5FO1A

E301a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVAQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 94
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo1A01
3HGMA 4WNYA 4MVCA 1EE1A 1VBNA 3IOCA 4JXXA 5HUHA 1M8JA 2HMAA 2YWBA 3A2KA 3L92A 3RJZA 4KR9A 5IJXA 3Q12A 5A89A 2A1UA 3ZUGA 2A4MA 4DE5A 3IOEA 3VRHA 4KPUB 2IP1A 1NYLA 3U1VA 1WXEA 1GZUA 3MMXA 3TQOA 1N07A 1R6TA 1EFVA 3F3MA 1PFYA 4BWVA 1I6KA 1R6XA 3CVXA 4JFAA 3H99A 1O95D 3HV0A 1TYBE 3SDBA 2J07A 3UMVA 4E1AA 2OQ2A 3AIIA 4ZCSA 5DASA 1IHOA 1M8GA 4ZT5A 2CYCA 1O97C 3INNA 5LM3A 1N2GA 2RE8A 3IUEA 4MW6A 3P0JA 1KH2A 4EGAA 2DLCX 4MWCA 1J20A 2OV4A 3LOQA 1JECA 3GMIA 2G36A 4MQ6A 1G8HA 4G5YA 1QRTA 1F9AA 3HZRA 1FYDA 4DLPA 3ISJA 1XNGA 4EG7A 3CLTD 1WZ2A 4MW0A 4JZYA 3TQIA 3COVA 1LW7A 4RUKA 5FO0A 3IMEA 1M83A 3PRHA 4EG8A 3HMQA 1HYBA 2VBSA 1H3NA 1KH1A 3IUBA 2YXNA 2O8VA 3CLTC 1EXDA 3ZJVA 4ZT4A 2I1LA 5J58A 4OJMX 3H9CA 3H97A 3CLSC 5HG0A 2A1UB 1M8PA 1EUQA 3IVXA 1Y42X 4QRDA 4EG1A 1UFVA 4ZCQA 3PNVA 2H2AA 4X0EA 2VTBA 1O96B 2A84A 1U3CA 4NATA 2CT8A 1EFVB 1JZSA 3P0IA 1OWLA 3CVYA 1N78A 4EG3A 3KT6A 4DNXA 3S3TA 3COZA 1M8FA 4GU5A 1EFPA 4YMIA 1PFVA 4JYZA 1G8GA 1NUQA 3IODA 5J5AA 3FNRA 1V8FA 5KCMA 1XJQA 5LLTA 5H16A 2DERA 3VU8A 3DV2A 5KWVA 1X6VA 3ZXSA 1T6YA 2QTNA 1YI8A 3NBKA 3MXTA 1VL2A 4ND7A 1GTSA 3TZLA 3SEZA 1JIIA 1P7PA 3RFFA 1QNFA 3CLRD 1KAMA 3NV7A 1QJCA 2X0KA 1OD6A 3FOCA 3DO8A 3COYA 3VGJA 4MW1A 2P3MA 1MAWA 2V0CA 1PFWA 2D54A 2J4DA 3TS1A 2A7XA 3C8ZA 3JXEA 4CT0A 1NSYA 3PXUA 4NAUA 4P2BA 1QU2A 4J75A 2HZ7A 1I6MA 5DB4A 5HUJA 3LE8A 2E18A 4DDKA 2ZUFA 1X8XA 1IRXA 1D2RA 2WB2A 1T6ZA 2VBUA 1N3LA 1TQ8A 2DUMA 3ILVA 3TNJA 1NUTA 1MJHA 4A91A 1JZQA 1O5TA 4FZJA 2E0IA 2Z09A 1TYDE 4EG5A 2EL7A 3X1KA 1N2HA 1VBMA 4EG6A 2DPLA 4QBTA 5DEOA 4I6JA 4KR6A 2WSIA 4L2IB 1H3EA 1LI5A 1WQ3A 1MOPA 2JA2A 2CV2A 1QTQA 3KT8A 2A1TS 2V0GA 3KT0A 3IMCA 2VTBB 3OP1A 1T9GR 1YUMA 3ZGZA 4XFJA 1YIAA 4HJXA 3SZGA 1N06A 3G59A 3CTAA 1VBKA 1EFPB 1WKBA 1I2DA 3OTWA 4AQ7A 3ND7A 2CFOA 4RPIA 2GM3A 3QTTA 2CYAA 1U7DA 4NDAA 1IQUA 3RBAA 3FG9A 4YP6A 2QUHA 1N2JA 1QU3A 3KT3A 1MRZA 4HPWA 4UZFA 3G6KA 4MUNA 3PNBA 1I6LA 5AHWA 2GOYA 4MW4A 3KFLA 2BTEA 1JIKA 5TEWA 1O6BA 1WOYA 2E89A 2CYBA 2BYTA 3FH0A 3ND5A 4QREA 3FY4A 4MVWA 5TGTA 2AG6A 4CDMA 1JEDA 4MWBA 1NUPA 4OUDA 4K0RA 4ZT7A 1JILA 3FIUA 5TEVA 4MWEA 4PBTA 3IDFA 2A1TR 3K9WA 4U8HA 2JANA 3RHSA 1IVSA 2PFSA 2J08A 1KP3A 4F3RA 1WJGA 2PIDA 1KQNA 1WXGA 2TS1A 2YWCA 1KKUA 2X3FA 1TEZA 3COWA 4MUFA 3DPIA 4MW5A 3A04A 1Q9SA 3X1JA 1M1ZA 3CVVA 1WXHA 4U63A 3UK2A 1NB0A 1N77A 3H9BA 2A88A 2AZXA 1N2IA 3AL0C 4EF6A 1ZJWA 3MLBA 2QTRA 2IJGX 3FI0A 3SYTA 4F4HA 4XSVA 3IMGA 2B7LA 3FETA 3BNWA 4MW2A 4CQNA 1EJ2A 3P0HA 1QRSA 3AFHA 4MUGA 2QTMA 1JMVA 1NUSA 2JAXA 3A05A 1PFUA 5A8AA 3P52A 2QUJA 3G5AA 4MLPA 1NP7A 4DDHA 1OWNA 4U7JA 1QQTA 5F23A 1K92A 1J21A 1YUNA 4R2LA 4DDMA 2QJTA 3ZXIA 1IQRA 1KAQA 2OYNA 3ZJTA 1Q77A 4PBRA 1DNPA 1JIJA 4NZPA 2WQ6A 1COZA 3AG6A 1TYCA 2NSYA 1T6XA 2DXIA 4J76A 2CSXA 1O94D 2J5BA 1F7UA 3N8HA 3BL5A 4MVXA 3IVGA 1M8KA 4PBSA 3M5WA 1IFXA 2C5SA 2PZAA 4K03A 4MUHA 1IH8A 4ARCA 1XNHA 4ZCRA 1NURA 4ZT6A 1NB9A 2J09A 1B6TA 1JGTA 5JBNA 3ZJUA 4JXZA 1G8FA 3LCJA 4ND6A 4ZT2A 1N2BA 1VLHA 1H3FA 1J1UA 1GPMA 1KH3A 1WQ4A 3N2YA 3IVCA 4MUIA 1Q15A 1J09A 1O0CA 1MB2A 3ND6A 1K4KA 1MBZA 2R5WA 2ZP1A 5A88A 1KORA 5FO1A 1T9GS 1O94C 1O97D 4S1OA 3MLAA 3IOBA 3SEQA 1Q19A 1GTRA 1K4MA 2GKSA 2CV0A 2CV1A 4WSOA 4MWDA 4MUJA 1PG2A 4Q16A 1O96A 4CDNA 1JHDA 1WXIA 1N05A 1ZH0A 1A8HA 2E21A 2EJCA 4TS1A 2VBVA 3QTBA 2HGZA 4ZT3A 4G6ZA 3E27A 4GRIA 1O0BA 3AG5A 1XNJA 2PZBA 3MUEA 2Z3VA 1MB9A 1F4LA 1N1DA 2A86A 3X1MA 3UY4A 2XRZA 4KR7A 5IHXA 3H05A 1R6UA 4H3SA 4MUKA 3GUZA 1IQ0A 3QE4A 1N08A 5K0SA 2DR2A 3Q10A 3CVWA 1H1TA 3ZIUA 3D6VA 2QJFA 2WQ7A 2X1MA 1KR2A 2QJOA 1FFYA 2Z08A 4HK4A 3DLAA 3CLUC 4MAFA 1JEEA 5EKDA 1GLNA 4L2IA 4Q93A 3PNYA 3CR8A 3A4IA 4I6GA 2YY5A 5J59A 1OBCA 3I05A 1GN8A 1OWOA 5H7XA 1N2OA 1Q11A 3RK1A 5BNZA 1K97A 1TFUA 2PG3A 5DK4A 1ILEA 4ARIA 4ZCTA 4I6EA 1N2EA 1WY5A 3AKZA 1RQGA 4XFDA 5K0TA 3ELBA 4MUEA 4NAHA 3IH5A 2RD2A 3CA8A 4EFKA 3K32A 1J70A 1YULA 2PXHA 1BS2A 2XRYA 1NUUA 4R0NA 1PG0A 1ZUNA 1U3DA 2QUIA 1YIDA 4AS1A 1MAUA 1OWPA 1U7XA 4UZEA 2O5RA 4KPUA 5KHAA 4YP7A 3HL4A 1NI5A 2X1LA 2NZ2A 4G5FA 1KQPA 3CLSD 5TS2A 1WXFA 2ZUEA 4MW7A 2VBTA 3GLVA 4EG4A 3CLRC 2IELA 4PY2A 2QUKA 1G59A 3UC5A 1J1ZA 2PZ8A 2H29A 3CVUA 1SURA 3N9IA 1KQOA 1EUYA 1O95C 1QRUA 3RK0A 4YP5A 1NZJA 1CT9A 5TRDA 2DETA 4NX2A 2CUZA 1MC1A 3D6UA 2DEUA 5LFAA 1U0BB 3SZ3A 1OBHA 1KP2A 3Q4GA 3FDXA 1GAXA 3UOWA 1F7VA 4YBRA 1S4MA 5FNZA 2VXOA 4DJAA 1TYAE 4HJRA 1LI7A 1V47A 4MW9A 3TZEA 2D13A 3HFJA 4ZCPA 1P4MA 4R2MA 3FHJA 3SP1A 3NBAA 1OWMA 1N75A 3FWKA 3N05A 4OUDB 2AKEA 2D5BA 4MVYA 4MULA 4KKVA 1ULHA 3CLUD 3L93A 1ZH6A
chains in the Genus database with same CATH superfamily
2C2YA 4Z2AA 1MJNA 3IHKA 3RUDA 2GPJA 4DQKA 1EDEA 3F5DA 3N87A 3WYDA 2EERA 5FLKA 4MRMA 2FKAA 1L7RA 4HLDA 2CLSA 5LC1A 4CU2A 4GKKB 1M8JA 3G9ZA 3ETLA 2I66A 3VJRA 3L92A 2EKLA 1S2GA 3V1KA 1LNZA 2JIPA 4L75A 3GJ0A 3TN7A 2QL7A 1NWCA 4L4UA 4MDHA 5LQJA 3ZUGA 4B2YA 1PGQA 2YWHA 3THWA 2X6QA 2ZQZA 5KOHB 4RHEA 2HLPA 1K3FA 1HLPA 3DXZA 5FYQA 5LUBA 4ARUA 2CXQA 4MJ3A 4PE5B 2PCJA 1K88A 3GCZA 3LC0A 1N07A 4Z3DA 3B70A 1E4EA 3P9NA 1KBOA 2ZVDA 3OURA 1EJ0A 2F3SA 2FVGA 3EXHC 4NABA 3AHFA 4QLOA 1G19A 5EIXA 4ZK6A 2EIHA 4Q18A 2GBIA 3M4XA 4ZCSA 5SV2A 2M6RA 3UMMA 3NC0C 1OPXA 4BLTA 3D3NA 1C4KA 1BWRA 1VSTA 3IUQA 3H3JA 4RGBA 4IILA 1G6KA 3T15A 3L1KA 2PYDA 1BW9B 2ZUTA 4DTCA 5A1JA 4C14A 1PJZA 3WADA 4MPDA 5EHXA 1P0MA 3QVXA 2DWOA 4QXOA 4RWEA 2IZ6A 3ID6C 4PIPA 2C8LA 4P35A 4XYLA 2L19A 4O2AF 5I9TA 1NW8A 3C7KA 3SBOA 4WCDA 4F2PA 3PKJA 5HHTA 3GFPA 3NATA 4IIXA 1G8HA 4C22A 3Q3AA 2VT3A 2ONZA 1DE0A 1U1IA 3FMVA 1UQTA 5FOXA 3ZUPA 2IYUA 1KU6A 5CX1B 4BQNA 2AN5A 3QVWA 2GCOB 1NU6A 1YNOA 4R05A 3W1EA 5EEGA 2BZ0A 3GQBA 1TA0A 4R2HA 3PHBE 3PTLA 3PPWA 1FYEA 2VQ6A 4EPTA 1N0VC 1RE0A 5JMTA 1R15A 1XD2B 2WP0A 5LCXA 4ARZA 3KZ1E 1Y89A 4QGGA 2CVFA 3EULA 5DHTA 2R3SA 5E6UA 1DT5A 3AVPA 4P33A 3IUBA 2R1TA 3FVTA 1EXNA 4XWYA 5C4IA 1QYCA 5K0EA 3QBJA 1JWAB 2D5AA 4KZPA 3WMRA 3BAFA 4P38A 3LQ1A 2FUG1 4KIUA 2QN9A 2UXDB 1SD1A 3F5FA 1FVXA 4HZUA 4LE0A 3VYTB 3DKPA 4F60A 4PXAA 1Y4AE 5KWIA 3WL7A 1AS3A 5I4BA 3LNTA 3CLSC 3M2PA 2C92A 3FB4A 4LXHA 4PZCA 1ZICA 4DIKA 2QG9A 1I51A 1C3XA 3JQ8A 4RCVA 3U4QA 3HP4A 2RAVA 1HFJA 4R5MA 3EWIA 3RKUA 5HW0A 5KX5B 4I8XA 4KU4A 4EPVA 3WXMA 5B36A 3MIIA 3MINA 3QPBA 5DSZA 3NPAA 4I50A 2L18A 2PSSA 1TIPA 4EG3A 1MQAA 1R5OA 4P4GA 4XSGA 1DSSG 2DHEA 2XMPA 3VO8A 1Z47A 5K99A 2ZI4A 3T5PA 1QMGA 4F9FA 1GL7A 4WFQA 5KCMA 5JDIC 4X8MA 1QH8B 1BW9A 1N3YA 1ZY2A 2O0MA 3BGOS 3CXCB 2ZZNA 3ADDA 1JXOA 2HHCA 3LZ6A 1A27A 2ZSHA 3JQ9C 1E9BA 1J2JA 3R0ZA 2CVQA 3A4NA 2IYZA 4F8YA 2VLIA 2D5LA 2LKDA 3KQYA 5EJIA 5JADA 4ZMSA 4PFSA 4RTPA 5EUMA 4B6GA 1GZ6A 1KYZA 2Q5EA 4YROA 4YLGA 1P62B 4D4HA 3VGJA 5JCJA 4LBZA 4NXNB 4Q48A 5DPMA 1PYGA 2D00A 4X20B 4M1TA 2WFAA 3OCWA 3ZZMA 2AYXA 5EJEA 3P5BA 2VJIA 3VR5A 2DFDA 2E18A 2E6UX 2OBTA 1G7SA 3EXAA 2J6CA 5KAMA 5B3JA 3KQHA 1CULC 2OAEA 3E2MA 3GXOA 2YW9A 3R9IA 4H77A 4RK6A 5FBRB 5DNYB 2XCIA 1LNSA 1AA9A 2E4AA 1U3UA 1DADA 2VYCA 3UXYA 2QRKA 4BVHA 4HVAA 2Q4OA 2CDBA 3AI1A 3EEBA 4RJIA 3GVXA 2OO7A 3L0IB 4YCAA 2QR2A 4M6WA 3JPWA 1DJQA 1X9IA 4HZUB 4Q02A 1ZISA 2VAVA 2B8NA 2QVLA 3DMRA 2A0WA 4GS5A 4I6JA 3QMPA 1WQ3A 2JA2A 2CV2A 1HOXA 1NVEA 4N01A 3QIVA 1C3VA 3O1HB 3OT1B 4HXFB 4KXVA 1GRCA 2UVPB 3BMXA 1U7PA 2SICE 4WEOA 1Q50A 1JQDA 2BFOA 2P1DA 3IMCA 3ETHA 5L53A 3HJTA 1NDQA 3HR4A 1H1DA 2ZI6A 4RKFA 4RTQA 1IJFA 2QUAA 3DMDA 1YIAA 1TEHA 4MYCA 1TVEA 4NCIA 3S44A 3ZW8A 5GIOE 1M0EA 2RARA 4XQGA 3C3EA 4ZQEA 2BH9A 3M6LA 3WS7A 3LXUX 1GSIA 4XTCS 1M2FA 3UA4A 2BONA 1GAJA 4BEWA 4ZHQF 1E63A 1UT8A 4YRNA 5AIAA 5GVRA 4S1PA 1E1YA 2CFOA 4CEJA 3QFCA 1HURA 2WSMA 1TX4B 2VZ8A 4HRVA 2XMQA 4C07A 2IDMA 3O9ZA 1G6HA 1R0WA 4YQZA 3CV3A 5AM4A 3DMYA 4GP9A 1QVWA 2ORWA 1PJ2A 5EJ2A 4WBNA 4UHDA 2GUGA 1YBVA 2G40A 4HOYA 2R25B 3CISA 2P1RA 2YTZA 2E89A 2UV8A 4L6CA 5FDFA 4ER6A 1GSOA 2ZATA 3AP1A 4OIMA 1IM5A 3RS0A 2HYDA 4KMMA 3DBIA 3IKTA 2DFVA 3JAWA 5FTLA 4JK3A 5U4XA 3UJNA 2QORA 4DSAA 4FLEA 3CR3C 2F67A 3A28A 3KQQA 5HIMA 1HETA 2JPDA 3HDYA 2C4VA 4IIFA 4NYMQ 1EAYA 5TEVA 2DQ4A 1T0UA 2YIDA 5AW8A 1LTHR 3LW7A 4R1LA 2CN1A 4V0QA 3E9YA 3EY4A 3FRJA 2VUTA 1FZQA 3GAZA 2P90A 5A5VA 2GYWA 1V7PC 4MMYB 2Y05A 4KKSA 3CD6B 5B1IA 4CR6A 3LQEA 2GN6A 2LGJA 1PS9A 1H0SA 1R6AA 2PFSA 1X1AA 1IBKB 3U3RA 1OFIA 3F6RA 3S40A 4F3RA 4PHFA 1RI5A 3BG5A 3Q3JB 1T1SA 3C5CA 3FLBA 1CYEA 4TWRA 5I7WA 1LDMA 2BFCB 2YCLA 1EBBA 1QYDA 1LB1B 2FQYA 1NE2A 2I76A 4E5NA 4HNAB 2QL6A 3UJAA 2JHAA 3RU2A 4HPXB 1VSBA 2PX0A 4MKRA 4ALJA 2GILA 3A04A 4UUNA 1B8VA 2CBXA 2VF8A 4GUAA 4QBGB 1TKRA 1EQ2A 3FPSA 3JRNA 1XD9A 3UT5A 1N2IA 1WUJS 1ZJ5A 4UUPA 3ECCA 3OC6A 4V3CA 4BQFA 1HE3A 2JGNA 1SBTA 3F4LA 2YY7A 2IJGX 3BIFA 2RGWA 4JBNA 4PSCA 4UDXX 3HU2A 3BICA 4YJ2A 1D4AA 1V1RB 3MMPA 2R7KA 1WUIS 1L6IA 1Q74A 2QTBA 3TOXA 3NBQA 4EMTA 4ID9A 4HDOB 5DOVA 2XCOA 3UCFA 1MPTA 1T91A 2BGRA 2W2QA 5AJUA 3ZHOA 1X92A 5L4LA 5F1PA 4IHKA 3TD2A 5T8KA 3URMA 4Z9FA 1XMSA 3OOEA 3QOWA 1KARA 1TA9A 3EVTA 1S1MA 3VC2A 2QT1A 2D2XA 2C9CA 3DHWC 4JR1A 4OYRA 4R7TA 4EGSA 2PMFA 3ZDFA 5BR8B 1L7OA 1P0FA 4GSYA 4XYMA 2Q6KA 1SXIA 2JD1A 5B37A 3U4IA 4LZPA 2X58A 5TMBA 5B5SA 2Q3HA 1KK2A 4WXMA 2IS2A 1KAHA 2IH2A 1Y5LA 2Y6UA 2AD1A 3JARA 1OYOA 4Y2VA 1PJ5A 1Y5MA 3LJKA 1IY9A 1CNMA 4WK0B 4MDFA 5CW2A 4NBWA 1KJZA 1GFZA 1WABA 3HA3A 1JEQB 5JANA 3LD9A 3G9QA 3JR7A 1W0JD 1XYYA 1PJ3A 3I53A 1YS2X 2C07A 1UWLA 1WW8A 2QMHA 3OZAA 2Q27A 4HDMA 2G9ZA 4XPZA 2AGVA 2WQ6A 2FMTA 3I3SR 3QLEA 3AFNA 3OTQA 1WNFA 1L1EA 4TS9A 3DDZX 5EP2A 2BFEA 1UC5B 3LHFA 3WB2A 4PG6A 1GV1A 5D3MA 5KHOC 2YVUA 3R7AA 1W5SA 2YRXA 3PLNA 1J99A 4RA6A 2A0UA 4A6DA 4GM1A 4EPWA 1H8ED 2FXIA 4BUCA 3TQFA 5HEKA 4C0AC 4D8UA 3LTEA 2HYIC 4HZIA 1U28C 3IP5A 4NYJR 3TSAA 3UG7A 4KRYA 5KSPA 5L4NA 3CCUB 2PS0A 2ZAOA 1B6TA 4Y2GA 1GIAA 2BHTA 1NN5A 3K0FB 3FDFA 1VYVA 2AFHE 3QLUC 2H4XA 2X53S 3SCZA 1ZZEA 5BMVA 1SHUX 1DTWB 3QUQA 4HAVA 7GPBA 5TGZA 4G07A 3RAPR 3L7DA 4B33A 3ANYB 1BNCA 1T4CB 1WWKA 1KO5A 1UMBA 4QDKA 4MI1A 3PK0A 1EP9A 4EYSA 1O0CA 3G7SA 4YREA 1RYYA 1G1MA 3AJRA 3PFWO 2BFNA 4JBWA 2P4HX 5EZ6B 2AD5A 4J1NA 1KORA 2HSEA 2RG7A 2PVPA 1CUSA 2GBGA 4FYPA 3DKVA 5CT8A 3VR3D 2GR9A 1RI3A 2HIGA 5LXTA 1F8FA 3FF4A 1G7RA 3WGYA 4BVGA 4R8KA 5DYTA 4EYKA 2CNBA 3QOFA 4DRXB 1EUZA 1CZOA 5GJWC 3HKEA 4OHYA 4IP0A 4ZC1A 2C54A 3TEFA 1GVHA 3ET5A 3C16C 3TD9A 3B3FA 1CUIA 5IDVA 4DRZA 1HUQA 4HAYA 3C8DA 4DN6A 4B3HA 4L95C 1PJ4A 4CDNA 5IG2A 4AP5A 5C53B 2VK1A 1BZYA 3W3ZB 5A3RA 1OLXA 4MTLA 1RQXA 3PPVA 2JHCA 4L9RA 5AHKA 2P8SA 2Y1WA 4H2DA 4TV8F 2EJWA 1JSCA 2V4UA 3M1YA 3NTUA 4IDBA 4KDCA 4G9GA 1U7ZA 2G7MC 2V7WA 2GZHA 2H7XA 4B82A 1CVLA 3UA3A 1VMIA 1TKBA 5HF9A 2HRBA 3H05A 4JJ6A 2ACVA 4MMZB 2P0EA 3U3ZA 5GAJA 3WGTA 4CG2A 1RBYA 5FTMA 1TRKA 1KSHA 1XL0A 2GRUA 4KZKA 3PLAE 2DFPA 4QUHA 2EKBA 1QKIA 4KKXB 1NLUA 1N9ZA 2NO6A 3A2MA 3RVLA 2IYWA 2WUEA 3D6VA 4DCUA 2Q5IA 4R1PA 1EGAA 2RGAA 1G21E 1YJ8A 3QVLA 1OPRA 5HE8A 4BMVA 4X6YA 2V1UA 1VQ6B 1YSCA 3EDRA 5DGHA 1HNWB 1P1CA 3HKDA 2FPWA 5EXEA 2OBMA 3BJMA 4YCJA 2XTJA 3OIYA 2E6KA 2IXEA 2BE7A 1DBVO 1KKLA 3ONFA 2OZKA 4PIVA 3HRHA 5KDLA 2QM8A 4BMDA 1GN8A 1XZEA 3V4PB 4AFNA 4A5SA 5EP1A 3PNQA 1IY0A 4Q4HA 4B9AA 5AH0A 2J9XB 2WOJA 5JDCC 3U3OA 2Y0EA 3ZGYA 2JVIA 4EB3A 5HIAA 3K6KA 1RWVA 3TUJC 3GLFA 5H83A 1PCXA 3RRXA 3QKTA 1N2EA 1PR9A 1SJ9A 2ZBFA 4MIOA 3DFFA 4CLOB 4CM6A 2O8EA 3TQQA 4M0FA 2YC2C 2YFQA 3K32A 4D2IA 4CTMA 2JKYA 3HCDA 1LBHA 3SXUB 3A2NA 1JAZA 3DDSA 4MGHA 4M8NE 3RNLA 2CEKA 3DCNA 5FTKA 4PZZA 3FJ1A 3H0CA 1I7SB 1ECPA 1WXQA 4XM3A 3WJAA 2X9QA 2L2QA 5CVTA 3DBVO 3TPCA 4YWJA 1AKQA 3ENVA 3LI2A 4HCJA 3EVNA 4EMUA 3G2IA 1JIUA 2IHKA 8ADHA 1CEEA 1XLTC 3W5HA 1KO1A 3LRPA 1MFPA 5DM70 4I66A 1Z62A 3ILSA 5A9SA 3IQIX 1LFDB 4Q6BA 4DLZA 4MW7A 2H59A 3I62A 1MD9A 3W6UA 1VJ0A 1ZMTA 1LVGA 2O57A 3FCEA 3HCOA 4QUZA 1F5NA 3EIHA 3L6UA 1LSJA 2HUPA 2WWWA 5K4GA 5KWJA 3TIIA 1DKOA 3QBDA 4OGFA 4NBVA 4XKWA 4YLEA 1XU9A 1G5RA 3BXGA 1U8FO 16PKA 1GPJA 1O95C 2PJUA 3LU1A 4X44A 5LA6B 2DECA 2D4HA 2Q3CA 3K70B 5IU6A 5JFOA 1MC1A 1FDWA 3DFZA 3FNFA 1MG5A 3IAHA 2RCNA 4UATA 3SKVA 5G53C 1SG0A 2FWPA 4GPTA 3ZWPA 2P69A 2TMDA 3D8HA 4ODIA 1G291 2Q1TA 2H1FA 1NW3A 5K3SA 1GAXA 2C1XA 3IBFA 5IVDA 3FPGA 2VF7A 3FNQA 1QFJA 4LJ8A 4FPXA 4BKOA 5AK3A 1YQWA 3W06A 4DR6B 2FZ5A 3BGVA 3CUYA 4MW9A 1SQFA 4YUAA 4XJSA 2F1OA 4YEJA 2B7BA 1SO8A 3KYCB 1K5DA 3QX7A 4PQRA 1KGSA 4QZVA 5JASA 3F2VA 2AK3A 4PTYA 2D5BA 3EH2A 2R85A 3D7SA 5I3ZA 3K7EA 2Y2VA 2J45A 2R1VB 3JTEA 3DE0X 2A8YA 1RWPA 4IXTA 5EZYF 3TKLA 2ZVQX 3UMGA 1NE7A 3JQAA 4WNYA 3RVBA 3ZWBA 5FOWA 4B3DA 2FN3A 4B09A 4DV4B 3RVRA 3N7TA 3OP4A 1EE1A 5J1TB 2XZOA 2P6OA 1KIFA 1HZZA 2YJZA 5FI0B 3QVKA 1FVFA 3BA6A 5AJWA 1EHCA 3WYAA 1UXGA 5FKJA 4A2WA 4P8RA 4W8GA 3HUUA 3MBIA 1XMVA 2HEGA 4J4HA 1X7DA 1QZTA 3AM3A 5A89A 2BFCA 3OO1A 1ADCA 1JIQA 2HSDA 4ZPJA 5E9WA 3C3YA 3N6XA 4EENA 4HDRB 1LRKA 3UXEA 1HGXA 1UBMS 2ODEA 2VHVA 1E3ZA 3VRHA 1MX9A 3ORRA 4KPUB 2H18A 4F96A 1UD2A 3IURA 3SBXA 4DW8A 4O2BB 2B8TA 4XQEA 1EFVA 2QTLA 4HHEA 5U1PA 1E3JA 2PL9A 1S8AA 3CVOA 5ECDA 2G4LA 4QOFA 1V9LA 1ISMA 1NXPA 4KYUA 2E4YA 4DTIA 1TYBE 4EHFA 6CHYA 3BXPA 1K86A 1OV4A 2NO1A 5KVSA 1ZIYA 4M0PA 3WQZA 1P2SA 2ZT6A 4TT8A 4UFPA 5K0BA 3BD7A 1M8GA 3C1TA 2P9BA 4G0ZA 4KRXA 2JAOA 1RWOA 4JLDA 3BORA 1VPLA 2UVQA 5C1BA 5JWOA 2V9ZA 2RE8A 2OOKA 1AXRA 2C5GA 3MTGA 1KMCA 4HLQB 2ASVA 2DHDA 1Q57A 2XSZD 4WZBA 4YRLA 3BUSA 3I42A 3AY6A 5FUXA 5K3FB 1CDZA 1P7ZA 2QGZA 3FI9A 3NBFA 2WD7B 2XQJA 2WJVA 3EZFA 4Q4AA 4RY2A 5ALYA 5REQB 5KUTA 3I37X 2C2XA 1M66A 2J30A 3Q41A 1G8JA 1DCMA 2HO5A 3H75A 2O05A 1KZHA 1OX4B 3HZRA 1XCOA 4I8IA 1SOUA 1VKJA 4W5JA 1FX1A 2IKSA 2XA2A 2PEZA 4DMHA 2VZLA 1VQKB 4QL3A 4C0JA 3MK31 2II6A 3CN7A 4MS3A 4MW0A 4FFSA 1XQ6A 2XTNA 3BFPA 3I73A 4KMRA 1LDBA 1RYNA 1JDSA 5DMXA 1NXXA 4RUKA 2ZRKA 4EG8A 3LWDA 5CVCA 2J4CA 3WIVA 5G0TA 1DT3A 1QVVA 1GGEA 1W5TA 3GRCA 2O2HA 1DBPA 2CK3D 5J5CA 3S2EA 2FW0A 3ZQKA 3CLTC 3H2YA 3L9WA 2BVNA 1WCWA 4MRMB 4Q03A 3RS7A 5KYWA 3U17A 1TUBA 1EGQA 1THGA 5F3DA 4BZQA 4ZT4A 5F51A 2ZTSA 2RK6A 5F9FA 2QB5A 2NMVA 5TARA 5SZIA 3G4SB 4D6PA 2CD7A 4QFMA 2ES4A 4D0RA 3VFDA 3ZI0A 1YDHA 3W5UA 4R1QA 3EPLA 1U90A 3RYIA 2PKCA 2Z0MA 4Q7KA 5DBIA 1ODTC 4ACAA 4NL4H 3ZLTA 4YMGA 1IXKA 1FDRA 4OP7A 3DBHB 4PW0A 4G23A 4TWBA 2PZKA 3CTPA 4NATA 1H5QA 2G83A 3U3MA 3W6PA 1JZSA 1E4EB 4LJKA 2RHCA 3E1KA 4RENA 5ALEA 1SHZA 4PYQA 1N78A 2FSVA 1PFQA 2IOHA 4AG3A 3T6KA 1PFGA 2ADFA 2DULA 4LJLA 1GA1A 2ZU6A 3HWSA 3L9XA 4RULA 1PFVA 3CMMA 2W83A 3FOZA 3ZV5A 4JYZA 3AYXB 5DM4A 1FJ2A 1BRTA 4J3FA 4BU1A 1UMDB 5BV0A 5FEMA 5H16A 1HRKA 1W0KA 1GGNA 1N9GB 1U0SY 3FM9A 4NU6A 3SC3A 1XEFA 1VMEA 3P94A 2IBMA 1A5AB 4QLAA 1YZFA 4UUMA 4E7OA 4GZ3A 3CX8A 4LDRA 1NI3A 1RDFA 3AH8A 3BFXA 4U2DA 5K3FA 3ZU3A 1YRBA 2QX9A 4FN4A 1P2TA 3R9XB 2F3UA 3TZLA 4CV2A 1XDGA 4KDEA 3E84A 3IULA 4IDEA 3QVJA 4J2HA 2UXBB 3DMPA 3KTAB 3AY0A 3QPAA 1MHPA 2Q8PA 1WXDA 4QDJA 6LDHA 3CINA 3B3QA 2Y1DA 3SXJA 5BWNA 1XTPA 1JPJA 3EXIB 1QSGA 1EFDN 2VEDA 3L40A 3MPOA 3O8NA 4NAUA 2UUAB 4O4LF 3VOAA 2ZJAA 4RH1A 3T12A 2OR3A 5BW5A 1NV9A 5CFRA 3AUYA 4IJWA 3JZIA 5CDHA 4KXWA 2IH5A 4FK8A 2RCYA 3NGMA 2PWBA 1SCIA 3I55B 2Q4EA 4QU0A 1A9YA 2ECPA 2GQ0A 4UAGA 4QODA 2EZ8A 1B0AA 2B2NA 2QYHA 3PDUA 5ESDA 5IYZA 3OLCX 3TG8A 3SE0A 4AY3A 2WZDA 4JHLA 5JC1A 1MJHA 3R3SA 3DDNA 4B7AA 1T9BA 1FSGA 2D4AA 2OP0A 3A6EA 2PD4A 3EA5A 5AOBA 3WDLA 4GWGA 4A26A 1QYRA 4GVPA 3PA1A 4E30A 4UKDA 1IG3A 2P2GA 3OLQA 2YY6A 4Q12A 4TWZA 3ROTA 4YGYA 1FFSA 1KZYC 3DHVA 1MIOB 2QMUA 3QXHA 2IYSA 3JQ8B 3U4QB 1OR8A 4M7WA 3AHCA 4DSUA 3SHVA 1L5ZA 1IOLA 4RIHA 1ECGA 2OBLA 5BNIA 5C7OO 5JSQA 3T3DA 3THXA 3ZE9A 4X7PA 3STVA 3L7KA 2WU4A 2FG6C 4IQ4A 3SZGA 1I30A 2IZOA 5D1NA 3QPVA 5T3YA 1QJ4A 4RPKA 3A3KA 5JYCA 3SC6A 3HYRA 4AQDA 3GIDA 5CLGA 5L3QB 10MHA 5I7HA 4F3NA 4UPVA 4D3SA 2NN3C 4GVXA 4RPIA 4I2NA 3SHQA 5CITA 3QTTA 4XA8A 3ZHUA 2Z30A 4H0CA 1KMHB 1LU9A 2XXAB 3V8QA 3HCBA 2G0AA 2OXRA 4IR7A 3AEZA 3KTDA 3EVAA 3PHJA 3EQ6A 4M9UA 2Q6VA 5TEWA 5K03A 1QGOA 2P9CA 1ZG3A 2MSCB 5KOJB 2V7GA 3GCXA 2ZBQA 1NVTA 2VCEA 1TJPB 4LHSA 4V3BA 3G0DA 3FH0A 3KPVA 4NS1A 2X6YA 4RS4A 4ZOCA 1IULA 3JU3A 4ZTBA 1WBDA 1ZJ4A 1QS0A 3AR5A 5BV2P 3TGLA 5CYPA 4MQFB 1K6JA 4WNCA 3FN4A 3EYWA 3GGPA 3NM5A 4RVGA 4UXIA 4BQEA 1PIWA 2HV8A 2LD4A 4YT4A 1C7FA 1W44A 3KLBA 1JILA 4XGKA 1X3LA 3VSDA 1SVSA 3CRMA 4MV1A 4BLRA 4C4TA 4CQMA 5JXIA 4JA2A 1RRVA 4C0XA 1MEOA 1XX6A 3CO0S 4U02A 2XA1A 4WVFA 1ULTA 2NTEA 3R3VA 3L1JA 3GB9A 1VG0B 3WRXC 1H5NA 1QOPB 1Q1AA 2Q3EA 3BD6A 3RH0A 1VCHA 2ZIVB 1TYEB 1TCBA 3INRA 3F7NA 1Z6AA 3LUHA 1X86B 2Y4NA 2FW6A 3AVYA 4DV5B 1NX9A 1U7OA 2J3DA 1OFUX 5TVGA 1NFRA 1XEWY 2VRCA 2RK3A 4LCJA 4JVMA 4OFZA 3CVVA 1WXHA 4OXNA 4NCNA 2IPNA 1ODIA 4GQBA 1SHJA 1AMNA 2NUTB 3H65A 1SXJE 4I99A 4MO2A 5CA0B 5LOVF 1XVLA 5I45A 1LGYA 3MWLA 3SYTA 4GR5A 3ZHTA 4ZD6A 1UJ6A 5TT1A 1NOJA 4NJEB 5IAKA 2P5UA 2XBMA 4KAXA 4OA8A 4J1TC 1EJ2A 1EUDA 2ZXEA 3HN6A 2JIZA 2VNKA 1KIAA 1VL1A 2FZKA 2VJCA 3ZZ0A 3B9QA 2OHJA 3PFIA 2XUJA 1HEIA 2POCA 2Z95A 1TAQA 2HI0A 1KMHA 3GL9A 5DE3A 4QTYA 2CLLB 4HDRA 5FOQA 3QVUA 3CEHA 5LKRA 5KC8A 4CN9A 1UPUA 2VHZA 5AM3A 3SNKA 3HUEA 3JZMA 2JLWA 4HLCA 2XX3A 2O2CA 3EQZA 2B7CA 1ZFNA 3AEUA 1UZUA 3MJDA 2HBZA 3Q2IA 5KREA 5DW3A 2J0SA 3EASA 2RB5A 4D99A 4MUYA 3K35A 4PBRA 1RLIA 5GV7A 1QV6A 3U2QA 1WA5A 1XKXA 2W6PA 3D8TA 4S0XA 4D9HA 4YV7A 2R97A 3O38A 3VDXA 2BFFA 2A4KA 2BSQA 2EYUA 2WUVA 2ZBUA 1O94D 4I4NA 2VDNB 3ZTYA 4UNSA 2V59A 1SCQA 1ORIA 4OHPA 5LSAA 1FDOA 3GLSA 1L7VC 1E3WB 4JIMA 2MSDB 5CDYA 2PZAA 2J9RA 1DOHA 2WUDA 1B8UA 3JQCA 3L6DA 4CFSA 3GD7A 1VI5A 3HXKA 1DRVA 4IJUA 1BH2A 2Q28A 2RONA 3LLVA 3NBUA 1T2UA 3L8YA 3RADC 1LTQA 1JKIA 3H9QA 3J7AC 1UDRA 1CRQA 3OFVA 2YWRA 4CM3A 4PN3A 1Z5VA 4EITA 1Q7BA 2PXAA 2L0XA 4YBZA 3V00A 1K27A 3FPKA 1DQSA 2GB4A 2WUWE 3ZY5A 1I01A 3KWFA 3UT5B 3PPXA 5CIYA 1OZHA 1Z4MA 3HKBB 3OSZA 3JSXA 3RY8A 4NF2A 1EM8B 4U6SA 7ABPA 2HSWA 3DCIA 5FULA 5BQOA 3LKZA 5H3CA 2J3JA 3LHIA 4EA8A 1HM5A 3TLYA 3ZPXA 1T5IA 3FSEA 4MVJH 1UDXA 2ID4A 3FRIA 4PFJA 1KE2A 3NG1A 3STTA 4DNQA 1PR0A 3V76A 2GF0A 4QPNA 2I1QA 5FO1A 4N0DA 2E1RA 4C78A 4F2GA 5ADUS 3L8MA 4RPBA 4ICIA 1L4EA 3MLAA 4HWGA 1N0UA 2BEJA 5K3OA 2R7NA 2LZJA 4ZCIA 5B64A 3HXPA 2BGKA 4KLZA 5DNWA 5K8TA 3MW8A 2XMDA 2ORED 3M70A 3KKLA 4P7KA 5IN5A 3NOQA 3HUTA 5I4CA 4KQ9A 2WFMA 1KDPA 4R84A 2IGBA 2V7EA 3DBHA 4Y1EA 2OUIA 2WE7A 3OPYI 3V4RA 3IAAA 1BVHA 3ZVLA 1KQFA 2IDKA 1BYUA 4GNKA 4O4IF 3VVBA 5CFLA 1KOLA 2ARKA 3ZYZA 1AGYA 5JC8A 1HI9A 1Y5RA 1T5EA 5BVGB 4KN5A 3FFXA 4WASA 4MI6A 4YUXA 1M2OB 3UMRA 1SUFA 4RTRA 2J0QA 3LMKA 4LC9A 2ZVJA 5IHXA 1NI4B 5B1EA 4ZV9A 1SVLA 1SHKA 4GLLA 4IUBS 1KDTA 3C74A 3VVCA 3KSMA 3W2IA 1B2LA 3D7NA 1E92A 1WD5A 4JB0A 4CIDA 1XTRA 3W2GA 1OXSC 3R9XA 4J3NA 1CJMA 3FTPA 1F6WA 1EK6A 1NXWA 5DYIA 4C06A 4DMKA 4EA6A 1EUCB 1FYWA 2GLUA 3SC4A 4NBSA 1BQ3A 2B5OA 4Q93A 1JB9A 4F1WA 2DQYA 4G85A 2PANA 5LVAA 2WBLC 2ZYWX 3R7WB 3E05A 3QE2A 5CNMA 4KXQA 3ICQB 3ZCTA 3VR0A 5AKXA 4EECA 1YMVA 1X74A 1SY7A 1RT9A 2XCRB 1UBEA 2RGNA 1GQQA 1V9CA 4KGXA 2Z04A 4E88A 1EM8A 1WY5A 2HN9A 1UMBB 4ZQBA 2IHYA 3TOVA 2YWDA 2X3YA 2R65A 1T9DA 1DIHA 4Q1BA 3COSA 4EGCB 5KMGA 4B4UA 1RQLA 3EHDA 3N0WA 3PD0A 4YASA 4B9EA 4M8KA 4PXYA 1V35A 5JE8A 1AGXA 2JAPA 3W3AA 4PSVA 4DL9A 3FZYA 5JG7A 1E7RA 1MT0A 3A6KA 1DC5A 3FWZA 3WAGA 1M5TA 3CNEA 4A82A 1U7XA 4LPSA 3DMFA 5IULC 3FAKA 1BDMA 5C34B 1EXVA 1XVIA 2RGGA 3GEDA 4YP7A 3HPQA 1GG5A 1MIOA 3VKUA 1NI5A 4EY4A 3NFRA 4EVRA 4H7PA 1KQPA 4YV2A 1WXFA 4MVJP 3TI7A 3NRCA 4CN8A 2VDKB 2WE8A 5CRIA 1SOVA 1G55A 5HK9A 4QTTB 1FTSA 1OLUA 2GN8A 3FVVA 3RVDA 3AR6A 4ZRNA 3G8BA 5IJ9B 4OMUA 3KV1A 1D2EA 4DNTB 1MG0A 3RUEA 3LQQA 1TMGE 2AN3A 1P19A 2EZUA 3D4BA 4RSRA 4X95A 1J1ZA 4YJDA 2PZ8A 3MCZA 1SUDA 3HA2A 1FQJA 3FSGD 1EUYA 1P29A 3DR3A 2EVWX 3RVJA 2ZW9A 5C51B 2QN6A 2DTXA 1IY1A 3N86A 3AWIA 1Y6FA 4DC1A 5EHZA 4RK0A 1NI4A 3FOAA 2MTBA 4K9QA 1TMKA 1YAHA 3SZ3A 4D46A 3T1HB 3Q4GA 5BUSA 4YJ2F 5FT9A 1GUBA 3OEYA 2RB4A 4MHSA 4YP0A 1MQ8B 1YVDA 3B8HA 2SCUA 3BRWD 4BBPA 4ZICA 2HXYA 3LNCA 4FE7A 3KYBA 2QXTA 2CJWA 3VNAA 4J7UA 4O4LA 5BR7A 1XQBA 3FHJA 4LSWA 2CVZA 4GPIB 2HDNB 4REQA 5JECA 4Q9LA 4HVLA 3HM2A 2N46A 3S28A 4M22A 1ISFA 1RXYA 3D81A 4RO0A 5KVQA 4ZI5A 4EJMA 1K7SN 2HCBA 5CXSA 4ZMBA 2Q7XA 2R48A 1M73E 4NE7A 2Z1NA 3UGTA 4UTPA 2OZEA 1F2TB 3I2HA 1H23A 4A8JC 1JG7A 1XFDA 4WERA 3L02A 5CLHA 2PEYA 1Z34A 3I64A 1M2VB 4P1VA 1RJWA 2IYOA 3G89A 5CX4A 3OZCA 1FJGB 1W49A 2C0QA 3QE0A 5AJYA 4JWKA 1VOTA 2CCGA 3K70C 2C7VA 3K09C 3QXSA 2HJVA 1Y3DE 2YHSA 5IFLA 1GNPA 2GYUA 4HY3A 2W8BB 1Z83A 4EUEA 3SXUA 1NF2A 3K5WA 4R8LA 2JDIA 1RYMA 1DL5A 1GHTA 2AV6A 2LCFA 3FLMA 3JD2A 3QK7A 4G5XA 4Y18A 2F1LA 4A9AA 2I2AA 4D26A 4ZDWA 1XLWA 4DARA 1H4SA 1D2GA 4LXQA 1WSBA 3K94A 3MD0A 4NENA 4MI3A 5EY5B 1UBGA 5GM1A 3WGOA 3DJFA 5IAOA 4RTMA 1FRNA 3FX2A 3LQ6A 3TQOA 1S96A 1U2ZA 1AU9A 1CS0B 1VL6A 3DAPA 1NBMA 3JZAA 3CEAA 3NHPA 1OROA 4FXPA 1U0NA 1BSVA 3EAQA 5J63A 1DV2A 3GH1A 1X2BA 4AJOA 1KK0A 5DTMA 4BN4A 1FLVA 2J07A 4INJA 4OGKA 2JCXA 4BKMA 2VF4X 1XDDA 1IZ0A 1T8UA 1M34E 1V4BA 1B0PA 2EFDB 2JATA 2R66A 3D1JA 1W2BB 3O8OB 5BV7A 1J8MF 1XL1A 4QRIA 3WLLA 1OB0A 3IEXA 3JQFA 4LYDA 3INNA 4GG1A 2QQ5A 4R1SA 3WZLA 5JAUA 2PKRA 3IXQA 3OQIB 1EVEA 5EVJA 3OBBA 3ASRA 2HMUA 3E58A 4II7A 4JNCA 1TI7A 4AUNA 5J3JA 4Z4YA 3LO5A 1E66A 1Z8DA 4L0CA 4B3TB 1P5JA 3QJGA 4DR1B 4E2XA 2PPLA 2QPLA 4L5CA 4M1KA 1RTKA 2Z2XA 4ZJZA 2ZQ5A 3MQ4A 3DDYA 4FXOA 1C5KA 2IU4A 4UARA 3BCFA 1UJBA 2FFRA 5JS7A 3SYRA 3SHFA 5IM4F 4FU0A 5JS6A 6ADHA 1QRTA 1EWRA 1YTUA 2DFLA 1V7QA 1YL7A 5F5LA 4YALA 4YAKA 4W5RA 3IDZA 1QVZA 1BMTA 3KYCA 1YB4A 2BMFA 3C7CB 3LGSA 5I7AA 1FTWA 1BAPA 1RS0A 3ZLUA 4JZYA 4W7IA 2F6RA 3KO8A 3R7SA 3A6PC 1T1IA 4JP5A 5AW0A 3C1OA 3DLBA 2B1RA 1HYBA 1TVKB 2QD3A 1XAIA 3C45A 1GQYA 4QDOA 2H3HA 5KYUA 1DJOA 1EB9A 2ODTX 4KPYA 3KBBA 2IBTA 1NMZA 2Z2KA 1SUAA 4W5OA 2QT0A 5E1BA 3WKEA 3VZQA 4C4ZA 2PBRA 3I9V6 4EYGA 5KNBH 1N34B 1GSHA 4KH1A 3VMMA 3WLMA 5J35A 5LNK1 3DAGA 4IDPA 1A7JA 2F1IA 6REQB 4BY9E 5HG0A 3RU9A 3OPOA 2I87A 4FW8A 3QVTA 4XLFA 1EDOA 4YRJA 4DSNA 2NLOA 3QWBA 1EWTA 2DQKA 3ONNA 2IYPA 1QFYA 2XGJA 3DLPX 1LRLA 3B36A 3LQYA 4N0QA 1EFVB 3V4FA 4JJKA 4BXOB 2BN4A 2VA9A 4MLDA 1U02A 3D0QA 3HKBA 3T9AA 1M0TA 2FW1A 1NVWQ 1EAMA 3E23A 4YHHB 1YOBA 1UPFA 4XORA 1AO3A 3HBLA 1MMFB 1J6UA 1FFXB 1T36B 3ECSA 2V98A 4GXQA 5CLIA 3PC6A 5ESXA 5H70A 3FSRA 5JPIA 5GTDA 4L9AA 1XJQA 2JLSA 1T15A 2PRYA 1E3SA 4NNPA 4S1WA 4CVNA 4RETA 4X9XA 4B6JA 3G0CA 2JCSA 3QX9A 3PUHA 1SC9A 1DCKA 1FW8A 1GZDA 4O1HA 1H6CA 3RVQA 3CZRA 2QTNA 4J3JA 3NBKA 4OAQA 5CXXA 3T3NA 4PZAA 3RIMA 4C0BA 4M49A 1MVLA 1LZLA 1XJCA 2B20A 3KHSA 2QP4A 3SR4A 3CLRD 1KAMA 3PUIA 2IHVA 1R4NA 1CQZA 3PUWA 4AYTA 5KSYA 1GNQA 4YB8A 1Y48E 1YTLA 4JI0B 3KEWA 1YR9A 4WKBA 2VHXA 4NC9A 1E96A 4UVIA 5E2IA 3KQNA 1FP4A 5F2NA 3COYA 2R6DA 3EXHA 1H2HA 3T06B 2XUQA 2WZPP 4CT0A 1AQUA 3TS1A 2QRLA 5BSVA 3CZQA 2BGTA 5H3LA 5TE9A 1GPH1 1J42A 4OMFG 1U80A 3FHLA 4UU8A 5HUJA 7REQA 1B3BA 2WT4A 1ML3A 3DE7X 1IPHA 2FR1A 1PDOA 2A3RA 3DB2A 3K2EA 1TVKA 3MEQA 3PR1A 5ALUA 5A3JA 5HS6A 1D2RA 4P3NA 3RC3A 4J2OA 3E8SA 3AJAA 3H16A 1RRGA 3PZRA 2OG1A 5I9IA 3V7UA 3WNZA 5E1OA 2QN8A 1N6HA 4RLZA 1GTZA 2H1IA 1T3TA 4HBGA 1W4BA 3QTLA 2NVUB 4BVBA 5E4TA 2BFMA 1VBMA 4EG6A 4DABA 1ZSNA 4KWIA 5K05A 4U39A 3ED5A 1BTOA 4OU5A 2JLQA 3A4VA 3F0TA 5CFMA 5AW2A 3VNRA 1J0CA 3CSUA 1JQ3A 1VHQA 4KE6A 4TKMA 5HF6A 1I8TA 4C7MA 4EG0A 1LX6A 3AXSA 1I36A 3CEJA 1B7GO 3OW7A 2HQOA 4LF9B 3OU2A 2BF4A 4GC5A 4URZR 4H1UA 2ERYA 5DCYA 4K6OA 1G38A 4KFCA 4H6WA 3ZHCA 1OI4A 2FFJA 2DFKB 4BAGA 1U65A 1WX1A 4IW3B 4J0HA 4WZKA 5HM8A 1N9GA 2FPKA 2PNFA 4LBWA 3DF9A 4NNOA 2P78A 4J90A 4JU8A 1J33A 1TB4A 3I2GA 4RSGA 1SG9A 1EFHA 5IVIA 2Q5QA 3LX5A 3ZDZB 2H7YA 5AHWA 4RZIA 2GZ2A 3VZCA 3ZBQA 3DB1A 1JIKA 1R0BA 2B83A 2DVMA 3C14C 2OZLB 2ADMA 2HR1A 1MZPA 2BHLA 2ZBDA 3BEOA 2GWHA 4LGMA 1GM5A 3A8IA 4P7GA 2P9HA 1REQA 1N5JA 3KTAA 1VJTA 2CHFA 3F7OA 1KHHA 3HVIA 4XDHA 4ZANA 5AXCA 1UD8A 4GXTA 1JEDA 4MWBA 5KQGA 5DLQC 2R68A 5I9BA 4FVTA 2IK8A 5LP1A 4KPFC 2GAOA 4B6OA 4F71A 2C4TA 2NW6A 5IC5A 1UD5A 1SULA 3ESDA 4XNFA 2VHJA 1IUNA 4C6SA 2J0VA 4PPNA 4ABTA 3NUZA 5G3YA 1UMKA 2WSSA 5J2TA 1U99A 3A1WA 4BPRA 4IAOA 1MGPA 5JXHA 4YCNA 3HL0A 5BSXA 2P0AA 5EINA 1CNFA 3BWCA 5ES4B 3AU9A 1WJGA 2HLHA 5IUKC 5B58C 1OVGA 3PTAA 2OENG 3S7ZA 2XB9A 1FCJA 1G16A 4P3OA 5K3BA 1L7QA 4P3YA 1KYQA 1LQTA 1Q6YA 2A57A 2CLMB 3D4NA 3EFEA 4I5IA 4U8GA 4Y7DA 3NHRA 2QM0A 1P9OA 1N3IA 2DPXA 4BNJA 5JS2A 2J67A 2Z4SA 4B4DA 4EABA 3NGXA 4J8PA 3PC3A 5IW8A 4DCVA 1O77A 5BSWA 4U63A 5HJ7A 4FX5A 4IZ6A 4AXBA 2UXCB 1S3FA 3CF6R 3BWYA 3UPDA 1Z2NX 2SECE 2VJOA 3FGPA 4N5MA 4LGYA 3JWEA 1WCV1 4UNIA 1RC8A 1Z68A 4KVAA 2JD0A 3FI0A 2VN8A 4O5AA 5FOSA 1HL3A 1Z75A 2X85A 1QNLA 3ZJ4A 2XGGA 1WLSA 2B7LA 2VK8A 5KQPA 2FWBA 3P1JA 1N36B 2JZNA 3WGVA 4DV1B 1K75A 4BQPA 5F3RA 1PYOA 2V5VA 3E1GA 3KLMX 3X43A 3L8EA 4B40A 4D9IA 1JHQA 3PDIB 1UJNA 1QTQA 1P7CA 3NAZA 1NRXA 3AGQA 3G0HA 3Q5GA 1RNLA 4DKJA 4ILKA 4W4TA 3LP5A 1IOWA 2HCJB 4MKXA 3K0CA 4WCFB 1MC5A 1ESCA 3MWYW 1QCCA 3QELA 2AI1A 1RJFA 1J8FA 3MPUA 4C89A 4O3MA 1AB6A 1GGVA 2NT4A 2IXFA 1O3YA 2PRZA 3C6XA 4WWHA 4DPLA 1NW4A 2ZPTX 2FLKA 3NO4A 1V8ZA 1E3LA 5YASA 3GJSA 1NQOA 3FYSA 3KR0A 3LHKA 2VHWA 3I9NA 4X1IB 1ANKA 4M9XA 4JJZA 1U0EA 3WSVA 5T64A 1XD2A 3PB3A 3DYBA 4Q66C 4R2WA 2J33A 3GBPA 1T8SA 5A5GA 4RD6A 3A7DA 4PHCA 1E3IA 4I5FA 4GZ6A 5E6UB 3KJQA 2DBZA 5FL3A 4YTEA 3A3GA 3VTKA 3K0EA 1F2VA 3JYQA 2FFQA 1AG9A 2OHIA 3OOYA 4RX1A 2DSNA 3WDMA 2JAHA 1ZIOA 3DYIA 1R74A 2WWHA 1FX0B 3UYKA 5K6TA 1V45E 1JU3A 4ASUD 1LF0A 3G5MA 2BBTA 1UT5A 4FDAA 1NBME 3ED1A 2GQFA 4K03A 4MYSA 3ROXA 1ZH8A 3DVQX 2P1ZA 2IPXA 4F38A 3FPHA 4OP1A 1VA5A 4Z5XA 1TCUA 2BKAA 3R5KA 1KK1A 3IT0A 3PC8C 3ZJUA 2QGFA 3HSSA 4HD8A 3TXYA 4UHBA 4E5SA 4ZT2A 1GWNA 2A35A 3U6BA 1ISRA 2Q3BA 3E22A 1KPGA 2ZQYA 4AJ4A 4O4HF 1Y98A 1BGXT 1GUDA 1YOVA 2GM5A 4BEJA 2O14A 2ZE5A 3EEQA 3R0JA 1G6Q1 4I3FA 3N2YA 2HZBA 4B7UA 1OXVA 1ESZA 5DMHA 1TO1E 2DLDA 4MUIA 4YMSA 1J09A 3PRKE 3T3GA 5HCNA 4GZMA 2VYQA 4OQMA 3VDNB 3ZG6A 4MWZA 4FMDB 4PCLA 4BVAA 1H93A 1T4DA 3OD1A 2V3WA 2DJIA 3F4BA 2AN1A 4DDTA 4Z49A 2PKEA 4BNYA 4ZAWA 4B45A 1ISJA 1O97D 3RVSA 5KU7A 1NBHA 5KNCA 2FP4A 3FUUA 3GJ7A 1WB5A 2AC7A 5KC9A 2GZDA 5I9MA 2C4WA 2JF0A 4RKWA 2B37A 2P40A 4UFNA 4YRSA 7ADHA 4W5WA 2DB3A 3Q7TA 3RQSA 1ZNQO 2D2EA 2VTDA 4UEJA 5CXQA 4XLTA 5KSWB 3DTVA 2ZSIA 3FDIA 4L6AA 3L0ZA 1BKSB 5DS0A 1TJ5A 4QV2A 3CP2A 1N05A 4G7XA 3H13A 4I1RA 1D7OA 3B6IA 4ZVRA 2VAMA 5GOZA 3V8BA 4C0SA 4HDNA 2KPOA 1T9HA 3DGEC 2YINC 5EYPA 2JW5A 3UT6A 4Z4ZA 4Z4TA 2BUAA 3TSYA 4FI3C 3HO8A 4WH0A 1JIVA 1PZFA 1PV2A 1FFXA 1T36A 4TV8B 2D0IA 4K2HA 1Q0HA 2DLNA 3UUEA 2BE9A 3OF2A 1ZGHA 3UWKA 3IAM1 3UY4A 2NSLA 4H6VA 3TZCA 1JKJB 1IHXA 1O0SA 2W98A 3GFSA 3O2SB 1D5WA 2M1XA 3HK2A 1Z5ZA 3ZZTA 1ACMA 5EPUA 1HBJA 5E8JA 3LIIA 4PX3A 1ZD1A 3WXBA 4YAGA 3MGKA 821PA 4WQMA 8ABPA 5EJ9A 3CWZA 3PXBA 4B6QA 4CQMD 1XYGA 1LDGA 4NJMA 5A62A 2X1MA 4FNMA 4ZVLA 3ER9A 1JEYB 5FTNA 3JX9A 2Z08A 4HK4A 3S1AB 4HWSA 1JEEA 1XTZA 1GLNA 4L2IA 3OA0A 3HYLA 5HTKA 5P21A 4BMXA 1Z0DA 5ICMA 3KFVA 3RO7A 2E1PA 2K5UA 1D8TA 2NQTA 4Z8YA 1J4AA 4CDRA 4KUHA 3AFIA 4QFBA 1FC0A 4Q6WA 2W2XA 2QKYA 4GPD1 3T94A 1VQNB 3UK7A 1OHHD 1P18A 2FJUA 1PQUA 3GBVA 3SIXA 2HXGA 3PX2A 1YR2A 4HG2A 3OIDA 3ZX5A 5C32A 3AOGA 1RQGA 4J0IA 4KNWA 5K0TA 3O3CA 2XB6A 1TOAA 3DDUA 3IHWA 1PJTA 3OMLA 4I1PA 1QE3A 4LE1A 4XGIA 4OI0A 2DP4E 1Y7IA 4ZC8A 3ROQA 5LA6F 4OHBA 1E9VA 1U3DA 3D2CA 3UGKA 4DYDA 1NQWA 4IOKA 3THWB 4ERNA 4QJ4A 5KBYA 1JVSA 1U8ZA 4OOVA 5LL6P 1RTTA 4TVOA 4L7VA 2J9FB 1WORA 1TLFA 3QP9A 3RFCA 1QH9A 2CFSA 5JATA 3H17A 3D8SA 1Y34E 3CLSD 5DT9A 2E4XA 2ZR8A 1WF3A 1AIPA 4LPKA 4BS9A 5CA1A 3G6WA 2XNJA 2WSLA 4MGZR 1ZBDA 3ZZ1A 3UJ3X 4FFBB 3WLFA 2QUKA 4EJ6A 4ZVQA 1I3CA 2XAAA 2Y0BA 1N2SA 2H51A 2OD9A 3MJ4A 4I1OA 1PBTA 5KDOA 5KJEA 1JFTA 1A9XB 4RPDA 2ZR9A 3BMQA 3A9WA 3IDSA 4I55F 2XWJI 4TV8A 2GHTA 3HY6A 4OHRA 3FNGA 5ALSA 1XMXA 4BJHB 4RPGA 1SKAA 3ASSA 3N2GA 1NOIA 2HL6A 1GQFA 4S0ZA 4K9LA 4BJ3A 1RACA 2JKZA 4WJLA 3VR6D 1ZN7A 2GXQA 3E9QA 2EATA 3EK2A 4RPCA 3WGQA 1C81A 1FYFA 1MABA 4TTPA 4YBRA 4TROA 5DNEA 4CF6A 3RLFA 1E1MA 5FNZA 4DJAA 3C43A 2Z4TA 4N76A 2EQBA 1RRKA 3FJOA 2FQWA 2VNHA 4IFIA 5FA5A 2VKQA 2WIDA 5G40A 3FMIA 5B53A 3HJHA 4MARA 4F4UA 3LO8A 2GCOA 3HFGA 4MB6A 1Z8FA 3PDWA 1BMFD 1N75A 4JYPA 2AMVA 3E7FA 3B78A 4LQLA 3RU7A 2DH6A 4K8OA 4AURA 2FCRA 1V71A 1FZTA 2PJZA 4FMBB 2B94A 2MOKA 3QFRA 1E9RA 1U8EA 4AJKA 2XWQA 5E38A 2AW3A 2AVNA 4UBOA 1QK5A 4KKUA 3A32A 3MJHA 4YJ2B 2PLRA 2ZSDA 3ZV3A 2LZ0A 4WOBA 5MN4A 5A0FA 1B42A 2CMKA 3DPSA 4JI3B 3TZ6A 5ICGA 3N3BC 4FWTA 1IZ8A 3T7TA 4DMCA 5B6JA 1JA9A 2HD4A 4XAQA 3RQIA 2WB4A 5AN9A 4J91A 5EJ5A 2Q4BA 1S8OA 2XQIA 1PP4A 4CZ2A 4A0QA 4KXYA 1VC2A 5JD4A 3COPA 4B2PA 4OO3A 1L7AA 4E51A 2ANCA 4MYUA 2GM4A 4NZOA 3GI1A 1N4DA 4OQEA 4BUJA 4DJTA 3MINB 2YWEA 3U19A 4JJEA 5ALPA 1OSNA 2DPMA 2Q3FA 1U0RA 1TJ3A 4D9CA 2NQ8A 4F8JA 2HT6A 4O59O 2XQFA 1GD1O 1ZL2A 1Z3CA 3IHTA 3IDOA 4OOSA 1F6BA 4U7HA 3ONDA 2AEMA 5FTJA 4N5IX 2FWRA 5ILQA 1QP7A 1NR1A 1HYGA 4LJAA 2I22A 1CB7A 2I91A 4A8JB 2GARA 4HDMB 3QUBA 3PUMA 1C14A 4TTRA 4XUEA 4FR0A 3U3KA 2NO0A 3OI7A 1SBCA 2BFEB 3EOBI 1XXLA 1A69A 3LBAA 5B57C 5JDIA 4S12A 2EBFX 4CLRA 1OB2A 4P7BA 2B1JA 3D3KA 3VISA 4DWVA 2R4TA 3L05A 2OV4A 3LOQA 5E6RA 3N58A 4N3GA 3LYHA 4Y30A 2X5OA 1T35A 5IN4A 4MV9A 1WV1A 3OOCA 4WI1A 2LBPA 3I12A 3KRTA 1I9CA 2CJWB 1U9IA 2Z8ZA 3USZA 3GT3A 3LSTA 1GLGA 4A2PA 4CUZA 3BULA 3ENNA 2WJ3A 1E7YA 2WSYB 1X9GA 4KUGA 2G1UA 4LY0A 3GG2A 3FMPB 3NAGA 5DU2A 1YK0A 3TLKA 3ZD9A 4QE3A 2BEVB 3IMEA 4GXRA 1R16A 3LDFA 3CG0A 4ZA2A 2YQ5A 1PJQA 2Z57A 3F9CA 5J1SB 2P7IA 1L3IA 3OTHA 1YKFA 3I01A 3MB5A 4P4LA 4WK2B 3HWWA 4F86A 5T41A 1P9RA 3EVDA 3JCZA 3VU0A 1IJKA 2Q3LA 2ZYTX 1DKMA 4P12A 3LPLA 4DA8A 5L40A 4AIRA 3GRAA 2RKBA 2CC2A 2XTAA 3NVAA 1VYTA 3IDAA 2I1LA 3OKPA 3IAXA 4V0ME 4A36A 4DDWA 2WILA 2BFAA 3UHFA 4MITA 2L42A 3HFRA 1FQWA 3ROGA 5J58A 1R12A 3OE4A 2VPPA 3KP1A 3ZV7A 1Y42X 2JEOA 3DO6A 3H5RA 2UVPA 3QFFA 4PO8A 4IHQA 1MVNA 5AHRA 3WP0A 1V7CA 2YV1A 3GGJA 3ZOKA 5BQPA 2OLEA 2I6QA 1UADA 2NU9B 3A4LA 5AWFC 3EXFA 2HC9A 3GLRA 4E13A 2QM7A 1L5SA 1ULZA 2EGGA 1VQPB 2C82A 5WRFA 2PX2A 4BB5A 3RSFA 1OAKA 1E4YA 2JIOA 3L0OA 4JLMA 3P7MA 5HMMA 1H85A 2PRJA 3C70A 1DPFA 3CF2A 1KZLA 4Q15A 2XPCA 5T6MA 2YUTA 4RY8A 1IZ7A 1WKCA 2C9DA 2IRWA 4HX2A 4M0UA 2GI4A 1DAGA 2PBZA 3G7UA 4BO7A 3B6MA 4EW1A 1RZRD 3ESYA 5I7SA 1MJGM 4AMYA 4QPJC 1GU7A 1M6EX 1E2FA 1FVHA 2ZUWA 5I7OA 3AJDA 3VC1A 1XRJA 2K7FA 4YAFA 3PWKA 1Q7TA 1AUXA 4B17A 2X0KA 2IV7A 1JE1A 3KOXA 4P83A 1VMAA 1JA1A 3P96A 3W5IA 1W36D 2FN9A 4FHFA 2Y0CA 3X3HA 1T24A 3NKLA 2XBLA 1U6JA 3OCUA 3BB3A 1SIBE 4L28A 3KR2A 4Z4IA 3QOYA 4PXSA 3FMGA 2M6LA 3NE5B 3BXEA 3PV0A 3N0TA 1NTOA 3Q7QA 3WJ7A 3CF4A 5CA0F 5FYDA 4YRKA 4O8CA 1LLDA 2EQ5A 1NSTA 3DQPA 3CUSA 4Z3KA 3K8QA 3D31A 1KL7A 2OE2A 5C3UA 3LL7A 2X2FA 4NYIQ 2Z6UA 5BXYA 4B3RB 2QV0A 4UJ5A 4HS9A 3PQFA 3VI4B 2F59A 1G0OA 2EFJA 3TNJA 2PT6A 4XR6A 2UUCB 1AD2A 3OHPA 2FDRA 3CW2A 1QHYA 4QSHA 1VE5A 2FUEA 4I1VA 2HWKA 4NJMB 1XK7A 3IKVA 1KI3A 3GLHB 4IY1A 3TOZA 2AS0A 4EA9A 5DEOA 6REQA 3HGTA 2HXSA 1H3EA 3QE3A 3USCS 5LQUA 1YQ9A 5ELXA 2H57A 1EXMA 3ILXA 4MLZA 2CLCX 4J4BA 3KT0A 1YUMA 3NBZC 3THSA 1OJLA 5BWMA 1LPNA 1JJBA 1VLLA 3BBLA 3E48A 1UMCA 2YIVX 2YWXA 2VZEA 2ZK7A 3R09A 1A7KA 1EZZA 1NFQA 2V6JA 4KV7A 1N06A 2CBGA 3M34A 1PK8A 3GBSA 3A1NA 2Y67A 3EQ8A 4XLLA 4IO0A 1RQPA 1CG6A 1VJSA 1Z56C 4II2A 4EIWA 9LDTA 4MUBA 2QX4A 2UYYA 4HVTA 4CLXA 4PNEA 4QBFA 4AJ1A 2CDRA 2SBTA 3GLTA 5K3CA 3Q38A 1KVUA 3PPIA 3EXG2 1POXA 3NXKA 3D8RA 3I5UA 3ADBA 3PEWA 1DFHA 1D03A 1M90D 1DKUA 2K2QB 3FG9A 3IEKA 5JEDA 1N2JA 2XMZA 4GBGA 2OFWA 1UKAA 2PZLA 1KQ3A 4R3NA 2OAQ1 4G2NA 5JNLA 3D6MA 5K8JB 3E5MA 2YYAA 4MQBA 2IX3A 1C7QA 3KKOA 1X19A 2V6FA 1AJEA 2A1IA 1J90A 1IBRA 3WTBA 3GJYA 2VUIB 4OFWA 4I50F 1UPBA 4C7XA 4UTNA 2BYTA 3D2BA 2JGIA 1HDIA 5SY4A 3C97A 2WAXA 3FKSD 1J24A 4ARBA 1W4AA 1W29A 1SWVA 3UGJA 1JHMA 3DOIA 1MN6A 3GUHA 1UAAA 2CMGA 2E85A 4MVJF 4HL6A 2BRUC 3KKEA 3SYNA 4FFBA 1MOZA 5F4JA 1CETA 1JN0A 5LWQA 1XTJA 2OO5C 4OOEA 4ZT7A 4X7CA 1E2IA 2OK7A 3RJTA 1X3SA 121PA 1RU3A 3ZHSA 2BKLA 4BFYA 2FQQA 2PN1A 5TDHA 4Q05A 2R86A 3EARA 4C0LA 1AO0A 4Q21A 3GEIA 2HRRA 3RG2A 1VIYA 1D0VA 4UAJA 4ZAZA 3K9WA 3BDIA 1DC6A 4TRMA 3N2GB 4S35A 3NIWA 4EPXA 3EG5A 3WSTA 2YNMA 3WTCA 4F4CA 4RA6B 3H4VA 3AP2A 3AR4A 3H4TA 5F4MA 5CTAA 1MABB 1TM2A 4Q3AA 1QM5A 5DM0A 3W0LB 2OC4A 2B6HA 4O25A 2WJZB 3GT7A 5DVZA 4ZI7B 4YCMA 5L7YA 4LZZA 4YRAA 1UFQA 2EKDA 3W8RA 3WGHA 4X91A 5M7EA 3UBTA 1RZUA 3N6VA 2O4UX 2QN3A 1C1YA 4B8ZA 1NUAA 2QMEA 3PS9A 1VYHA 2CBZA 2CMDA 4XQCA 3FFAA 4RMIA 4EHNA 5EN4A 5LQNA 5FADA 5HX7A 4LAFA 2EF0A 1D04A 1R27A 2PKQP 2LRHA 4KO4S 5ELMA 2PU5A 3ZV6A 3B7GA 5E3JA 1R5BA 4M0LA 5AT1A 4L85A 4F11A 1P31A 1PW5A 1I4EB 2NT3A 2P0YA 2QX8A 2YICA 4ZALA 4Y2XA 3CVJA 3QW2A 3F8WA 4TMXA 2J32A 2XT6A 1L4BA 4L78A 3TVTA 1SVIA 2JLXA 3DHNA 4WK4B 2C9ZA 1UT6A 4OI2A 3VBCA 5ALFA 4PONA 3OF5A 4ED9A 2QEXB 2NP7A 4CKCB 3W5AA 1DC8A 4GIBA 2G5GX 5GY7A 5SZJA 4V0MA 2A5FA 3FPAA 1PV1A 2XUAA 1FSFA 4R8MA 5CNKA 4ZXPA 3VX3A 2IIPA 2OCLA 3MHPA 4AZWA 2I7VA 4ENUA 4QXRA 5A2GA 4MYRA 2PJRA 1XDUA 1IHUA 4KYVA 5CK5A 3UFXA 1IQRA 4MCAA 1EU1A 3PHGA 2RGNC 1Q77A 3SDSA 2KBFA 1XI2A 2ZRHA 3RARA 5CDGA 1JSZA 2IDJA 1JJAA 3FYHA 2ZJ3A 3CO5A 3BRQA 2WF9A 1FJHA 3DC7A 4E5YA 2XZTA 5LP6F 3JPYA 2X42A 5DBHX 3HZZA 3WWCA 4BGIA 2DBYA 2JS7A 3C8HA 1NATA 1M33A 4YXWA 1MOSA 2CY0A 2Y71A 2H4YA 3A6GA 4DZTA 4EHLA 3G9UA 4TYNA 4PZ9A 3GJ8A 3M3DA 1N92A 1R8JA 4AJHA 2O0JA 1DFIA 2OBBA 1VM6A 4TLDA 1JJVA 1GKIA 1E0JA 1PHPA 1C80A 2RDMA 3MVEA 4QA9A 3UJ6A 1UFOA 1QFMA 3Q3CA 4MUHA 5BOVA 4D8WA 4ARCA 4D9KA 1HTBA 1NJ5A 2ZSAA 2NO4A 4H31A 4BX8A 1G60A 4Y7CA 4FEGA 1Y4UA 1SU7A 3EFOB 1DUVG 4TMVA 3RYIB 1NVVQ 3ZWMA 4OHKA 2NZJA 3QEAZ 1DRKA 1CHDA 2XMGA 1XPJA 3A1SA 2QLJA 3E7XA 3GJRA 3QG5A 2Y68A 4JQOA 3GLFB 3A25A 1G8SA 3E9CA 5GOTA 3T9DA 3CSDA 1W36C 3T0GA 1M0SA 3PG5A 1Z29A 4KSCA 1V5GA 1OZGA 2GZ1A 3AF0A 4RC9A 4UZSA 3O31A 4EW2A 2GAJA 5FWYA 5UKDA 4IFEA 3TEJA 1SBYA 4DR5B 2HU2A 1YL5A 1HFKA 1K8RA 4X65B 5GP1A 1QH8A 2H5IA 3SEFA 4AF7A 4K6CA 2CUKA 1TM4E 1XQVA 4C20A 5JJ5A 1JXQA 2IHZA 3Q3GE 3SYMA 2IEYA 3EG9B 4RLHA 5B1SA 5J2UF 1GTRA 4GI5A 1JNYA 2GTHA 4ND2A 1LBQA 2C7PA 1UC8A 2EX1A 1NC3A 2C3UA 1TZ2A 1Y6RA 5F73A 4DHWA 1A5BB 4XRGA 3WK7A 1G20B 5IH7A 4U7DA 1A8HA 2VBVA 4CQLA 2OBYA 1V25A 4UHHA 4CEHA 1AXGA 1L4YA 3SZOA 5DKFA 5F7OA 4JI7B 1SKYB 1XG5A 1E2EA 3AG5A 3MWJA 3NTRA 3T7KA 4ZYXA 2MHCA 1MLDA 2PZBA 1UDBA 3JQ6A 3CNNA 4D44A 3AM5A 3GDGA 1MTZA 1W96A 4J1QA 3TUIC 2AJCA 4I4LA 4W5QA 1GR0A 2J3MA 1Y4ZA 3UJDA 4RZ3A 5HIIA 4FZ5A 5T8KC 5KQSA 2FOXA 3A10A 3MTQA 2VJMA 3M5CA 1XEAA 1FTYA 3RRZA 3PFGA 1IQ0A 2X8AA 4UDYX 1G5PA 4XDYA 5CG2A 1EK0A 3Q10A 1YF3A 1E1RD 1LXCA 3OT5A 2B4AA 2X4LA 5K6RA 4TMYA 5G4KA 3T1YB 2BGWA 1V0EA 1HFWA 2Z98A 1IDOA 5TMDA 4WKNA 1YS7A 2WIKA 3UW3A 5TMPA 2PX8A 3R0XA 3OT1A 1N9KA 1X7WB 2GBLA 4K9OA 4JB8A 5J59A 1IOVA 3FDZA 2M2IA 4JDPA 4B81A 1QH1A 1OTHA 5D87A 3MWFA 4FZVA 5AI9A 3IEIA 1CUXA 1YQXA 5F4BA 2ZJ2A 2EV9A 3G85A 5JAZA 3RYFB 1E1CA 2Q0SA 4WEQA 4ARIA 1DEOA 1G7CA 3SLNA 4EB0A 4QYSA 2CE2X 2HA5A 1JT2A 5DZSA 1BOOA 3ZY4A 3QJYA 2V54A 1LEHA 1GPWB 2WM2A 2YJ6A 2Y0PA 3KG2A 2AVDA 2GJ8A 4MMXB 3SJZA 1XKLA 2I6FA 1HT3A 2KHZA 2O2JA 3BD9A 3VUFA 4IZOA 1TL7C 2XMCA 3OCVA 5BVHB 4I55A 4P2GA 2B5WA 3LSYA 4ZKDA 1ZUNA 2A59A 3C3WA 3I6BA 4G5RA 1KZ1A 2Q3MA 3EAFA 2NTJA 2QSZA 5BPHA 1WCYA 1JLRA 5ITVA 2AZTA 2H0QA 3A27A 4UEQA 2FUKA 3UXHA 1IOZA 4KPUA 2O8NA 4LOLA 1EVJA 5BO5A 1EQAA 4OVKA 5TT0A 1F12A 2Z6VA 2ZULA 2X5XA 4C0KA 6GPBA 5FQOA 3AYZB 3CFYA 2BW0A 3I04M 5E2AA 5F21A 4L5BA 4K05A 4B3FX 1MAVA 1Z6TA 1EGHA 5M04A 3E5RA 4AKHA 4RJTA 2GH1A 4DNPA 1E79D 1B3RA 1KYTA 1CP2A 1SUBA 3AGPA 3BEDA 3E9ZA 1U04A 3QOXA 3WL4A 4JQZA 4KN6A 4BNHA 3E03A 4MJXA 3A1VA 1W4ZA 3N9IA 4DF3A 4Z6KA 1G6OA 1EVIA 2F00A 1ZRHA 1CR0A 1ECFA 1CT9A 1JL3A 1V16A 3QKSA 2C94A 3MTEA 4NOJA 4WOCA 4WPGA 2WYOA 3OZEA 4LVNA 3TCXB 4YXFA 2CUZA 1QX3A 3RVOA 5LYJA 3GIWA 1R64A 4GPAA 2OXEA 1T0IA 3CPSA 3JAKA 2EZTA 2YV3A 3GA5A 5DTEA 3M83A 2BHNA 4URUR 4C4RA 5L6MB 5GADl 3IS3A 3IIMA 4G84A 3I2FA 1IBMB 3T9EA 1QQAA 1S4MA 2IHUA 2C5BA 1L9XA 4LZLA 1YC2A 4H4EA 3TL3A 5FIUA 4LF5B 1DCFA 2PSEA 3BWEA 5ICFA 2XVYA 3V3TA 4HNAA 4NZNA 3QPWA 4AZ0B 4DCNA 3EIEA 3GJ5A 3HNRA 4AJLA 2N1BA 3AFMA 1BYIA 3PFHA 4W1QA 3WLKX 3FWKA 1RAGA 3HN2A 4A2QA 4B7XA 1GPLA 1KK3A 4MRAA 3AI3A 2W6JD 2XVAA 4GQAA 3AUXA 4AECA 5HIJA 4FE3A 1UKZA 5D86A 4OX9Y 5J43A 3B9BA 3I01M 4GP7A 3RROA 3VU9A 1L7DA 3ZS9A 3MT9A 4XZ3A 4BNMA 4CIYA 2PCLA 2GXSA 1OOEA 5HUHA 5IYRA 3KC2A 5CBPB 5KYWB 2I4IA 5F2EA 4BNWA 1Y37A 1VB5A 5ECGC 5GM2A 4NBTA 2JLAA 4F6RA 1XGKA 1U8YA 3N76A 2RHJA 3Q12A 5JRZA 4ITRC 2Q62A 1UKEA 1K8ZB 3TB6A 2XAUA 4CM9D 1HDCA 1WDKA 2PHZA 2FJPA 1M1UA 1AKMA 2Q1XA 3UW1A 1ORTA 2DAPA 3U44A 2XYRA 4J0DA 1MZVA 2JJ1A 4OV6B 5I7EA 3ETNA 4XE5A 3W9YA 8GPBA 4OKNA 3I76A 5BUZA 5L3RA 1I7DA 5JV5A 4B4VA 4YPFA 4AY4A 1YXMA 2ZYUX 4OXXA 1LCIA 3HV0A 2PGJA 3SDBA 5GJCA 4DLRA 4ZCMA 2DGDA 5DASA 3TQSA 3JTMA 5D7BA 4BFCA 2F64A 4BOYA 4OYYA 3ZHBA 4YR9A 3CJRA 3P19A 2E4WA 2HPAA 2J6HA 5EWMB 2VJPA 4LJSA 4M55A 2W48A 4D8YA 5A3QA 5K3EA 5HA5A 2O3TA 4D8TA 1BJTA 1ZXXA 3FHOA 2ZUSA 1GKKA 2PS1A 3DMTA 4NMXB 4QQFA 5D3MB 3N8DA 4HH3C 2ZTLA 3E0XA 3ZWQA 5LYJB 1GR1A 1JAXA 1XK6A 2FHSA 3OPVA 4B3CA 3AVXA 2EBHX 2Q0XA 4MV8A 3FGZA 2ZSBA 1XZCA 1EHIA 4FQ5A 5B3LA 5DN6D 1XPRA 1OBFO 1ZMBA 5LYYA 1AB5A 1D9ZA 3MCVA 4Y6SA 2G8LA 3HB5X 2BAGA 3L7OA 4HUJA 4G3XA 3KDAA 3VHXB 1T4GA 4GWLA 3DAFA 4PLCA 4W8OA 1JMKC 3UFXB 4Z1MA 3PFKA 3LXMA 4NHEA 4PQEA 5CPFA 1WIWA 5ARCA 4AXXA 2EFGA 4U1RA 1SELA 5F64A 1XNGA 3DNMA 1QHFA 1VQ7B 1A97A 1NJ2A 1VSQA 4H3HB 1I32A 1FMLA 1V4NA 3W7VA 3AZPA 2FEOA 2ZRMA 5DTIA 2VBSA 2R96A 4DVGA 4JMPA 4U7GA 4WL0A 5MHTA 5AKLA 3PQ3A 4LOKA 1KFKB 3BXXA 3RM3A 2VPWA 4LF8B 1KJJA 1U8TA 3VU9B 4NFHA 3PFCA 2WF7A 4YJGB 3FVWA 1Z4NA 1Y33E 1GILA 1WW2A 2C9YA 3OPQA 1C7IA 4E5DA 1MUUA 4F6RB 5DRYA 4LDPA 4INAA 4QGFA 4Y9UA 1KERA 1AZTA 1EUQA 4ZOAA 1L5GB 1T4BA 3RRBA 1U2PA 4OHXA 1R0RE 2RHGB 4EW6A 4NOKA 1Z3IX 3PKIA 5C8YA 5U4QA 2UAGA 3T9BA 1LK0A 1FUEA 4Q1CA 1BQEA 4ZVSA 5CD9A 2YDYA 1U3CA 2C9BA 2J5RA 4KL8S 2NSHA 1EK2A 5K8IA 1LBSA 2B2XA 4ARSA 1WU8A 1YZYA 1TUIA 3Q9UA 5ERGB 4DNXA 4F5ZA 2NTYC 2J7PA 3LC7O 4AKGA 3DR5A 3UHOA 3N75A 3TJMA 3HNPA 4M1QA 3EGEA 3L8ZA 4RV4A 1P33A 5J2UB 5BMVF 3OE7D 4I4IA 3BE4A 5E1DA 1W0JA 5AI0A 1Z8HA 4QTXA 3TM4A 4CMAA 4OXRA 4IIVA 1YFZA 3RG8A 2VBIA 1NULA 3AQ4A 1RWKA 1UD3A 2XXAA 1ZD9A 3NOVA 1PF7E 3BC1A 2V6BA 3PPYA 5TIIA 3CG4A 4IRUB 3HEAA 5ADWA 3VPXA 3SVZA 1C7RA 1XA3A 1TT5A 3DOUA 3FNBA 3HEBA 3R6GA 3SEZA 1IDN1 2WHYA 2YMQA 1QNFA 1VIDA 1ZI9A 4G63A 2G77B 5A03A 2H1CA 1N32B 4OJNA 4A6PA 4R1OA 3HO1A 4XKJA 1PNQA 2XRFA 1DUSA 1H2EA 1JBQA 1L5OA 2DBVO 2VHQA 4KQKA 1HT1E 1OY1A 4OJQA 3VHXA 4EBBA 3T3EA 4WZEA 2ZROA 4MA0A 4UQLA 3IIIA 4CQLB 4BN5A 4AULA 3QEMB 5IMSA 1RRPA 5JZVA 3C8ZA 4DIFA 1NSYA 2O8CB 4MOWA 3VXKA 3A1FA 4BP9A 3GPIA 3WWOA 4COOA 2HU5A 1S4QA 4FOTA 4PHHA 4C04A 4TLMB 3WYBA 5DB4A 3T3PB 2BELA 1J9ZA 1N4AA 1PNRA 4JYCA 3JQFC 2F4NA 3NHYA 1SKQA 1LJLA 4ZEMA 3AOEC 4P6VF 1IPEA 3RUPA 4FIDA 1MRSA 4RW0A 3WVNA 3EH1A 1BDBA 2VJMB 3NDPA 4RIIA 1BROA 1TQ8A 4YS6A 4YJGA 3LLUA 2AYYA 4AJ2A 4BFZA 5IVKA 1HTTA 3MT8A 1J5EB 3C6KA 1H4QA 1HLFA 1TKCA 2B21A 5EE9A 1PZXA 1U9JA 1EA7A 3EVEA 3OPNA 5HVNA 4YELA 3U31A 4Z86A 8LDHA 4G1UC 2F90A 3PGVA 4MZXA 3LP6A 4V1CA 3WA6A 1OI3A 1J06A 2W6IA 2Q3JA 1CDDA 3SEAA 5KEIA 3JVVA 4IJVA 3NR2A 1S3GA 5A02A 2DUWA 2H1SA 5BNFA 4W5TA 3IAS6 4QQNA 3VYUB 4YRFA 2C4NA 4HYTA 4GNRA 2WJGA 3LQ2A 3QMMA 1GZ7A 5G0UA 5AXAA 3RYFA 4HWTA 1JDNA 1YCGA 1C30B 5G1OA 4LW8A 3LBIA 3DE1X 4C5AA 3QLJA 3K70D 1OGYA 4HDAA 3T3HA 4WKGA 1SZDA 3PT9A 4FFDA 5JAIA 5J2UA 2VCHA 5AUNB 3KTFA 1C9DB 3PJDA 4AS2A 1UFKA 3E9MA 3DWEX 3NDIA 4RK1A 1U7DA 1V6CA 2GNOA 3GW8A 1QO0D 2X0NA 3LZDA 4YMWA 2Q21A 3DH0A 4IQ8A 3LWNA 5BSYA 4DK1A 2ZS8A 5DHQA 1ZK0A 1DC4A 4K88A 2FOLA 1Y5IA 4AZVA 4QT0A 3M0EA 3O4HA 3OZUA 4TSRA 2J3QA 2VOEA 1SQSA 2XNDD 2JCVA 4LXYA 4ZOLF 2C83A 1O9GA 2JNWA 3QGMA 3RFXA 2JLVA 1SVOA 1Q16A 1Y7LA 2NYRA 3HJRA 1J23A 1NQAO 4P9NA 3TYXA 5CXUA 3NHWA 3ONVA 4M76B 3CC4B 3X1WA 4JDUA 2AI2A 4B87A 4LHXA 4OHFA 3X44A 1W88A 3CUKA 5P8WA 4PBTA 4P26A 1CQIB 1P0IA 2WNHA 3OCCA 4JP1A 1U3VA 3U7EB 2G04A 1ZR4A 3C3JA 2X5KO 3LECA 1HY3A 2QRHA 1OXXK 3RHSA 5HCUA 3ZE2B 4I46A 2AR7A 5DRTA 1VLJA 2VBGA 4KQIA 3RW9A 4GX0A 1TK2A 3Q9LA 2WMOB 4LFCB 2JBHA 2PV7A 1XZFA 3PNMA 2QS9A 4FEAA 1E1DA 1U28A 2PIDA 5LBIA 1Q0UA 1M75A 1UOEA 4ZARA 1IEWA 2DMRA 2H2FA 3A9UA 4FCTA 4GKAA 4HNVA 4TSFA 1AN0A 2YWCA 3Q7EA 4JI5B 1T1GA 5IEBA 1GAWA 1HMYA 3NCHA 1JWLA 4B74A 2JD2A 3GY0A 5CHYA 3UK6A 1IHMA 1IK6A 3OIUA 3KL4A 3RLIA 2H1RA 3DE6X 4V1CB 4L7QA 5LQMA 3X1JA 4C2AA 4GM0A 3W9SA 3G8AA 2M9MA 2BCJQ 4LF7B 1HK7A 3IIEA 5EC8A 4ZHSA 4PIMA 5IT0A 3RUCA 1S0UA 2IV2X 1U2DA