKA 1W59A 2JF0A 2X13A 3O83A 1T5BA 2UAGA 1QK3A 3G5UA 5EWJB 3QXCA 2HCRA 1SOMA 1I3CA 1HDIA 3JQBC 4QQ8A 4UHDA 1M8FA 1DEKA 1DWOA 3W6NA 2AYXA 2OFXA 4FOPA 4ZMBA 3OZWA 4B47A 3OZGA 5GAJA 4XN3A 1NFFA 4GYKA 4J3NA 1YVPA 2RCNA 3PE3A 2C1EA 1V47A 3A1VA 3B89A 3M4JA 2EJTA 1FEZA 1SUCA 2EX4A 4JHLA 2NACA 4UVEA 4L8LA 1QTIA 2JHFA 3OTWA 4OXKA 4R54A 4YYZA 4B3SB 1RHRA 2WMYA 1UCFA 3UMVA 4HD8A 2PBLA 1OAOA 4XRRA 3FW1A 3VPGA 3LKZA 3ZGVA 1OLUB 7GPBA 2Q9CA 1QAOA 5T3UA 3PJDA 2QZSA 1JFVA 3DOCA 1R0YA 1BCSB 3IV6A 4B43A 2WPNA 3JYLA 5LDDC 4UCWA 1E8DA 1YSCA 4LHYA 2PL1A 5H82A 5KYUA 4BZXA 1LQ2A 3L06A 3PGJA 3EZLA 2HRQA 2NT4A 4JLDA 5CH8A 4L4XA 1DIAA 1XZNA 4URUR 1AX9A 4BQQA 3RK1A 3TNLA 4JT9A 1EP2B 3F7NA 4H60A 2RJ3A 4YP0A 3NJ8A 4KWEA 5FWXA 2R6AA 1PR6A 3HRKA 1FBTA 2OILA 2YIDA 3PA8A 4RZHA 3QTTA 5IN5A 5FBKA 4B3DA 3FSJX 1P4JA 3P9QA 2HKIA 3GIDA 4U7TB 3DZHA 1B8NA 2ZBGA 4J4BA 4E15A 1I7NA 3NTOA 4X7EA 3S4YA 2WHYA 1E2FA 1UBGA 3MK31 1XZHA 3GFSA 3RJZA 3ENNA 2JIRA 3EEBA 3EWAA 4ZMRA 3KKEA 4HWPA 3ZHTA 1RBYA 3RK4A 4Z0TA 2R7MA 2V74B 4PSKA 5KVQA 4XL9A 2JARA 5HF8A 2REOA 3K8QA 3CMCO 1CDZA 1NG9A 1ZD5A 1PHPA 1WKVA 3SDSA 3JAMA 2CEAA 4DS3A 3DDZX 5BSVA 5JTTA 3ZDDA 2FKNA 3AIKA 5IYZF 3VU0A 4F2HA 5IH3A 3CSSA 1Q5PA 2B78A 4NOKA 3HO1A 4K03A 1EDDA 2O06A 3I39X 1M9NA 3OZSA 2AMYA 4BRSA 4F6CA 3ZDRA 1A4RA 1R4NB 4U3JA 2WVAA 1C8BA 1OX4A 1P6XA 3PJFA 4N01A 2YCBA 2GDZA 2Y1FA 1Y4SA 5H8WA 2RDMA 4M9QA 1KVRA 5GJBA 3L8ZA 4BZZA 3LQ2A 1JHZA 1U3TA 2IY8A 2OZLA 4O4HA 4LG1A 2VAMA 4TS1A 5BNZA 1OYWA 3F49S 3AHFA 2W6IA 1U4OA 2CNOA 4UBJA 3I2FA 1B1CA 1U94A 3CF2A 4BDSA 1CRPA 3BWYA 4CQMA 2P90A 1KR2A 4GBMA 1K68A 2HPVA 4RSGA 4WECA 4MQFB 2G63A 3P27A 1KEUA 3IAFA 2C29D 1R4ZA 2WF8A 4JJEA 4PE5B 4BB5A 3OE4A 4P35A 4PR3A 1LQUA 2R7KA 4IF4A 3VFDA 3IPXA 5KQPA 1FSZA 2NTVA 5JY1A 1Z6GA 2W6OA 1M5UA 2YWXA 1BJRE 1EK5A 1N32B 2G8LA 3ZE6A 4IHJB 1NX9A 5FQNA 1YU9A 1IBCA 3EEIA 4X9XA 1L5HB 1FRQA 1UBKS 1X42A 3CNBA 3QLUA 3FR7A 3BX1A 4PNZA 2OLJA 1V2HE 2ORWA 4GMGA 3IALA 2ZZQA 5J40A 4BIMA 2YMPA 4UUAA 3E20A 2I3DA 3AUAA 4YDSA 2BL4A 2I1VB 3JAWB 3SHVA 3S55A 2TMGA 1IVNA 2N1MA 2CL5A 4F12A 2FZWA 1LW6E 1K8XB 2P69A 2WSBA 5I51A 1T1RA 1ZSNA 3Q88A 4B7CA 2C59A 2W43A 2HR1A 2WTUA 4P12A 5HS6A 3EVZA 3M89A 4UHBA 3KVRA 5E6SA 2G9VA 3AVXA 3UJHA 2QVYX 3T4PA 2LNDA 1BE6A 1WBJB 1MABA 2QP3A 1OXKB 2PS0A 4D8UA 2NVBA 3TJMA 1UOQA 4YCNA 1DMSA 1V8BA 1L5RA 3GU3A 3JAKB 3LOQA 2B25A 1DWQA 4OBXA 2GILA 4FFBB 1T8YA 2PBFA 2VDNB 1L4MA 1ZYUA 1SC9A 2EZ9A 3MJCA 2JC3A 2XE8A 4M1QA 2IU4A 4MV7A 4L1KA 4W4TA 4X7BA 4DNRB 2QQ5A 4W5HA 2BGJA 2WOOA 3QMMA 2O0HA 3TGWA 2FG5A 1CF4A 2AMLA 4B3JA 5TB5A 3PR3A 1TQ4A 3DWFA 1VBNA 1GG9A 2XB6A 3ELWA 4JI5B 3KOXA 2CUKA 1GRNA 3BXEA 3FOZA 3GHYA 3GMDA 1G60A 3AETA 2X8LA 3L49A 5FOVA 1G5RA 1UIMA 1G18A 3Q7IA 2H7YA 3AR9A 1PP4A 1TLLA 3KKPA 3VO1A 2QM0A 3FVVA 2WJWA 4C0BA 2GEVA 2GPAA 2OB2A 2ONZA 4QDOA 4R84A 4AW9A 5CDUA 5KNBH 3CH5A 5FF9A 5KAMA 2HHCA 4NHEA 5L95A 1GPWB 1NF2A 4IDNA 4IJKA 4EZEA 2Y6UA 4HH4A 2GK3A 2XQJA 3IHTA 2D2FA 3D3NA 3QG5A 2Q3DA 3LT1A 1ES9A 3P32A 1I2ZA 3LDFA 3RT9A 4BU0A 3OHPA 1Q1ZA 4O0MA 1HYQA 4KQXA 2W11A 3AIIA 3SNHA 4CV1A 3DMPA 4M9SA 2OLKA 3CC4B 1BDJA 3PKIA 2OPBA 3KVNA 5CRIA 4Q9JA 2I55A 2YN4A 3C3MA 4R01A 3VR4A 5KTPA 7MHTA 2QJOA 5AVXA 3R3YA 5H7XA 3HJRA 1QIFA 2QXYA 1O87A 1G8JA 3IQXA 4PNEA 1YBMA 4B4WA 4I50B 2QA4B 2C1XA 4N49A 2ZKIA 1CUGA 1KY2A 2K2WA 1KZ7B 3BWMA 3K0FB 2WV9A 4YRLA 1B0ZA 1XZKA 3UCEA 3LX4A 1W47A 4A2WA 3GN1A 3MB8A 1L1FA 3HTXA 2AL7A 3OZTA 5LQRA 4ZANA 3L1JA 1Z6YA 5I9IA 2V6GA 2YOHA 2QAGC 3JYHA 2GQ0A 5JIBA 2GCIA 3BMCA 5ITZA 3P2JA 4A91A 2ZSAA 2K2QB 1BCSA 1LK0A 3B3GA 4KNVA 4YBRA 5FNVB 4DG5A 2ACWA 4N76A 1TPZA 3K70B 4DHEA 3R6DA 3KLNA 2PJRA 4URYR 3B13B 2QRVA 3SHQA 4M0EA 5E0OA 2CWDA 3FN4A 2HTEA 3KYBA 4P08A 4Q3OA 1KSHA 1VQLB 2N0SA 3E48A 4TWAA 3VR4D 3WKBA 2IX9A 1HQCA 3RBZA 3U60B 1W5EA 1ZIXA 4IJ6A 5AVTA 2RGNC 3KAJA 2I6SA 2WVHA 2Q5CA 3A4LA 1X3SA 2BF7A 3ID6C 3NATA 2DHEA 2V0NA 3QWIA 3UHFA 2B83A 2XJ4A 3K2BA 4FYKA 3UWPA 5E6SB 1PX2A 2FTKE 1FXWF 1DBVO 2J59A 1IWPB 2ZXEA 3GJ0A 3K9QO 3VR2D 4BBPA 4U2GA 3WE7A 3K9NA 4MI6A 4OEHA 4MDYA 3EZGA 5E3HA 5B64A 5MN5A 2IPMA 4I2VA 2RKBA 4OI4A 3RDPA 4DTCA 2LPMA 5F52A 4WFIA 3W8DA 4TTQA 3CF4G 3GJ4A 4FN4A 1YMUA 4UU1A 4Z54A 2FMFA 1S4MA 1YHNA 3NVAA 1G98A 4P6YA 2CXSA 2WWTA 1D0IA 2YFYA 1K6EA 1LXCA 3M70A 3MAGA 4ZCMA 1QIIA 1VXRA 3FNEA 3PQ7A 4GMFA 4JEUA 4LYJA 4W5QA 3I1IA 4ZZ3A 3KJNA 1QO0A 3QVOA 1NJID 3JPYA 4JEIA 4JVOA 1UPCA 4E11A 4RGYA 1H2AS 2P4QA 3C6QA 4GNKA 1CT9A 4C6HA 4IV5A 5DT9A 5JCOC 3G0CA 4OIFA 4A92A 3VA7A 2O3JA 1H2XA 3R77A 4PBRA 4GKJB 5TXGA 1R9NA 5M2QA 4GG1A 3ZCVA 2ZWOA 3PQ2A 4FINA 5AHOA 3ZHZA 1ZHHA 3GT7A 5C2JB 1EGVB 4KGVA 1JMVA 1H0KA 1N7GA 5IZCA 3GFVA 4JKIA 3A6ZA 2HBZA 2QAJA 4GSKA 1J6UA 1NVGA 3A1SA 2OUKA 2XTNA 1R5BA 2J6CA 2DJ5A 1ZOSA 3X2SA 1HFWA 4L6IA 2V6IA 1D2NA 4TT3D 1W2BB 5EPUA 2CYCA 1DAHA 1CYEA 3GVHA 3D59A 3KPWA 3ZDYB 3D9QX 3L8GA 2EJUA 3OX1A 4XOIA 1RS0A 3ZD9A 5E7IA 2HLPA 3IQWA 1NF3A 4PF1A 4TL7A 3FGOA 2NZVG 4B6EA 5K8TA 5L3QB 4B7UA 1YDWA 2I22A 4UBKA 4WCFA 4AWAA 4CG2A 4WKGA 1M2EA 2VTBA 1M34E 4PM4A 3ZX4A 4D96A 1Z7YA 3Q7QA 4C07A 3H4VA 4LFAB 1RE1A 1Q50A 2BUBA 3IQHX 3NTUA 1Z18A 1SKMA 1MJHA 4ILKA 5IP5A 1RYYA 3GVIA 2QI9F 3B60A 1NF8A 3V7UA 1Q12A 4ERXA 2GTIA 5IUNC 2MSDB 2QX8A 3NR2A 3SZOA 1NN5A 1RIIA 3FTPA 4GKBA 2IWRA 1P3JA 1VMEA 1Y9ZA 3NHUA 4FMDF 5KNLA 2QLNA 1J0EA 1E5VA 1NVFA 3ZW8A 3RROA 2HX1A 4YDQA 4BWYA 1QFYA 3PWSA 1X8JA 5FUBA 3WOHA 4F2DA 2OCLA 4PGFA 3I23A 3PFHA 4ABTA 3PFIA 3NU1A 3KALA 5KWSA 5H70A 1NF9A 2OCKA 5HHTA 1KNQA 3SLDA 4G4SO 4Q7JB 2EFDB 5G1OA 5IFKA 1QZXA 4M0KA 4MYSA 3LQQA 4TMZA 4U9UA 4GOKA 3UGJA 1ZBDA 3LY5A 3CW2A 4ZHQB 1KJZA 4HS9A 3D5EA 1HT3A 2ZSEA 2A88A 1CZHA 4QVAA 4ZO8A 3H3FA 3LLMA 1DOHA 3K9LA 4JYCA 4PZAA 3U40A 3K0CC 5JSUA 5BMVA 4M8KA 3E03A 2LR0A 3V2IA 2PL5A 4NYIQ 2BZ1A 3HFGA 3FBWA 3ZE2B 3C5WP 2XADA 1N1EA 2BDEA 2HTFA 1ZCZA 4L9WA 4D46A 3AR7A 2PVSA 3FLAA 3DBRA 3ERCA 4OU5A 3VVBA 3MPUA 1T3ZA 1ZJ4A 2QYSA 1SBIA 2QY6A 1E43A 1CUXA 1Q84A 2OP0A 2VEDA 2M9MA 2BUAA 3H13A 3KKMA 3MTJA 3Q3JB 4R05A 4L5BA 5IAKA 3TLXA 1AK2A 3IC5A 1E8NA 2R62A 3HZHA 4PRLA 2R6FA 4PXSA 4OHUA 1DSSG 3MT7A 5L53A 1YR2A 1L2TA 3IYLW 5BRJA 4B73A 3U6KA 4YV7A 1AZTA 3W9YA 3T54A 4QM6A 4PTLA 2VO1A 4W82A 4X1OA 4C2AA 1PJRA 4RXUA 2MSWA 4BL5A 1A4IA 1MQAA 3AEQB 4AP5A 1PGJA 5TPZD 1QFSA 3BSSA 1BOOA 3BDIA 3P0FA 2POQX 3P4YA 3PNQA 4WOJA 5TMDA 1AA9A 3R5KA 1AH2A 3PGXA 4M1KA 1EK0A 1JFFA 4RK5A 5AWFC 4GMDA 3INYA 2PE5A 1RWKA 4CCWA 5GONA 2Z5FA 3EOAI 2HV8A 4KQFA 3R9WA 3BCDA 2QPOA 1TTTA 1F8UA 1FRVA 3H2GA 4JLVA 3QHQA 4RCZA 1NSYA 3LPAA 5HGJA 2Y05A 5IM5A 2YRXA 1XG5A 3NG1A 3RANA 4KYUA 1RKQA 1ND6A 2GYVA 4ZVVA 2FFQA 2WD7B 2HHAA 3KDPA 2D1RA 1GQOA 3PA2A 3WKCA 3SIPA 2ZIWB 3BRCA 5AM0A 1W46A 3CUEF 1I5OA 1NW6A 1TVEA 2G72A 3HL4A 2GPJA 4X5OA 1N2JA 3DOIA 1J1IA 1GSIA 4Y2YA 2ZRCA 2Z4RA 3O4RA 5BORA 1D9XA 2GLUA 4RM3A 4RTPA