5FO1A

E301a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
338
structure length
338
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVAQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 94
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo1A01
3FNRA 2QJOA 1V8FA 4MUGA 1KQOA 3CLUC 2D5BA 1YIAA 2V0GA 2GOYA 3NBAA 5TS2A 1M8GA 4S1OA 2O8VA 1O95C 4DNXA 4NAUA 3FI0A 1XNGA 1YI8A 2CUZA 3ILVA 4EFKA 4F4HA 4ARCA 4WSOA 3BL5A 2J4DA 2VBSA 1K4KA 5BNZA 1JEDA 4MUFA 1QNFA 1N1DA 5IJXA 3RJZA 3RK1A 3P52A 1WXHA 4QREA 3MLAA 1CT9A 1XNJA 4JXZA 4Q16A 1N2GA 1JHDA 2J07A 3CVUA 1IQUA 1IHOA 4YMIA 3KT0A 1U3CA 2D13A 1KP2A 4EG7A 5KHAA 1N2IA 1J21A 3ZIUA 2X0KA 3TQIA 5DK4A 2YWBA 1OWLA 2VXOA 3VRHA 4K0RA 2CV1A 1DNPA 5J58A 2WSIA 3UY4A 1PFWA 3N9IA 2DERA 4MW9A 1EFPA 4PBTA 1LI5A 2PZBA 1T6YA 3MLBA 2B7LA 1WXGA 3D6VA 1M8PA 2X1LA 3IOBA 3RK0A 2DR2A 2IJGX 4MULA 5A88A 2CYCA 3ISJA 1P4MA 3JXEA 1GTSA 2VTBA 2A86A 3DLAA 1O97C 2V0CA 2QTNA 4KR7A 3GMIA 4FZJA 3SZ3A 3CA8A 3SEQA 1WZ2A 5TEVA 3ZGZA 4NZPA 1EFPB 1JILA 1YIDA 1TYAE 5EKDA 3A2KA 3IOCA 1YUNA 3C8ZA 1O0CA 3OP1A 3N2YA 2J5BA 2BYTA 3D6UA 1J09A 2VTBB 1SURA 1N2HA 2VBUA 3PXUA 5KWVA 1PFYA 1S4MA 2PZ8A 5A89A 4R2LA 4TS1A 3UC5A 4ARIA 1OWOA 2CSXA 5FNZA 3FY4A 3P0IA 3VGJA 1T6XA 4DJAA 2X3FA 3QE4A 1R6XA 1TEZA 3ELBA 1ULHA 1NURA 1WQ4A 1EE1A 2QUIA 4CT0A 3M5WA 1T9GS 1IVSA 3CVWA 3A04A 1TFUA 3ZXIA 2CYAA 1J1UA 2A84A 4EG8A 2WQ6A 4EG3A 4UZEA 3CVXA 1IRXA 2QTRA 3X1JA 3I05A 1PG2A 4MWDA 3IODA 3FG9A 1A8HA 4PBSA 1EFVB 4G6ZA 1F9AA 4RPIA 1NUTA 4MW5A 3FETA 1VBMA 4YP7A 4ZT5A 4NATA 4JYZA 3SYTA 4OUDB 3MUEA 1R6TA 5HG0A 2Z08A 3Q12A 1QU2A 4MUJA 1D2RA 5TEWA 3IUBA 3AL0C 5H7XA 3TZLA 1QU3A 2ZP1A 1U0BB 1GTRA 2NZ2A 1I6KA 2IELA 3FH0A 2E21A 1NZJA 2E18A 1UFVA 3FDXA 2AKEA 1MC1A 4KPUA 1KH1A 4CDNA 3IVCA 3FHJA 3ZUGA 1H1TA 4ZCTA 1ZH0A 1GPMA 1NB9A 1FYDA 3FOCA 4RUKA 3H99A 4PBRA 1KQNA 2PFSA 2A1UA 2WB2A 5AHWA 3MXTA 3ZJTA 4K03A 3UK2A 4ZT4A 1KKUA 3CLRD 4KPUB 4I6GA 3A4IA 3CLSD 1OD6A 2H29A 2PIDA 1N06A 1ILEA 2VBVA 3GLVA 1QRSA 2A1UB 1OWMA 1OBCA 2TS1A 5K0TA 1Q15A 2A1TR 3K32A 2EJCA 3SEZA 3X1MA 2QJFA 2GKSA 4J76A 3HFJA 4ZCRA 4EGAA 1U7DA 4YBRA 2OYNA 3HGMA 4QRDA 1IH8A 2X1MA 2Z09A 4MAFA 4A91A 5DEOA 1JZQA 3E27A 2BTEA 1M83A 1MB9A 2JAXA 1QRTA 1WKBA 3CR8A 3COYA 4JFAA 1EUQA 3H05A 1JZSA 2A88A 3RFFA 3SP1A 1COZA 4EG6A 2QTMA 1PFVA 3TQOA 3G59A 3LOQA 3BNWA 1KAMA 1KP3A 4EG4A 4MW0A 4MVYA 3HL4A 4ZCPA 1NP7A 4I6EA 4GU5A 3IVGA 1JIKA 3NBKA 1M1ZA 3CLRC 4UZFA 3MMXA 4MWCA 3CTAA 3IDFA 1H3FA 4AS1A 3CLSC 2WQ7A 1I6LA 1F7VA 1NUUA 2PXHA 3DPIA 1NYLA 3ZXSA 1FFYA 1ZJWA 3IMEA 2IP1A 3K9WA 4ZT2A 1QTQA 1IQ0A 2GM3A 5J59A 1TYCA 4GRIA 1LI7A 1H3NA 3CLTD 1K92A 3RBAA 4CDMA 2D54A 2HMAA 4HPWA 4ND6A 1TYBE 2QJTA 5DASA 3KFLA 1G8GA 2EL7A 3DO8A 4BWVA 3ND6A 3VU8A 1EFVA 4DE5A 4MUNA 1MB2A 4G5YA 1N75A 4YP5A 4MVXA 1KQPA 2J08A 3S3TA 4OUDA 3KT3A 3N05A 1QQTA 3FIUA 3OTWA 4H3SA 4DLPA 5IHXA 3SZGA 1PG0A 5TGTA 1KR2A 2AG6A 4HK4A 1VBNA 1QRUA 3TZEA 1TQ8A 1NUPA 2XRYA 1O95D 4X0EA 1QJCA 1O94D 5TRDA 4NDAA 4XSVA 3DV2A 3KT6A 1BS2A 4JXXA 2CT8A 4MUEA 3HZRA 5F23A 1M8FA 3IH5A 2CYBA 4U63A 4MWEA 3PNVA 1WXFA 1O0BA 3P0HA 2YXNA 1JMVA 1X8XA 4MUIA 3N8HA 3TS1A 4KR6A 5DB4A 3KT8A 4NAHA 1N77A 1JIJA 1I6MA 1OWNA 2QUKA 4AQ7A 4EG5A 1NB0A 4J75A 1MRZA 4P2BA 1HYBA 1WXEA 4ND7A 2CV2A 5KCMA 4KR9A 1NUQA 4G5FA 5H16A 1O96A 5FO1A 2JANA 1O5TA 4DDKA 1N05A 1B6TA 1K97A 1J20A 1N78A 1ZUNA 1Y42X 1GN8A 4ZT3A 4U8HA 4PY2A 1VL2A 4EG1A 1N2EA 4EF6A 4ZT7A 3PNBA 1N07A 1JECA 1M8KA 4MW2A 1EXDA 1MAUA 1O94C 4MVCA 4MLPA 1O97D 4XFDA 1O96B 3ZJVA 2QUJA 2R5WA 3PRHA 3QTTA 1N08A 2A1TS 3Q4GA 1N2BA 3GUZA 2J09A 4MWBA 3U1VA 3ZJUA 2DXIA 1GZUA 2E89A 3LE8A 4MW7A 1U3DA 1EUYA 1JEEA 2DETA 1WQ3A 3CVYA 3RHSA 3L92A 3ND5A 3AG5A 1JIIA 4DDMA 4R2MA 5LFAA 4U7JA 4HJXA 3AIIA 4XFJA 5HUJA 1GAXA 5HUHA 1PFUA 2DLCX 4E1AA 2A4MA 1WJGA 2CFOA 2P3MA 3NV7A 2C5SA 3Q10A 1MOPA 1YULA 5LM3A 2Z3VA 1V47A 3X1KA 1MBZA 1YUMA 5FO0A 1NI5A 5K0SA 3HV0A 3A05A 4ZT6A 1KH3A 1X6VA 2CV0A 1T6ZA 4F3RA 4NX2A 2DUMA 4WNYA 1XJQA 1WY5A 2A7XA 1G8HA 4MUKA 4MW4A 4Q93A 4R0NA 3LCJA 2HGZA 1WOYA 4HJRA 2E0IA 3SDBA 2O5RA 2PZAA 5A8AA 3H9BA 2PG3A 4KKVA 3COVA 1KH2A 4JZYA 2ZUEA 1Q9SA 1NUSA 3TNJA 3AG6A 2H2AA 4MW6A 1R6UA 3IMGA 4YP6A 2RE8A 4MVWA 4MQ6A 3G6KA 1XNHA 1U7XA 4I6JA 1F4LA 3UOWA 3AKZA 2ZUFA 2YWCA 2QUHA 4ZCQA 5JBNA 3G5AA 3IVXA 1H3EA 1TYDE 4CQNA 3CLUD 1OWPA 3H97A 2HZ7A 1T9GR 1F7UA 4OJMX 1ZH6A 2XRZA 1EJ2A 2OV4A 1MJHA 1KORA 3AFHA 3FWKA 1NSYA 4ZCSA 2DPLA 1Q19A 1VBKA 1K4MA 3IUEA 3CVVA 4L2IA 3PNYA 1P7PA 1RQGA 1IFXA 2RD2A 2YY5A 5J5AA 4MW1A 4QBTA 1Q77A 1KAQA 1JGTA 1WXIA 3ND7A 1J1ZA 1G8FA 2NSYA 3IOEA 3CLTC 2JA2A 4DDHA 2G36A 1G59A 2DEUA 2AZXA 1J70A 1OBHA 3INNA 1MAWA 4MUHA 2VBTA 3H9CA 1Q11A 3IMCA 4L2IB 1VLHA 2I1LA 1O6BA 3P0JA 3QTBA 1I2DA 1N3LA 1IQRA 2OQ2A 3COZA 3HMQA 3L93A 3COWA 3F3MA 3UMVA 1LW7A 1N2OA 5LLTA 1M8JA 1N2JA 1GLNA
chains in the Genus database with same CATH superfamily
6CHYA 4Q47A 2QW8A 1SU7A 2J0QA 2QL6A 1F4VA 4AJEA 1Q7BA 2H63A 3IEUA 3U7QA 1W76A 2FMKA 2FPMA 1GPKA 2RGCA 1B0AA 3DEAA 1XROA 1IY9A 2I71A 1RSZA 3L7BA 3QEJA 4Q3KA 4Q9NA 5DT9A 5HKBA 5IBCA 3G2NA 3HXOA 5IT9A 3DOFA 2XT9A 3WNVA 2R9VA 4B09A 1CZOA 1S1CA 3F8TA 3NUGA 1SVWA 2GK3A 2JGLA 1YC5A 1G3QA 3B13B 1NOKA 1Y34E 1YZFA 3OKXA 2B98A 2O07A 2QSYA 3QFHA 4UEQA 4TLAA 5HF8A 4DY4A 2IS4A 4UCWA 1JAYA 1JALA 2Q49A 3LPNA 5SY4A 5T41A 1AQIA 4EHHA 4ENTA 2VQEB 2PUDA 4GOXA 2H2FA 1D6SA 2HCBA 2HI0A 2OO3A 1TW3A 2ONKA 2ABWA 1QDLB 4IDDA 3HLKA 5AKLA 2IU0A 5I48A 5K0FA 5HTOA 3B20A 2R6R1 1K1EA 1M1UA 4B7XA 1US8A 3K2IA 4LHXA 4PC1A 2QAGC 4J1SA 2V7QA 4TX1A 2FVGA 4Z7OB 5DE3A 4PG6A 2PJZA 1ODLA 2H1CA 3DMDA 1UDXA 1LSSA 2GAJA 3MIZA 1KP2A 3GRUA 3WWYA 5L3QA 5CFQA 1NXVA 5DMHA 3U56A 1RHUA 3QWHA 3ZIUA 2VJOA 1JKIA 4XDHA 2HO4A 1K28D 3C7AA 5KVCA 2Q5JA 1JQDA 3DTVD 1KI2A 1WPRA 4WNAB 3V00A 5A1JA 4BLVA 5BNWA 1C3LA 1AZWA 1DG3A 1UZUA 1Y5NA 2L69A 1IATA 1K3UB 1XTVA 2JNWA 3FMOB 3LLUA 3LPAA 2CHFA 5K1ZA 1RBYA 1P5RA 1C7RA 1QYRA 1KU0A 3JQ7A 5KHLB 3IQIX 2R1UA 3HB5X 3GRAA 2IJGX 3PYXA 5F9MA 4B17A 4R54A 3VJLA 5IHPA 2J5XA 2F7SA 4P2GA 4UXJA 3PQ5A 3V8PA 4DMLA 4M7WA 1WEHA 5C34B 4IM7A 2PQ0A 4G2TA 3F0TA 4ON9A 1BH2A 3WIBA 3CW8X 3JS5A 4HP8A 3VPFA 3FW1A 4FD2A 5TEVA 3DE0X 1JILA 3GUYA 3GPBA 3UJ3X 4GZMA 3FOAA 1SIOA 2IEZA 4NCHA 3V1TC 2X2PA 4ISBA 1QHHA 1MJGA 2ZBPA 3R4CA 5LXTB 3L4BC 1OILA 4MEJA 1EGAA 1XMPA 2ZULA 3IT2A 4NH4A 3SZLA 1NBAA 3OKCA 1UM9A 1CPYA 1ONPA 2AT1A 4QDUA 2OMKA 3V55A 2FCRA 2YWJA 4IW3B 1OLSB 2DU8A 1WULS 4OOVA 1PSZA 1MO5A 4F2WA 1EFLA 3I09A 4QM7A 2C4HA 2OXRA 3ZU2A 4HRXA 3CPEA 4HWOA 1KDVA 3ZWYA 4AULA 2IXFA 2P8JA 1EXMA 4HRVA 3GEGA 5E8RA 5A89A 3W5AA 1SQSA 3ZQ4A 1MC4A 2VL7A 2LNDA 3AXSA 1Z17A 2XCQA 1U28C 3ML1A 2VQSA 5CGQB 3FYDA 1TW2A 2H3HA 4GI2A 4A8TA 1R6XA 3KHUA 1ULHA 1BA3A 1U9YA 4M87A 4OJYA 4QU8A 1YA6A 2PCLA 1KZ4A 4FHFA 5BVHB 1CUJA 1TDJA 2D5LA 3DVAA 3A04A 3FFWA 3H1AA 4JOCA 4N82A 2A3RA 2CYAA 2IWRA 3QEMB 4PSKA 1O2DA 4X0CA 4EG8A 3H13A 4A27A 3WNZA 3H2GA 7MHTA 2GD1O 4EW2A 2VHWA 4HNTA 3EMDA 5KZMB 3R6WA 3ROFA 4IVPA 1G20A 5I47A 1WETA 1MPTA 1BH6A 4MA4A 5B30A 3KXLA 4CMIB 1R8JA 2D8MA 3WWZA 5SZHB 3EB9A 3RU3A 5A9SB 4JI5B 1QYWA 3OQVA 5JATA 2F90A 1NKSA 3M5DA 4B3RB 3EXHC 2O5CA 2OUKA 5DW3A 1BD3A 3M6FA 3D8HA 3OCYA 5B7GA 5KB3A 1RIFA 3Q7RA 2AC7A 3H2SA 2LGJA 1YSCA 1MEJA 4NATA 1G98A 4Q9JA 3T3HA 2HQSA 5DPMA 3ZWBA 1J6UA 1Y82A 3IR6A 2VN8A 3E5HA 2R47A 2VSYA 3L6BA 1RI2A 3W7VA 2AMJA 3MN1A 1P1RA 3I6ZA 3EA5A 5EN4A 3TXXA 3HU5A 3JPWA 3OLWA 3M33A 1BDBA 4KK3A 3PUNA 4RVDA 3W9SA 3PC4A 2AKEA 2E5LB 4X6XA 2FKNA 3SQMA 3ENQA 2IITA 1U9IC 4WXMA 3QI2A 4TWZA 1VL1A 3K05A 4KRFA 5AK3A 1BOOA 4OGKA 1E4YA 3F1KA 1I33A 2VFAA 4TVOA 2FEKA 4Q4HB 5KSYA 1R12A 4P5EA 7ADHA 5F2KA 1E20A 2R8OA 4PBRA 2VYND 2GX6A 3GLTA 1UJNA 3L8HA 1KO1A 4GBED 4QQNA 4C22A 4YELA 3NKLA 1Z29A 4IHJA 4OFWA 3OBIA 4PICA 3LVBA 3MQ4A 3PT9A 4WN3A 2Q3HA 4HBGA 1FX0A 1ILWA 5JS6A 4YLEA 2WJAA 4CLOA 4ZOAA 2X0JA 3F5MA 4BFYA 1QQ6A 2AJTA 1I3LA 2ODAA 4ERXA 1IN5A 1WPQA 2F1IA 4XKWA 1B00A 4Z4EA 3CLSD 4RHUA 4XR6A 1BXKA 4OYRA 5DHFA 4MWOA 2VBVA 1N0VC 2JHAA 4QFMA 2QLMA 3JYQA 2IHBA 3KD3A 4FUTA 2AOTB 4BV8A 3W5UA 1UDAA 4ZYZA 4OJMX 3K32A 4Y0VA 4XR9A 3HCWA 5LQRA 3F2VA 3GFPA 1WVIA 4QOJA 4XRRA 3T06B 4B4VA 4IDAA 3KJNA 3NHUA 2IXEA 1W88B 1YZHA 3KNZA 1RFGE 4HGZA 4NQZA 5JLAA 4XQ9A 2F3QA 1VLVA 4J0FA 3CUSA 4L4UA 1PNOA 1CYDA 3FKJA 4ZMSA 3AINA 1RJWA 3DR5A 3R3SA 4TL9A 5H3HA 1WDLA 3A4MA 1GNVA 4OQXA 3KR0A 1XQVA 2NTNA 3QFTA 3DOHA 4DEXA 3CPJB 4NZYA 4DMKA 1KZYC 4YRKA 5KJFA 1Z36A 1Z4PX 1LPAB 1E3SA 2NU7A 1V7CA 2QTMA 4MB2A 4OD0A 4PEVA 4UQPA 4MHSA 2JAQA 5ILGA 3R0VA 2XSZA 3H4MA 4QD3A 5JXIA 3WL4A 4EENA 2Q41A 4F11A 4NXMB 1MQAA 1PO7A 2W2LD 4FYHA 4ICIA 2JIZD 2DHDA 2VOEA 4GDMA 4L6AA 4MW0A 4QUKA 1LBHA 4QVKA 2ZAMA 2HK6A 1Y7HA 1UMDA 2R97A 4YCSA 4IUBS 2GDJA 1FIUA 2F9FA 1L7VC 4MROA 4UBOA 3LL4A 5KQMA 1HGXA 5L6MB 3VMFA 2XMGA 1R9GA 1JXMA 4GKVA 4ZPXA 5FOQA 1FBTA 1NJ8A 2R5NA 4GYKA 1GDHA 1OW3B 5C7LO 4Q1AA 4YDSA 4A8JC 2VT2A 5THXA 2QWXA 3FPLA 3QU5A 3OJ0A 5JSKA 3MNFA 3TR5A 1YO6A 3JQGA 4P58A 4XQEA 4O2RA 1I6LA 4M46A 3PIRA 1NYLA 4ENPA 1H2ZA 3IUQA 4X7RA 1IOWA 2P4SA 3EZ9A 4BNDA 2ZOSA 4E32A 4QUGA 1FFYA 3NHMA 3PLNA 3C3BA 1Y48E 4X92A 5JAQA 3N86A 3TECE 1ZJWA 3E3OA 3HYSA 4W5JA 1C1YA 2D3WA 2PKQO 2VRNA 4KBGA 4GL4A 3L7DA 2HIHA 4D0NA 1YCDA 1NV8A 3B7PA 1X1AA 5C1PA 5CB6A 3K20A 3L2OB 3EEBA 2VAPA 1TUBB 1JDBB 4J9UE 4F72A 3KFLA 1DOHA 4WY5A 4C89A 1ORRA 1LH0A 4I9FA 4JROA 3S1SA 4DE5A 4M0CA 4Y1RA 1ZMBA 4KQ2A 4XONA 1R00A 3QF4A 4GQBA 3RC8A 5LA6B 1F0PA 3H3JA 4PZUA 4I50A 3P8ZA 4R8RA 3N05A 5C4MA 4OXQA 4RHFA 5HZKA 5K99A 4CFYA 3RYCA 1C5KA 4BQPA 1DG9A 2KLBA 4DLPA 1EGMB 2ON6A 1XOIA 2P3QA 2JFXA 2QGFA 3ST7A 2JLVA 3KOYA 1W0CA 1CDZA 2GJ4A 4M55A 5DH9A 1KMNA 2QM8A 2X19A 4FFLA 4LRWA 3R8CA 4CLDA 4QAQA 1ISMA 2FW1A 4RADA 4P7JA 4RDJA 1ZGCA 4JI6B 1VYVA 3K31A 2P0AA 4DUPA 2SKDA 2HK9A 5MN6A 3ZY3A 1DRWA 5HQTA 3M1LA 1IXRC 2JH9A 3EXIB 3E2MA 3NHJA 1M2HA 3R3JA 1VCNA 4UM9D 1YQQA 1EVJA 3REQA 2HBRA 1I1OA 3OIVA 1NVEA 5ITZA 3JASB 1KMIY 4K6MA 4YJKA 5JDCA 4AZSA 1NW9B 4GPAA 1IIRA 2G5GX 3NBMA 4BDSA 1RIIA 3W5JA 2Y66A 3O75A 4UCQA 4B7AA 3VR0A 2G1JA 2PTGA 2XOEA 1PR5A 2C0CA 3BF8A 1O0BA 2B0JA 4AF7A 2YUIA 4R9RA 3SZUA 4D4HA 2G4VA 3FIJA 3HVKA 4GW3A 1QHXA 3SM9A 5KJEA 5KPDA 3QVWA 4F5ZA 4NBLA 1UQUA 3O2NA 2G1AA 1KE2A 4R98A 3VR1A 2DUJA 5DKFA 1EFCA 3F8WA 3OICA 1SZJG 3T5DA 1DU4A 3MJTA 1NN3A 4DWVA 5DGHA 4F8YA 1NB0A 1LC3A 1P0MA 3ANMA 4IVRA 4Z99A 3AVYA 1TMKA 3NFYA 4IQ0A 3S5JA 1ZAYA 4ND7A 1CZLA 4YAIA 5A05A 1OZGA 5I9IA 2GBCA 1BNCA 1THGA 3VVMA 3PFNA 3Q0TA 3IA7A 3PJEA 5KMGB 2HQ1A 1H4VB 2JRLA 1K97A 3C6KA 5K0GA 3LKDA 4CT5A 3N5CA 4RVCA 1G3UA 1Q20A 4KNYA 3M9LA 2YX1A 2B9VA 1X70A 2OO5C 1OJ7A 1SB8A 1UAAA 4EB8A 1N07A 1QE0A 4RE6A 5CXUA 2QQGA 1O94C 3CEAA 4RE5A 3GHYA 4XB2A 5DNYB 2YJZA 4LNAA 5TS3A 1REQB 3TUIC 5BUCA 5KNDD 3KQMA 1YONA 3LQEA 5IZCA 2QDXA 2YHBA 3T1VA 5E6UB 2EFDB 4AWXA 4IWYA 2J46A 2J09A 3NOXA 1IZ8A 3T3NA 3WP0A 4O1IA 3VU3A 4EQZA 1RPAA 2XQFA 3HVHA 4F3TA 3L6OO 3BZWA 2DR0A 1K9MD 4OKIA 4HDSB 4OXIA 4W9MC 4FYMA 1Q6ZA 3F71A 3S2SA 2YCBA 3RHSA 3OY2A 1GFIA 3JQCA 3O9MA 2GREA 4X8LA 4NQRA 4DDMA 3EMBA 4LJ5A 3OD1A 2G5TA 2XF8A 3PFIA 1UPUA 4R6WA 5E6TA 3N8IA 4EVIA 4KXYA 5HUJA 1X7XB 4PGHA 2FZ4A 4UD6A 1F6BA 3L7CA 1KTIA 3D3QA 2BOVA 2JBWA 4AWBA 3TGWA 3NX4A 3NC0C 4EKNB 2IS2A 1ZEJA 7REQA 3HS3A 4ITRC 5JSZA 1JI0A 1I2AA 1Z34A 1LV8A 5FFFA 2WINI 5J4KA 4ZT6A 3VZRA 3PVDA 1A2OA 4WCFB 3DT8A 4U7GA 3T1YB 1NZDA 1FYWA 4Q4HA 5C5IA 3NT2A 4IIBA 4DC1A 2I1QA 1G41A 2O0JA 3AKDA 1VHDA 2A7XA 2EQ5A 1VOTA 2DF8A 4MX8A 1FDWA 2H8GA 3W4IA 3WK8A 3KFXA 4Z3OA 4FBMA 4BRWA 3LCJA 2QGZA 4BBAA 3WLSA 3AR8A 4PIVA 1AGNA 1C1DA 3DONA 1QP4A 1OREA 2YW9A 3G71B 2RJOA 5TQ0A 3WWCA 4CF4A 4D3SA 4PFKA 2VDLB 3VR5H 4KQGA 3SEJA 4WK4B 2AFHE 5KYXB 1XE1A 1EP3B 4RY0A 3AG6A 3OPYI 3JCZA 3GZTB 3E4DA 4GOLD 4C0BA 1N0UA 1R6UA 3AP1A 4JYMA 1Y8AA 1CETA 5IU6A 2FPPA 1TLTA 1DWUA 1DRVA 5CPFA 4WWHA 1BYUA 3IALA 2G04A 5SZIA 2UXCB 3DAPA 1O57A 3F6SA 3ANNA 4CNBA 3ZCSA 1N1EA 3IVXA 4R3NA 4YIKA 1JJIA 1NVKA 2LR0A 2QX7A 1CUAA 4G5QA 3VZDA 2I6QA 1RI5A 3B6IA 4UM7A 3JD4A 1GDTA 1QORA 1C9DB 1FBNA 2D62A 4CZ2A 5ERYA 4AMGA 1IN6A 3HWRA 1POXA 3BD7A 3NALA 1JR2A 5BQPA 3N7AA 1O3YA 1TM7E 4Y98A 1RC8A 2Q2QA 1LDMA 4IJVA 2DQKA 2OUIA 4C0LA 4UTNA 5JU6A 2VKTA 3Q2KA 3V1MA 2C2GA 2OG1A 4YJ3B 5JSUA 4M7OA 2OBSA 1LTQA 5IYQA 1MHPA 3ACBA 3QVXA 2FR8A 2FY8A 3A9VA 1XDGA 3DLIA 4K9OA 5CRIA 3RUPA 4Q03A 3WGLA 4NP6A 2X5KO 4G65A 4L50A 3FCSB 4HDKA 4P7BA 4E30A 3GK3A 3JQBC 2RD2A 1KSGA 2XE8A 2Q4RA 4OHMA 5DCUA 1WS6A 2D3TA 3ZZMA 4D9BA 1OFUA 2SHKA 5CLFA 1G6Q1 4IKPA 4Q1DA 4ZDIA 1NRWA 1ZJZA 2B35A 5IYNA 1X7YB 2EQAA 3LO5A 3QH4A 3EC7A 3TL2A 4KKUA 3FRJA 4RSHA 2GRUA 3C1OA 3D4OA 2AFVA 3P4YA 5EL0A 1WMAA 1L7OA 3PUIA 3WMEA 4FJ2A 4C4AA 1T15A 2DE0X 1H1LB 3RC9A 1MX1A 5EMLA 3FVTA 1EQUA 1XEWY 1SQFA 2IKSA 2J6CA 3G8AA 3PUWA 4EFLA 1M1NA 3TD9A 4C3UA 3S8EA 3HY6A 3V8BA 5JNLA 4QUJA 4HXGA 2NQTA 2BBWA 1GLNA 4DG8A 3UFXB 2QJOA 5LIPA 3QG5A 1QZXA 3FMPB 5DLDA 5A3SA 3ZGLA 2DQZA 1Y37A 1ECCA 3FUTA 1KBZA 2FW6A 3TUZC 1OVGA 4EGFA 1QFMA 3AK4A 1PR1A 1Q1ZA 2OKGA 1O95C 4DNXA 1F14A 1U4NA 3VZBA 1YBHA 2GZSA 4NMMA 3WRVA 5BNZA 1EFRA 3MCUA 3V1KA 4R8KA 1DEXA 1ABFA 5IEBA 3IJRA 1V3UA 1O9BA 1TT7A 2BMFA 1U3UA 2OCGA 1EP2B 4KQIA 5FHRA 3T99A 3PL1A 1QDEA 1S3FA 5KO2A 1CHDA 1Z07A 4AU1A 2Q8PA 3W3AD 3D8UA 1N6NA 1T1EA 1CSEE 4TUYB 2OCYC 5CT4A 4XLHA 1NNSA 3ETCA 4R2XA 3DZKA 2IYYA 4RZXA 1IQUA 2BE7A 1WTHD 5DM2A 5IJ0B 3X1ZA 3R75A 4D46A 5AN9A 1X1BA 4RFLA 1MQ9A 2MOKA 3OH8A 1LWNA 4LXTA 4TXLA 3E1YE 3ADKA 2IYRA 4QECA 1V37A 2R84A 1H2WA 5BYBA 2X0FA 3W1WA 2YHIB 4IFIA 4B8YA 2WQZA 1XMSA 2QZ9A 3DJFA 2X6TA 2IIVA 2HB6A 4XVCA 1X80A 3JALA 2WSIA 3GUHA 4LVOA 4Q3AA 5JALA 1XA0A 2W6MA 5EJ7A 1ND6A 3MLBA 2KVOA 4TT3A 2QYSA 1EVLA 1LLCA 2I2XB 3A0RB 4PCUA 4UOQA 4U02A 1ZCJA 5F73A 2DT5A 1Z6YA 3VVBA 1NDQA 3BK1A 3HA7A 3LCMA 5A88A 1N8KA 1X3LA 3OCZA 3V7YA 5IUJC 3M49A 2IK8A 3TOVA 4LI3X 4YUAA 3G6EB 2A86A 3EBOA 2CJYA 4JQZA 4PO3X 3URKA 2YWXA 3HP1A 3OAAA 5J4YA 5GINE 4DVGA 1CZUA 4QDTA 2ODQA 5EYPB 3VOTA 1XZIA 5BVGB 3NOOA 4AYTA 1VQNB 4GUAA 1YHQB 1QGUA 4H1VA 4DJFC 2XCOA 3BL8A 5JV5A 5EKDA 1JU9A 1HT0A 5K2OA 4E0BA 1MG0A 2MYPA 1ZIYA 1K6IA 3GFGA 4UCFA 1JG3A 2VSXA 2VHEA 3DF7A 4QLOA 3VH1A 5GJVC 1S2MA 4RIGA 4US0R 1YS9A 1OFTA 3R0ZA 5HJ2A 2VRCD 5EKUA 4ARSA 1AH2A 1F9EA 4RMGA 4WCVA 3RU7A 3SG0A 2I2CA 1WP4A 2QT0A 2VDWA 2YBEA 3ZHVA 2JLCA 1PFYA 4ND4A 1K98A 1QQBA 2I4NA 1DKQA 1WHTA 5FUQA 2X6WA 1UC5B 2FPRA 1OBFO 1B1CA 4RIHA 1FFXB 3HDTA 2JF0A 1JDNA 3H7AA 1L5SA 1VI2A 3P0IA 3VGJA 4RTLA 2GM4A 4JVLA 4RFSA 3RHFA 4C7MA 2G5PA 4HB4A 5KWIA 4PXAA 4O2LA 3SJZA 3FPHA 3W6UA 1XMQB 5A3VA 1PQWA 1K3FA 1O87A 2A84A 2FE1A 2I6FA 3L6UA 3MJVA 1VRWA 4HDMA 4H7JA 1JTVA 1FVHA 1GPLA 2WKQA 2G4LA 1ECGA 5EE5B 3UCEA 3WV4A 5I3ZA 4R4JA 4COKA 4IOLA 1CEEA 1C1XA 3ETHA 2CUNA 5DBIA 4E31A 5CD9A 4OPVA 2F1HA 2GEFA 3FB4A 2VHCA 4F92B 1XAJA 2HCFA 3EASA 3PP8A 1XJCA 3HRIA 1SUFA 5BSTA 1P77A 5EXSA 4D6YA 3VZSA 1UUFA 3EXFA 1SC3A 1WOMA 2FW7A 3PHLA 4H77A 3VHQA 4TLDA 2OVFA 4BJ5A 1Y6GA 1XB2A 1DO0A 2GJPA 2OECA 2AJLI 5IYWA 1Y1RA 2JKVA 2Q4TA 2ZYSA 5KOYA 2X77A 1QF7A 3KYDB 3MWLA 3A8JA 4FIZA 4HNQA 4NICA 5B57C 4K46A 4YALA 5FORA 1KY3A 1TA0A 3A8TA 2P3SA 1V2GA 1WDKA 2BE9A 2GYUA 1N92A 2YOHA 4F38A 5AW4A 2GD0A 2CUKA 1B0UA 2Z8YM 4YBZA 4PCAA 5D51S 1TCVA 3M3DA 4EJSA 3DUFB 2GK4A 1QV7A 3BWYA 1P2DA 3I9MA 1L9KA 5AXBA 1G9SA 1QUEA 3G0OA 2WAAA 3HYLA 5IMSA 3SXJA 5C53B 4YRMA 3ADCA 3BHIA 4IIFA 4RWEA 2FSVC 2RKWA 2AWOA 2X40A 4G1UC 4QNMA 4TWBA 3E84A 2DTEA 3FDXA 3QYPA 4W7SA 1N9ZA 4IDOA 1TQHA 3SNKA 4R9UC 2NPOA 3NDIA 2HDOA 1H1TA 4ZCTA 3TMAA 1YQWA 3QU4A 2IODA 3L1UA 1U2QA 1YHZA 3UUEA 5JPCA 3EF0A 1GQYA 5E4TA 3CX3A 3VKWA 4KIGA 2QN7A 3H99A 1OAOC 4MPTA 1KDYA 2DWOA 4TS4A 3W8RA 2AFHA 4B40A 5JD4A 1USIA 2WB2A 4PSUA 2X14A 1YR1A 4FEAA 2Q7OE 1EM8B 3DEHA 2AOVA 1JG7A 1RPJA 1SCDA 2V74B 3WGUA 4EG0A 4B87A 1FFHA 3QUTA 1YDFA 2GN8A 1A9XA 1Y3FE 1ZITA 3S2EA 3GVPA 4LDZA 3GLQA 3IBTA 4BZWA 1OXTA 1Z39A 2DCMA 2FWMX 2V0NA 3GZNB 4U7HA 3UJ6A 3LT2A 1I4OA 1RCFA 1P5JA 2E4WA 4FINA 3A4IA 4KOAA 2BFDB 5B5SA 2VSQA 3RO7A 5IH7A 3ZWWA 2A3NA 2QORA 4UAGA 3ZTWA 4UPEA 5K0TA 3GSIA 4WMLA 4IZ6A 3WAKA 1GT6A 3P9NA 3SFVA 1DKLA 4UBLA 4ZYYA 3HBFA 1YB5A 4LSMA 1E8DA 2OYNA 4IV8A 4TKUA 1M54A 1FFCA 4OTZA 3OCWA 4G01B 2G88A 3W3ZB 4UBMA 1W5BA 4MMYB 4BX3A 5BN3A 2ZZQA 5DHUA 3JATA 3QUAA 1G0NA 2UUOA 4GP9A 4BGEA 1NN5A 3TTSA 4P3OA 221PA 3E03A 3HXTA 1JZSA 4L7QA 3R5KA 3U3MA 1CQIB 1TYEB 3NW9A 4G67A 3TNYA 4RK6A 1EVKA 3R5TA 1JVNA 3NR2A 3ZLJA 3UM9A 2WSSD 4BLTA 5BQXA 1URPA 1V1MA 2I3ZA 2J3KA 3WYNA 3HDHA 1SK8A 5E6SB 2O7RA 1F4PA 1RZ3A 4KFUA 1RLTA 2VJLA 3PENA 4O3MA 1D4OA 5C18A 4MVJP 1ND5A 1F5NA 2XXJA 1N5DA 1T0IA 2FFJA 4BFVA 1UFOA 4ER5A 5I5GA 2PCJA 3JQEA 4CDGA 1IEXA 3L0ZA 1Q81D 1UXIA 2ZE7A 3KPUA 1MXFA 2JA1A 4IWXA 3MGAA 4HSEA 2WWYA 1Y7IA 4FHGA 5AK0A 3NATA 3F9CA 2I65A 2QZPA 1Q14A 3IAS1 2Y76A 5KJCA 3DZ8A 3O9ZA 1HZEA 2JGDA 2CMKA 5B2EA 3ZXSA 1YD7A 1QFSA 1Y3HA 4KC0A 5J23A 3EN0A 3I72A 4G0MA 1LLQA 5LOVA 2SBTA 3J80A 5ALJA 3HRKA 1UBGA 1W6UA 5HIMA 2VWGA 2QTVA 5GIPE 2CF4A 4KR2A 2WNSA 4ZZ3A 1DDOA 3P9RA 3CUYA 4AS3A 2WU0A 3BILA 3FDFA 1VG1A 4U9HS 5BXQC 2ATCA 3AI7A 2GCEA 2I78A 3PVCA 4DM3A 3AOEA 2EOAA 5TVGA 1HQYE 2I7XA 1NNEA 1YBMA 3OA2A 3REFA 3T0IA 5DT2A 3OHPA 1HQKA 1YACA 1EAMA 4BO7A 2PBFA 1QVRA 3EAFA 4W5HA 3V9PA 5IFKA 3QE3A 1U2EA 3HN7A 3OTWA 4P53A 1PEYA 1B43A 2FI1A 2QTTA 3TTUA 3WDLA 2HW8A 1GTJ1 3CEPB 4JBXA 1WD5A 2I54A 4QYIA 3JWHA 3ZIAD 4IRMA 2CL5A 4X7PA 2OHXA 2F8TA 5AW3A 1M72A 3CTMA 3O47A 2IHTA 1O7JA 3KAKA 3LGAA 2ZZGA 2RH4A 4XI9A 1HM5A 3IC5A 2NNWB 2BBTA 2WM8A 3GX1A 2CNLA 3BA6A 3LY5A 3FPJA 2WU1A 4NBTA 2IV7A 5KTTA 2WWIA 4ZHQB 4S12A 2REOA 2P7IA 5L9AA 1EWQA 3KT6A 4RDCA 1E2HA 2CJWA 2BTOA 3WLEA 4MHOA 5ALLA 3KQUA 3AJ8A 1SCAA 1E3MA 3C3MA 2GXSA 4ZV7A 2NYRA 1E2BA 4OY3A 5BSHA 4LJ4A 2JJ2D 4WLOA 3W5BA 2XKJE 4NBRA 3HNRA 2GQFA 2XX3A 1OAKA 2WD7A 3BF7A 3HN6A 3ODGA 2ZIAA 3WV5A 1BJTA 2Q5OA 2HHCA 2PK3A 4K8OA 3QPBA 4WVLA 4D9KA 3RVQA 1E2GA 1PT6A 2G70A 5FOTA 3ZE8A 4ND8A 4B3BA 4KJZA 4EL5A 3QU7A 3AF0A 1I6MA 1QIEA 1P2GA 5EWMB 5JHGB 4ZC1A 2XGSA 4CF7A 4AQ7A 3R0JA 5BRJA 2I7VA 3QY9A 3BB3A 2AVDA 3IHKA 4IIEA 4LYAA 5K0ZA 3BXOA 1RQ7A 4GZLA 3A6PC 3M1AA 2VDNB 3CF4A 3CCLB 1D8TA 1W4ZA 4L5YA 5EAIA 3SHOA 5LOVF 3U4GA 3N70A 4A92A 4CLRA 3G2IA 2GEUA 3ZWXA 2OHGA 2J3EA 5HE9A 2IVZA 2VKQA 1KKMA 1BE0A 1Z68A 2FZVA 3LLCA 4FE7A 3W6PA 2ZBVA 5CB4A 2WHEA 3TQHA 1R1DA 4KXVA 1UBSB 5EGNA 1CZNA 3WADA 3IKTA 4QEZA 4RXUA 3KB6A 2G80A 4B48A 1WUIS 1NV9A 2WB4A 2RHCA 2YXDA 3ANSA 1P0QA 2ZATA 3NONA 4LZJA 4OBBA 4RNCA 1KOLA 4I8IA 3T7SA 3ZX5A 2W6QA 1G5HA 2QF7A 2FFBA 3PQ3A 3OZBA 5DCYA 4QHSA 2W2LA 4DIEA 1DCTA 1Z2DA 2M98A 1GSOA 2IVFA 2PGJA 3MRVA 1CR1A 4FGLA 3S29A 2QAJA 4P3PA 1R3UA 1TU0A 2REQA 1WZIA 3IOMA 1VQ6B 3NB0A 5KSWB 1JEYB 1H05A 4LJ6A 1HX7A 2DETA 2YYAA 5K2MA 1K6EA 3RS3A 3WIVA 3AV0B 4YJ2F 3ZCPA 2Z2KA 2B8WA 2XQJA 1AKWA 2ZRLA 3GJXC 4QXMA 1XD9A 4O2BB 1XTKA 3AT1A 3UN1A 3ZIDA 4AZ0B 4EJ6A 3GDOA 1E2QA 1AJEA 3T1OA 1JDSA 4FSXA 2WWRA 3DHEA 3PGKA 4G63A 4I4LA 2PMEA 3OCCA 3L4KA 2DLCX 2A4MA 3CKLA 2VF5X 2WJZB 1TJ5A 3ELDA 2Y1EA 4ZO9A 1PWZA 2E2WA 2JLBA 3Q5DA 5KTMA 3NIDB 4HYTA 5KDDA 2ATVA 4MUBA 2H9YA 4KO3S 4P0QB 3RS0A 4B80A 4EUEA 4F93B 1AOXA 1PDVA 4E13A 3KOWA 1LPSA 5LZ8A 4UHHA 3RS2A 5ABPA 5E8JA 4FI3F 2O59A 1E1CA 1FQWA 1FW6A 1TM2A 4L3VA 1FC0A 4A0GA 1I18A 1MEEA 4YJFB 5CFRA 4A82A 3LW7A 2JH3A 3WJ7A 1XDDA 3CPWB 4N5IX 4ZJPA 2CGEA 3B89A 4H3VA 1S8FA 4DOMA 4D8XA 2ZIEA 1VHJA 3HUTA 3IP8A 4ZIRB 2BKUA 3PZBA 3UXMA 2OM2A 4TVSA 4QAJA 2PT9A 3KAQA 1ZGHA 1KH2A 4JZYA 2I7CA 5K8TA 3KQHA 4YYZA 4L73A 4YR9A 1X14A 2GN2A 3AFNA 4J0IA 4WLNA 3UJNA 3EA4A 3O4VA 1FSGA 3QEOA 4IINA 2GO7A 4ZKEA 5HVNA 1AKYA 1E7MA 4CIXA 2QGNA 4WERA 2I5PO 5DWQA 4UW9A 5CBPA 5EXTA 5KKNB 1JEJA 5ESXA 1IN7A 4LHEA 3O21A 3CF0A 4XVHA 5AXAA 3B6MA 1Y7PA 3HCDA 1TM1E 4NMWA 4L4RA 2QOEA 4OXYA 3W1VA 1JFRA 3CXRA 4QATA 1KVSA 3VV2A 2LWIA 4AD8A 4W8OA 1QCYA 2Y4OA 2Z6AA 2YZGA 1M0SA 2CD9A 2RI6A 4JJEA 2AF3C 5KPJA 3QFFA 3RU9A 4IDPA 3TRJA 1WTAA 4YT5A 2P6PA 1OV6A 1PJSA 2WHPA 4XXHA 1J22A 5IKXA 2I7TA 3AP3A 4MGHA 3P2OA 2ZT7A 3STWA 4LJKA 2NZUG 3O8QB 2J5RA 4MVJD 3G9QA 1RQLA 2FW0A 1YRHA 3LUGA 1H2XA 4DQLA 2W6ZA 1GPYA 1QTRA 1Y89A 1C3XA 1RRPA 5D3MB 1J2YA 5FUBA 5HA5A 3ROZA 3T0FA 3MWEB 1J1ZA 4D4IA 4Z6KA 2VH5R 2P91A 1VDMA 3OY7A 2OV3A 1R15A 1HSOA 4YRJA 1GV1A 3L04A 3LW8A 4MMZB 1AB5A 1XP5A 3ZUPA 4L2IB 4F1JA 2P6NA 4I3HA 3T51B 4BNUA 1U1IA 4QQFA 4LYJA 4HNHA 4IIJB 2BFAA 4MPDA 3VDRA 2W8ZA 4D4GA 3LUDA 3QGMA 4OQNA 1WMSA 1P8AA 2H0QA 2X5OA 1M1YE 3COWA 2MINB 1N2OA 3KM0A 1SBTA 2GGSA 2FHSA 3M6AA 5LQJA 3GLFB 1FMLA 5ICFA 1LK5A 1V8FA 1KQOA 2HY7A 4DYHA 5HE8A 2OXIA 1YIAA 1UMBB 4OAOA 4MGYR 2A0KA 5CJJA 1BCRB 1V41E 1WWKA 3MCTA 1WPXA 1KZ7B 1MT3A 3RF7A 5J3JA 3MWDA 1IHMA 3FI0A 1ID1A 4PSCA 3CONA 2PM8A 4FHZA 4MYCA 1IMJA 4JI2B 5AJUA 3L84A 4IEIA 4FTWA 4WBNA 2WZDA 1E8MA 4Q4JB 3PQEA 1MQ8B 4WNAA 1UKVY 1G8KA 2QQ5A 4OPOA 4E2FA 1O58A 4FOSA 4P7GA 2QZJA 3DAOA 5G53C 1CUGA 2YXPX 3LA6A 4GIBA 1HYHA 1XLVA 3GT3A 4J1TA 2O23A 2AC2A 4NWIA 4TMKA 5FOXA 2QLBA 1G4AE 5EA2A 2W6CX 4JK3A 3HH8A 4OP1A 1TB4A 1NVVQ 3VH2A 1SVSA 4PYIA 3D1LA 3GPLA 1A9SA 1A4RA 2IY7A 4FYIA 3DW3X 3EDOA 3B7GA 5CDFA 3TQIA 5FLXA 3N2GB 1MAAA 2DC1A 3ER9A 4QLAA 4X91A 2H3EA 4DV4B 2HJVA 5KTKA 2B30A 4AY2A 2YFKA 1U0GA 3KLOA 2B4AA 2EERA 3ASPA 4MW9A 4YAFA 1D7AA 1H8HA 1GSIA 1NULA 2H07A 2PZBA 2H4YA 1Y1LA 3K1ZA 4WBSA 3RIYA 4O33A 5BV1A 2X1LA 1XQ6A 2EEZA 5K3BA 4DV6B 3EPRA 3RANA 4MLCA 4LE1A 4NNOA 3VKFA 4J1QA 3TSZA 2WUFA 5JCXA 5LXTA 5IRCD 3EX7C 3HEMA 2P1RA 1SBQA 2P9TA 4O1HA 1TJ4A 5KKAA 4M89A 3ICWA 1O97C 4IZHA 5FCDA 2RGUA 2GR9A 4MQUA 5JZ9A 3THXB 3KDSE 5LSAA 3VNQA 3LSTA 1WSVA 5H0IA 4PABA 3ZGZA 1FYVA 5JAZA 1XJ5A 4K8RB 1XHFA 3ZQKA 4CKCB 5FTLA 3REGA 1M2NA 1U9ZA 1YUNA 2I6UA 2Q0HA 3OPXA 2FB9A 3V4FA 4LGVA 3WICA 4D45A 4XYLA 5F64A 2QBYA 1CJVC 2Y1FA 2V9ZA 1P1IA 1XQ1A 3FCXA 2EIXA 2I80A 3RFCA 3UF0A 2BYTA 2R8EA 5TMDA 2DBYA 4GDFA 1YC2A 4JBGA 5BVHA 1XCLA 3D0RA 1AK1A 2ZRKA 4QTTB 1RLUA 4OQDA 3QEMA 5KWVA 1K7CA 2XBUA 3EWAA 3I6IA 5HK8A 1RMTA 5LDDC 4TKLA 1YE5A 1QG6A 3GBSA 3LFHA 2BEUB 3UC5A 4AK9A 2EBWA 3QJGA 4HEJA 5HJEA 3WHPA 2RAVA 5JD5A 2VNIA 1NWCA 5L7TA 3FY4A 3A27A 2M6LA 1HRKA 1WCWA 3OIDA 2C92A 3QW2A 5AKHA 1TEZA 4CMIA 1W581 3UAGA 5A9SA 2VXBA 3BH6A 3Q3VA 3GWZA 3G5MA 3GJTA 3FBWA 3ZWQA 2EX1A 4NHEA 3V3TA 3NO4A 2ERCA 4Z8YA 4C7XA 3OJFA 2AW5A 3B1WA 1WDTA 3RWBA 1E60A 2WJ4A 2PRYA 2J48A 3LJKA 1ADCA 3I05A 1JQBA 2DWPA 2B6HA 2JIRA 3B3FA 4OSPA 4TZ0A 1Z45A 4CQLB 4S1VA 2V4UA 3Q8MA 4NONA 2RBEA 1L5RA 1RJDA 3ESCA 2PX4A 3IODA 1A4IA 4RQAA 4Y2HA 4A9AA 2IX3A 2QN3A 1QFYA 1GL7A 2G77B 4NS1A 2XGOA 2NZVG 3EF1A 3F9RA 5BWCA 1JG2A 1K6MA 3GJYA 4NESA 1M2JA 5AQEA 4EELA 5FI0B 4KDCA 3DMYA 1L7NA 3KL4A 3IBSA 3HBMA 4LVCA 4TVBA 3S2YA 5CW2A 4QNRA 3F3YA 1T5TA 4FNGA 2XUGA 4AYXA 4G4JA 5TRTA 5JLJA 5EJGA 1KPIA 1GZSA 2FMHA 4Q82A 1QWSA 2FPUA 3CLHA 1RHJA 4AQDA 5BWNA 1B6GA 1KWKA 4ZDWA 3TBKA 1KIFA 2RC6A 1XALA 2ZQ5A 2D6FA 1L8OA 5IBRA 1DPGA 2Y1XA 3UICA 1P9LA 2FW9A 1UANA 3BGOS 6ADHA 4MXDA 3VNAA 1ODJA 3ZDXB 1CVRA 3J81A 1U0HC 2JGNA 2CXQA 3IX7A 4I4TB 1WAMA 5B1DA 1WLSA 4FGUA 4L0MA 3W3AA 3BKWA 1T36A 2RKBA 3PUJA 1JVSA 1PWEA 4D9EA 1T2EA 1W5FA 3MS7A 4NTZA 3V8VA 4DMGA 3B5EA 4LBWA 1FW8A 3ZE7A 1KQNA 1JG1A 1P8JA 3IBFA 4CMEA 4EIWA 2XBMA 2JGAA 4PO1A 5CJ2A 3ROTA 1T2CA 1RYEA 4V1CI 4HLUA 3UK2A 3DG9A 3T7KA 1XRJA 3ZKWA 3VSCA 1W88A 2RHHA 1AQ6A 4YLYA 3LT4A 3FPKA 3IT0A 5H3CA 3FPFA 2AMLA 2PLWA 4GZ5A 5A1TA 3MB8A 1YI1A 1J25A 5DVZA 1UXOA 2HOQA 5EJ2A 4G1EB 3DKVA 4JSRA 3DWIA 2Z8XA 4J0KA 5EMKA 3MK31 3P2IA 1N1GA 3MPOA 4UDNA 4E15A 3QFCA 2G17A 4GOMD 4J4BA 1DAEA 1W1WA 4WA7A 3NBYC 4X41A 5FNVB 5ED0A 1K5GA 2F67A 1RAEA 4F4CA 1Z74A 4LDAA 2WM3A 4LMAA 3O74A 4G2NA 4MAFA 3S2FA 4BWGA 3VHRA 2XRFA 3GD7A 4P38A 1GZ4A 3E27A 2CB9A 2RBKA 3BUSA 2AUMA 2KS6A 5DSXA 5DX1A 2X7HA 2TMDA 1FP2A 4PYLA 3X2SA 4ZGNB 1RXSA 2KHZA 1YZYA 3I04A 3KTFA 1PQPA 1QZTA 2GBPA 4E03A 4LMBA 5KHOC 1N8NA 4BLSA 5J1TB 2P7HA 4RQBA 3RVNA 6Q21A 2VRCA 3EQ2A 1ECPA 1H5NA 2J9FB 2P2SA 1PZEA 2RH8A 5E1DA 1KEUA 4C21A 4RTKA 2DPGA 1KNQA 2XNJA 3F67A 4MHTA 3H42B 1M1ZA 5G1PA 2CK3D 4U2FA 1O89A 2I99A 4KNWA 1JDUA 1WOPA 1WCV1 4BP3A 4CL2A 1K8RA 1XZNA 3F6EX 1E3WB 2Q0SA 4M86A 3H04A 3AUXA 3VNUA 3NHBA 4EY7A 4JASB 1M1YA 1TUBA 3JQ6A 5D7BA 1T2NA 5AKZA 3ZK8A 2WQ7A 2E1BA 1NUUA 2H4WA 2X13A 3PCTA 3PRJA 4ZYLA 3GJ0A 4EMTA 1Y5MA 1QF9A 3VYRB 1FJ2A 4BVAA 1IM5A 2PYDA 4RMIA 1U04A 5LA6A 4CEIB 1U7TA 2YXBA 4KH1A 3GAAA 1M76A 2ZJAA 4IDCA 2O1EA 1TZJA 3OM1A 2P40A 4IO0A 3ZVKA 3PHIA 4PO9A 2PBRA 2WYWA 3GA0A 1W85A 2O8EB 1K66A 1YXMA 4MV3A 3EVCA 4KUEA 5ALYA 2Q3LA 1LI7A 4R3UC 3CLTD 4CCAA 4AAYA 4CG1A 1C0EA 2YRFA 3D2BA 3FWPA 3NGMA 4GNKA 2FMTA 4URHA 4N76A 4MWSA 2XVYA 3D3JA 1WABA 1ZWLA 4OSEA 3W5SA 3GDHA 3GJ6A 1GU0A 2VK4A 3X1XA 5KWJA 2YR0A 4LDQA 1DAGA 3BE4A 1NQVA 3EXIA 3RCBA 1GG5A 5JAUA 3M2PA 2R87A 4XB1A 5IZCC 2XQIA 2VF7A 5F2OA 4ZAGA 1SNYA 1FRQA 4EY4A 1AQUA 1Z8NA 1X19A 2OBLA 2XWBF 4N5HX 5DYGA 5HXBA 3JASA 2FOLA 5FT9A 2LZJA 2O4UX 3IA2A 4KIFA 5DYYA 2CVZA 3X3HA 1N3YA 2IYEA 3N53A 4UHJA 5DJ5A 1PWHA 5FPHA 4F4UA 2HO5A 3FROA 1IJKA 1NY5A 3KWJA 1VBNA 5FTWA 1KDZA 4AZ3B 3H8SA 3OEED 1P7VA 2R44A 4B7ZA 1BMFA 2JI7A 4P4TA 1L4KA 3LK6A 1YKFA 2PV7A 3ONWA 4PZ9A 2FQXA 1A5SB 4GO1A 4LBYA 4CDNA 2EF0A 4NDAA 1I0ZA 1K63A 4DWJA 5CLQA 5EHNA 4AM8A 1GKUB 1EXWA 2JI4A 3HY3A 3M6LA 5D86A 1CD5A 1B1AA 1JU3A 1R0SA 4NYIQ 1BHSA 4R1SA 5JFTA 3WZMA 3VR6H 4LJYA 3K92A 1JU4A 3H9NA 3ISXA 4M2LA 2CYBA 1QGAA 3ONUA 1I4LD 1BA2A 1QV6A 3CZMA 1N2ZA 2G5CA 2EXXA 2I3BA 1JHYA 2VHJA 4KACA 4BMXA 4DV3B 1B93A 3AWDA 4MQFA 2R4QA 4BMPB 4AF6A 5KMGA 5IXSA 1T43A 2YXNA 4R2HA 1OYWA 3WYGA 1P1HA 4N39A 1I32A 1ZN7A 2BMDA 3ZDYB 3RUDA 4TRRA 3M3HA 4NCXA 3F6YA 4J3FA 4WNCA 3QJYA 5JT1A 1T9DA 4FVTA 1HDZA 1HMPA 1L7PA 2BUBA 2IUYA 4X1YB 5LA6F 2BEJA 1N2CE 4G5FA 3H94A 4G81A 1ZOSA 5ALGA 1SVNA 4XX0B 2ZDHA 1B6TA 3D02A 1QVZA 2LKCA 4C87A 1PZXA 821PA 3TSOA 2PZMA 5E6UA 4AL4A 5JS7A 1J97A 1DC7A 4HWPA 1T9HA 1EK6A 1GG8A 1L4EA 1A04A 2BGMA 2TECE 2SKCA 3OE7D 2F3RA 4MYUA 4ZT3A 4AMYA 1TTQB 2EP7A 4EF6A 4NDNE 4IRXA 1C81A 1L1QA 1N5JA 1PYDA 3AONB 2VHVA 1JF8A 1ZUD1 3F98A 3PNBA 1YR7A 3KQLA 3O3MB 1BGVA 2ZIXB 3O95A 1E5LA 3BXPA 3IV6A 5JSYA 3R0QA 4WZBB 5IK2D 3PR3A 2RFLA 5KQRA 2DKOA 3BRWD 1FMTA 2AIRA 4JA2A 5BN4B 1I5EA 3MTBA 3RJTA 4DA6A 1P45A 3DZJA 3E1KA 3RSQA 4Z4TA 2HCRA 13PKA 2I3GA 3G5UA 4AXXA 2XMBA 5CJPA 1E64A 3RQIA 4RH0A 5LZ4A 1MTOA 4U6QA 1EUYA 1E1NA 4TKZA 2HJSA 1D2MA 1VJSA 1F6DA 3NKVA 1ZGJA 2LPMA 3HKBB 4H0CA 4WCFA 1GCOA 2PJUA 3GY0A 2FR8C 4BIIA 1E98A 2IIQA 3L8GA 2FZGA 3UMSA 4GPD1 4R41A 4D6XA 3LIIA 4HUJA 2RCNA 2BTQB 4GEGA 5LU9A 4EI2A 1WKCA 2C9OA 1UM8A 2FHPA 1JV2B 3NV7A 4E5KA 4URZR 5JDIA 2UZ4A 1PTJA 2R3SA 2OAGA 1GOTA 2PZFA 3JD1A 2JCYA 4IBOA 2ONJA 4YHBA 1RBMA 3M1YA 4C4TA 5K0SA 1NI5A 3DFKA 3DL7A 3HV0A 2YV3A 2R8YA 3N87A 4RD3A 2JIBA 2JCBA 1JSRA 2AYXA 2CFRA 2D0PB 3LX8A 2V7GA 4KQMA 2QR2A 3TSYA 5IDWA 4FBLA 3HR7A 3NYRA 2RONA 2ZBDA 1T6ZA 1DVRA 3ND8A 1KI8A 4M8SA 4HAZA 4WNYA 3GUVA 1GQ2A 2IHVA 3WGIA 4J29A 1Z4IA 1XPJA 4NAVA 2BGNA 2I4TA 3GDFA 4FHCA 3GRFA 1Z13A 3EOZA 4D9JA 1H93A 4TMVA 1MEOA 2Q3CA 1AKVA 5KAMA 2A9VA 3D6TB 5HOQA 1TC1A 1YRLA 2DRIA 3NBXX 2PG3A 2R6AA 2RARA 3A25A 3AGQA 4QA9A 4HNAB 4DV0B 4INZA 2PT7A 4CLHA 3CKYA 1PJ4A 3BTUA 2GZ1A 4C5AA 5KREA 3CRZA 2V4ZA 2XNHA 3ZIAA 3OPQA 1TQ6A 5FKJA 4BVJA 1G7TA 4DXHA 2O8BA 2B1JA 2H8KA 4MR9B 4GL2A 1UDBA 2IYXA 4C4PA 1NVVR 3K4PA 3K2QA 1M34B 5E1OA 1M6VB 2WYHA 5IC6A 3VZCA 3UANA 1E9CA 4IH9A 2P4HX 4JELA 4A03A 1AHPA 2QNRA 3AY7A 3R8XA 2KJQA 2DP4E 4YJ3A 3E9ZA 2K2QB 3ZGOA 4UFPA 4FDVA 4GR5A 3LWDA 5DF1A 5ALNA 2IC5A 4MPPA 2WM9B 5AVUA 4CQNA 1XO1A 3O90A 4CI0B 2HZBA 1U31A 4P4GA 3U17A 3NM4A 4FDUA 4G0OA 2JJ2A 3TJZA 2PIAA 3LXUX 4RZ2A 2PS3A 2C7QA 1MV5A 2IF0A 4LV8B 4OMFG 2G3YA 3RS4A 2ZWVA 3G5LA 1Q6YA 1X9HA 6AT1A 2NWQA 3II6X 4Q9DA 4KMMA 2Q3BA 3A3GA 3ESYA 4NSNA 4R05A 4RK1A 2CZGA 4TLCA 1E58A 1ZOPA 3R0XA 1H1LA 2KM1A 4LRSB 4RF4A 4NE9A 3GP5A 1U2SA 1PEDA 4ZQFA 4DV7B 4O02B 3PB3A 3LFUA 4BMCA 5DNUA 2B92A 3HZOA 4FCVA 4YN3A 3ZD9A 4MW1A 2I1WA 2C84A 3IAAA 4QBTA 5ANRB 1KAQA 1XTPA 4RETA 2WU4A 4DF3A 3SQWA 4B9EA 3OWOA 4DCNA 5WRFA 1QHSA 4CR7A 5EIEA 4XDZA 3UFXA 3L8ZA 1Z75A 3AU8A 4PR0A 1MAWA 1SXJE 3H5RA 3M4JA 4Q1EA 5GONB 1PJZA 3OPMA 4KTVE 1LZKA 1Q11A 3QIAA 4KRYA 4J7AA 4WXYB 1A7UA 2FX5A 4JYBA 3KOZA 5FQOA 4BGDA 3PWKA 5HK9A 3I5XA 1RNLA 1BHO1 4D3DA 3B6ZA 1YL6A 1N3LA 1GNPA 1ISHA 1JAHA 1U80A 2HSDA 3BE6A 4IDQA 2V8BA 5FOUA 3VSBA 5B64A 1LW7A 4QEKA 2DHCA 1P9RA 4WCDA 3IL2A 2EVWX 4IGAA 3OQMA 3U7HB 4Z4FA 3DZCA 3A1DA 4EZBA 3OC0A 4HADA 4B4OA 1ONOA 3OMLA 5FR2A 2G72A 1XD2B 4RPJA 3MTJA 5JCOA 4G0VA 3E5NA 4ZXFA 2P9CA 3FMFA 4TUYA 3RS5A 1P19A 3BWXA 1VQPB 1TKAA 1HMYA 3DOJA 4DHEA 4ENVA 5IJ0A 3LBFA 4XVRA 1XNGA 1Z7WA 2CUZA 2DY0A 3FFTA 4JXJA 5CA0B 2D7DA 4HVLA 3I64A 5AKKA 1QVGB 4M9CA 4YJ3F 1QR6A 1L7XA 3FBGA 4DR7B 3H5OA 3COPA 3CW9A 2GCPA 1R8YA 1LDEA 1GN9A 1SH7A 3OUUA 4WZEA 3H5WA 2Q6OA 4QJIA 4BQSA 5DN6D 4K28A 1CERA 4Q9AA 5GGYA 5DWVA 1TZBA 1WXHA 2D1QA 3A32A 1UAYA 4URUR 2H18A 5BV0A 3K5PA 4WWVA 1BN6A 1EH5A 1LVGA 2GNOA 3CEMA 3DEFA 4XKJA 3GN2A 1ZL0A 4D0LB 1T2AA 2XUQA 2P5TB 5LQDA 2W98A 3IP7A 4EG7A 4I5DA 1FNMA 2VYCA 1P74A 1KQ3A 3ICPA 1IWOA 2GN1A 3GPCA 3OCJA 4UEKA 1NRXA 2R65A 1GTZA 1RWWA 2IF2A 3A6LA 1SB9A 4E2WA 2QYTA 4LXXA 3RARA 5EMHA 4WL0A 4AKSA 2NUTB 5LDHA 3OZIA 1PYOA 1SKYE 1T3TA 4MTLA 4NJOA 1CUWA 4XQGA 4BL5A 2CV1A 3CPXA 1UP7A 1KJQA 3JQFA 1DSSG 3TRHA 3PF9A 1CUSA 3GRRA 4UBKA 5GJBA 4WZ6A 1JHZA 1DC6A 2IP2A 3V7WA 1ZEMA 3PFHA 4LGMA 2CXOA 1XZLA 1M7GA 2DBZA 3EVTA 4XVQA 2Y0BA 4RTQA 3QX3A 4TLEA 2C0QA 1ZSYA 3RY8A 2WZBA 4E5NA 2C99A 3ZCRA 4AX4A 2WVHA 1G8SA 3HYNA 3LDHA 1ZH4A 2AH5A 4MITA 1EINA 3IDSA 1W52X 4FWIB 3HKEB 5FPYA 5IABA 2PQ6A 4UHCA 2UV8A 3BX1A 1HF3A 1RKUA 2XUPA 2ZLBA 4CR6A 3ZNQA 1OX6A 2ZK7A 5D5HA 4GXQA 3QVGA 5A9RA 3AU9A 3IOCA 4OK5A 1FFXA 3BPSA 1SWWA 3GNQA 4RAOA 4RJ2A 4B7UA 2RB4A 2IZ0A 3E7WA 2QXYA 4TUYF 3KPWA 4RTRA 3C70A 4IXNA 1K5HA 1M6WA 3UK1A 3LRXA 1JBKA 1I36A 4Z3KA 3BMQB 3WLJA 4E21A 5JPDA 1U98A 2GB4A 3ZU5A 4EJSC 5AKJA 5JOQA 2EDAA 3PXUA 1RLMA 2WWVD 3I55B 3ETEA 5JAIA 1NP6A 3QA3E 4X93A 5FWYB 1JNXX 2DZDA 2PR2A 3ILXA 2HLHA 3MJRA 5PNTA 4TS1A 4BLUA 4NVRA 3OCUA 1YR3A 2R00A 4D82A 4AJKA 3V46A 4A7PA 4MVJA 1GZ3A 3QPUA 2KB0A 2VAMA 1YH3A 1YZ3A 4P36A 3KVVA 2D1FA 3BXGA 1QUFA 3EAQA 4KDEA 2JGKA 3FI9A 3H1PA 2J8ZA 3OO1A 4XM3A 3H5AA 5I5EA 3SQLA 4GXNA 1EQAA 3KYDA 3L8MA 4N49A 4M1EA 1T8RA 5A9TA 4EG3A 1QAQA 4M0LA 4MTCA 4XWKA 5IULC 4D8UA 1AUQA 3B1YA 3GYBA 2W8BB 2TMGA 4KQHA 4XD2A 1T1GA 3PQ7A 4FGJA 2GFHA 4PZCA 1JEQB 1VHWA 2Y3IA 2OCLA 4KAJA 1PRYA 4TWRA 5ALWA 1E2EA 3SZOA 3DUFA 1KIMA 4XEUA 1ZU5A 1BS9A 4FT2A 1JXQA 2A5GA 3AEZA 1NX6A 1YJBA 3G2OA 4G6ZA 4EY8A 4RV4A 2OE2A 4PYMA 4G56A 5EJ5A 1P0FA 2JFQA 1B6SA 3I0ZA 1NOJA 3NM6B 1FJGB 4B32A 4CIDA 4EHDA 3BDAA 3I53A 4RIEA 4NG5A 3U31A 4JGGA 4OFXA 1QU2A 1ZSNA 3RJ9A 5P8WA 4FMBB 4DR3B 4PC6A 3L4JA 3NWEA 4PC7A 1Z06A 3BJIC 3OZRA 4NJMB 4ED9A 4JT2A 2E21A 4B3HA 4LFAB 4DR6B 2G76A 5D1NA 3J81k 3N0RA 3N2IA 2ORIA 4G0WA 3N0WA 1A50B 1HY3A 3AM1A 1Q91A 2C2YA 2HMSA 3C3XA 4JXZA 4PTLA 1IBMB 2D2EA 3GZNA 4FYYA 3U19A 2QLTA 3H19A 3A9RA 1OT3A 4HNGA 2OORA 4ARBA 2BFDA 2VJNA 2JIQA 3CCFA 3DE4X 4FFPA 4LEIA 1DADA 2CNDA 4MGIR 4RUKA 3VBCA 3PA8A 4CMKA 3TZCA 5KEIA 4OI2A 2I6GA 5BR1A 3MXTA 1RYDA 3IE2A 1GY8A 1GDDA 4DANA 1FFDA 4Z7QB 5EVJA 5HRCA 4HGPA 1K9SA 3G2PA 4QPCA 4Q4AB 1SC6A 4CQJA 2A5YB 4MVJF 1MD9A 1Y9DA 4TZKA 5JSFA 5K0EA 3FNIA 1TA4A 5JSQA 1Y9ZA 3OI7A 4I1YA 3HABA 3AOEC 1T5BA 3WVNA 4BVHA 3HFRA 4EI7A 1I7SB 5K3EA 1XK6A 3EUWA 3IE0A 2CNOA 2DPYA 5E2IA 3KKMA 1CQIA 2IDKA 4QBHA 1H23A 2EJCA 1JQJC 2HWXA 2XECA 2XOXA 2J9RA 1ZM4A 4LFCB 3SS8A 3W0LB 3WWDA 4F4IA 3LPLA 2WSYB 3TB6A 1YA8A 2HLNA 2JI6A 4AY3A 4OXRA 5AHKA 2FUCA 4D41A 5A3RA 5IASA 3D9QX 2RGGA 4A91A 2Q9BA 4TTPA 1V5IA 1UJ6A 5E6SA 4ZI7F 2R7KA 3RAFC 1R7RA 5BSYA 3C4QA 3NKFA 2E9SA 1EBUA 2Q0QA 3LBNA 2B3TA 2L82A 2CF6A 2TMKA 5EHQA 2VHZA 3SP1A 3VI3B 4R6XA 3JQ9A 3ONFA 4FJ1A 2Q5CA 4QASA 1XF1A 4IQFA 1DOZA 4WKNA 2BJWA 1UFRA 1E94E 3FUWA 2MWMA 3KU1A 2O3SA 4WKOA 2G6BA 1LPPA 3G89A 3PVZA 3WLIA 5C8ZA 2PUBA 1Y81A 1UODA 3K0AB 4NS4A 3PBKA 4CKEB 4L16A 5LMCA 1DUIA 2LXNA 2OZLB 2XDWA 1KJZA 3FN4A 2Z6UA 1L5LA 5M29A 1JIKA 5C37A 2VBIA 4G97A 3ESXA 4WJLA 3ID6C 3MM4A 5KOJB 1R6AA 4QUZA 3L0BA 2YJNA 3C4JA 3TW0A 4F1KA 5EIAA 3CCVB 1TVKB 3F6CA 1OC4A 3IDFA 1HL3A 4J0HA 1YQEA 2QUAA 1H3FA 1UKZA 5CEJA 3CLSC 2WWXA 5L4SA 3QVVA 2LTAA 3QE9Y 4B3GA 2F6RA 2F1OA 1CIJA 1NJFA 3NHYA 1G5PA 3ZGVA 1SOVA 4E46A 1FXSA 1Q21A 2EFEB 3LX4A 3FTQA 2VP3A 3L1KA 3LUHA 3CZ4A 4ZVSA 2RK6A 3UHAA 4DDTA 3EIOA 2I6TA 1IHUA 1ZIOA 4BO0A 2ZDGA 2CDNA 1EVZA 3L0YA 3GVLA 1AA9A 4HPJB 2NU8B 1E2IA 4II7A 3UMCA 4Z4VA 1KK3A 5D01A 1QTQA 4BNIA 1W0KD 3DR3A 5T4BA 1K8ZB 1AUXA 4F2PA 4R0MA 2NQ2C 4LNUB 1FU4A 1JXAA 4DMFA 2IYPA 1UPBA 2F8LA 2JHGA 2OCPA 1B6RA 2E5FA 4WEQA 2WUVA 4Y2QA 4BHTA 2AF4C 2G0AA 1ARZA 2VYFA 3HJNA 5CX4A 1EFVA 5FR1A 2HLDD 2GA8A 4MUNA 4BMZA 3KXDA 5FTNA 3V33A 4YDQA 1LK7A 3FJYA 3JD2A 1N75A 5E9AA 3UOAB 1T2VA 2CXSA 5EIBD 1VJ1A 2ZE5A 4ZHQA 3DE2X 3E1SA 5DHTA 3UB2A 1PR2A 3Q7QA 3DZGA 1C0IA 1ISIA 2YJ4A 1J07A 3V6LA 1BCSB 1PW5A 4Y2PA 5ENZA 5ALIA 3E5MA 4JODA 1CU1A 5K03A 1EX1A 1YJXA 3PLRA 2APJA 1MJ5A 1JSCA 5KINB 1IOVA 1YU9A 4J7UA 3HDVA 4L3OA 4G0YA 4IJ5A 5FBKA 5HRAA 3QKIA 3ADDA 3IJPA 2HDHA 4JP1A 3LC0A 5CTAA 1LF5A 3C7TA 5EWMA 5IT0A 3UCFA 4Q05A 1OFIA 1ZLYA 1VQ1A 2MSLA 1Q1GA 1Y3IA 4MCHA 1YLOA 3QUCA 4ALKA 3GDWA 5EMNA 1Y8RB 1X9IA 1X1RA 4FYVA 4L4ZA 5CLIA 1WXWA 2I91A 4KWCA 4Z3DA 1CWUA 1J2EA 2VS1A 2FPLA 5KTOA 1XRLA 4EOGA 1NF2A 2EIHA 4MJ3A 3O8LA 2HIAA 1PV4A 2Q3FA 3L0CA 4RDXA 1FSZA 1U1CA 3GBVA 4BKQA 1JTFA 1HSZA 4U00A 5F3DA 1CUVA 3JYLA 3R77A 3ZU4A 3Q40A 3E15A 3ESAA 1K06A 2AEEA 4YCJA 3PR1A 1I4TD 3QV1A 1T3ZA 3ISVA 4LZLA 3UPTA 2A4KA 3PYLA 2CV2A 1Z08A 4LK3A 3TX6A 4ZTUB 3PG5A 3D2CA 3WLNA 1JUDA 2X85A 2QG4A 2R6CA 3H83A 4IMJB 1NBMD 3ZDDA 1WU8A 2FEPA 3I2JA 1B7GO 2VCHA 2X0NA 4E4YA 1N78A 5CAEB 3HFSA 1YOBA 1KC1A 2MSDB 1ZD1A 3BDVA 4NZOA 4U8HA 3G13A 3LK7A 4H6WA 4EVSA 1JEYA 1GL3A 2HBQA 3OBBA 3GRVA 5HGXA 3VH3A 3EZXA 1ZD4A 5TV2A 1ZN8A 2VTEA 1H4TA 2BZ1A 3LCVB 3RJMA 1ZCAA 2FYTA 3ZNPA 4BMYA 3EWIA 2ZUBA 1W2BB 2GYVA 4CMGA 4QE3A 2NVUB 2IYAA 4B75A 5NLLA 1VCOA 4OLFA 5JC1A 1Y6ZA 4MWBA 4JLKA 1YAJA 1R5NA 2XMZA 4Q00A 5I9BA 1PG5A 4DNPA 2HD4A 4K88A 1DAPA 1ODCA 3CBGA 5ITSA 2KPOA 4YAGA 5GADl 4YONB 4C04A 2CK3A 2FV8A 4C2AA 4IIYA 4B4DA 1ST2A 2EJUA 1ZHOA 3L92A 4YRPA 4EKIA 3PDIB 2Y2VA 3MBKA 2JKYA 3U4HA 1GZ5A 2X41A 4QPZA 4CU5A 2PMCA 1UQTA 1HWYA 2ERXA 4Y2JA 4YJFA 1KVTA 2GETA 2UUPA 2PUEA 3P96A 1YGYA 2VUSA 3L7KA 5BSXA 4OGGA 4R8MA 3B3AA 1TEHA 4ZIRA 1KJIA 1P1FA 1KH3A 1NJID 4RJKA 3BAFA 5I9LA 2CXRA 3W5CA 1JEOA 1YVDA 3SC6A 4BVKA 3FZGA 4F7WA 5KNCD 1L7AA 4FP9A 3W78A 3TCXB 1UBLS 2C5EA 3I2FA 3ZW7A 4AIRA 4FMCB 3AVWA 1WZUA 1XMIA 2HF9A 4NCKA 3RT7A 4XRGA 1PSDA 1T13A 1AS0A 2B37A 2CZQA 3EWSA 1N1MA 1PFQA 3QUBA 2NU6B 4K26A 5I3CA 1BEZA 3W34A 2CCKA 3ZWPA 5IJWA 5ALUA 4PTZA 2JGEA 4XQFA 4HDOB 4YXWD 1OZAA 3K0FB 2PWPA 3I9V1 1HDCA 4D8VA 1RWXA 3CCSB 2YBDA 3MZ0A 3KR9A 4RMNA 5FL7D 1Q9SA 4EJMA 3RIHA 4ZYXA 1GL9B 2ICAA 3OEEA 2BGKA 2OV6A 4NEGA 5T5QA 2WY2D 4AB1A 3K0SA 3ZV5A 3DDSA 4RD1A 4XYBA 3WBBA 3FGNA 2W9XA 1ZINA 2AWNA 5EUQB 1EU1A 4HFNA 4O2BF 3R5XA 2BI4A 3OWXA 8ABPA 2QVLA 2ZRHA 3RTBA 1E4OA 2Q7XA 3CCRB 4X7EA 2HRQA 3PYMA 3T4XA 1X8KA 1G4HA 4RY9A 3EA0A 3NDJA 3O8QA 3LHKA 4RAQA 2C98A 4URFA 1XDUA 3KQSA 1L3CA 4KJXA 1MMFB 2HK7A 3CN9A 3EZYA 4RVOA 4J1TC 2J6HA 3QVJA 5GV7A 4RVUA 3ZY5A 1QNLA 5D3MA 4KXXA 3WFJA 3MWEA 2GA9A 1PVDA 2BRUA 1PVVA 4C06A 2ZIZA 4BCCA 3DKPA 1WL8A 3E9RA 3QBEA 1L3BA 1NI4B 5A4MS 3OEHA 1W25A 1K4MA 4MP8A 4L2IA 5KC9A 1T5OA 4I2VA 1QIKA 4GQIA 4IIJA 5J5AA 3A7DA 4MZDA 3SBDA 1UPAA 1PL6A 2NAPA 1XTJA 1UJBA 4A0QA 4TZ6A 1B23P 2ANBA 2NYUA 4JLMA 4Y2RA 4FQ5A 3GLFA 3IP6A 4DDHA 3AR7A 3NCTA 4JB8A 4KZKA 2WU3A 1NL3A 1QXSA 3DHVA 3HY4A 2A67A 2V6FA 5SYAA 3VBEA 5FJJA 4ZI5A 1YZLA 3AHDA 4R01A 1ADYA 1VLHA 1OX4B 4L76A 4ZV9A 2SNIE 4IXTA 5IJAA 1DKOA 4FN5A 3BH0A 1KAOA 4ZEVA 4Z4QA 3W4KA 4B4UA 3WK4A 3ET4A 1GYQA 4A26A 4I5GA 5IK2A 1I1QB 1B4DA 3VI4B 3R09A 4M1ZA 4AWAA 1YZUA 1T8TA 1XDSA 2ZBGA 3GJZA 3NYWA 3BRWA 2GRJA 3TSWA 1K8AD 2FG7C 1XQXA 5SV2A 3U3XA 3NP9A 4KYTA 3KJZA 3E05A 4Q4JA 4N41A 4IYRA 1OB2A 4A1FA 4L8JA 3CCMB 3LKBA 5EY5B 3PNOA 2XDAA 1RP1A 1UIMA 1NJSA 3UIEA 5K0CA 3DB1A 5ECYA 4NFYA 2FSGA 1FNSA 4D9CA 2FSPA 1I3MA 3BQMB 1ESEA 4CE6A 1YKGA 1DP4A 2J4DA 3WIOA 1G2OA 4JUFA 1XMOB 1PDOA 3ED1A 4B46A 3WK9A 3OKAA 3E7DA 1H2HA 4MA0A 1YRQA 4P25A 1G5RA 3UAYA 2IQ5A 1JKMA 3LAWA 2PZKA 4K9SA 4KFSA 1BHJA 2PLRA 4F8EA 4X8HA 4CT4B 5KTSA 3RK1A 1L4UA 2QRVB 1E1QD 1JLMA 1SQ0A 3IAM6 4ZO4A 4B2YA 1EXNA 3AZOA 4KN8A 4I1OA 1JHDA 1PTKA 3TQFA 1X77A 2ZG6A 2IUEA 4IFBA 1F8GA 4HQFA 1XWIA 4YMIA 2AN4A 1U3CA 4WDRA 5K51A 4OLAA 3D5TA 3W5DA 3DP7A 1O0SA 2IH5A 5BMOA 4JI0B 2PUVA 3L0PA 4QOFA 9LDBA 4GC5A 5KHAA 1K08A 2ZJBA 1L5OA 1P2SA 3QLJA 2BR4A 2WDPA 2BI8A 4YT8A 4FPXA 3WC4A 1W93A 1JXOA 2ARKA 4RDIA 4KRXA 4IIJF 5SY6A 1ZVQA 1YQUA 3T1QA 1S02A 4BUCA 1KSJA 1XVUA 2IXBA 4UMVA 3THXA 3A9WA 1PFWA 3H3XA 2JFHA 3ROPA 4NPCA 1W2WB 3DMRA 4CKCA 1KP9A 1NPDA 1YBFA 4XDGA 3HCPA 4ZEOA 1EESA 3B1FA 1SKUA 2WLTA 5CXSA 2PRSA 4JWKA 4N3AA 2Z9CA 5CA1B 3FBTA 3ZPNA 1U65A 2ZRPA 1TECE 1HDXA 3QWFA 4OQQA 3GROA 8MHTA 2V7TA 1F51E 2ZKIA 3W2HA 3DLAA 6NULA 4INPA 2FGKA 1V9SA 1SGWA 3IYLW 1SRRA 1SIWA 4FZJA 4N65A 4DNQA 3W4JA 1CUHA 3QQ5A 4P35A 1VLOA 4LY3A 4I2NA 2CF5A 1EFPB 1WUHS 2B8JA 5FWNA 1P7ZA 2J7PD 1O9HA 1N25A 2WG1A 4LRTB 1OI3A 3T3IA 1KMHB 5I7FA 4GM0A 3Q5EA 1N4AA 5JAMA 1IHYA 4B71A 1TYZA 4G85A 5J35A 1RQPA 2N47A 2UYQA 3CU5A 2Z2IA 3UXEA 3OTQA 5JCPA 1SUEA 1N34B 3OFSA 3VDXA 2C94A 4LPKA 1PJLA 1UP6A 2I2FA 2VI5A 3PF8A 4CMEC 4BO1A 2ZS8A 1GXSB 3KQVA 3M89A 4BE9A 2V54A 5HF6A 4ZYVA 4HLUC 5JCZA 5E3HA 4C4XA 3FKSD 4MUAA 3OKFA 4RS3A 1DBSA 1Q82D 3C43A 4O3FA 3Q8KA 4HVCA 3TW6A 5C0OE 5JVDB 2BGWA 4ARIA 3I9OA 1XEFA 2WUEA 1QPBA 5EOVA 1DEAA 3BK2A 3EARA 5CB0A 1TFRA 2BM0A 3CC7B 4KUHA 3QE4A 2Q0XA 3G2KA 5A02A 5DIFA 4WINA 5EXPA 5EZ6B 4EUKA 2CHUA 4DPKA 2BAGA 4H08A 1CBUA 2N46A 3JSXA 5AVXA 3GJQA 1PJ6A 3K8YA 3NAZA 2XTZA 4DCOA 1A98A 4GT1A 1U2TA 2O7QA 3ETJA 4WLUA 2A7QA 3VISA 1R4ZA 2G1UA 4IMIB 1X7HA 1XEXB 3VHLB 1TCCA 3BB1A 1OBOA 4KKTA 3PNPA 2JAHA 1KA9H 4DJ5X 1K8YB 1Y8CA 3AVVA 1OV4A 5AW2A 5IZ4A 1RQ2A 5HILA 3KR1A 4ZYWA 5ALMA 1PU2A 1EBFA 4MCJA 1Y3CE 3T5BA 2J3LA 2ZSAA 4DLAA 4GQNA 3QBVA 3QVKA 1E2NA 1TM3E 3ZE9A 4P33A 1U7WA 4QICA 3EZ2A 2EKLA 1NUTA 3FETA 3AGPA 1COWD 1P17A 2AS0A 1JLKA 2HIGA 3T1NA 5IS2A 3U7RA 4JYZA 1R16A 3SEFA 2HT6A 1NFQA 2PLAA 1FRVA 2LD4A 3EHEA 2CBXA 1NN0A 3EDMA 2W43A 4HD8A 4CODB 5CLJA 4WZTA 1QVAA 3AHGA 3V32A 5J47A 5MHTA 2HHHB 5JANA 2II6A 1YFJA 1E9VA 1KDPA 1GG9A 2E6UX 1N9KA 3EG5A 2FUG1 1A5TA 5DN6A 5BSRA 2E18A 3BTOA 2B8NA 3QPAA 1UP4A 3BHNA 1HLFA 2ODTX 1DRJA 1RWNA 3GIDA 3P4UA 2ZXIA 1JDBC 1NVXQ 3N2EA 4MYRA 4D4KA 3SI7A 1JDVA 5CXQA 2I33A 4OOEA 1TQDA 3T3GA 5BORA 1G291 3OEWA 4B6FA 4L74A 4BNFA 4FC6A 3EVDA 2VDPB 4IJKA 1LSJA 5DW0A 4YXFA 3A3YA 4MS3A 3L7MA 2H5JA 3F7TA 1SZDA 1VL0A 5FNVA 1YZKA 3C3DA 4B31A 3KOMA 2OD7A 5KNBH 3QXSA 2K6GA 2CXXA 1R0RE 3SQDA 1OC2A 3T7DA 5B3LA 2YOFA 3Q1KA 4PYNA 2VNAA 1U90A 1EWVA 2PIDA 3U5TA 1JI3A 4IG9A 3SEZA 2YYSA 2EX4A 5CIWA 3D4BA 4LF5B 4M37A 2WAMA 1AD2A 1AB6A 2OB2A 1LNZA 4RS4A 3G2QA 2NP6A 1K9VF 1N6RA 4QU9A 4KODA 4KI7A 1KE1A 1QONA 2G9NA 1DI0A 5HZGA 3DL4A 1G8PA 1U7DA 3HVRA 3HGMA 3OIFA 1QGZA 1HYGA 3GO4A 2PGOA 2RGNA 2Y71A 4N6NA 1BN7A 1Y33E 3GEPA 4GS5A 2J9FA 2B99A 3Q3CA 5A5DA 2ZXFA 4TN1A 1JZQA 3HEBA 4GLLA 4JLUA 1CYEA 3GGPA 3U61B 2ZETA 2JFPA 1LJLA 1WNTA 1G4UR 4IJWA 1B8OA 4LRXA 1K0UA 3LP5A 2TRSB 1VB5A 4BFWA 2ZSJA 3AEKB 4I4TF 1IOLA 1A1SA 2QDKA 2FMIA 3EG9B 1ENZA 3MWKA 1T9ZA 3I45A 1OTXA 5I8ZA 1FP4B 4QVIA 4O6VA 1WVMA 2WUDA 1MVOA 2F3PA 3KTOA 3GGCA 3RUAA 1E8NA 4PQEA 1E6UA 2ODWA 3IO3A 1T6BY 1DOAA 3BGSA 1CNMA 3QKRB 4RIIA 2WR8A 1P9OA 3BDIA 1RYBA 4JBLA 1F8XA 5GIOE 2NU9B 2NUPB 3KPYA 1I9GA 3EPJA 2GAFA 1P3Y1 1HE3A 2EW1A 1WSDA 4HZUB 4C29A 4OLJA 2C7BA 2D7JA 4DG9A 2O57A 3LFTA 4ZHSA 3ES9A 4XARA 2O8EA 1NI3A 4AUNA 3H0CA 1HC7A 1WG8A 3CR3C 5JE8A 3WDKA 2J31A 4QYWA 2HPHA 4NOKA 3D7LA 1V6SA 2R1ZA 4RYDA 4ZO6A 4OHOA 1VE6A 3GARA 1RJEA 5D1HA 1V8PA 4X6LA 3CP2A 3DE6X 5EQJB 3DQZA 4MKXA 2GTPA 1XRNA 2PMBA 2CLFB 5FUWA 4LQLA 5JJCA 3JR7A 5FNVF 2CLHB 4B43A 4II3A 1PX0A 3N59A 3M82A 2ZXUA 5FUYA 4Z9BA 3BBPA 1D2AA 1V71A 2QB5A 5HKLA 1UOEA 1KETA 1MW9X 1CE8B 1Z5WA 2B61A 2N75A 4GX0A 5E2AA 5G41A 5T6BA 4CM5A 4EITA 1Z6QA 2LV8A 2YJGA 1PHPA 1L5ZA 2DMRA 2WTXA 1Z5NA 4N12A 4AZ3A 5K5EA 2ZZMA 4M8LA 3USZA 1MO3A 2BV3A 3ND6A 3VU8A 4H6VA 5K09A 1Q17A 1ZAKA 3RASA 3ZWMA 1JYFA 3FKQA 4K9QA 3EGDB 4DTIA 3TRDA 3KT3A 3NHRA 4XUCA 5BNTA 3H9GA 2OBNA 3U9TA 1RD4A 4XIJA 3MUNA 3SC2A 3BIFA 1H0HA 2C96A 2WYRA 4O4IB 2G71A 3GGOA 5JXWA 5F2NA 1KQGA 4XOIA 2AG6A 1JJ7A 1KSFX 2A78A 1OI2A 5EWLB 1TQ8A 1Q7RA 2G7MC 3I5YA 3PVSA 2DSTA 3CEJA 4WCFC 4XGNA 2XDYA 1O95D 1UBCA 3H5VA <