5FO1A

E301a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
338
structure length
338
Chain Sequence
b'MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVAQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 94
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo1A01
4MW5A 2RE8A 4MW2A 1KH3A 4F3RA 4L2IB 4R2MA 3QTBA 1RQGA 3JXEA 4GRIA 4DE5A 3UMVA 3CVUA 3HZRA 1F9AA 3DV2A 3DO8A 5F23A 4J76A 1N2IA 4PBRA 1N06A 1JIIA 1H1TA 1WXEA 2IJGX 4UZFA 2CSXA 3AG6A 1YUMA 3SZGA 3K32A 3N9IA 4X0EA 1VL2A 1M8JA 3COWA 1ZJWA 3A05A 3FDXA 1MAWA 3DPIA 3KT8A 3M5WA 4MWDA 1TQ8A 1ZH6A 3FIUA 2CFOA 3SEZA 1N2BA 2JA2A 3CA8A 2PIDA 4XFJA 4TS1A 1O96B 2BYTA 1PG0A 1TYBE 3CVYA 2DR2A 4XFDA 2V0GA 5DEOA 3L92A 4ND6A 2WQ7A 1QU2A 1F7UA 4DDKA 3FETA 4MVXA 2CYBA 1XNJA 3INNA 5KWVA 1NUPA 5J5AA 3CLSC 1G59A 1VBKA 2X0KA 3IDFA 5HUHA 2CV0A 1NI5A 2QUHA 3CLRD 3KT3A 3C8ZA 4BWVA 1T6ZA 1NUUA 2AG6A 2DPLA 1N78A 3QE4A 1MAUA 1PFWA 2D13A 2PZBA 5HUJA 4ZT6A 4KR6A 4EFKA 3FY4A 4Q93A 1EFVB 1N2JA 3COYA 1CT9A 3MLBA 3TZEA 3S3TA 3LE8A 1MC1A 1J09A 3ZJVA 3TQOA 1LI5A 2E89A 4ARIA 2YWCA 1R6TA 4MVYA 3ND5A 3VGJA 2QTMA 4JZYA 4QBTA 2AZXA 4U7JA 4P2BA 1EFPA 1FYDA 4MUKA 3ZUGA 2A1UA 1GLNA 1KQPA 2J5BA 4PBSA 4UZEA 1FFYA 2WSIA 1OWLA 4MW4A 1P4MA 2QTNA 1R6UA 2GOYA 3SEQA 4EG1A 1J21A 1TYCA 4NAHA 3CTAA 4ZT7A 1T6XA 3K9WA 2QUJA 2QJTA 1EUQA 4MW0A 3RK0A 3RHSA 4G5FA 1QJCA 4U8HA 4CDMA 4KPUA 3MUEA 5J59A 4DLPA 1F7VA 4HK4A 1IHOA 3VU8A 3FI0A 1GN8A 3P0JA 3G59A 4F4HA 4U63A 2VBTA 5A88A 4YBRA 2DEUA 1OWNA 1N77A 2J07A 1WQ4A 4NDAA 4ZCQA 3RJZA 4ZCRA 1U3CA 4DNXA 2A86A 2B7LA 3L93A 3Q4GA 3PRHA 1YI8A 4ZCSA 4EG7A 2EJCA 1IQUA 1T9GR 3A4IA 3CLUC 1MRZA 2XRZA 3AFHA 3Q10A 5K0SA 1Q15A 2VBVA 4R0NA 1OD6A 5IHXA 2H2AA 2D5BA 5TS2A 1MOPA 1OBCA 2EL7A 2TS1A 2A4MA 3GMIA 3CVWA 1O96A 5EKDA 4YMIA 1H3FA 5FNZA 1U0BB 2I1LA 1T9GS 1YIDA 3ZXIA 1O94C 4MW6A 2E0IA 1H3NA 3MXTA 5TEVA 3U1VA 1DNPA 1WJGA 4ZCPA 1M8FA 1GZUA 1O95C 2E21A 3AIIA 3PNYA 4MLPA 1N2GA 1HYBA 1TYDE 2OV4A 3LCJA 4CDNA 1GTRA 1J1UA 3ND7A 4ZT5A 1WXFA 2PG3A 3Q12A 4JFAA 4RUKA 4HJXA 2IELA 1WY5A 1Q19A 2A84A 3CLSD 1QRTA 1J20A 1PFYA 3PXUA 1N2EA 1XNGA 1BS2A 3IH5A 1TEZA 2CYCA 3H97A 2YY5A 4EG4A 3FOCA 1KP3A 1IH8A 3IVGA 3ELBA 1K97A 5LM3A 1IQRA 3KFLA 4NX2A 1M83A 1EJ2A 3ILVA 3D6VA 1EFVA 3AKZA 4KKVA 3SDBA 5DASA 3ZXSA 4PY2A 3NBKA 1GAXA 4EG5A 4WNYA 1R6XA 1XNHA 2D54A 1O6BA 1U7DA 2VTBB 2DETA 4E1AA 1ULHA 2GM3A 2ZUEA 3CR8A 5H7XA 2J08A 3SP1A 4MW9A 1NUSA 4MUEA 4K03A 1IRXA 1WQ3A 1I6MA 3H05A 1NB0A 2WQ6A 1X8XA 2JANA 4ARCA 3ZJUA 4CQNA 4YP7A 4QREA 4WSOA 1O0CA 2IP1A 1ZH0A 3KT0A 5A8AA 3FH0A 1VBMA 4PBTA 1VBNA 1QQTA 4YP5A 1QU3A 2HZ7A 1J70A 3CLTC 1S4MA 3G6KA 1WXGA 1NP7A 3H9CA 4MUFA 2R5WA 3A2KA 3RBAA 3LOQA 1OBHA 1WZ2A 3D6UA 4KR7A 4HPWA 5AHWA 5FO1A 4EG3A 2VXOA 1UFVA 1J1ZA 4Q16A 1T6YA 3N05A 1JGTA 1N07A 1LW7A 3UC5A 1IVSA 1VLHA 2HMAA 3TS1A 3IUEA 3G5AA 1O5TA 1NSYA 4ZT2A 2JAXA 1KORA 1IQ0A 2PZAA 4ZT4A 3P0IA 2H29A 3TZLA 3N8HA 1G8FA 3H9BA 4R2LA 1KAMA 2O5RA 4G5YA 1QNFA 2YWBA 3SZ3A 2ZP1A 4NZPA 1YUNA 1IFXA 4ZCTA 3BNWA 4XSVA 3KT6A 3CLUD 2J09A 2J4DA 2AKEA 2ZUFA 1JIJA 2XRYA 3IODA 5J58A 5DB4A 3GLVA 3HV0A 4HJRA 3ND6A 1M8KA 4MUHA 3VRHA 1QTQA 2C5SA 2YXNA 3QTTA 1U3DA 1JEEA 5A89A 5FO0A 1N1DA 3UOWA 1X6VA 1ILEA 1WKBA 3FWKA 3HFJA 4GU5A 4EG6A 1O94D 1I6KA 4DDHA 3I05A 1NUQA 3NV7A 2X1LA 1Y42X 2VBUA 3IMGA 2OYNA 3F3MA 4YP6A 4AS1A 3RK1A 4MAFA 3HGMA 1JHDA 1N3LA 1F4LA 1O97C 4A91A 1I2DA 1P7PA 3UK2A 4H3SA 4OUDB 4OJMX 1JEDA 2Z3VA 3IOBA 1EUYA 1MB9A 1MB2A 1U7XA 3ZIUA 1G8HA 2NSYA 1ZUNA 1KKUA 3COZA 1QRSA 1KH2A 1YIAA 4ZT3A 3IUBA 4CT0A 2VTBA 1QRUA 1PG2A 3UY4A 1KH1A 1N08A 2VBSA 4MUGA 5LFAA 3P0HA 5BNZA 2QJOA 1JECA 1M8GA 3NBAA 1K92A 4G6ZA 1N2HA 2DLCX 1KAQA 1WOYA 4I6GA 3CVXA 2OQ2A 1JZSA 1G8GA 1TYAE 1GTSA 1D2RA 2WB2A 3HMQA 3PNBA 5TEWA 4MUNA 2O8VA 2QJFA 2A7XA 1PFVA 4ND7A 5IJXA 2CT8A 1MBZA 4EG8A 3N2YA 1KP2A 3SYTA 4MVCA 2DERA 2A88A 2QUKA 1JMVA 3IVXA 1N05A 3H99A 3COVA 5HG0A 1NB9A 4QRDA 4S1OA 2BTEA 2CV1A 1PFUA 1KQOA 1N2OA 2X1MA 3CLTD 1NYLA 1V8FA 4DDMA 1JZQA 5KHAA 2RD2A 2P3MA 2CYAA 1KR2A 1K4MA 1O0BA 1H3EA 3X1JA 2NZ2A 4KR9A 3CVVA 4I6JA 1JILA 1OWOA 1B6TA 3ZGZA 3OTWA 1K4KA 4NATA 1SURA 3TQIA 3X1MA 1N75A 1COZA 2PFSA 5KCMA 2PXHA 3IOEA 4MWEA 4MUIA 3TNJA 4J75A 2CV2A 3CLRC 1LI7A 4EF6A 1NURA 3MLAA 2QTRA 3IMCA 3PNVA 2PZ8A 2CUZA 1NUTA 1I6LA 4MQ6A 1Q11A 4JXZA 2E18A 2HGZA 4MULA 1WXIA 5K0TA 1TFUA 2QUIA 3MMXA 4MW1A 5TRDA 3X1KA 4MWCA 2X3FA 1M1ZA 1WXHA 3HL4A 1A8HA 3IVCA 1OWMA 1Q9SA 4MVWA 1MJHA 2DUMA 3RFFA 4I6EA 5LLTA 5JBNA 2Z09A 1OWPA 3DLAA 3P52A 1NZJA 3A04A 1V47A 5TGTA 3BL5A 4JXXA 3E27A 3FG9A 4MW7A 5DK4A 4JYZA 1KQNA 3FHJA 1YULA 3ISJA 1EE1A 1Q77A 1EFPB 4K0RA 2DXIA 2A1UB 3ZJTA 2GKSA 3IOCA 2V0CA 4MUJA 1M8PA 4OUDA 5H16A 4FZJA 4L2IA 2A1TR 4MWBA 3OP1A 1O97D 3GUZA 1O95D 2Z08A 3FNRA 4NAUA 4AQ7A 4KPUB 3AL0C 4RPIA 2G36A 1EXDA 4DJAA 1JIKA 4EGAA 1XJQA 3IMEA 3AG5A 1GPMA 2A1TS
chains in the Genus database with same CATH superfamily
3AU9A 1FP2A 2PH1A 2CW5A 4JYAB 3ICCA 1XALA 1U2ZA 2F00A 2M1ZA 1QQ7A 1IBRA 3TSOA 3A26A 3KL2A 2QM8A 5LOVF 5ALLA 3CVUA 5CM2Z 4OFBA 5ENDA 3ZY5A 3IKMB 4U9HS 1FQWA 4TQAA 3A6JA 4WT7A 2CCJA 4RL6A 2XUPA 4INPA 2ZYTX 4IIJB 1D6MA 1QAOA 3E8MA 3HCPA 4NG4A 5SYNA 4HGQA 3MTAA 4MR9B 4RF3A 3RTEA 4ITRC 1VL2A 5FLYA 4D98A 1VSBA 2OAGA 1CPYA 2QDKA 3IMFA 4M1TA 3B6KA 3MJVA 3TZCA 1G8SA 3IO3A 5F1KA 2ZRGA 2J3MA 4R7ZA 1ZJWA 3PHGA 2OHOA 2PT6A 4EYOA 1NJ8A 2OAEA 3S6JA 1KYZA 2I3GA 5IDWA 2ZRMA 3FJOA 2BOVA 3PUYA 2R66A 4Q3LA 1FL9A 3BHNA 3T3OA 3ESRA 4JBWA 2FETA 2J3DA 4K9OA 4ZHQB 4D42A 3ESZA 3P9KA 4JR1A 5MN6A 5DOVA 2BYTA 3CVYA 2JJ1A 3V80A 5CCBA 3BE8A 4JJGA 1I3KA 5AKIA 1U4NA 2PH5A 1VMEA 4NCJA 4AZ0A 3LT2A 3U4HA 5MGNA 4WY8A 2IU4A 5T4HA 4QD3A 1DVRA 2AIRA 2JFPA 2XJ4A 3CNQS 3ENNA 4Q4DA 4UM7A 5IANA 2AJDA 1RMQA 5CR9A 2GRJA 3CNEA 3SX2A 4N7MA 2QUHA 3ZGNA 2ZR7A 1IN6A 1VLVA 4IMIB 4BFUA 5K0EA 3BEOA 2AOTA 3QW2A 3TD9A 2GXQA 5BSKA 1WV0A 1IHPA 5EJAA 1C7JA 2OFFA 1QVFB 4J1TC 5FT9A 4HWTA 5HA5A 2C7OA 2B30A 2IH4A 1CF4A 2GCPA 4LBVA 3BQJA 1KK1A 3MPOA 1PFWA 1XTBA 2NO6A 3GRCA 5EQFA 1MRSA 4NI5A 4FWIB 4UZSA 2PL9A 3C6QA 2WPDA 3W8EA 4MLCA 2Q0HA 2KBEA 1OH8A 3BMQA 1A8UA 2TECE 3KZOA 3PD1A 4HPJB 4Q39A 3Q9NA 5K99A 1ECCA 1DDOA 1T24A 2H7CA 2Z2ZA 3IDSA 1LD3A 3GIWA 3R5XA 4IX9A 3CYFA 2D4AA 1EEXB 3O2JA 3O82A 2YWCA 5FOWA 5HS6A 1CZHA 3RVKA 1PHRA 4Z6KA 2IDKA 1OHHD 3ZNPA 1QVRA 5KOJB 1JEQA 3D1JA 4YDRA 2DUUA 4BX2A 4ZO9A 1A9YA 4WZ6A 2FEKA 1S2DA 2QTZA 4L5IA 5E9AA 4UUAA 1GLNA 4M99A 3MWFA 2X3YA 1GTL1 2JGRA 5HIKA 4DR6B 1ORVA 3E58A 4OQNA 3KKQA 4JI6B 1M76A 4TWIA 3JD4A 4NH0A 2RHMA 3SKBA 2MHCA 2YYYA 2P1ZA 1E69A 2OP0A 2VJPA 5ALRA 3A2MA 2MDTA 2JIDA 1W9XA 2C2GA 1J00A 2RHWA 5IYNA 1OAOA 1P9OA 4YVFA 1BD3A 1FOEB 4UCWA 5FJIA 2E2WA 2RBKA 2V55B 4G5FA 2ZJ6A 3ED5A 4U8HA 4GG1A 5DNDA 3A4NA 2DF8A 4LV8B 4AG3A 2WT8A 4JU9A 4C4RA 1XWFA 3EUAA 4R01A 3TUZC 4AUNA 1XFDA 2XNCA 2NXEA 4FEGA 4K6FA 2Q3FA 5E8RA 4BB6A 4ZO7A 4E5MA 3KSRA 2J0UB 3AEQB 3PJEA 4BKRA 2I3BA 3EIHA 3C5VA 4LNHA 2P3LA 3LV8A 3W04A 2X0IA 3WIEA 2AR9A 4UE2A 2OFOA 4CKWB 2QRMA 3OZWA 4B8ZA 3PPIA 4BYMA 4HUTA 5KSWB 1QGUB 2OOSA 3EFEA 5CX4A 3R6GA 3DBHA 3E7DA 3KKNA 4IIYA 3LBFA 4ZI5A 3SQXA 3W2EA 4XGRA 2YWEA 3ETEA 2IP2A 4MQFA 1M0SA 1PD1A 3LQYA 5B3JA 3T5GA 1B6RA 2JEYA 1J06A 1DBQA 5HWSA 1JSCA 2I6QA 1Z38A 3O1HB 1H0SA 4AAYA 3ZE8A 1AXRA 4C2BA 2JFUA 1Q7CA 5DHQA 4Q9DA 4URYR 1ZRSA 3UG7A 1LNQA 3B1YA 4NDNE 5A3JA 4K8OA 1RR6A 1V11A 3E2IA 3ERCA 1DWUA 2FMKA 3DWFA 1VKJA 1YONA 5G41A 5JBQA 3M4XA 1HF3A 3OX2A 2A5JA 4LA4A 3U7RA 1OBCA 2CMKA 2ZYVX 2RSLA 3P19A 4KW7A 3DOUA 4C76A 3LNNA 1HDYA 5FLXA 1XTUA 1JJAA 3CU5A 3P0RA 4ZXFA 4XQEA 2C58A 1FNBA 1QH8B 2H54A 2FMXA 1WVIA 2N0SA 2VUHB 4MW6A 4U2KA 4KPFC 4D4KA 5TEVA 3RS8A 1ZU5A 2VDUE 2YH2A 1NI4B 2GBCA 3CW8X 1D9ZA 4HMQA 2O2SA 1MJGM 1O95C 5FUQA 2LR0A 1UT5A 1T5DX 3ACDA 1J0XO 3FROA 4BMXA 4RHEA 1HOTA 2BFDA 2FRDC 3MBIA 4PRLA 4KQXA 3COJA 1V3QE 1WTAA 1T0UA 3KHSA 2WU1A 3T5BA 2HXSA 2UKDA 1XL0A 4RO0A 2XXAA 2CVFA 1RFGE 4OQFA 3RNOA 4BQFA 4OOXA 3PDHA 4BAZA 4GOMD 4KQFA 5EXTA 1KTIA 3CCQB 2OVFA 1YZKA 1DKOA 2OBXA 3CO0S 1X9GA 3VHXB 2PU5A 5EERA 4CM5A 2HDOA 4E3ZA 1A96A 5AW9A 3AC0A 1IQRA 4KXQA 5JNVA 2VC2B 4OTZA 5LM3A 5KYUB 3OHMA 2WIDA 4IEFB 2P6MA 4KKVA 4W82A 2OHFA 2AX3A 3HVRA 1NF9A 4FEYA 3U37A 3A0UA 3KHTA 4JYBA 5D3QA 2QYOA 1J9EA 1FUKA 1N0UA 2AWNA 3IRVA 3L6EA 2XOKD 4J1NA 1Y81A 1QHXA 3Q3VA 4IG4A 4KYVA 1KQFA 4Y1GA 2Q2WA 4RMNA 4X1YA 2ZJ1A 1ZY2A 4XGNA 5F78A 3W2HA 4CW7A 4D80A 3GELA 1GPLA 4X9XA 1QHHA 3DA8A 3HABA 4JNKA 4UU0A 3PDIA 3GAZA 2XHEA 4JOQA 4MUEA 4PS1A 1WQ3A 1UCFA 2ZPTX 4KMMA 4PSUA 5CDGA 4PHCA 4K1XA 4DLAA 3K15A 4TTIA 2HNBA 1XYYA 1UDCA 1KI6B 3EQZA 2WMNB 3G2MA 3MWJA 4XE5A 1MGOA 2OYCA 3ZZ1A 3HJGA 1Q1AA 4DEVA 3RSHA 4E2ZA 4IQFA 1MZPA 1KI1A 1CUCA 4IJKA 2C96A 5L95A 2C07A 2XWBF 2JARA 4MIEA 1FMFA 1R4MA 1U7OA 3OFNA 2UUPA 2W2OA 4LMBA 1I7SB 1KERA 4X20B 4Z4ZA 16PKA 3K6SB 4QT0A 1CG6A 1VLYA 4CI0B 3V7WA 4EATA 2JHFA 1ORHA 3MD9A 1KC3A 2WHXA 1EUZA 3TBKA 1WTCA 1Y8QA 4CL3A 2WSBA 4KUHA 4R3UC 5ELLA 5CFOA 1V35A 4BQIA 4JLMA 4MUXA 5FO1A 1NULA 4U8GA 3PF8A 1ORIA 4K9PA 3VZSA 1ZINA 2L17A 3RU3A 1KR5A 2FFQA 2P6OA 3O8LA 4O1IA 2XQKA 4UDOA 2XZPA 4LYEA 3ZE0B 1S8OA 2JW5A 2ODQA 3N05A 4MVJH 2AYYA 3S7ZA 1NW5A 3ADOA 4DKXA 5M04A 1H0KA 8ADHA 1FPQA 2Q3MA 1H4VB 1ZJJA 3MWDB 4K88A 4RDKA 1XMJA 2JLZA 2ONCA 3GGCA 3HUTA 5F1YA 7REQA 4C0SA 2EFHB 1KORA 2FZLA 3LYHA 3SHTA 4H77A 1NY6A 1KE1A 3ZWCA 1VP3A 3K0FB 4CBVA 3M2TA 5C1PA 3COSA 4YGYA 2VS1A 1J8DA 2FN7A 4X95A 1XZMA 4TYMA 3WV4A 2YWBA 2O19A 1YSCA 3PPWA 4EG0A 4FC7A 1F8XA 1ZW6A 3H6KA 1GRNA 2GEVA 4YXFA 1YUNA 1WCWA 6ABPA 4YPVA 3RIGA 3ABZA 3HJAA 2CJWB 4ZVQA 1ZSYA 1SCDA 1PI3A 1IE3A 3HV0A 4IH4A 1T2CA 1ETUA 3EC1A 3O90A 4MDEA 3QMPA 4P4TA 4TLMB 3EGXA 2EJWA 3WLOA 2WSMA 3GLIA 2H2HA 1Z3IX 1OB5A 2I1WA 3LPMA 4AD8A 5K6AC 1LZKA 3I9KA 1D2CA 4ZVVA 3VYVA 1ODTC 4KYIB 5DHAA 1PNQA 3FR7A 1FFWA 3S68A 2I87A 2FWAA 1U3UA 2ZIWB 4G8CA 2GZRA 5IAKA 2X1LA 2FZWA 4EY8A 1M1UA 1XDUA 2H1HA 3VVCA 1ZGCA 3HVHA 3DFFA 3F3MA 2GH1A 1IN5A 2FMIA 1MABA 3I09A 4RF4A 4AS1A 2IOFA 2JBHA 4IRMA 5E2IA 3H84A 5FORA 1CZUA 1EAYA 5TARA 3T56B 3KQSA 1TZCA 4EMTA 4F9EA 4ALJA 4CQMA 3EEYA 4TVOA 4BFSA 3U7HB 3KWFA 1TA4A 2D1SA 3LUPA 3DBRA 2IPLA 2Q4BA 2ZTMA 5BY2A 2PX4A 4A8JC 1E1QA 3ZIUA 2CD9A 2ZT7A 2IUTA 2E1BA 4TL6A 1VZ3A 5ECGC 1ZM4A 3GRVA 1T8PA 1HDCA 1XEWY 1EDBA 4PGFA 1QZTA 2HJGA 3OLYA 1Q1ZA 5JATA 3CLVA 4WBSA 4J3JA 5K0FA 1MVLA 4LRWA 4NABA 3SFTA 2FPOA 2JFNA 4GFDA 4OMUA 1NDUA 4W8GA 1D4OA 1DT3A 4I9GA 4JSYA 1Z18A 2HWUA 4RGYA 5SYAA 3JZMA 4BLTA 5B5SA 3NGLA 4KK3A 5DHFA 2WIKA 4ZAFA 4GI5A 4TV9A 4CEHA 5T3YA 2PN1A 4DTIA 4CM8A 1YJXA 5KZMB 4JB2A 4F38A 1MP0A 3LFUA 4RIEA 4UXJA 3AI3A 3EN0A 5CBKA 1G4UR 2QIOA 2MU1A 2B5OA 4KK4A 2QJFA 2XSZA 3O8QA 2A7XA 3PFFA 4UEKA 3YASA 2YWXA 3MWLA 2ODAA 1XNQB 3SOPA 2PMKA 2WUDA 4U39A 4IS3A 5G3YA 3KTDA 1RWOA 3WLHA 3OEHA 1FTNA 1D1SA 2R6R1 2B37A 4UM8B 3EWSA 2X85A 4FOTA 3ZCUA 3L1HA 2MYPA 4B48A 4M46A 5FP0A 1G7SA 2KLHA 2J7PA 5FA5A 2A30A 1KVTA 1KQOA 1N2OA 5I7RA 1L7QA 4IUYA 1PJ4A 1V8FA 1JZQA 2GBPA 1XMPA 2ZXFA 3EVNA 3IQFA 1TUBA 2PCJA 3MXOA 4W5HA 1NMQA 2EBWA 4G5SA 4ZA2A 4X7FA 4MUMA 1BU8A 1VP9A 2ISCA 2YOFA 3L2OB 2QAIA 1BFDA 1GTJ1 2IXDA 3CJQA 5KSZA 4B83A 2W0MA 3LD9A 4ROTA 4UDYX 3OTWA 2Y1LA 4CU2A 3I9V1 4UHEA 1CUUA 3GJ4A 4YRTA 1MX3A 2ZWIA 1N6KA 2I4TA 3RVRA 2W6ZA 1W2WB 2VH5R 1H65A 1QGZA 2G0NA 3R5TA 4PCVA 4S1PA 2X3UA 3HO6A 5JG7A 2DOKA 3V1KA 3N2IA 1VCMA 4A92A 2ZWMA 3QOWA 4AZ0B 2NAFA 2VUUA 1KJZA 4HNAA 3LKVA 2Q2OA 1UJNA 4IXTA 5AVVA 1N2CB 1JWBB 2GK7A 1AKNA 4CM9D 4EHLA 1OXMA 4QC2A 3K16A 3TO5A 4AQYB 4WZBE 3MVEA 4DMKA 1Y9JA 3HDVA 1WHTA 3TOVA 3UCFA 1MVNA 3U4IA 2AN1A 2AOTB 3OCVA 3UH1A 1JHXA 4AJJA 1LBIA 5C2JB 2O4CA 3ZGVA 4PLTA 4XWYA 3MMXA 1JWLA 1B26A 3BZUA 5FPHA 4ER0A 3SS9X 2OBYA 4MQLA 5EFOA 2TYSB 3K4PA 1Q57A 1CUXA 3A4LA 1R6DA 3TUIC 4DCTA 4CDGA 3PQEA 2C2YA 2P65A 1HE4A 3AR3A 5DIZA 5A62A 1ZXXA 3HGTA 3MRVA 3U0VA 3BMQB 3PTZA 5A4FS 5MGBA 2H5EA 5KJEA 1PR1A 1FP4A 1VKHA 1E32A 2YZNA 1GITA 2AN9A 1GFWA 2WTXA 3QLJA 1WXWA 1Z37A 1AY0A 2E4VA 3NYWA 4O1HA 5EIBC 3ZVKA 1YULA 1ELOA 3GJ8A 2PKRA 1JEQB 4MJXA 1NPYA 3HRHA 1OMOA 1EBBA 1WVGA 2PWZA 3OZRA 4F2PA 4BE4A 3WICA 2ACVA 3OT4A 1FXSA 2PBZA 4KO4S 4XUCA 1UD4A 4WZKA 2DU8A 3LVFO 3K9HA 4TTJA 1X87A 3I6QA 3O7MA 2IKQA 4TXHA 4MWBA 4DSOA 3I2JA 1IHMA 2FE4A 4L6CA 1VXOA 3AFGA 4OLAA 1GDHA 2VXYA 4ALLA 4L28A 3W4KA 3HJFA 4K9QA 1V6AA 4KIGA 3FNRA 4RPLA 5BNFA 3WL6A 4F71A 4Q7LA 1EFHA 1RADA 2PR7A 2X42A 1WORA 2WM2A 4Q05A 4KXVA 2AOXA 2RC5A 4FXPA 2QSJA 4OQYA 4EJ6A 1GM5A 2FLVA 4KQGA 3ESDA 3CZQA 4MW2A 1E92A 2GM9A 1DBSA 2DFPA 3P9CA 1YQDA 4DE5A 4ERXA 3DBHB 2QN3A 2EBUA 4J1QA 5B4UA 1RHRA 1YD7A 3RAGA 1HG1A 4DV2B 1DQZA 2IJGX 2LKDA 4EO9A 3AVTA 4MQFB 3HU3A 4UBIA 3DOHA 4GDMA 4IJ5A 3IA7A 4N8DA 1UBCA 4JD5A 1GZ3A 3TK1A 2FCAA 5JSHA 3QG5A 2ZUSA 4A1FA 3BCRA 3DLCA 3HFRA 4G84A 3WVNA 4A5SA 2F8SA 1QF9A 5FOXA 1EGAA 5CIWA 3I3OA 4EA7A 3DPIA 5C4MA 5K01A 2BMEA 4Y2XA 1ADFA 1V11B 2EJTA 1J2TA 5A2QA 3O8CA 2AFIB 4OBEA 1Z06A 4LYFA 4MYDA 1HMYA 1U63A 4H1WA 3NEJA 2VNSA 5A7HA 3SKXA 3TJRA 2FV8A 3R7FA 1AZTA 2X4DA 4LOKA 3E6AA 3PJGA 2DR2A 3OICA 4AY5A 1Y5RA 2XCUA 2O3UA 4PYKA 4WOBA 2FSSA 2QNRA 3W6ZA 4DDUA 5BVHA 3Q7RA 5PGMA 4NBKA 5LUBA 4ZJUA 4I08A 4D5EA 3EVTA 3QWFA 5TQ2A 4GWKA 2JHAA 3EFBA 1J7JA 4Q9JA 2GFIA 2J3HA 4A0FA 5JEEA 2BFDB 1O0SA 1U65A 3KL9A 4FQ7A 1G0NA 2W22A 3NG1A 4RZIA 3EODA 5KCZA 2W4MA 2ZYAA 3GIDA 2CL5A 4FKBA 2HA7A 4GW3A 1MO4A 1NG9A 2DB3A 2XXAB 4H9GA 4WJZA 3FPJA 1A4XA 4B34A 3H11A 3MM4A 3TCNA 5JV5A 5T7BA 2VK2A 1ISPA 2EFDB 1OFTA 2OLJA 3L1JA 3KP1A 1DAPA 13PKA 1I13A 3SX0A 1KQGA 2EYQA 3A9VA 1I3NA 1E7SA 2DAPA 5D01A 5IMSA 4XX0A 5EVCA 4QQNA 3D2AA 1THTA 2ZBEA 1VHWA 4ME6A 5L53A 1YZYA 3ONUA 4IVQA 1CT9A 4AECA 1SCUA 1ZD5A 3K7EA 5K51A 2V7QD 1GCOA 5I5EA 5K4AA 1AC5A 2Q2VA 1O5IA 4RM0A 3L4SO 4BGIA 2ID8A 3QF4A 4HDAA 4MOWA 3VGJA 4X1YB 3CCSB 3NBUA 1K0UA 4NS1A 1DTEA 1QHHB 1UBHS 4M1YA 4MUKA 1X1QA 3T35A 1E60A 3EB9A 5F5LA 3KAJA 2CLMB 3SC2A 4JGIA 2FUG6 2H31A 2V6JA 3FE2A 4B3HA 3HJTA 2OQVA 3OPYI 1QH9A 3HU1A 5BQ3A 3R9XB 1JLLA 3L46A 1HT1E 2OFXA 2CJPA 3IT2A 1PT5A 3VC1A 3FHOA 3UHPA 2AVDA 2HRBA 2IHNA 4FLEA 5DWQA 3IAHA 4MIKA 1XP5A 2ZW9A 4JKOA 1OIXA 1R4MB 1WNTA 2B69A 2IYTA 2OHXA 1UUFA 1PV2A 3W90A 4BRZA 2JJYA 1S3SA 3E9NA 3KYIB 3N7AA 1F7VA 4JUIA 1FE8A 4MI3A 3DOCA 4OHUA 1N5LA 1Y8QB 1XQ1A 1ZESA 1GCIA 1Z9BA 1DKUA 2D5LA 2PMWB 3BHIA 1E3EA 4GZLA 1TVKA 4P7GA 3RRJA 1U2GA 3C4QA 4QPCA 1HLFA 4EX6A 3QYFA 1MPXA 3C4JA 1ZSNA 4GBMA 4RDHA 2OXEA 4YBRA 5F98A 2ON6A 3GT0A 4TT8A 4AKGA 1OAKA 4HNQA 1QLWA 5KNCA 2O1SA 4W1RA 2P69A 3AVQA 2DBZA 3SC6A 5HR5A 2Q0QA 4Z86A 1DDIA 4B0PA 4JI1B 2QR5A 5B30A 2H5JA 5CCXA 7REQB 4WEQA 4EK9A 3A8IA 3EDOA 1D2NA 5ALGA 3IB6A 3SCZA 4Z9FA 3CH5A 3O8RA 2FRXA 3CB4A 2CNKA 1YXMA 4HLUA 2WFAA 1F4VA 4E46A 1YCGA 2GZHA 2PRZA 3LYAA 2FLKA 4A7PA 3R3JA 3UWMA 4BB0A 1U04A 1T2NA 2F55A 2J3LA 1EP1B 1U99A 5C8DA 4B3TB 1DC6A 3QWHA 5E6SA 1T35A 2Q3BA 3QVOA 1KARA 4TV8A 4ILKA 2RGCA 3C0KA 4BRWA 1SIBE 4PX3A 3E9DA 1X7XB 2I1LA 4H08A 3ZK9A 2GHQA 2Y76A 5ALVA 1HE5A 4REQA 3EGXB 2RIRA 3KBOA 2QOEA 4RX1A 4RETA 2HJHA 5IP5A 4L51A 3L4EA 5J2TF 3F2VA 5BPHA 3GLIB 2JFZA 1KZ7B 1Y6JA 1QV6A 1N6LA 2E21A 3QKTA 5EGSA 2CVOA 4PZEA 3PIRA 1UT6A 3WGMA 4EY7A 2GK4A 1CDOA 3LFHA 4DQUA 2AXNA 3LGSA 4Y0NA 4G56A 3IULA 1RCUA 4XVCA 3U60B 1YK0A 5FBHA 4LGYA 3I1JA 5HCNA 4OFZA 1KOLA 1YC5A 1IB6A 2VDMB 2V6MA 2GN0A 2WIBA 3RSFA 3H17A 1MABB 3AQ4A 1FJHA 4JJ8A 1Z4KA 5AJVB 4BBPA 2W2VA 2FEWB 2VP9A 4WXRA 4MUYA 2YIMA 3SEAA 3OZSA 4XUGB 4EWLA 4BMCA 4NYJQ 3ELBA 1NE2A 4CQMB 1X86B 4G5QA 1C0PA 4R1UA 3RU2A 1EJ2A 5KNBH 4MGIR 5HXAA 4HAYA 1OXUA 2J41A 2QTBA 4WWVA 2X6QA 3DBRB 3KFXA 4Y67A 3SDBA 1N3IA 1WMBA 1AT1A 4RLQA 1ULTA 4RLZA 3P2OA 2GPAA 3LA8A 4IQGA 4PSKA 3QE9Y 2UZ1A 4TZ6A 2ZYWX 4OLJA 4P31A 4QDXA 1S2NA 1LH0A 5FPSA 1O6BA 4B0OA 5EFZA 3O4GA 1OUMA 1W96A 2H2IA 2GM3A 2K7ZA 1YH3A 5AN9A 5KYTA 4PGOA 3SZMA 2C9CA 3KSMA 2AMVA 4MW9A 3ROMA 4AY6A 3QELA 5KYNA 2Y1CA 4K03A 1IYZA 2GCEA 3SJ7A 2QU8A 1GPYA 4PNHA 2H65A 2V3CC 3T1QA 3PVSA 2PKQO 3H3XA 4CEHB 3L0CA 2OA0A 1FFSA 4CM8B 2HQ1A 1DAGA 1Y5MA 1T5HX 2EKDA 3SNHA 4AN4A 5ANRB 3ZWBA 5IUJC 1QX4A 1I14A 1O0CA 1OJ7A 3GZNA 1TK2A 4LY9A 3BH4A 3SQWA 1GZVA 3B7GA 3O95A 1NYTA 2Z5FA 4OPVA 3K9CA 4ZEVA 4KO2S 1ODCA 3C6ZA 2Z6QA 3D1VA 4KLCA 3ZQUA 7ABPA 2X6RA 1NHWA 5ADHA 4ZFNA 3RKRA 4LRXA 1NP7A 3S27A 3PRJA 4W4TA 5BWOA 3GCDA 5BT9A 1LSSA 1XB2A 3RBAA 5K0LA 1A3CA 3OUZA 4FWTA 1TEXA 1N25A 4HPWA 1VQMB 1VA4A 3IKVA 3OX3A 4UUPA 1W48A 3BD6A 4JCCA 2JIMA 5A7GA 1NJ2A 3MQ4A 4UMDA 1B6SA 4GSYA 3SJBA 3VR1A 2V59A 1TUBB 3T4UA 5DN6A 4DR7B 4P92A 3UHJA 5JLJA 4QYWA 4UHCA 3S8EA 1KC8D 1N0HA 3TXXA 1IVSA 1JA1A 2QG9A 1TW2A 2EF1A 4FGJA 4I8XA 1E3TA 1TMYA 3M2PA 1AXGA 4P8RA 5IJ0B 3BRSA 2BSQA 2WAAA 1I0LA 2A9KA 3G5AA 2O6LA 4BFCA 3NCTA 3QU7A 5A4DA 1CVIA 5JQGA 3A1VA 4KQJA 1G7TA 2J0VA 1ZVJA 4MPJA 1JTFA 5HVNA 2V7WA 1USKA 3HB0A 3HHPA 3I2YX 3HDGA 3V2GA 3ZKWB 2ZL6A 2UYCA 4R2LA 4HN9A 3VNQA 4RD0A 2XZLA 1Y8RA 4PTZA 4TLLB 3K9FC 4X07A 4HYYA 2UZ3A 5AKEA 5BXQC 4OKNA 3R5HA 1Q1BA 4HNAB 3TIIA 4UULA 3A11A 2CY0A 2W4QA 4CCSA 4KXNA 4QEKA 3CLUD 4Q9IA 4X7PA 3QBJA 3A9UA 3FTNA 2YZ2A 5CA0F 1G21A 4HC4A 2HF9A 2JHPA 3G0DA 3OHSX 4KYTA 2WYHA 4EYKA 1WHTB 4MGZR 4CQLA 5EJ9A 4HQ6A 1J8QA 1R0YA 1X77A 1L5QA 3H2ZA 3QTTA 2QL7A 2J5XA 2PT5A 1PEKE 5FAKA 3B3AA 5LWHA 2Q3CA 3EC2A 5A1TA 3BFPA 3LUCA 3KB1A 4B85A 5I47A 1WKBA 3BHMA 3Q7TA 1HETA 4GU5A 4C6HA 2BFMA 3DMRA 5LMNB 2AX4A 3A1DA 1P31A 3LOUA 4BNNA 2X7XA 1OYVA 2UXCB 3Q3IA 2ONJA 5JH7F 4P1VA 1SIWA 1IATA 4Q9LA 4IEIA 3ZTTA 3NV7A 3S2FA 2D00A 4V39A 1Z8NA 2CMDA 3OT5A 5IJAA 3ZI0A 3DLHA 4W1QA 4MX8A 5AM5A 2FP4A 5KTPA 1FP4B 5GP1A 1GUFA 2QVLA 2EF0A 2EFJA 3EUEA 3A3BA 4FN5A 1DO0A 3GX1A 4IW3B 3KVYA 4EKYA 1NJ5A 1VCIA 3ZN2A 4RTKA 3PQ8A 4FFBA 4NKRA 3X44A 1O97C 1U9CA 4A91A 3U7GA 1J24A 2VQ3A 1CU1A 4OB8A 1DLIA 1PE0A 2VPIA 5HBGA 1N8TA 1DXQA 4FHGA 4Z4IA 2DG2A 3FMGA 3GFFA 3HI6A 5I7UA 3ZGXA 1PK8A 3OPMA 3QRWA 1IPEA 4I1PA 2OZEA 1AQ6A 4YLGA 2QSUA 2O9JA 2P77A 2ZR0A 3R3HA 4LDRA 4DF3A 3UW1A 2GXUA 5DGHA 2NMVA 3BXXA 2ASVA 2CE7A 2QLJA 1D2GA 4BUZA 5DDIP 4ZVNA 4N9WA 4EHBA 1A2KC 1E64A 3L7DA 1V1JA 3MBKA 1TEHA 3QKUA 3PC4A 2EBHX 4PYQA 5DULA 2ONYA 1BYUA 3O0DA 4N0QA 2WJ3A 3L40A 2GEUA 3PPYA 4INJA 2O50A 1ABFA 1FRVA 1SOWA 4C08A 1T9ZA 4MB2A 3NC1C 1N6PA 3V7NA 4E5NA 1TLTA 3A1WA 1XTTA 2PBFA 3HV2A 3C8UA 1FNSA 1ML3A 2BBOA 4ETWA 3E1GA 3DQPA 2Y1KA 3HVUA 3NQ41 3OCJA 4M49A 4N7JA 1A27A 4CN8A 4OFXA 2RGUA 4EG8A 5JMOA 5CT6A 4R0VA 1UJCA 1IOWA 2GF2A 2IYXA 4GSKA 1TF2A 1KEUA 2H1VA 3G7SA 1CHNA 1WIWA 4RM3A 1ESEA 1NONA 1T4CA 4PC7A 1U3VA 2RHGB 3VI3B 4W1PA 4E7OA 1AHIA 3O93A 4DLYA 4KREA 1UWLA 3FFXA 1A2QA 5FF9A 2AS0A 4TMKA 2B8EA 2XWSA 1Y89A 4DCVA 2PX6A 3GPCA 1Y1RA 2JAWA 1Y1QA 3I76A 2HF7A 3K30A 4JQZA 3ZR4B 4PHTA 3JSXA 3RJ5A 4A26A 3L4JA 1J6UA 2CXUA 4OHFA 4AY4A 2ZI3A 4BO7A 4LHZA 3DEAA 3LUFA 1RWPA 3H1BA 1OLUA 2ZEJA 1JQAA 3AHIA 4BNFA 1P4JA 4D25A 5DXFA 3CWZA 3GEGA 2Q5FA 3TQIA 2UUCB 2O6HA 1U2EA 2GEBA 2BM0A 4X06A 5KCMA 1QE0A 1GPH1 4QFBA 1VIVA 4GLLA 1P7WA 1SUSA 1PZXA 3K8OE 5BVHB 3NVAA 5DM2A 1G9TA 1R00A 3FPBA 4FYIA 4EW2A 1B8UA 2PAFA 3CLRC 4FMDB 4P4UA 3LF2A 1HNZB 5TQ2B 4EF6A 3G2OA 4MICA 3KAQA 1PTJA 2A57A 3D54D 3DKKA 1NVVR 4XD7D 3W34A 1IXZA 1I6LA 1XHLA 2I65A 1WSDA 3HXLA 1HH4A 1IG0A 3F4BA 2V4DA 4GE0A 5HGXA 1KWKA 4FIZA 1AX9A 1K7CA 4IWNA 1H8HD 2GEDA 1C4OA 4CM6A 4RBNA 3H11B 1KYYA 4YO8A 2X3FA 3T54A 2HJWA 2EAUA 2K4MA 2PX8A 3MS2A 2WWFA 5KVVA 1QWOA 2C2HA 2F59A 3HWRA 5EVJA 3ZIAD 4D82A 3BM5A 4X44A 5KEIA 2Q9UA 3EBPA 1SCUB 4DQVA 3C98A 3AP1A 2JJ1D 3T7AA 1AK2A 2JKZA 2UZAA 3AIOA 4L5CA 3QF4B 3SU8A 1Y1LA 4W5RA 1LJLA 2WKSA 5CLHA 2KYRA 2G6TA 3R3VA 2FYTA 2A5YB 4N7RA 4OHCA 3TZQA 3C45A 2GKSA 3IOCA 4MKGA 2AJTA 1KK3A 3JD3A 2O4UX 4OOFA 3SC2B 2X53S 4ZCIA 4A3SA 2X23A 4HMPA 1P7ZA 1JLLB 2PH3A 3H8VA 4QM6A 1RAHA 4CL2A 3H94A 4MO2A 3KPVA 1Q3KA 1CUWA 2QTGA 5F3WB 1TT5B 1Y6QA 1ST2A 3BB1A 2UV8A 3KSZO 4L3WA 1Z6PA 3NHJA 3U3OA 5ALPA 1V95A 1SCBA 1ECJA 3HYTA 4PIMA 5DNCA 1O57A 1G7CA 3GDOA 1UZNA 5TVGA 3FPLA 5ITSA 1JR3D 3QVUA 4WLFA 1SEPA 1W0KD 2LXNA 5B2FA 2JGDA 1E4YA 4WZLA 3CF2A 4ACBA 3R0JA 2D7CA 3DMFA 3RLIA 1O9HA 1TZJA 5FEMA 3T9AA 2BISA 2P6RA 3V46A 5T41A 3TX2A 5C31A 1I4OA 4Y1RA 4GKJB 1TVKB 2UVQA 1JMYA 3SZLA 4C0KA 2JASA 1FSGA 2KWIA 1A82A 3GPDG 4R2MA 5HFNA 4F3RA 3TG8A 3ER8A 1XD2A 3QA9A 4IHKA 1Y34E 1XU7A 4URFA 1WL8A 3E0XA 2ID4A 1WP6A 3L4KA 1GPUA 1D1TA 3N87A 3OJFA 4D57A 3OIUA 1EVZA 3LUHA 5L3VA 4GOKA 2G1JA 8ATCA 3URKA 3A1FA 4G24A 3ZVMA 3IR5A 2FQ1A 3NYQA 3K32A 4Y2UA 3CT4A 4AJLA 5I9BA 2G1KA 1FNMA 2G67A 5KW9A 1Z6GA 2AMJA 4OPOA 1DCKA 2Q50A 3BS4A 4Q82A 2PAAA 4EGFA 1HKUA 2CK3D 2OBSA 1MAWA 2I8CA 1PLLA 1K7EB 3KQNA 1BE0A 1ENPA 1TQ8A 2C98A 3KDAA 3WMEA 4XA8A 1BOFA 5DZSA 1VQNB 1DUIA 3T53B 3MJHA 5REQA 5ALMA 1VE7A 1OROA 2JLAA 4A8PA 1SMKA 3DYVA 5KQMA 4EPXA 1NP6A 3DEHA 3HYNA 1XZBA 4FZVA 1YLOA 4I3GA 4PAOA 1JL3A 4TV8B 1OJLA 3B36A 1NBHA 3DZJA 3UAGA 5HPYB 2UUOA 1GVNB 1E79A 2ZBRA 5EEHA 3T12A 4TTRA 2WFMA 3EXIA 3EVDA 2FMHA 3M6VA 1DEAA 1UXHA 4LRSB 4REQB 3RAJA 5LZ9A 4HF7A 3EIXA 4K9MA 1P3DA 2X6XA 4M0FA 1S3FA 4JN6B 2QAGB 3ORRA 2AXPA 2AN3A 2BDTA 2R65A 1JHZA 4TN1A 1E1KA 3ZZUA 2OR3A 2WUVA 3CLSC 3INGA 1G59A 2IBMA 2FUG1 1AUPA 2VG8A 5J63A 2CKDA 4BDTA 3GMTA 3RJMA 1PLJA 2H4JA 1OB0A 1Q14A 1P1BA 2R5FA 3CPJB 3FTDA 1VL1A 2ENWA 1CUBA 2DBVO 3QU5A 3MCVA 2G83A 3RS0A 2UZIR 3I34X 1U9YA 3JYLA 1MEOA 4Q7EA 4BIIA 1NW7A 1NUUA 1GNVA 2BFPA 2JIBA 2Q99A 1E1DA 4NAVA 2YDXA 1AQLA 1CS0A 4YRKA 3OIVA 3FNBA 2J48A 1FUYB 1MAUA 4NJMA 4RJ2A 4RHFA 1NJ6A 1L5MA 4JQYA 3R75A 5BUZA 1RZ3A 1F5SA 4GMXA 4MUAA 1EE2A 3P9RA 3PU6A 4WCFB 3TW8A 1KEZA 3FTFA 1L8XA 3B1WA 4LJ6A 1ORRA 3C24A 5DE3A 3VR3D 1SM4A 4AZ3A 1WMFA 3L49A 1KPGA 3ETCA 3M8KA 1S1MA 4B3GA 3M4NA 5GONA 3Q72A 1KYXA 3HPQA 4QWWA 2PY6A 1XEXA 4AO7A 2ZSDA 5CNKA 2E89A 4MRRA 2UZ1B 4IJ6A 3V4RA 3ZLJA 3D7MA 5A03A 2CUKA 4HH3C 1D1PA 3IEKA 2PANA 4MDYA 2AZXA 2BGTA 1WCV1 3LT1A 5GV7A 1CY6A 4ZOCA 4LDAA 4EW6A 2O3RA 5AW6A 1P1FA 4OXYA 1W36B 1D6NA 2RJ3A 2J5BA 4OJQA 1KU6A 3QELB 3NO4A 1R5NA 1A88A 3ROFA 2IPOA 2J4FA 4H31A 3KK0A 3OOHA 3BQ9A 1Z26A 3V1UA 3H4MA 3HBJA 2DHEA 2WINI 1LTHR 3AM3A 3F8TA 4L8WB 1JTVA 4C9BA 2DVMA 1PL0A 1TD1A 1OBOA 2LV8A 3PEFA 3UJ3X 2ZCVA 1IJEA 2VDWA 4I36A 1UP7A 2Y6UA 3KB6A 4LUCA 2DTXA 3GZNB 4MGEA 3BD8A 2QY6A 4YB8A 4B6EA 4JI4B 2B4AA 4RFSA 4POAA 1RYEA 2VLIA 3JQ8B 3OF3A 2HSEA 2O2YA 4YUVA 4BKUA 3MUEA 2P9HA 2REQA 5KQLA 4E30A 1JJ7A 4IVPA 3MHPA 1IZ8A 1DIAA 1WMEA 2ECQA 2X2EA 4L4ZA 2HCBA 5FA6A 1Q21A 1B14A 2FPIA 4LZNA 3S44A 4ZV4A 2A0WA 3G82C 4JXJA 2C54A 1W5SA 3FPSA 3NJRA 4KXMA 4PM4A 1FTQA 4XIIA 5ALZA 3VV3A 4F8YA 4E03A 1FFAA 3F8WA 4MKFA 4ER5A 5IULC 4F93B 2M1XA 5AXAA 4D74A 3LBHA 3D8NA 3ZEIA 4CM4A 3EGCA 1DQYA 5EP1A 3RJZA 3RUAA 3RUEA 3WXMA 5EI5A 3DTNA 3I58A 5D6NA 1ORDA 3OJ0A 3KG2A 1NQTA 5JQGB 1GZ4A 1XE3A 1PW7A 3KIPA 4HTFB 3F5MA 4ZOLB 3CUEF 4IJMA 1EZ1A 4II7A 4CMIA 1ZNXA 6CHYA 2QGGA 5IVDA 4B45A 2NSHA 4DBZA 3V6LA 4OVKA 1MRZA 1US8A 1Y8RB 3JWIA 1YJAA 1G8MA 4LC9A 4PG7A 3U4DA 4WGGA 4UQOA 4EJMA 3PUMA 1GZ7A 2G07A 1LJ8A 3TDNA 1D04A 1Q83A 2OHIA 4M0UA 4R2JA 3BJEA 3AHDA 4J29A 1PQWA 1KIAA 1W34A 3OPQA 1G21B 2IHUA 2QXTA 1DIBA 4O4HF 4QLBA 3ETLA 3FYCA 1KL7A 5DGIA 1U0BB 5IVIA 4CQLB 1XEFA 4L0MA 4GKAA 1MB3A 1O94C 5F3RA 4OXKA 1Y7PA 3Q8WA 1X9IA 4M0KA 4C4TA 1ZN2A 3NDIA 5E3IA 3B53X 4HWRA 4KKSA 2QUZA 1GZUA 3E82A 1V4BA 1ZK1A 1PQPA 4NLLA 3CHYA 3KJNA 1E9VA 3ZK7A 3GT4A 1OLOA 4ZU6X 5KAPA 1JI3A 2IITA 3GPLA 1CUJA 3WBFA 4IOJA 3SD7A 3LXUX 1UXOA 2EXXA 1W94A 2A84A 4P32A 5J1SB 2FP4B 3EQ7A 3H6GA 3UCXA 1BS2A 2O2IA 5FUWA 4Q3DA 3T1NA 4EYQA 3K73O 4FIDA 4PPQA 4NPHA 3H97A 2PL3A 3A1EA 2B1IA 3FKQA 4ZEWA 3NX4A 1A95A 4FFBB 4D44A 1WD7A 1VPVA 1TJYA 2FWMX 3LHDA 2AFHE 5MDHA 5ALWA 1GHTA 1T0HB 1C7EA 3L0IB 2O2JA 3G0BA 4EI8A 2GZDA 1Y9AA 2V97A 3SXPA 1ZS9A 2IV7A 4NC9A 2J46A 2A5GA 4BO1A 5BQFA 1Y8ZA 4WNYA 4IGFA 1EB9A 1VHTA 5D1HA 3S1AA 4PXYA 3ET5A 2LCFA 3LDUA 1P1KA 4FYPA 3W3ZB 2KM1A 2RAUA 1H1LA 5LPNA 3LNCA 3WTCA 2WHPA 3AW9A 1KAEA 3VZCA 3L8EA 4G6IA 5C46F 4KGZA 4YJ3A 5HK8A 4YDQA 3NXKA 3FZGA 1IK4A 2O2ZA 2YMPA 3JQ9C 4GUAA 4NICA 5G4KA 1T1JA 1FYXA 2RJNA 3FGZA 3I62A 3WR5A 1IEVA 2QVXX 5JIBA 4QECA 4PG6A 1LBSA 2VHUA 4WSOA 5B57C 1ZR4A 2WU0A 3TLXA 4QOIA 3G2HA 3OE7A 1FLVA 4PPYA 3VI4B 3VOAA 2PS0A 5HJ5A 1SBNE 3K1AB 1WZUA 1VBMA 5DPMA 4EEKA 2ZRQA 1QS0A 3TLKA 2BBSA 3U9TA 1WB6A 4AXBA 2PKWA 2ZJ5A 3CZPA 3TW4A 2VDJA 2CLLB 2GREA 3KQYA 3PKZA 4JJEA 1GKYA 4MUFA 1GQFA 1CP2A 4JBXA 3EGVA 3FWZA 4L5BA 2P0EA 4XL9A 1M2WA 1KMQA 2WMYA 3AUJB 3MUFA 3H9NA 1Q81D 3G8CA 3PJFA 1U0JA 1Z13A 1QOZA 3CZ4A 1UFVA 2YN4A 3GLHE 3GR6A 1OBFO 2LKCA 1V96A 3NHWA 4K7JA 1X0VA 4HQKA 3S8MA 5L7TA 5DSTA 2HPVA 1SKMA 5H83A 2G82A 3LLUA 5B6PA 4YJ2A 1WU7A 2J3KA 3Q7PA 1X2BA 5I7OA 3QFSA 1V6CA 1VLHA 3PE4A 3VKGA 4JNCA 1EMDA 1BCRA 3LJKA 5CM9C 3L0OA 2ZRAA 3K8YA 4TKOB 1XCPA 2QG4A 5IUNC 3HXPA 1ONOA 4JEMA 4PC3A 4U7PB 4BU1A 2GNPA 3AF4A 3P0IA 3NFYA 1N3BA 4OQXA 3N3AC 3UGJA 1FRZA 1X70A 2Y6VA 3E7PA 2Z58A 3U61B 3LLSA 3AR6A 3M3DA 3V4FA 1HEYA 2FVGA 1WBBA 1ZLXA 3DDOA 3DE5X 4TTAA 5FTWA 1QCYA 5C3MA 5AK0A 1GPJA 3P9YA 4KKXB 3ICWA 3K0AA 3PHLA 3R9IA 2FHSA 3E5NA 3AM4A 3KVNA 4BJHB 1ZVKA 2XRYA 2HYDA 3VPDA 1C1XA 4S35A 5BRJA 2O54A 3OEHD 1BGXT 3Q0TA 1I2MA 1DKRA 4QGHA 4ZICA 4Y30A 4U3JA 3OIWA 5TGDA 3OMXA 4IMPA 1RRPA 3OQ1A 5L9AA 3AY6A 1FVHA 4TSFA 2J7PD 5A06A 2X4GA 2NU8A 3L7LA 3FNHA 2FKAA 1J2JA 2PX5A 1EG2A 1JLKA 3H1FA 4JAVC 4NEHB 4TKMA 4PO3X 3PG5A 4AKTA 5BV2P 2IGTA 4DDHA 3HDJA 4D3YA 1GO2A 5GJBA 2QM3A 4EY5A 1Z8FA 2OO7A 1NNSA 1SUBA 3OLZA 1UPBA 3KETA 4GKVA 2VDKB 3A06A 1T26A 4ESHA 2QM7A 4TROA 5FTKA 1PP4A 2FFJA 5FL7A 2NTVA 2XHZA 3GUCA 2JS7A 4RKFA 3TLGA 3FWHA 5IARA 2IWHA 5F7JA 4N3AA 4CHTA 1NHGA 2HRQA 3BTSA 1QPBA 4G0ZA 2B82A 3BVPA 5KYYA 1XV5A 2YQZA 3ECAA 4CTJA 4R69A 2I2XB 3VSBA 2FSGA 1N8SA 4G8BA 1EH5A 4H3SA 3N0TA 2C9YA 1YZ3A 2BONA 1AG9A 3GFPA 3R0QA 1J4AA 1ZM2A 1W6RA 3G1WA 4QWMA 2EDAA 4Z4TA 1BSVA 3CCEB 4OAOA 1PSDA 1T2UA 4M9XA 1QQ5A 3IAEA 1C9EA 5J4LA 2AW5A 3BL6A 4MHOA 3UY4A 4E2YA 4OPSA 3L4BC 4BE9A 2QX4A 3VHRA 2Q0SA 2RK6A 1YDEA 3OQJA 3WNDA 3WXBA 3X3HA 3DMHA 1E58A 2QJOA 3TQTA 3BC1A 1DIRA 1QBGA 5AUQA 1UBFA 5L4NA 4LYGA 4QHTA 1WOYA 3T9BA 1B15A 4JQCA 3R6TA 1FDVA 1Z4PX 3HDHA 2HH9A 1H5UA 2CL0X 3QKWA 3C16C 4JLJA 2CXRA 3W5SA 1TYAE 1H4QA 2MR5A 3C14C 3E48A 1WDWB 2NLOA 1FUEA 2X5NA 3AZPA 3KDSE 2IV3A 3WAGA 3T3DA 2DR3A 1GU1A 2G76A 3OO0A 1H2HA 4QVAA 3T5DA 4L15A 4OHWA 4B4DA 1ODIA 3OAAD 4WVLA 5G0WA 1NU8A 4NU0A 2DLDA 5MN4A 5IJXA 2QENA 5KYKA 4E33A 5AWFC 5I51A 1M0EA 1DCTA 1TL7C 1KP2A 1Z0AA 2AOVA 1U5BB 5D5HA 5L7YA 1DELA 4ZPXA 4QOSA 3BMXA 4BHTA 5GPBA 5H3HA 2UU9B 1I3CA 2QLBA 1JI0A 3ASSA 1HSOA 5FWNA 1PFUA 4JENA 4MAMA 1NZFA 3MT0A 4MUBA 3ZGLA 2CJFA 5EQDA 4OF4A 1AK1A 4QQRA 1GDDA 4MRVA 5JJLA 1K4MA 2OCBA 2R6HA 4EZBA 5P21A 1TUGA 5LIPA 1DQRA 4GR4A 1KBQA 4KV7A 3JWEA 5EJIA 1O3YA 4FSXA 1QYVA 4AMZA 1KAOA 3K0BA 1WG8A 1O95A 4XLFA 5ENZA 3RIYA 1E43A 2CB9A 2IIVA 3PNLA 1DXOA 1COZA 3EXIB 3L1KA 4X97A 3W3AH 5A6SA 2HNAA 3HY6A 4BCDA 1E8DA 5CLFA 5KAMA 2G9VA 1BMDA 1LKZA 4HZUA 3IOEA 3TSAA 4DR4B 5JAUA 1TO6A 1A2BA 4LCEA 4DC9A 2B1QA 3O4HA 4P54A 1H6BA 3F8SA 3PLNA 4OKSA 5T57A 4BNTA 4UU1A 2ZKLA 4US2R 4KLZA 3PUJA 1X2EA 3LCRA 3PNVA 4MIOA 2JBAB 5F7ZA 4C4YA 3X2SA 2CFRA 3O9VA 3OTQA 2OCDA 3P0EA 1BJRE 3A6LA 1U1EA 1EHCA 1M67A 1XRLA 3PZRA 4N5IX 3IJPA 4PSAA 5HBRA 1OX4A 4QO7A 4ERNA 1CS0B 4O4LA 2D2FA 4UVEA 3MPUA 4BNXA 2IX9A 1OOEA 2QTCA 5A0TA 3UW3A 3WMXA 3TW8B 2G72A 3JQCA 1HM5A 4IO1A 4RIHA 1BMFA 2DUMA 2PRYA 1NYRA 5BQOA 1UJ6A 4AZ3B 1VJGA 2F43A 4LFCB 3QXCA 3VOSA 2P9EA 5GONB 1XEXB 2RAFA 3MJFA 5DGTA 4B4OA 3PEYA 2Q1UA 4K3UA 4F8EA 1GFIA 4NZOA 5DP1A 5IT5A 3HZHA 2G25A 5JD3A 1KQNA 1H2WA 3JQFA 2P4UA 1XCJA 2II6A 3DULA 4P86A 4QU9A 2A0YA 3RC1A 4JEUA 4KFUA 4XIFA 2ETXA 4L85A 2C8LA 3OUTA 4OK5A 3KUKA 4ENSA 1UIRA 5D3MA 2BL4A 4RCZA 1DHRA 4MR8A 5J43A 4MUJA 4F1KA 2IYSA 3O4JA 1L4EA 1CY1A 3IP5A 1A50B 2A1TR 4GDFA 3UANA 5JSUA 2VQ6A 3K0KA 4DCUA 1RIFA 4J6FA 2H2FA 4L76A 1TTTA 2VDWB 4DNOA 4B6RA 3KKOA 1PG5A 4WK0B 5EXPA 3EGDA 3ZDRA 1WW2A 1U6KA 5DMHA 4M1WA 3RWMB 3UMGA 4W9NC 4GYYA 3GVJA 2REQB 3E7WA 2E4ZA 2HYIC 5BSHA 1UC4B 1KSGA 2EEPA 3MS4A 1DAMA 4GD3Q 3NHSA 5TVKA 1F0KA 1KO8A 2JFFA 3WLKX 4QXAA 3DKIA 3IUQA 5EHQA 2FPIB 3LKBA 4ZAZA 4MPRA 3OW7A 2QPOA 1TM7E 3FSRA 4JVNA 2CXQA 3GPBA 5ERYA 3QTBA 1LPOA 1SOAA 3FKJA 3DHVA 1YZGA 3AF1A 2RH5A 5E6UB 3ZI7A 3Q0IA 5K03A 1ZWKA 3DAPA 4Q47A 2F9LA 4BKPA 4PW0A 2JF0A 3ZZ0A 1ZQ1A 1M2EA 2NQ8A 3JYOA 4UZFA 3EZGA 3PWSA 5C5DA 4G09A 1Q0RA 5DGCA 2WPNA 3VH1A 1NAHA 4ETNA 2QPAA 2E48A 4C7BA 1GCUA 2OORC 4NH4A 3HPRA 1XLWA 4PZAA 1W4CA 4LY3A 5EGNA 1CDEA 2IYWA 4JQOA 4M37A 4Z0PA 3HO1A 3M5DA 4DY4A 1UD8A 4KBFA 4ESVA 2D1FA 1Z2EA 5LMCA 3DHEA 3OE5A 3IEXA 1E98A 5EE1A 1X80A 4P98A 5SYMA 3LYUA 3AVPA 3PA8A 3GRUA 2FW6A 2I99A 1YZQA 3AEZA 3LQ6A 3G8AA 3S2ZA 2GVDC 4HI0E 3NONA 2C2OA 5ULLA 3TJMA 3IP9A 1YZFA 2FQQA 4HS4A 3V76A 3NIFB 4DWJA 4Z1MD 3QJ5A 2C57A 2XNKA 1TD9A 1RHUA 3AFNA 1P75A 1JJ2B 2IEIA 3N74A 3PFHA 4DK1A 5DTEA 3UG6A 3KZMA 4E5UA 4LZPA 1JJBA 5JCZA 5CK4A 5K8IA 1MIHA 4FCTA 2C7QA 1K8YB 1KY5A 1JLRA 1XGKA 4H0FA 2Y0EA 2C03A 2XUKA 3HUFA 4C88A 4L07A 1P4RA 3DHNA 3AY0A 3NHFA 4DDKA 1J5PA 3GJXC 3CX6A 1PZFA 3N58A 2GF0A 4GPAA 1U1GA 2BP7A 1Q6ZA 4RQTA 4DUYB 2RGNA 3TL2A 2Q5IA 4X7EA 5J5AA 4Q02A 3Q8XB 4WVFA 3L7JA 2I6TA 3VZQA 5KNCD 1ID8A 1E99A 1OKKD 3EA0A 4QYSA 4G5HA 1W85A 4FE3A 5A4AA 1QIMA 3MGKA 2IZ1A 4AS3A 4DBVO 2AR0A 1SUDA 2NYUA 3ZYCA 4LYHA 4AX4A 1YRQA 2EZ4A 3E81A 5H9WA 4ZTZB 4LMPA 3MOSA 5ER9A 2P9FA 4DT1A 2P8JA 4AF6A 2KB0A 2YYSA 1VIYA 3E4CA 4NECA 5TPZA 3T7RA 3V1YA 2DPLA 3DM5A 4A73A 2YTZA 1U8UA 2CXXA 3BK2A 2VP0A 1VG0B 2GA8A 1NPTO 3IIMA 3NDJA 4P7JA 4AZTA 2BZ0A 2PTHA 2WABA 1JJVA 2PZBA 3KOOA 1GG2A 2PMDA 2BF7A 3WRXA 2DHQA 3V9PA 2RI6A 3EOAI 3RHTA 1CQIA 5LP6F 4KR6A 5SZHB 5BMOA 2VDVE 2WNSA 3QUAA 2VYND 1JNYA 4V0KA 2LCIA 1D3AA 1E6MA 2ZSUA 3KRTA 5BSMA 3TZEA 2W9XA 5KYWA 5CIQA 2IT1A 4EEXA 4GL2A 4TYYA 3ZWPA 3S1AB 2RG7A 2JJ2D 1KXZA 5K05A 4NU5A 1H1LB 3IUMA 4BNGA 3MTJA 4YK7A 1M0TA 2XWJI 2ZYSA 3MWYW 5F4OA 2OCPA 1Y3CE 2H9AA 3ZUGA 1XQYA 2IIPA 3AERA 3CKMA 4FYWA 1ZUD1 3B5EA 2V3WA 4K6KA 4OMFG 2J5RA 1OWLA 1V9LA 5KQSA 5G4KB 3KPUA 5TRTA 1XR3A 1P4MA 1E7WA 1FX1A 1R6UA 1XMSA 2C29D 3BXOA 3EAGA 4GNRA 1JUDA 4IXNA 3WP1B 3UMYA 3O9ZA 3REFA 4GGOA 4DR1B 1KS2A 2B78A 1DIGA 2VPZA 4L5AA 1QZ3A 5F9FA 3PIDA 4ZGQB 1DE0A 5KJCA 2QJTA 3NP9A 1XA0A 5K2MA 3VX4A 1T0BA 1RAIA 1UBMS 4BP3A 4KXUA 4ZAXA 5KDOA 1QS0B 2X58A 3F7MA 5A3RA 1AKEA 2KS6A 1XE1A 2AYXA 3GFQA 3E3MA 1GN8A 2JAHA 4I19A 1OTHA 3KU1A 4MEAA 1NXQA 1OR8A 3FF4A 4FP9A 5HEKA 4BZWA 4DNFA 1KY3A 1KBZA 1X3SA 3KPJA 4PZCA 3ZE7A 4BZQA 5JJIA 4YMLA 4CGZA 3HEAA 2GQFA 1ND5A 2BGMA 1DV2A 3ABOB 2YRFA 1RJFA 5K0NA 4OM8A 1A9ZA 2DULA 1ISSA 4W6QA 4YJ2B 4PYJA 4KC0A 1E61A 3C3KA 3EVCA 2Q29A 3TX6A 3VPGA 1E6UA 2BGWA 3VR4A 1P9LA 1BCRB 4RS3A 3D5EA 2QMZA 3GMSA 1W36D 2GEFA 5TNXA 3C7DB 2X2PA 3IBTA 3SGLA 1J2UA 1WLYA 1IJBA 2PIAA 3TGLA 3W5HA 4P0QB 1GZHB 1IN4A 1B41A 3UT0A 1TT7A 1NJGA 2V8OA 3AJAA 1AS2A 4M7WA 2BKVA 4I55A 4Q3KA 1JA9A 3WRYA 4BB9A 4Z7NB 2R1UA 1ONNA 2XLCA 1T1GA 5IYPA 3ZCVA 1LLFA 2OESA 2VF2A 3CIOA 2PRKA 3K0AB 3PEUA 1I3LA 2C2WA 4KUGA 2D5BA 3SAJA 1W1UA 1DEHA 1QVAA 5BWBA 1Q0HA 2IYEA 3D8SA 3GRYA 1ZIYA 3E2PA 3KEFA 3KZCA 5ALJA 4L8JA 4AO6A 2B1GA 4D3SA 2V74B 2BFCA 1NBIA 3B13B 4JLWA 4ID3A 1W4AA 5E7IA 3PGMA 2LDXA 2BDUA 1I36A 2C82A 2VPXA 4UBJA 5CT8A 1Z83A 3T1YB 3ZNNA 1DNPA 2BZGA 2NU8B 3FZEA 3A2NA 1XX6A 3L05A 4LF8B 4DY6A 3CPEA 4L16A 2H4ZA 1WAMA 3M70A 5C3UA 3ZV5A 3OJXA 1SHKA 4P5DA 4A82A 4OHZA 1ZD1A 2GPWA 5B3LA 9ATCA 5AW8A 2D5CA 3QE3A 4J6EA 3PVZA 3ZHRA 1J1UA 5A0VA 2HRCA 4PZUA 5J40A 3NANA 4ZCLA 4C7JA 4NZ9A 1FFBA 3Q3HA 4KVZA 3U5TA 3R7BA 3TLGB 2WWTA 1ZN8A 5U1PA 5C7YA 3UUGA 1UXIA 4B9AA 2F90A 3W5UA 1DWPA 4OQDA 3CNHA 4JFRA 6LDHA 1RXIA 1CD5A 3STHA 2VRCD 4M55A 2QD4A 3G79A 3K5HA 2PLFA 1RI3A 2VZ8A 3B20A 2IHZA 4FFNA 2W2MA 3LUAA 4ZO4A 4F91B 2A33A 1YDMA 2HC9A 3Q15C 5J3OA 2IYQA 4K2HA 5KWJA 1X94A 5DASA 4QUAA 3KL4A 1GGFA 3H04A 2ATVA 2K87A 1DQSA 5DM1A 1NSFA 3NBKA 3QMWA 5D7NA 5WRFA 2QROA 1NBME 1P91A 4Y6GB 1DTWA 5HGJA 1E3JA 1HI9A 1ZYUA 3P4UA 1QYRA 2RAPA 3OFVA 4ZAVA 3IYLW 3MOGA 2CLHB 4XYGA 3ICPA 4OHKA 1ULHA 4XM0A 1NIJA 1DJMA 3OIGA 4UNPA 1YBVA 3GZJA 5CB6A 3BWDD 5B4TA 5BOSA 1CS4C 4HB3A 1YRAA 1L7OA 3LC2O 4IF4A 1I6MA 4N0MA 2C97A 1HBJA 3LG2A 3FLBA 4RACA 4AMYA 2C3MA 4ZOQI 1M2KA 5IYZB 3PS9A 4FE4A 3VPXA 5LYJA 1H2YA 3OF2A 3OT1A 4G63A 3VDQA 4LZWA 1R4NA 3N7TA 1O89A 3R7DA 2VJCA 3A35A 1KO4A 3S1SA 3I4LA 2H4YA 1GIAA 1H2XA 1PJCA 3C7TA 1O5OA 3FH0A 3I12A 3ONVA 4HDMB 2GCGA 4D9CA 4E3WA 4G9BA 2ZAYA 5HOEA 3L1IA 1GAJA 2B0CA 2O20A 4GBJA 4MKHA 1D4FA 4MVJE 3UNXA 3X0DA 3SYKA 1GADO 2JGEA 3Q1KA 4G1EB 3M9XA 4BO3A 2N46A 2NAPA 5ADVA 1Z0SA 2XUIA 3HKBA 2GO1A 4WTOA 1MV8A 1Q7EA 2OKGA 2ZYRA 4MCAA 2FMUA 4Q4JA 5FI5A 3EPHA 1EIZA 4X71A 4QYTA 2WTBA 5AT1A 1RTTA 2A3RA 1Y5NA 3PHCA 4WXYB 1QYCA 1PWYE 2JFQA 1J8YF 2MYTA 2VBIA 2XMRA 3GGSA 3NBXX 5D2CA 3GP5A 2JLYA 3GRZA 5TDHA 3ZK8A 4P9NA 1N5RA 2A9JA 1RAFA 4N6NA 4UREA 2MJLA 1UPUA 1FDRA 1YJBA 2HA2A 4MYTA 3N8HA 2COEA 4K87A 5COBA 1R6BX 1YL5A 4P58A 1HKHA 5A6SB 4Z0NA 2CRVA 4TTTS 5JXJA 1Q22A 2OM2A 3L7BA 4K9KA 3PZBA 2A94A 1TCBA 4IO0A 3JASA 2BRUC 4I9FA 5DBIA 1MAAA 3WK4A 2X8BA 4DA4A 4Z4VA 5TMEA 3ZWMA 1L4NA 1W4RA 1UMBA 2XYHA 3L1UA 1BLIA 3Q6IA 3FPFA 4X41A 3GLVA 4CF6A 4OYRA 1T5BA 5DV9A 4CL0A 3AILA 1F2TA 5JRZA 5J2UA 2ZUEA 2C1ZA 2JAPA 3MTEA 5AK3A 1W4ZA 2WYUA 3DL4A 5TPWB 3UOWA 3HN6A 1XDBA 1PJRA 2YZGA 3BDIA 1WKCA 1ANKA 2I2FA 4O02B 4O4LB 4RGBA 3HFJA 2I2AA 1P0MA 4BAUA 4HDKA 1GV0A 1TJ4A 5AVJA 1ZGBA 3K70B 1VJRA 3PR2B 4GR9A 3HA7A 4LDQA 2F43B 3EASA 1GA6A 1R0LA 3G9XA 1EVQA 3C2QA 4G0PA 3I9FA 1NT4A 3QXJA 2PK3A 3A32A 3KSUA 3TIFA 4D3DA 4HNVA 2IGBA 1DXHA 1C4WA 2G4VA 4M3NA 1BHJA 3UV6A 3HACA 3RK1A 5DBEX 3VKWA 4I5IA 4XYLA 2D06A 3LQEA 4Q12A 4Q1DA 1T29A 2OHJA 3LU1A 1AMOA 5D3MB 5GVRA 1LVGA 4MR8B 1P7PA 3QSGA 2JFYA 4LZJA 4U2GA 3EXHC 4QXRA 3VR2A 2ORWA 2K6GA 4OLHA 2JCYA 3FCSB 4V3BA 3MMNA 5ILGA 4FSHA 4C43A 1U7XA 4RDLA 3MJEA 1XSEA 1NVUQ 2RHBA 4LXYA 5AJTA 4FZ5A 4CT5A 2VUIB 4FNOA 3EGDB 2ZR9A 3NEYA 2BT4A 1YIAA 4PFKA 1JDBC 4LSWA 2C5HA 4X8IA 2W0SA 3MFYA 3CESA 1DC4A 3W6UA 1SZPA 2JA1A 1Q12A 3BHJA 5HF5A 3F90A 4CEJB 4EY3A 1NE7A 2NUTA 4OMCA 1KI3A 2QL9A 2R6FA 5TJHA 5K3BA 4CIWA 2PH7A 5U9CA 4FGZA 1BWSA 1R0SA 3I56B 4R71A 1T2FA 3QW4B 3ZWQA 4DUPA 1FNNA 4ZYLA 1P1HA 2G71A 4IP0A 2OBNA 2QP4A 4JVSB 3UKOA 3A31A 4F5WA 2WE7A 2BTQA 2JFOA 4DRXB 2W43A 4ZVMA 2GA9A 2QT9A 2OMEA 4UBNA 3WQSB 1MBZA 5DBFA 1ZUIA 5A02A 3JQAB 1B3RA 5DTMA 5COQA 1S2IA 1SUIA 1IJKA 2C5GA 4GKBA 5BP7A 3T0FA 1CBUA 1S2MA 1EZ4A 2X5XA 3OO1A 1KF0A 4XOPA 3Q39A 1JSXA 2JAOA 1AZWA 1OIWA 2R62A 4NYJR 4X94A 4FSDA 1X80B 5FPTA 1T3SA 2WJIA 4NL4H 1V5WA 2FZVA 1UZMA 3ST7A 1GGJA 3UQZA 1KR2A 5EL0A 3UV3A 5CB4A 3HK2A 1O0BA 3AEKA 1H3EA 1G3IA 1LB1B 4N6OA 1N8KA 2EQBA 2IQ5A 2JCGA 3EBLA 1I2ZA 2WA1A 2ACKA 5I7FA 4B76A 1AUXA 3OD5A 2G28A 1RBQA 5AVTA 1S72B 1ODSA 2HRRA 1D4ZA 4EA6A 3CQ9A 3FYDA 5E1DA 1S8FA 4QOGA 1JR4A 4N5LA 4E7PA 2GJPA 4MWEA 4ZEMA 4WUVA 3AF5A 2AMYA 5HRAA 4X54A 4AK9A 3MLAA 3IAUA 2PYIA 1CJUC 3NHYA 3WMGA 1NUTA 1AQYA 1VYTA 1W85B 3QPUA 3ZIDA 4YCLA 1TJPB 1Z34A 4Q19A 4WFJA 1AMUA 2NP7A 1WSAA 4G7XA 3C48A 3MWEA 1ZU4A 2Q5OA 3NM6B 3LUJA 1CUGA 2GJSA 4WFKA 1YJCA 3D6NB 1P7CA 1RLJA 2VJBA 4NONA 1L7PA 2XY4A 2VH1A 5EKSA 4ZD6A 4YMHA 4DV0B 1E0KA 2DMRA 3Q88A 5E4FA 4PLFA 5FLEX 4CIVA 3OTOB 4FGLA 4LJ7A 1A4IA 3M4ZA 5EHGA 1CQIB 1RKXA 4GH5A 1AHHA 4Z7QB 4BS9A 5FPPA 2QE7D 4QODA 4AP6A 2VJDA 4TS9A 1KFCB 1NI3A 1NN1A 5LMZA 1YQWA 4CQJA 2QTFA 5ADUS 5KYWB 2G40A 4GI7A 1E79D 3LYLA 4PG5A 2XYQA 1E2DA 4DXAA 1E9DA 4N03A 1ETHA 5D5PA 5DK4A 4IFEA 3ANMA 4LHYA 4DLRA 2F1HA 1I0IA 1U8EA 1EE1A 4QG3A 5ERGB 3HXOA 4K6OA 3RH0A 4MP6A 3B1XA 1P60A 3ANLA 4DJEC 2VUSA 3AERB 2DXIA 4IUDS 1C9KA 2ORYA 3H5VA 2DBQA 2XUGA 4OUDA 2R6JA 5BMVA 3HTXA 1KHHA 5EG5A 5AW7A 1SRQA 4D9NA 4X7BA 4U7DA 3B6MA 1BE6A 2CCGA 5K6RA 4JV5B 1C3XA 1YMVA 2QRGA 3VH4A 1CYDA 4MZXA 3MTIA 4MARA 3B3QA 1NW4A 3EQ9A 3GRRA 3KEQA 4PHHA 1XRPA 1M34E 1II8A 4K9SA 4XM3A 2YASA 3ESXA 3FGPA 3BMNA 1QANA 4Z9XA 4MV4A 3AVOA 1ZL0A 1XCMA 2Q8PA 4NZYA 3A6ZA 3LY8A 5JBIA 1XZ8A 2AFHB 5JCPA 2XECA 3H5AA 3JWHA 4MI1A 3RUIA 4UU8A 2R3SA 3RFXA 4ZI2A 3W7BA 5FX2A 1XXHE 3EEQA 3GQVA 4AU1A 5JXGA 3N07A 2YJGA 1VXRA 3C5EA 1XTQA 3MC1A 5K6TA 4MA4A 2JRCA 1BS9A 1Q95A 3G8BA 3U9LA 2ICAA 2KPOA 2WJAA 3IT1A 3L7NA 2VJQA 4Z4GA 3K2IA 4RE6A 4UW9A 1DPFA 3PLRA 3PRKE 3ELDA 4MVJG 2FSUA 1F6WA 2JPDA 3TLYA 2PWAA 2ZWAA 3FDIA 1I1OA 3N9IA 2BH2A 4MHSA 1BWRA 2VXBA 4OO3A 3OLWA 3TTWA 4FBGA 3V4VB 5B2ZA 2OXTA 3TSCA 4I55B 2AHRA 5KQGA 1BA2A 4MWDA 5AFSA 1XUOA 5B6JA 1FYWA 2Z1DA 1XZKA 2PHZA 4GM4A 1LW6E 5JWHA 4JOSA 1J5XA 3LXRA 2Y9MB 2XE8A 3I2IA 4OXNA 1U2SA 4XAQA 2ZZQA 3I9NA 2PSEA 3SKYA 1UWVA 4E0BA 5FYDA 2G9QA 1V7QA 4XVUA 1A7UA 2W6OA 1CJBA 4RK5A 1U0RA 2BFCB 1H5NA 2L2QA 2GHRA 3VNBA 4MQBA 4AUMA 2ZSIA 4DBLE 4CIYA 3HWX1 4D4LA 4UOQA 4TLEA 5KSOA 2C1EA 5GOZA 3GLHB 3TXYA 3TDMA 4EA9A 1ZPDA 2BEJA 3ZYZA 4J16C 2Q46A 4J0DA 4JA2A 1T15A 1L7NA 4O4JB 3V7UA 4B9EA 4BXOB 3DD5A 1XJ5A 3BFVA 3UXEA 4F1JA 2GJKA 3H0KA 3VZBA 4BO6A 4BNVA 4M9QA 1QUFA 1SRRA 2DY0A 2GYVA 1WSVA 2FWNA 2NSJA 3O2QB 4FFOA 1L4FA 1LLQA 2AC7A 3RLFA 3TE6A 1G20A 4DCPA 4RJTA 3VYRB 3N2KA 1R8YA 1T6ZA 2HUNA 2I03A 2A9OA 2XYGA 4Z1OA 3HU2A 3O3OB 5AD1A 1E1CA 4A0SA 3CCFA 2IE0A 4EB6A 3A3KA 1ENYA 3CW2A 5C1IA 4DQDA 4F8JA 3JCZA 1W4BA 5BNWA 2BV3A 2F3PA 4YLYA 4OGKA 5HZHA 1YJNB 1SPBS 3WYNA 3FY4A 1H69A 4PAAA 3K70D 2Q6KA 2LRHA 2QVGA 5AJXA 4FS3A 1Z4LA 4MK4A 4YCBA 4Y6RA 3FUCA 3E15A 1W581 4HVLA 2ZL7A 3O3CA 3CC4B 5CEEA 4KLNA 4LI3X 4FZ3A 3UWDA 1JNXX 1JHMA 4US0R 2X40A 1KTVA 5CCDA 4U7JA 5K5EA 5DX1A 1U28C 1SBCA 3GBSA 2J0EA 4IIJF 2R4UA 3OLCX 5FI1B 3F5DA 4G1FA 3ED1A 4XSGA 4XJXA 3AWDA 3VBEA 3WGLA 4HNTA 2P9ZA 4P0PB 1FS4A 1S4QA 3H1TA 3VSAA 2GOYA 3CRQA 4DGQA 5AKHA 1BVRA 2X8WA 3QYJA 5LYJB 3OT1B 4IIGA 3ASZA 4NAHA 3U4QA 4Q21A 3TAHA 1R4NB 3BEDA 1D0IA 3K9WA 3BCSA 2X6WA 1EUQA 1HA3A 4UHDA 4A5OA 5FAXA 1M5RA 4C0JA 2ZXIA 1MPTA 1U7PA 4X90A 4FEAA 4EYSA 4KMRA 4ZHQF 1FF9A 1EI9A 2X8LA 3OZDA 4HXFB 2IY7A 2QMUA 4W7SA 1VKZA 5IF9A 2O8NA 1O6ZA 3OU7A 3GJSA 4QASA 4NS4A 1GQOA 3HKBB 1S0UA 4V0QA 2H85A 3IQWA 1HXHA 4Q4JB 3VAZA 3V8EA 1NBMA 1VQ6B 3HGQA 5AVUA 4MP3A 3IEVA 2BGLA 2CLEB 5EP2A 5GMOA 4XPIA 1Q0QA 3BJMA 2HEGA 4QUEA 1PEAA 4OI0A 2AEJA 4I4TA 1LDNA 1DWQA 3PSHA 3REOA 4RQUA 1E7MA 2WFLA 1I32A 1DBVO 5CVUA 5FBRB 4BMYA 4D2IA 4XD2A 3QPWA 4HGRA 4QXPA 1P39A 4XWTA 3BC9A 3DR3A 1RTKA 3T7JA 3G13A 1CV2A 4EJSC 1QBKC 1QO0D 1Z7EA 5AW4A 4U9IS 2VF5X 2H9IA 4L0QA 5CP8A 1O7JA 2H4XA 3W7VA 1M5TA 3JASB 1YS4A 3WZLA 1C41A 1Q15A 2Z2YA 2C2XA 2D2XA 3PC8A 3Q5EA 5JCOA 4FFVA 4DCMA 2YNMA 1BVYF 1UMBB 4U7TB 4X1KA 3NP7A 1YGPA 4HDNA 4MVJA 2BI4A 2IK8A 3CWQA 3BGDA 5FNZA 1XELA 4UTVA 4HP8A 1VIAA 1F2TB 1YIDA 3LL4A 5J2UB 2BMVA 5F64A 2JCVA 2COUA 3Q6RA 1C0LA 3QX9A 1DQNA 1RMYA 5LDGA 2BH9A 4X60A 4AF7A 3U1VA 4UOZA 3KVVA 5AM2A 1PNRA 4Q4AA 3QU4A 4P3OA 4E94A 5J47A 1EE9A 1GU7A 1TKCA 4XIGS 2D2VA 3KWLA 4MMYB 3VKVA 3N0XA 3WWOA 1SWWA 3PX3A 4R2KA 1D2HA 2R6CA 2C2KA 2XWPA 4LDNA 1KC1A 4AVZA 1DUSA 1GKLA 1HYBA 1TYDE 2X9LA 2XUQA 3CISA 3KXDA 2HHCA 4QEDA 3TFWA 3VTKA 3HCEA 2Q6LA 3ZGOA 1H2AS 5TF4A 1IPFA 4BJ3A 1IM8A 2MSLA 5ALDA 4R1MA 5IM4F 1E2UA 3E3OA 3G5TA 4HNGA 3FHTA 4QBGB 4ZVSA 2BY4A 1PFYA 5EWMB 1ZISA 3IH5A 4TWZA 2DUJA 3DVRX 4MWSA 3N5CA 3QOFA 4I14A 2CYCA 4BVKA 1F6DA 2D5IA 4BEWA 2WZDA 1ZK3A 3IR6A 1A8IA 4OPMA 3ZDDA 3GUYA 1XLTA 5KIAA 1E9AA 1R3UA 2VF8A 2BLNA 1NNLA 2XUZA 3UOAB 4PSDA 5JJCA 4UUOA 2D3LA 1ZITA 3IJ5A 3LVRE 5TC4A 2G63A 2IPXA 4OQZA 4ZI7F 5KQRA 5FA8A 2W83A 5K09A 3ER9A 1DZ3A 1LWNA 5A3VA 4B6QA 2Q1YA 1B6GA 2OO5C 4IIXA 1DSSG 3ENKA 2FN4A 2BFFB 4CNBA 3F4LA 2Z8YA 2GERA 1MIOA 3L9XA 4US1R 1Q0TA 1KOJA 4A16A 4C06A 2FPMA 2X1VA 1ZEJA 5AI0A 4A27A 1C3LA 2NUTB 2VT3A 4NHOA 2JCSA 4BATA 4E12A 1P3JA 1WB5A 2AYZA 2GBLA 2P78A 1NB0A 1WCIA 2XB9A 4KLAA 5AO9A 1PS9A 4D81A 3FPCA 4QRHA 4Y2YA 2V7VA 1CY7A 1V8ZA 5AW5A 3TBHA 4AL4A 1OLXA 3CCUB 3F5SA 1QF6A 5JAOA 4Z9YA 3W8DA 2IP1A 5L46A 1JFFA 2ZBUA 2OGWA 2O2XA 2P79A 1ZHFA 1JDPA 2BTQB 4JXKA 3W79A 3OCZA 1J8VA 3MAGA 1A4UA 5KJ1A 4DPMA 2HZ7A 4DCJA 1GYQA 3U9SA 1H2RS 2ARKA 2Q3HA 2YBEA 3NHRA 4M0MA 4TL9A 1NXTA 4J3FA 4CG1A 3QHPA 4LPKA 2BMDA 1L7MA 1QFXA 3R3UA 3WSTA 2I7XA 5CHEA 4O8CA 2O8CA 3UEOA 4OH7A 4FTWA 3SQOA 1J1ZA 1NX6A 3NVKI 4R16A 1CUEA 2QTAA 3ZE6A 2LNDA 1KRHA 2JAQA 2OLEA 4I4IA 2XAUA 4MKXA 2XXBA 1TB4A 4N54A 5CB4B 4QZVA 3AEKB 3IKTA 3MK31 4BMPB 1QIGA 1PWHA 4OLBA 2F3QA 2ABWA 1V5GA 2BKUA 1J2YA 4ZT2A 1CIJA 3C3AA 1Y3DE 2FEPA 5ECWA 1IQ0A 1QLJA 1CFJA 4ZT4A 1RYZA 2N3ZA 3OE4A 2QNIA 4U2EA 5K3AA 3VVBA 1G8FA 4OAPA 1QVGB 1F8FA 1JPNA 1HQKA 2ZRPA 3FSJX 4FGWA 4ZWNA 2HCFA 2IDZA 1R18A 1E2PA 2C88A 3SZ3A 1CRLA 4DZZA 5E3JA 5I8PA 3PNSA 5D7BA 4FHCA 3TQRA 3UT5A 3Q3AA 3BNWA 1AKMA 1U1FA 4RZHA 4R4JA 5F9HA 2WVHA 3QFRA 2J09A 4N8SA 1S5PA 3ABRB 4O2BF 4Z53A 2R25B 3IP7A 3IODA 3ZVRA 1MEJA 5JJBA 5JYEA 4UUNA 4YP0A 5EXEA 5SZJA 6GPBA 1HUQA 1MC8A 1P6XA 2IEAA 4HB4A 3LCVB 5CHYA 5DRTA 3MWEB <