5FO1A

E301a mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
338
structure length
338
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVAQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 94
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo1A01
1R6UA 1WXIA 4I6JA 3IODA 4QREA 4MW4A 4MUEA 4MUFA 3OTWA 1FYDA 5IHXA 2CT8A 1OWOA 4Q16A 1QRUA 1N2IA 2PG3A 1PFUA 1PFWA 1JMVA 4MLPA 1QRTA 1NB9A 4PBRA 1GN8A 5A88A 2IELA 1IQRA 1J1ZA 4MWCA 1KQOA 1PG0A 1PFYA 1H1TA 4MW2A 3CVYA 5H7XA 2RE8A 3X1JA 2V0CA 1XNJA 2NSYA 3ND7A 1N05A 3IOCA 2D54A 3CA8A 3ISJA 2A1UB 1P4MA 3CLTD 3IMGA 1TYCA 3RBAA 4MW6A 1LI5A 1OWNA 5H16A 4NAUA 4EG6A 3TZEA 3MXTA 3IOEA 1Y42X 3ZJUA 2J09A 5KCMA 1MB9A 2E21A 2RD2A 1JEEA 5LFAA 4QBTA 4R2LA 4WSOA 4F4HA 3IH5A 1MRZA 3TQIA 1KH3A 1KQNA 1H3FA 1WXFA 2CV0A 4EG5A 4MVYA 1V8FA 2QTNA 2Z08A 4ZT2A 2EJCA 4MUIA 2R5WA 1EFPA 1WQ3A 2NZ2A 2B7LA 1JIJA 3FNRA 4OJMX 1GZUA 2QJOA 3INNA 4MWEA 3AG5A 4HPWA 5TRDA 2C5SA 3KT3A 3HL4A 3PNBA 4PY2A 1O0BA 1G8GA 1TFUA 1Q9SA 1NI5A 2D5BA 3BL5A 5J5AA 3LE8A 2ZUEA 1J09A 2CUZA 2QUHA 2O5RA 4WNYA 1J70A 3SYTA 4EG7A 4MQ6A 3CVUA 1GTRA 2H29A 3PXUA 2P3MA 4G5FA 3C8ZA 1T9GR 1N06A 1KKUA 1EUYA 4DDMA 1BS2A 3UC5A 4EG8A 1KORA 3ZJTA 2ZP1A 2DUMA 4PBSA 1U3CA 3Q10A 5TGTA 4CT0A 2PFSA 5EKDA 1MOPA 1T6YA 1N2GA 1M8GA 1Q77A 2DPLA 3FIUA 3M5WA 2A88A 2X3FA 2DERA 2XRYA 1WZ2A 5HUJA 1N78A 3FDXA 1H3NA 4MW7A 1N2BA 4EFKA 3ND5A 3KFLA 3D6VA 4F3RA 1HYBA 1MB2A 4ARIA 1JEDA 4S1OA 1N1DA 3ELBA 1IH8A 3HGMA 3MLAA 1TYAE 1WOYA 1IQ0A 1VBMA 1O95D 4G5YA 1N2JA 3AG6A 1O97C 3ZGZA 3UK2A 4XFDA 4NZPA 1NB0A 4UZEA 3G6KA 1NUQA 3CLSC 4MW9A 1EFPB 5BNZA 2WQ7A 1X8XA 1YI8A 3Q12A 4EG1A 2PXHA 1RQGA 5KWVA 1KH2A 1QQTA 4MUNA 4A91A 1WXGA 1QU3A 2VBTA 1DNPA 4DLPA 1M8KA 2HZ7A 1U0BB 4AS1A 3Q4GA 2VBVA 2CYCA 1U3DA 2YXNA 3GUZA 1WQ4A 4MUGA 1IFXA 1O5TA 4ND7A 3TQOA 1N75A 1IRXA 1ZH0A 1N2HA 3PNYA 4P2BA 2O8VA 3NBAA 2J5BA 2QTRA 1ZH6A 2D13A 3IDFA 2CFOA 4MW1A 2E18A 3AL0C 1JIIA 1EJ2A 3VGJA 1GAXA 3AKZA 4DDKA 2A1TR 3FWKA 3JXEA 3A4IA 3P0IA 1OWLA 3P52A 3QTBA 4RUKA 4YP7A 3MMXA 5K0SA 1K92A 4J76A 2J08A 3X1KA 1SURA 1S4MA 1GTSA 4MVWA 3RK0A 5JBNA 2BTEA 4DNXA 4NX2A 2VBUA 3IVCA 3NBKA 5J58A 2HGZA 4L2IA 3G5AA 4MAFA 1T6ZA 3PNVA 3CLTC 1I6LA 3CLUD 5A89A 1M8JA 2G36A 1XJQA 1YIDA 1R6TA 1M8PA 1ZUNA 3H9CA 5K0TA 2X1MA 3IUEA 4K0RA 5HG0A 1WY5A 1NUTA 2J4DA 2CV1A 4TS1A 4EG4A 5F23A 4OUDB 1LW7A 1QRSA 1N2OA 2CYBA 2WQ6A 1KP2A 3DO8A 1GLNA 2Z3VA 3FETA 2IP1A 2OYNA 1ULHA 2AKEA 4ZCTA 1KP3A 4DDHA 1COZA 1EE1A 3GLVA 4QRDA 1N08A 3RK1A 1A8HA 1MJHA 3X1MA 3IMCA 1YULA 4EF6A 2CYAA 1K4MA 1K97A 1PFVA 2A4MA 2E0IA 1J1UA 1MAUA 4KKVA 1JZQA 1U7DA 2DEUA 2GKSA 3S3TA 3G59A 3COWA 2A86A 1NUUA 4CQNA 4ZT3A 2JANA 2TS1A 3AIIA 4L2IB 3SP1A 3A2KA 4KPUA 3HFJA 4XFJA 1ZJWA 3OP1A 1VL2A 3NV7A 1IHOA 1TEZA 4ZCRA 2H2AA 4AQ7A 2QUJA 3D6UA 4MVCA 2QTMA 3IVXA 1WXHA 2J07A 1JIKA 3RHSA 3COVA 2PZBA 4U63A 4GRIA 3UMVA 3TZLA 3COYA 5FO1A 4DJAA 3UY4A 3ZJVA 1Q19A 2DR2A 1QNFA 1O95C 1Q11A 3L93A 4BWVA 3CTAA 2PIDA 1NZJA 4JXXA 1IQUA 1NSYA 1T9GS 4J75A 3H9BA 1U7XA 4X0EA 5J59A 3A04A 2WSIA 5IJXA 3ZUGA 3CVWA 3N8HA 4G6ZA 2PZ8A 3ND6A 3TNJA 3H97A 1YUNA 1KAQA 1JZSA 4I6EA 4RPIA 4ZT7A 1QTQA 3RJZA 1O0CA 2YY5A 1KH1A 3LOQA 4ZCQA 2IJGX 1LI7A 1VLHA 5LM3A 3ZXIA 3K32A 4NAHA 3FOCA 4KPUB 1OD6A 4CDMA 4U8HA 4KR7A 2I1LA 1QJCA 5TS2A 1EFVA 2XRZA 5DEOA 4Q93A 4HJXA 3I05A 4U7JA 4E1AA 4EGAA 4ZT4A 1WKBA 3PRHA 1WXEA 4MUJA 3SEQA 1TQ8A 3ZXSA 2A1UA 5LLTA 1WJGA 2EL7A 3CLRC 1EXDA 3KT6A 3UOWA 2PZAA 2CSXA 1KR2A 3LCJA 1N07A 4ZCPA 2CV2A 3IMEA 1OBHA 3E27A 5AHWA 1N3LA 1ILEA 3CLRD 3CLUC 3FI0A 2DXIA 1O96A 1OWPA 1YIAA 3IUBA 3KT0A 4KR9A 5KHAA 1I6KA 4MWDA 4EG3A 1JHDA 3F3MA 2DETA 1FFYA 1B6TA 3IVGA 3A05A 2A1TS 2AG6A 1F7VA 2QUIA 4ZCSA 2V0GA 3P0HA 1OWMA 4MUHA 1OBCA 2JAXA 5DB4A 2X1LA 3FY4A 3SDBA 3BNWA 5FO0A 2QUKA 4CDNA 2A7XA 1G8HA 1UFVA 1EFVB 1KAMA 4MW5A 2VBSA 1CT9A 1N2EA 3CVVA 3VRHA 2VTBA 1MAWA 1KQPA 4R2MA 1XNHA 3H05A 1M83A 2YWCA 1I6MA 2Z09A 1F9AA 1VBKA 1O94C 5A8AA 4JFAA 3ILVA 4MW0A 3SEZA 1NYLA 3SZ3A 3AFHA 1O94D 4H3SA 1J20A 1O96B 2HMAA 1D2RA 3HMQA 3FG9A 4R0NA 4YBRA 1X6VA 1TYBE 4XSVA 1N77A 4NATA 1JGTA 4HK4A 3K9WA 2E89A 5HUHA 1F4LA 4JYZA 3QTTA 1F7UA 3DV2A 3CR8A 3MLBA 3MUEA 1EUQA 1M1ZA 2JA2A 4YP6A 2OV4A 1H3EA 3COZA 3HV0A 1J21A 4PBTA 3H99A 4KR6A 3N9IA 1Q15A 1QU2A 2QJTA 4ZT6A 5TEVA 2QJFA 1NURA 2VTBB 4UZFA 3KT8A 1O6BA 3RFFA 1G59A 3FHJA 1P7PA 3DLAA 4JZYA 3TS1A 1IVSA 3CVXA 1MBZA 3L92A 3VU8A 2VXOA 3P0JA 1MC1A 4YP5A 4MULA 5DK4A 1K4KA 3U1VA 4YMIA 4HJRA 4NDAA 2DLCX 1GPMA 4FZJA 1YUMA 1M8FA 5DASA 1TYDE 3N2YA 2YWBA 2ZUFA 2AZXA 2WB2A 4ZT5A 4ARCA 2A84A 4K03A 2BYTA 3DPIA 2GM3A 4GU5A 4DE5A 1JILA 1NP7A 1XNGA 2GOYA 1G8FA 3HZRA 1JECA 1I2DA 3IOBA 1O97D 5TEWA 1PG2A 3FH0A 4ND6A 4I6GA 1V47A 3ZIUA 3CLSD 3N05A 3QE4A 4MUKA 3SZGA 1T6XA 1NUSA 4JXZA 5FNZA 1NUPA 1VBNA 3GMIA 4MVXA 4MWBA 4OUDA 1R6XA 2OQ2A 2X0KA
chains in the Genus database with same CATH superfamily
5LMZA 2JC3A 4ISBA 3UK0A 3ZHCA 2B0JA 4DEVA 4AP9A 3RVNA 2B8JA 4UDYX 1V71A 1YCDA 3ZLTA 1ULTA 5KHOC 3ZW7A 3GLFB 2GX6A 4QDJA 2HLHA 4KRGA 4H6WA 5K99A 4B35A 1K98A 3PFWO 1YI0A 2CVPA 1RPJA 4P25A 2ZYTX 4U2FA 4URVR 4UTNA 1KIMA 3V33A 1SKAA 4AXBA 2XTNA 2J7PA 2CT8A 5JEDA 3H4VA 2GK7A 4Q39A 1L5SA 1QQAA 3JR7A 3ZNOA 4OL9A 4X0CA 1HT2E 3D8SA 1GP2A 4JGIA 4YRQA 2P2ZA 3DO5A 2H5JA 4IX1A 4PPNA 2XJ9A 3B53X 4PBRA 3NJRA 5ICFA 3SXPA 4RZUA 3CY6A 2XB2A 3R5KA 4O2BA 3SF8A 3ZE6A 1EWQA 2Q28A 1G5IA 2XQKA 3AR6A 1E61A 4YONB 4YJGA 2X40A 1K7CA 3ABZA 2N3ZA 3ONUA 3JQCA 1WSBA 2O3TA 3M4NA 4YPFA 4MK4A 4OJYA 2LCFA 2IZOA 4M36A 3DKVA 4CCWA 2F67A 2ADOA 1G7CA 4EPXA 5CYOA 2QBYB 4C6TA 3R3JA 2HIHA 2PM8A 3FPJA 2Q4OA 2QM7A 3Q6IA 5CRIA 4K05A 5J2UA 1Z2NX 1F6WA 1T34A 4BNHA 1TKRA 2X9VA 1WDWB 2J3DA 4MRRA 1T8RA 4UE2A 4K9KA 3HDGA 1L4MA 2IRWA 4KWIA 5JQGF 1T43A 1R10A 1V2HE 1ZIDA 3GLIA 1ZI9A 4D82A 2ZYWX 2NM0A 1G5TA 2ZWPA 2FCRA 3RC7A 3Q5EA 4YXWD 5J4LA 1ZEJA 2C9MA 4NDNE 5DFAA 3ST7A 3U37A 4HGYA 1U3VA 4CZ2A 2FSPA 1Q6ZA 2HN9A 1KYYA 3DEAA 3HRKA 3PL1A 3TRKA 1GQSA 3GHHA 3BHJA 4QBTA 4BP8A 2PE3A 3ZD7A 1ZCZA 2FI1A 3OIYA 4LZJA 5ECDA 3U4DA 1LSSA 4R9SA 4RAQA 4CV0A 4O63O 1DIHA 1J9GA 2NACA 4U2EA 2D3WA 4H18A 1L4YA 1V8FA 4NF2A 5A04A 2B5VA 2QMQA 2I34A 4LGYA 2GD0A 4EGSA 2G1JA 1EA7A 3LPDA 5CDFA 1TNDA 4G36A 1GUDA 2WOOA 1VDMA 3P2EA 1F1JA 3PE6A 5KOIA 1Q44A 2QN8A 5C53B 4GOLD 4PC6A 4GEKA 4R2KA 2GKGA 4YRRA 2KS6A 3VHLB 3HL4A 3HN7A 5KNLA 3MTEA 3OM9A 4TL8A 2JAQA 4D0LB 1A1SA 1YB7A 3M34A 4ILEA 4PO3X 4B4UA 1Y6GA 2QUHA 3VKUA 3OOWA 4FBLA 1I30A 4DIMA 1HVXA 1TAUA 2H54A 5FTKA 1WZUA 4JBYA 1E8DA 4DK1A 1MJGM 2V58A 3DD5A 3G8YA 3V00A 1N06A 3MQFA 1OYVA 1GLVA 1NVDA 1IHPA 1L7PA 4WA8A 3S2FA 3UC5A 1VMKA 5J63A 3L7MA 4G0VA 5BN1A 1SXQA 2YFYA 3PENA 2PLWA 3O4FA 1Y0RA 2H6EA 4X45A 3VPBA 4TQUS 3AEUA 3DTVD 1PN3A 4OQXA 2QGZA 3E9QA 1ZBDA 1L3IA 4CU2A 3ENKA 1B6GA 4US1R 1W49A 4CFYA 3WL6A 4A0HA 5AI9A 5ILQA 3VV2A 4LJAA 2VJCA 3X2FA 4C3UA 5HZHA 3OM0A 4M53A 4N3NA 3R40A 3FYUB 3EA5A 4OHWA 3NTXA 3UJDA 3HGMA 3O8BA 5I7RA 1DIOB 4GBED 1E99A 3HB5X 2DUNA 4DR3B 2A5JA 5CITA 3GEPA 2B8TA 5FBHA 5EI5A 4ZC8A 4MGKR 3PTAA 1VJSA 1N2SA 1SVMA 5JJ5A 1K1EA 1O97C 1TB4A 4JLKA 2WMNB 4XQGA 2L0XA 1WXDA 4S12A 4B31A 4Q1BA 3DT9A 5L4LA 5KSZA 3E5MA 4RJIA 2KMLA 5IU6A 1M34E 4HEA6 5A4DA 1KMMA 2FZWA 3OKFA 1YJQA 3SEFA 3HMKA 3PYXA 4J0KA 2WPDA 4LZNA 3KS9A 4R1NA 4L16A 5D6OA 3CZQA 4CR8A 1BQ4A 1C8KA 5KTKA 3S2IA 4HE5A 1Q83A 3VOBA 1EBFA 1V96A 1P6XA 2HU5A 1LI4A 1M8KA 1RRGA 3BGOS 1QK5A 3ITDA 3M1IA 4AS1A 3IHTA 2YMLA 2CYCA 1U3DA 3GUZA 7REQA 2R4QA 1J8YF 2VO1A 4QRHA 4BPBA 3GGSA 4KHZA 1I2BA 3ICCA 1QHFA 4RX1A 2EZUA 3CINA 4D9KA 5CA1A 3LM8A 2QN3A 1NQUA 5F51A 1EG7A 2WJ4A 2F1RA 1FBTA 4IDOA 4ZYZA 3PXBA 2XIJA 3N5KA 3ZS9A 1WTCA 1JEYA 3A35A 1THGA 1Y34E 2PMWB 3CH6A 3KPJA 3VR3A 4DDKA 5B57C 4CQLA 3UMFA 1DIAA 2OHXA 3G5UA 4HAUA 5BYAA 3ZH2A 3U56A 2IYPA 2R6JA 4PWZA 3W5BA 2ZKLA 3C5CA 2Y1WA 1Y8ZA 1Y4SA 3IQEA 3QEMB 3EGCA 4HDMA 2A0UA 2ZT5A 2EP8A 3BEOA 3KYDB 4NZYA 3FVQA 3DV9A 3NH9A 4RVHA 1E4OA 3HKBA 5JBNA 5JHGB 5JTTA 2BTEA 1HX7A 1NXPA 4E7OA 4MCIA 3WRXA 1JIVA 2C00A 2FEMA 2VSXA 3ABIA 2ZBUA 4QYTA 2FJ0A 2G9UA 3JALA 3QMVA 1X7ZA 2IXAA 4FE7A 3CLTC 5DBFA 4QLOA 1JHZA 1PNTA 5F7OA 4AKGA 5D00A 3K2BA 1TCUA 1BXRB 1ZUNA 4BBPA 4L4XA 1VSUA 2GQFA 4M46A 4A2CA 2X1MA 5FEMA 4C2UA 2QRVB 3FSJX 3A4LA 1GNSA 1NUTA 2F17A 4ROSA 4TZ6A 1QORA 2YCBA 1EESA 3VO2A 1QRDA 3A9UA 3NM4A 3SSMA 1OV6A 4E6PA 2CK3A 2HSEA 3BQNB 3HQ4O 4H0FA 4UMEA 5FBZA 4YQYA 5C4GB 3K0AB 2NU7B 3BMNB 3EDRA 4DXAA 4EK9A 4KU4A 1NXXA 5GGXA 1QYDA 1ATZA 3IULA 4O08A 3IXLA 4YB8A 2OOKA 5KQSA 3GD7A 1JHUA 3BVPA 4GP9A 5EPUA 1YXMA 4BVEA 2W0MA 4F92B 1JYEA 3PDWA 2YS6A 1PHRA 2GYWA 5KNCA 2AOUB 3LXXA 3PFIA 4LVUA 2HRCA 2QM3A 3NIFB 3UMRA 3ETDA 5B4VA 1WL8A 3DM9B 4QU8A 1MC5A 5LNK1 2EAUA 5FI1B 4RJKA 2OY0A 2JEOA 3L79A 4XORA 3E15A 2NNWB 5B3KA 3SQWA 3EA0A 3VM6A 1E63A 1KNQA 1N7HA 3PFHA 2BZSA 4E1BA 4MYUA 5KJ1A 2FE1A 2V55B 1XJWA 2DFDA 1D2EA 3G7SA 4Q4HB 4A26A 4Z8YA 2JFHA 3B9RA 1DBVO 2J7PD 3ZZ1A 4P5DA 4Y67A 3OIVA 2O50A 4ZCRA 1VQLB 1MT3A 2F8LA 2W2VA 2QI9C 1K86A 1T36B 1ID1A 2AFHE 2O2YA 2PGNA 3MOSA 1PAUA 1T5OA 2M6RA 3KKLA 4KH1A 3AOEC 4BMPB 2G67A 2NSJA 3DB2A 3CM0A 5LP6F 1JIKA 5GZ6A 1PP4A 4YX9A 2H9AA 1JEJA 1ZNYA 2C2KA 5E7QA 2R6AA 2X77A 1U98A 5EUQB 1VGRA 3NATA 2ECQA 3G2OA 4Z9BA 3OT5A 1OASA 1JHOA 1U2SA 2ZM6B 3CUYA 3UV3A 1OLSB 1RVDA 3E4CA 4Z4ZA 2KLBA 3KP1A 4JXXA 1J8MF 4TV9A 1T9GS 2FJUA 4CLDA 2QRQA 3SOZA 3ZHRA 3VTKA 4I1VA 1OLXA 4BGIA 1R8SA 4TTIA 4AAYA 4JUBA 4D3YA 3HLTA 2G06A 1RW4A 2YVAA 3R1IA 4HR7A 3VVLA 5ERYA 2FLWA 3KHUA 4GUDA 1M3SA 4JJEA 4G1MB 1KSJA 3ADKA 2RGAA 3DOHA 3MMSA 1WCYA 3O3NB 1ENOA 4BV3A 1CS0B 1REQB 4DCTA 2UYGA 4QUZA 4Z4VA 1GAWA 1G5FA 2GN9A 2J67A 1L3CA 3CX7A 5K2MA 4YDSA 3ESQA 4DNFA 3SZUA 3BTOA 3UJ3X 1R9GA 3HY6A 4F7DA 1TF2A 4IVQA 5K3DA 4EUFA 1GILA 5K51A 1E9VA 3HCFA 3ZI4A 3PFCA 5IWAB 4QHTA 4UBMA 1FLDA 1HT0A 1JQ5A 4XCXA 1FP4B 3IVAA 4YQFA 5AW4A 1PDOA 2YIDA 2I22A 1Z5PA 2ZIXB 3PE4A 3GEIA 3H8SA 4HRAA 4A2PA 1KJYA 6PFKA 3BJRA 2HPZA 2V7EA 1YUBA 3ASVA 3D0RA 1EKXA 2X8AA 4LYYA 4U7JA 4CLRA 3VC7A 3TG2A 2VQSA 4LGVA 2FW1A 4Q3EA 4YRIA 2X8WA 2Y71A 1DINA 1GXSB 2GD1O 2QN1A 4U4AA 3OE1A 4LQ4A 1O1YA 2EFYA 1QH0A 3G79A 1P80A 3SEQA 4EY3A 4S05A 5FOTA 1XN4A 4CMIB 3QBJA 1E9DA 1FDSA 2JLBA 1FQKA 2ZITA 3VQTA 2HJGA 4S1VA 3RIGA 4FN5A 3E27A 1RCUA 1XTUA 5G4KB 1AE1A 3Q2OA 2OQVA 3VDXA 1N3LA 1LSUA 1YTLA 5IAGA 1PWHA 2DXIA 4FGLA 1O96A 1EK1A 3CMEB 3IUBA 2ZBFA 3GLIE 4C88A 4RD4A 2JAUA 1B6TA 4BCCA 4I99A 4G25A 2GXUA 3GARA 3IFSA 4GH5A 4REQB 2YY6A 4FWBA 1G2PA 1YMVA 5K09A 3BC1A 2DULA 2IUSA 4LQLA 2XQFA 1PL6A 3GUUA 3MWFA 1NBMA 4GT1A 3VYUB 2PQMA 3W8DA 1G16A 2QTVA 3O03A 5JANA 2QQ0A 4RPCA 3E48A 1HE5A 1YIJB 3JVVA 4WD3A 3MRSA 4JLWA 1YB1A 4JUAA 5I9LA 2Z9BA 1XDBA 4J0FA 3R0JA 3MTBA 1CKEA 4TKVB 4ZREA 3IIKA 3WLFA 4B7UA 4YT8A 3MFQA 5CDFE 1QF7A 1OAOA 5JISA 1PQ4A 1JQ3A 1Y1LA 3QUAA 4KXVA 4F3CA 3BB3A 3Q9LA 4QA9A 4ZOAA 2WPDD 2QM0A 1JWAB 2ZRAA 3ROTA 5JJIA 3ODPA 4LMAA 2O8EA 3Q9UA 1UZMA 1TC1A 2C61A 4L5YA 4PHHA 4XYMA 3S2GA 3TIGA 4FQ8A 2QTGA 3G0OA 3IAM6 1CV2A 4BV2A 1LDEA 2ZUTA 2HNKA 4CMJA 2IKSA 4R84A 1OSNA 3LNNA 2QSZA 1A7JA 4J2TA 4NJMB 4UQPA 2DHEA 3M6AA 4X07A 1G18A 4F8EA 2QLLA 3H4TA 4CF4A 2Q5HA 4TSFA 3S68A 1QJ4A 2OP0A 1O3YA 4C7MA 3MG9A 3DR3A 4QYMA 2WHEA 4HLNA 3W79A 4K81B 3FTEA 2BRUA 1GL7A 4Q3AA 3RVKA 2ONCA 4WQMA 2XLBA 2Z8YA 3HMQA 3FG9A 1SC6A 2BISA 1A95A 1RYEA 2VAMA 4RV9A 3AESB 2X5KO 2B92A 3BG5A 1EDDA 4P53A 3VR3D 4YRGA 5BW4A 4GLOA 4MVJM 4F1WA 1N9GB 1Q0QA 4OQ4A 2FG7C 2ZVDA 2GJ8A 4RKRA 2E89A 3QMPA 3VZSA 2JBWA 3N2NA 821PA 1Q7YD 1VQ5B 4E2YA 4OO3A 3CIOA 3UG6A 4WY2A 4BFSA 2VPZA 4N48A 4OBWA 1FRNA 1BS1A 4FGKA 2OCDA 2PLRA 3DFFA 1AV6A 1UJNA 2Y99A 1Q2XA 5JS8A 2LCQA 2EBFX 1EVJA 3CPSA 4HRVA 2G82A 3QPAA 4A2QA 4WGGA 3AKEA 4X8OA 5IXJA 3MHPA 5IN4A 3QVKA 4FE3A 2KI5A 1TIPA 1CYEA 2LIVA 2Q0HA 5IDQA 2P8JA 3AEYA 3ZIAD 3IPLA 4CTMA 2X0NA 1U5CA 2A5FA 2XCQA 2J46A 4HXEB 4JQOA 3T9DA 4YRBA 2VQDA 2XWSA 2EZTA 3CRVA 2XR1A 2HRBA 4XX1A 3GCDA 1XP8A 4MCAA 4XR4A 2SCUB 5BQ3A 4EPRA 4Q3BA 3GMDA 5D6NA 3P0JA 3GLFA 1W5FA 3DAOA 2O57A 1R64A 4P1ZA 2YRWA 4JI3B 1SKMA 1AK1A 3L02A 5P8WA 1FJ2A 1G5PA 3KBBA 4HWPA 4UU8A 3RS0A 5GIPE 3IJPA 4RNDB 4MWSA 1XYVA 2ID4A 4BLRA 4CN8A 5SY6A 1JXMA 3GJ8A 1ZD9A 2P5TB 4Q24A 2O3RA 3OURA 5DI9A 5B36A 2Q5LA 4G0PA 4I55F 4QVKA 2YWBA 4PYMA 2ZUFA 3PX7A 5LWHA 1FDTA 1RJ9B 4YP1A 3U3ZA 1OQAA 4DCJA 4DWVA 1X3SA 3VR5D 5K05A 3KQHA 5DGCA 1TYZA 2Q5EA 5KNCD 2HF9A 2BYTA 3AF3A 3L5KA 3R3ZA 1JHXA 1W5SA 3WKBA 3ORYA 1JILA 4MJLA 4CKCB 1UIMA 3PQ4A 4LWOA 2BGIA 1UKYA 4L76A 3JVIA 4BB6A 4O25A 1OU0A 4TWIA 1TVKB 4TLAA 5EHIA 2OC4A 3MVEA 2SKEA 4LOAA 3RTCA 3FPLA 1FDVA 3ZS8A 1ISSA 4A1OA 5TPZA 3HXPA 4CM9D 2QBYA 2OXEA 1VLZA 1U7TA 1Y7LA 3PB3A 1GZ5A 3ROZA 3RC8A 4Q1FA 3KSBC 1LD3A 1T6XA 5DVZA 3WYBA 2W6MA 3VXKA 2GZRA 3A26A 5I9MA 1YX2A 1H0HA 3CUUA 3N0WA 4MVXA 3AV0B 2H59A 2W6JA 5DWDA 4AJOA 6ABPA 1CHDA 2W8ZA 4BNWA 3UK6A 3ZBTA 1R6UA 4LWZA 3MGAA 3MHTA 10MHA 1XF9A 4Y9TA 2FPXA 3OC6A 3GPLA 3SJAA 5A03A 2M9MA 1YL7A 2PCJA 4MW4A 1P4GA 1T4CB 3GH3A 2NZXA 4KE6A 1PSZA 1U1IA 1X14A 4EABA 5JAPA 5KYWB 2MCFA 4QULA 4RPLA 3PICA 3LBNA 3F90A 1E6MA 2W2KB 2B5WA 2Z3WA 3FJOA 3Q8WA 1RYMA 3ERCA 3Q1KA 2C04A 3AU8A 5DDIP 5DLPA 1ESNA 2QB5A 1JMVA 1SVNA 4EY5A 5ER6A 4C0QC 5A88A 2OOSA 3R6KA 4RGQA 2R0QC 1ZM7A 3K9FC 3W5IA 1VB3A 4YK7A 3RVQA 4MYTA 5M7EA 3L07A 1GUFA 3FJ1A 3NRJA 4FFSA 4D9CA 1KQOA 3FNGA 4L51A 3ELDA 5EP4A 1V7QA 1PQPA 3FDFA 1UC4B 1W46A 1WO8A 4W1QA 3CJQA 4HQOA 1NQXA 3R5FA 4LN1A 2FPRA 3JZMA 3QKUA 4ANFA 4F5ZA 3FOWA 3A3OA 3F1KA 4PO9A 1AKWA 1M1YE 4PR0A 1J1IA 3B89A 5F3WB 3V1MA 5DEIA 2O1EA 1H2EA 1ODKA 1KIAA 4O5OA 3W77A 3B52X 2YNMA 5AK5A 1ODJA 1NJID 3UMGA 4TYYA 1NAHA 3OCJA 3IO5A 1WDKA 3GJQA 4QGBA 4MGEA 5KNDH 3IOEA 2PKEA 4JLMA 4WZKA 3F5QA 2IY7A 1GQRA 3O9MA 5TB5A 1HRKA 3UHFA 4Z8XA 3SYMA 1NBAA 2OVFA 4MARA 5HF6A 1M0SA 4LNUB 1LBSA 5HCUA 5B7NA 1EYZA 3CKYA 1VQMB 2WHPB 4QGHA 1ODIA 1P4AA 1RYZA 3EZXA 4RWZA 1YAJA 3JR3A 4ARBA 4LF5B 1GKUB 2GYYA 1OZFA 4S1NA 2QD1A 5B1HA 3HPRA 4PPQA 1SU8A 4GF5A 2XGJA 3JD0A 2P3QA 4BFTA 1Q14A 4CM5A 1XEXB 3PP8A 5I5GA 4US2R 1O54A 2OLEA 3INNA 4HPWA 1Y5MA 5DJ5A 3FYTA 1DAHA 3NHYA 4KIFA 3V2IA 1C8VB 1X19A 1WQ1R 4ZODA 3EYWA 3H9QA 3QUQA 2XGMA 5LQNA 4KPYA 2IGBA 2WDZA 5U4QA 1WG8A 2PE5A 1FTYA 1X86B 4FDAA 4Q9IA 2ZWMA 4E5UA 5KIAA 1NBMD 2ACVA 4KXWA 1QFMA 1KOGA 3PXUA 2FK7A 4JI0B 3NHKA 4A5OA 4QM6A 1WHTB 2C9BA 5HQTA 1U8AA 3PUVA 3V7FA 1H22A 2JHPA 1HE8B 5ENDA 1G8KA 4UMFA 4EX6A 4W5QA 1KQFA 5L3QB 2IHUA 1M8GA 5BSHA 4ZA2A 3SFZA 2KW5A 3JRWA 5EXTA 2LDBA 2XRYA 4UOQA 3RKUA 4BEBA 3I5UA 4DY6A 1N78A 1F06A 2WMDA 3H1GA 4HNQA 3U3RA 4DNOA 4EH1A 3D6VA 4ARIA 1NKSA 3NDIA 1NOIA 3ORFA 4R68A 1N1DA 3DEYX 4RSGA 3UGKA 2Y0PA 3FAKA 3KZOA 2FMXA 3BIJA 4J4HA 3MLAA 4PYNA 1W25A 3ICPA 1VL1A 4AC9A 4TMXA 3D64A 2DQ4A 1DFHA 2W4MA 3B78A 3S2ZA 3UBMA 2QGGA 1UXIA 3KYDA 4YDHB 4ZDIA 1ZM3A 1E5VA 2AR0A 5KQMA 4PCUA 1YZKA 2ZL6A 3DG9A 5G1PA 2P30A 4HMPA 2VP5A 4DC0A 3I73A 2BF7A 4NZPA 3B6ZA 5FADA 5CXUA 3ES9A 1QGZA 2VXCA 1W44A 2NTEA 4IFBA 4MW9A 4TSFD 1ZG3A 2XRMA 2C7RA 4UJ5A 1BH6A 3RY8A 3O7WA 1I8TA 1K6IA 4DARA 2YASA 1YI8A 1Z29A 1YJ9B 3RS4A 4L0CA 2AYXA 2O0LA 3WLEA 2ZYVX 1BXRA 2QNIA 4XMYA 1ONBA 2BM9A 3I42A 3IBYA 2ZCUA 2QRVA 3L7LA 1A1VA 4X7PA 3E2IA 2P4SA 2I7TA 1CPYA 5C4MA 1HDRA 1H2HA 1U0LA 3HS3A 3P94A 2PQ0A 4LZPA 4OPVA 2J0UB 2N42A 1RS0A 2KSQA 3FX2A 1VYUA 3R77A 1W59A 2ZDHA 5L3SA 1YVDA 1ZH0A 3K0AA 2NU7A 3R2JA 3OCCA 4DLSA 2Q4RA 5F2NA 1ETHA 1ZH6A 3KAPA 2JIQA 3V7YA 3JZAA 4R3UC 2BFWA 4JP8A 3RS5A 2AYZA 4KH0A 3BE5A 3FVRA 2HW8A 2WILA 1OZGA 1TK2A 3QMMA 2Q3CA 4MVJF 2UVDA 4H7EA 3TKLA 4IIHA 5FEUA 2NW6A 5K8TA 4A8JC 4IIGA 1E6WA 1IOZA 4XGRA 4V0KA 3MMXA 1DBWA 4DIOA 4QDZA 3Q3IA 3P9SA 1UP6A 1C80A 2BY4A 4G1VA 4KQ1A 3ZWYA 2P4UA 3Q3AA 3X1KA 4GOMD 1ISFA 2FPIB 1UWLA 4LDNA 4O6VA 5CDGA 1N3IA 4E5NA 4CIAA 2QV0A 4DAOA 4G5OA 2XUDA 4PGMA 3SC3A 4CMHA 1MB3A 1X9GA 3RRJA 1BQEA 1IN7A 1I80A 4M6WB 2I3ZA 3NIBA 4Q4HA 4BLSA 1YT5A 1GRQA 4YLGA 3DH0A 5GINE 3LCCA 3N2IA 4R6WA 1KP9A 4G8BA 2ZATA 1T36A 3FFXA 1J06A 3G13A 3H5WA 3MTDA 3U7QB 3U19A 3U1BA 1GAEO 2I2XB 3COJA 1E0AA 621PA 3ZQ4A 3AFNA 1S9DA 2NVUA 2OR3A 2H1SA 2NUPB 2LUOA 1JKFA 3KOUA 4GC5A 1IHUA 3BMOB 2CXHA 3MILA 4ECAA 4EDFA 1Z0IA 3EWSA 4OUDB 1C29B 2PKRA 4YACA 4WINA 2W9XA 4QAQA 2P65A 3NTUA 3DO8A 3ZKAA 2H8GA 2RGWA 3G0GA 3L04A 3T61A 1SQ5A 5AW7A 1OLSA 2PBZA 4G0WA 2O8CB 5E4TA 5T64A 1S7CA 3D3QA 2GZAA 3GD5A 3AMVA 5TPZD 1QP4A 4RD3A 1QO9A 2BCJQ 3ESBA 2OFPA 3VYTB 4BIIA 3SAJA 2WTBA 4GMKA 3OKXA 4UEJA 5DLDA 1N08A 2DWOA 2PLFA 3KVYA 1RBQA 3PHJA 1Q3TA 1RJGA 3GG2A 3DBIA 5AOBA 4V0MA 4D8VA 4JUFA 1GUYA 1ORIA 2GCNA 4LJ9A 1ES9A 4WT7A 3NTOA 2A4MA 2PO7A 3N6RA 4B85A 4KKVA 3EPJA 1J5XA 4LF9B 3FMIA 1Z7EA 2GSWA 1YS7A 4CQNA 4ENPA 5HA5A 3WYGA 5JYEA 2DQSA 3DZHA 2AC2A 3OC0A 3QVVA 1OX5A 4PC1A 4DV5B 1R0WA 3NV7A 3R6GA 4BE7B 3P4YA 1FP4A 5JXGA 2G83A 2UUPA 1O77A 1N9ZA 2ZIXA 1A4XA 3BQMB 3LKBA 4N0DA 3D6UA 4ASUA 1B8UA 4PHTA 3M1LA 4B82A 4E0BA 2O8DA 2BZ1A 4EAAA 2WINI 3FPPA 1EJ0A 2Q1XA 4E5MA 2RGRA 3G9ZA 5JS1A 4GRIA 3UMVA 4KAAA 2NXWA 1IJBA 1GXSA 4E09A 2JCSA 2VRWA 1EUDA 3ZJVA 1Q19A 2EFJA 1HV8A 5C5DA 1YHZA 1T2UA 2X9LA 4TT3A 2OQIA 4G84A 4M9RA 3IQWA 3Q6NA 1E2IA 2VUIB 3F8TA 4CMIA 3K0SA 1DAGA 3VUFA 1GNLA 5JMPA 3O92A 4P2GA 3SE7A 3UMBA 4PGOA 2CW5A 1G38A 1AS3A 2IEAA 2R44A 4OJQA 1IYZA 1UDWA 3TZ6A 4WXPA 1YB4A 3GT0A 1QGDA 1CRLA 3L1IA 4KQ2A 3UUGA 3V5NA 1EVQA 3PCRB 4REQA 2BW0A 4OU5A 1W34A 3HP4A 4WKPA 2QJRA 4G2TA 4RPIA 5BR4A 4HMQA 1OROA 4YDQA 2I76A 3GMSA 1OYYA 1UBFA 3OEYA 3EULA 3GVXA 1RQ2A 4YRLA 5KOJB 1Q2UA 4MXDA 3TVTA 1DRKA 2ZI4A 3EVNA 2C3MA 3H17A 2Y0BA 1JJ2B 5KSWB 3AGQA 3D31A 1KYVA 4KFTA 4Q1CA 4X24A 2R86A 4RY8A 3HTXA 4IX9A 3IRVA 3FPSA 4KR7A 2Q1UA 1NW4A 2GK3A 2YH2A 2FWJA 4X1OA 1RZ3A 1VKRA 2B25A 5D3QA 4Q05A 2CN1A 2R84A 3I61A 4IUDS 2IE8A 4DT1B 3UFBA 4DQXA 3MTJA 1T2DA 2NN3C 1INLA 3IJ5A 2J3IA 1YO6A 3S8MA 4Y7CA 1MU0A 4LRWA 4GP7A 4PPGA 5JPIA 4A0QA 2O19A 1WXEA 3BOSA 4N82A 4PNHA 4ZOCA 3M82A 1P1HA 3SX0A 4XLAA 3DP9A 4KKSA 2ZM5A 4KI7A 3MCVA 3QTLA 4N7RA 2C78A 2X0JA 4B48A 4UHHA 3RO7A 2VT7A 4PSUA 3SKYA 1II8B 1ZH4A 3IQFA 5CD1A 3C4JA 3LG2A 3J7AC 3AERB 3FGPA 4WXHA 4F93B 1QKKA 1JI3A 2QAGC 4WNCA 1G8JA 2PGAA 4EG3A 1YVRA 2FQWA 1KRWA 3GFSA 4US0R 3JAMA 3HJNA 4V1CI 1ZU4A 2F55A 1VP3A 1ZH2A 3H5NA 4NCNA 1GTVA 1N9GA 2LZJA 1PFKA 3PQ8A 2HRRA 1MV5A 2X6RA 1TUBA 2O8DB 1Y8QB 5CLFA 2V54A 3HCDA 2CGEA 4TTRA 2P9ZA 4JC4A 2GZDA 1U63A 4LUCA 3RADC 1HF3A 1PJ6A 2WDPA 3IIIA 4GWKA 3BWDD 1YQTA 3BNWA 4CDNA 4WTOA 1V5EA 3DAPA 3H2ZA 2V9ZA 3VHQA 4DFDA 1LBEA 1U04A 3DJFA 3DMTA 1JPUA 5H83A 2PWAA 2HWXA 1G60A 4RTOA 4OK5A 1TFRA 3BRQA 1JJAA 5AO9A 3TRIA 2BPOA 1C41A 2VRNA 3T7KA 1Z13A 5J5VA 1T5HX 1ST3A 1RRVA 1IOLA 3AFGA 3B13B 3VZQA 2Z3ZA 1UMBA 2WP0A 4R2MA 3MNFA 5IVDA 4AZWA 3BZWA 1G8MA 5AK3A 1ZKDA 5FI3A 5F7XA 1QCZA 1UPBA 3OF5A 5EVCA 3JASB 3K0FA 3G5TA 1WMFA 2NVOA 3PNKA 1FW6A 3EDQA 1PW5A 5DW0A 2ZAGA 4PHGA 4BO6A 3EK2A 1C7QA 3K70B 5AJYA 3GJRA 3MW8A 3QEBZ 2NUTB 4AS2A 1CVIA 1YS9A 4WW0A 3D7SA 2QN7A 5CT6A 1ZVJA 4FCWA 1U99A 2C88A 1TU3A 1WB4A 1XNRB 2NYAA 2V1XA 1XRQA 2GPAA 2YX1A 2HSGA 3GT3A 4ONEA 3IP8A 3R7BA 1M5TA 1RJ9A 2EQ5A 3AXSA 5EXSA 2COKA 2H07A 2INGX 2YV5A 3KU1A 3LGAA 2G5GX 1D6NA 3DAYA 5KSPA 4EBFA 1PWZA 3F67A 2OC9A 3L18A 2QLNA 4ZMRA 2DBRA 4CKCA 5T67A 5BNWA 4HLUC 1NNUA 5BR8B 2Y3IA 3BQJA 4YHBA 4PLZA 2RGYA 4OJTA 4ZANA 3Q8LA 4OHZA 5BNIA 1PSWA 1TVKA 1ZISA 1BYUA 1TTHA 1PR3A 1XQVA 3D9QX 4C87A 1SCUB 3ADOA 2OHGA 4XUDA 2B9EA 2O23A 5A1JA 1HE2A 1G6KA 2YXBA 3F5FA 2XKBA 5HGXA 1WBDA 3E3MA 3EXHC 4OK3A 2BBOA 4ZQHA 1CCWA 3NAQA 2WZNA 4I55B 5HBRA 3VX3A 2Y4NA 1UD8A 3PUHA 4ND1A 5IYZF 5FWYB 1FFCA 2BEJA 2PN1A 4B0OA 4D8YA 4EUKA 2VTBB 3GNTA 2XUPA 3C15C 5KKAA 3BH4A 1KI6A 1ZSYA 2CXUA 2VWQA 4JZYA 2R11A 1PU2A 4A2WA 4DAEA 3H9NA 3SQLA 1Y4ZA 3C3AA 4IQFA 3TXXA 3WB9A 5BXQC 4XL9A 2HPAA 3CRRA 1CEEA 3IOYA 3FDIA 1RC0A 2X2OA 5TF4A 3ETLA 5ALMA 3S2YA 5FV4A 5I9IA 5JAIA 4AKHA 2Q3HA 4QYWA 1T4CA 4R7TA 4X1YB 4F60A 2VYQA 4YBZA 2YWHA 2C2OA 1L7OA 2P2CA 4HFMA 5B1IA 2SHKA 2W2KA 1PK8A 1VLMA 2WVJA 3ICVA 3A6FA 4OHBA 1N2XA 3WJ2A 3LBAA 3WV4A 4C4RA 4DEYA 3IPXA 2VVTA 4OMDA 1W88B 2WB2A 4AO7A 1UFOA 4UTOA 2V96A 3ADPA 3ZR4B 1FVFA 5BUSA 1A2OA 4HAWA 4BQFA 4P3YA 3FUVA 4DE5A 5B4UA 3P9YA 4FNMA 1CUSA 5IFKA 3TD9A 1XNGA 2GOYA 2G6BA 1HUQA 2R751 3CN7A 3EIOA 5F77A 1C5KA 1IEQA 1M2GA 1ZMTA 1JECA 3H4IA 3QJYA 3UAWA 9MHTA 3HEBA 3KSRA 4IW3B 5E7JA 1DWPA 2WAYA 3PGXA 3FBGA 1YA4A 4G67A 1OBFO 4QDUA 4UD6A 5UKDA 4IIFA 1E79A 2WE8A 1YBHA 2FLVA 1QVRA 2ECOA 2X0EA 3DOUA 3EGXB 5LLSA 4IIVA 1YZNA 3LQRA 3R0QA 1ENPA 2ZLBA 3O4RA 3E3LA 1B0UA 3A06A 2ODNA 4P7KA 2BEWB 4C03A 5BVHB 5HJ7A 2H17A 4X8MA 5JADA 4G81A 5AK4A 3MIZA 5JQWA 4UASA 3HI6A 1MO2A 3RVRA 3B1VA 2HJVA 2PZEA 4RQBA 4WFKA 4YLEA 4F7WA 5F9FA 4JNCA 3K4QA 1X1SA 1NC3A 3I4FA 4EJ0A 4NICA 4KUEA 5BYBA 2O0MA 4AU1A 2O7QA 2LDXA 1JG4A 1RKBA 1IIRA 1MAAA 2WHPA 3FBWA 4HX9A 3IRUA 5H82A 4AKIA 4KXFB 1AQYA 3GQBB 3SC6A 1WY7A 1RWWA 1ZGHA 1OWOA 5TQ2B 1TYEB 4GMDA 1E2MA 1DAPA 2WBLC 3V4SA 1QRUA 2C20A 3W9SA 2I7VA 2AEMA 1QRTA 4IYRA 3G6EB 2A7QA 1FMFA 3OE5A 2Q9AA 1OIWA 2P9BA 3AINA 5AICA 5K0EA 3M6LA 5IF3A 1WRBA 1E6CA 4GGMX 4V0ME 3FD8A 3BIXA 4J49A 3ZY5A 3PT9A 3EFOA 1TC2A 1BE1A 3HP7A 5BNFA 2XUOA 1UFKA 1TQ4A 2YFKA 1PUJA 4TRNA 4AQYB 1E3MA 3HGQA 1Y3FE 4CODB 1R5JA 5H7XA 1ZHFA 4FGJA 4ZKEA 5I5EA 4YNBA 2LRHA 3NKLA 4RMIA 2WYIA 4F9EA 4RABA 5ARDA 1HG1A 1KSHA 3GEHA 5GAJA 4JP5A 2WPNA 4XYBA 1TE2A 1Q0RA 1XJ5A 2C03A 3H2GA 4X5OA 3UWPA 4UQLA 5LBIA 4RENA 1WSDA 3C5VA 1LK5A 3OJCA 3PXEA 4NAVA 3KAJA 2JBHA 4BE4A 5A4FS 4EY6A 1CF9A 1Z6AA 2ZSUA 5C1PA 1TZJA 2J3JA 5MFZA 4KO2S 2QWXA 1AMUA 3V8RA 5BSXA 1LTQA 1KETA 5ICEA 2E21A 2JGJA 4O4LB 2NSLA 1JIQA 3A4TA 1W4ZA 3KOXA 4MB2A 3UA3A 2IOYA 1XZLA 1V6AA 2I65A 4DYVA 4H7DA 1BU5A 4QVAA 2FFRA 4CCSA 3QE9Y 4OP1A 3I6MA 3CF2A 2YWDA 1T3GA 3OOHA 4EW1A 4LHEA 1DL5A 4CIDA 5DWQA 3V1UA 2VJDA 1IU9A 1KZYC 3EISA 3SS9X 8ABPA 3L0CA 1B74A 1JWLA 2X8BA 2VTKA 3IYLW 4PYLA 4LDAA 1B43A 1U3GA 3N7UA 4WLFA 4URXR 4ZP1A 2NZ2A 5F21A 5I7WA 2B4RO 3C7KA 3FIJA 5JRJA 2QTWB 1CDZA 4B8WA 3CZRA 2DJIA 3HYTA 3BXEA 3JQBC 4NEQA 3ICQB 5A5DA 4BZQA 5JAOA 3ENZA 3OCVA 4R8LA 1ZY2A 5GIOE 1QIGA 1NRIA 1Z5NA 5EWLB 3LGXA 5AVWA 1LJ8A 2GPSA 3DHEA 3HXMA 2XUIA 3SYTA 2AF4C 2ZWAA 4JR1A 2J0UA 3E1YE 2ZJ1A 4RPDA 4KNYA 1B73A 3VSDA 3D7RA 3Q88A 2AS0A 1WSRA 4I0WB 3V8EA 3H1PA 4EZEA 2ENUA 1Z4KA 5LBTA 2GPYA 1IMOA 2P9CA 1L5HB 4MHOA 4B3BA 1VJDA 5KWSA 3EGIA 3PDUA 4AG3A 4QVIA 3M5WA 3I23A 3JTEA 4BWGA 3CWZA 4AK9A 3DDUA 3ND5A 1TZCA 1H66A 2W48A 4NONA 1UD2A 5F98A 4TQAA 3TOZA 3KVNA 2AEEA 1SCJA 2EOAA 4P3XA 4W99A 1A8PA 1DWOA 2FOLA 3ZH9B 4I4IA 3IUNA 3CMCO 3KELA 3L8YA 4W5WA 1S89A 2FPIA 1P3DA 2V4MA 4JKYA 1N2JA 1NW6A 1L7QA 2DTDA 3UAOA 4ZVNA 1E3WA 3BB4A 4FOSA 5EIWA 4QUAA 4PIVA 2BOVA 3T3DA 2HJWA 1Q0UA 5C1BA 4FYIA 4M6WA 1NUQA 4OHXA 4MS1B 3Q5DA 1NV8A 3T9EA 3KO8A 4AB1A 3EQ6A 2WFMA 4OJNA 4D9FA 3PHBE 1H94A 2PGXA 2RIPA 3Q12A 4EG1A 4MKFA 2PXHA 4XKVA 3DSRA 3U7QA 2HV9A 4Q82A 4DG5A 3GGJA 4EJMA 2NXNA 5GVRA 1Y1RA 5AWFC 3K6KA 3W8EA 4JS0A 4G0UA 2NUPA 3ANYB 4HDOB 1ADYA 1ZVMA 3BMOA 2A2ZA 2GBPA 1WQ4A 2UYOA 2ZR9A 4XWTA 1I14A 1EP3B 3A8IA 1TJYA 1RKQA 3GX1A 1AG9A 5LOVF 3GLUA 3FLBA 3MGKA 2GGSA 4KK4A 3A1CA 1QHHB 2AUTA 2PL3A 4L4ZA 3GLRA 1J0EA 1MP0A 4PZ0A 4RD1A 3E7XA 5IZ4A 2O8CA 7YASA 4M8IA 2OB1A 5ICSA 4GSKA 1NR7A 1R9MA 1SCDA 2YCLA 5B64A 5JXWA 3VNSA 4TVOA 2WIAA 3PJRA 3HL0A 3BWMA 4JITA 4W9NA 3B3QA 4RUKA 4OM8A 4IYJA 5LP6A 1PTJC 4R81A 5IWCA 3PLAE 2GARA 1F8XA 1L1QA 5F3RA 2W2OA 3J7TA 3UEOA 3GFBA 4RFSA 4MVWA 3FSRA 3JS5A 4QGGA 2ORWA 3CNLA 3WGGA 2ATCA 3AHEA 4GX5A 1QCCA 4OLBA 1MC4A 3IIMA 4F1JA 4M1MA 1K75A 3TIXB 4DJDC 4F4JA 5JCZA 3HVRA 1IK6A 3OJWA 4EO7A 1E89A 5BWOA 1THMA 2H2HA 1VPDA 2H9YA 2V6BA 2ZEJA 1B42A 2HBYA 3K0KA 1P44A 5IMSA 1FIUA 3DS8A 4F91B 1VQ9B 1EVEA 1WY5A 4S2UA 1YAHA 5IDWA 3E0QA 5C7LO 4GFDA 3ZU5A 5A3QA 2UVPB 2R00C 2J9GA 4MPTA 4EHAA 1V6SA 2A9VA 5JC1A 2CVFA 3R7WA 1RM5A 3RJTA 3PGMA 4BGUA 2HEGA 2CYBA 2P1ZA 4JZKA 2ODAA 5CAEB 3W1EA 2I1WA 5BYKA 4QOSA 4XIIA 4B7XA 3V34A 5JFGA 2KBFA 4BKRA 1NTRA 1RYBA 2QEXB 1N8KA 1TZ2A 2IYXA 3DC7A 3PV0A 2EGHA 4ND2A 1E79D 3GDWA 4OPSA 1A82A 2DG2A 1WPCA 2Z83A 5HCIA 5E6UA 4C01A 4NENB 3KLOA 3G2JA 1AN9A 5BRAA 2H2GA 4NTZA 1XQWA 2ZZEA 4C5AA 1LRJA 4X65B 2W4IA 5EJ4A 5FXMA 4R69A 2GMWA 4IJUA 1XWFA 2B1QA 5DRTA 2CVHA 1YS2X 2E0IA 1MAUA 3OOEA 4D6PA 2WIJA 2GKSA 2QTFA 3IAEA 4YRKA 1OKKA 1ZZEA 2NO9A 2UYQA 1XCMA 5EJ6A 3BGSA 1QQBA 3U09A 3FZGA 1RJEA 2Y05A 2GCGA 4ITUA 4J2OA 4KRFA 1WEKA 1LS6A 1HTTA 1ZIXA 2IEIA 1EVLA 1JFSA 5JZBA 4RVGA 2PGJA 1RE0A 5FUVA 1KHHA 3NS7A 5B5SA 1L5FA 1AMNA 1Z8NA 1WXHA 2ATVA 3GAAA 3IVXA 1GNQA 1ESCA 1ZN2A 4WA7A 2VF7A 4XGQA 2W58A 3O1LA 4NZMA 1V95A 3AZPA 2PR2A 4CV1A 8ATCA 2AQIA 3QVTA 1MO3A 1MJGA 3Q5GA 5DZSA 3O7MA 2RGUA 4Y2JA 1G2QA 4TSKA 4WESB 1O9HA 2GTHA 2H00A 1GITA 2ODQA 3U2QA 1PS8A 2PIDA 3K3PA 3CKLA 5AHXA 3TI9A 1J0CA 2XVXA 2P9HA 3R9XB 2FMTA 1II8A 2KQUA 3CC8A 3RT9A 1QX3A 5KBYA 1GA6A 1JR4A 4MPDA 5CT9A 1TA0A 1EVIA 4EDHA 2IFTA 2VDQB 1DC4A 3N86A 3H6HA 1W9MA 1O6ZA 3CZMA 2JK1A 4CG3A 4XB6B 5MDHA 4AN1A 4JENA 5I3CA 2XXJA 1I0ZA 1XZDA 4UNPA 5F12A 2P2DA 5J1TB 1P62B 2GHIA 4HSEA 3ZCRA 4B3TB 3HABA 2ZXEA 2JAHA 2Q8QA 2VLIA 4JI5B 5A9SB 3U4QA 1F0PA 1Y8QA 1CG6A 1I2AA 1LKZA 1EMDA 4O02B 1G3UA 4BKUA 4FYPA 2ZB7A 3CC4B 4YWHA 4JLBA 2H1HA 3Q9NA 5DYNA 2B61A 3ZWQA 3FOCA 2F3PA 2H16A 1MZPA 2AUMA 3K9LA 3PQDA 1CB0A 2ZRBA 3N8DA 2V7XA 3MM4A 1IY1A 1OFUA 1CD5A 2HA6A 3H65A 3U62A 1L1EA 4I5DA 3RC9A 4B5KA 2OV3A 1IBKB 4LF6B 2XOXA 5E3IA 4ZEOA 2HWUA 4QFDA 2KE5A 2OFWA 4RXTA 2XOEA 5DN9A 1SXIA 3DB1A 2NU8B 1JTFA 3GSIA 2PL5A 5EEHA 1DG1G 3K2QA 2CHGA 3KOZA 4D8XA 3NGLA 2PWZA 4L7QA 2BR3A 4EY4A 2VYVD 1P2DA 2MDTA 1FB5A 1O5IA 4G1UC 4Q37A 3ON5A 2A1UA 2G9QA 1QYRA 3JASA 1EK6A 2ZKIA 1BHSA 2WG0A 2OV1A 3NR2A 3MRVA 3GJXC 2GHRA 5ILGA 2IV7A 1GEEA 1W76A 3K2IA 4AZ0B 2E82A 1M2HA 4UUBA 4DC9A 3GCWA 4D96A 5JYDA 1D1SA 2BFFB 4TXNA 4WZBB 2CV2A 1OBHA 4WUTA 4GICA 3DT6A 2NUTA 4YJ3B 4KVAA 3VR5H 5KNCH 4B7ZA 2EW2A 1KFEB 3OCWA 4G0YA 3H3XA 4HFJA 3L01A 3FI0A 1E3QA 3K1TA 4GPZA 4R5HA 4RIIA 4ZAZA 3WZMA 1ODFA 4M0DA 1YRLA 5DIFA 5B7GA 3LDGA 3RAJA 1YFZA 1LLDA 3RIEA 4CGYA 1FJXA 5EG5A 3LPLA 4NMWA 1HYQA 1Z7GA 4FGZA 2Q99A 1E9BA 3CVOA 1JFRA 3A05A 4J16C 2OAQ1 3UXHA 1W36C 2JFYA 5IARA 4GX0A 2VR1A 3PDCA 3ZC3A 1IZ0A 3NHRA 2BKAA 1PGNA 1XTIA 2C92A 4LOLA 4DRYA 3EJ6A 3V46A 3L8CA 3W04A 1OBCA 1ITZA 4A8HA 4DLVA 3NEPX 1VZ2A 3B60A 1EFTA 1G1AA 4QWMA 4XOIA 5ESDA 1RVV1 1CR4A 4TMYA 4CMAA 1SCUA 4C21A 2PSJA 1SHUX 1SD1A 3L6OO 3OA2A 4RD2A 4Q9AA 1NMZA 5IUKC 3T9AA 3LS2A 3U39A 3VKFA 2VYCA 3RRBA 5IFLA 2FZGA 2N75A 2VQEB 1RFGE 4I55A 3ZDBA 1A9XB 4FFBB 2AIRA 2YZMA 3E20A 1L0BA 4BVLA 5FWYA 2VTBA 3U7FB 4KVGA 1T9HA 4P32A 1OLUA 4AZSA 4M8SA 2BVNA 1SMKA 2NGRA 3FPAA 3IPAA 2QT9A 3DZIA 3H5AA 1XTKA 1GG5A 1P4JA 1VJ0A 1DO8A 3QIVA 4M0KA 1XKXA 3GOQA 3VI4B 4AY6A 5CGQB 3CF6R 1BHO1 2Q2WA 1PCXA 2Q9CA 3LKZA 2UUCB 3ZWKA 1IN8A 3ID6C 4U8GA 3EUFA 2YN2A 1SR8A 4RZ3A 3VSBA 1MA3A 4GX2A 4Q9DA 1J20A 1LDBA 2VDPB 2BGJA 3V8BA 1D2RA 4I50B 3HU1A 1W88A 4FGSA 1FFGA 1HDIA 1Z6QA 4FQ7A 3GA7A 1WSVA 3OUTA 3CEHA 1G5HA 2Q29A 4FZ3A 4KQKA 5AQEA 3WADA 3PUZA 2A67A 3E0XA 4JODA 5FOVA 3SVLA 4YYEA 1AQIA 3KXLA 3P4XA 2R7AA 4IHJB 2OM6A 4KYTA 4KPFC 3HJGA 4FDMA 3REGA 1M1ZA 1XD8A 3A3GA 2NUAB 2F64A 1RU3A 4DR4B 4A0RA 1IMJA 1Y0YA 3ESZA 3WGUA 4RHUA 4J9UE 2X14A 3TDNA 1C3OA 3O1IC 3TAUA 5LUBA 4G6IA 2QIPA 2V74B 3II6X 1UJCA 3EGXA 3QNMA 1Q1AA 1YDMA 4P98A 4QPCA 3SDSA 3UW3A 3WWZA 2GBCA 5ADWA 1R0XA 2D2VA 3HXKA 4GOJA 2AX4A 2J8ZA 3DEZA 3FRJA 3D8TA 4Q19A 4GOXA 4REMA 3CW8X 2VEOA 3BZUA 4NNPA 2R62A 5REQA 3ER9A 3U44B 2XV1A 1N5KA 1NL3A 3FOAA 3AM3A 1JUDA 1KO4A 2FF5A 1VIMA 1D1QA 3D1LA 3PSAA 1RLMA 4KQGA 2ZVQX 4OU4A 5EAIA 1TT5B 3RNOA 5BN3B 5K4GA 1R8JA 2FPKA 5HQ3A 3UB4A 3OD1A 3CC7B 3OIFA 2DU8A 3OJFA 4W8GA 1I5RA 1K4KA 1J2RA 4XDGA 3U1VA 5K45A 3FCUB 3BWCA 3PXGA 3TGLA 1IWOA 2A0XA 4GZMA 4L22A 4A8TA 3T9FA 2C29D 5TQ2A 1YUMA 1LPNA 4JLVA 3N2YA 2G9VA 4IWXA 1LJLA 2DM6A 2R1VB 5G0WA 5C4IA 5I7HA 3RHZA 3JD3A 4R16A 2W5UA 1XTPA 2EC5A 3O1HB 5ESRA 3RRZA 4RY2A 4P36A 2GM3A 1VLQA 1KKMA 3ZWCA 3KPWA 2F1LA 4X7MA 3ASQA 2FMHA 4L7VA 4Q9JA 4BPRA 3S0JA 3GYGA 1G8FA 2QVCA 3TMYA 3EF3A 3EVGA 3HZRA 5K0LA 5E3HA 1EQUA 5JS7A 3NU1A 1P2TA 3DBHB 2OK7A 4TKLA 2RKWA 1NNLA 2A92A 4YC7A 1W85B 2BSAA 2GWRA 4X95A 1NZDA 2ERCA 5EZYB 3VTAA 1OKKD 3KYBA 4I4LA 5CFLA 2VJBA 1VRWA 4LRYA 4Q21A 5IYNA 2QR2A 3KTFA 1CC1S 3N74A 3DHWC 4XDHA 5D87A 3QOFA 3OETA 4WK4B 3DZCA 2AW5A 5FNZA 2VA9A 4JC5A 4ZHQF 3IEXA 2YBEA 1X1EA 3O83A 4BNVA 4BVKA 5HW0A 3UWMA 3AVQA 1G19A 4Z7QB 1O9BA 1EWYA 3DTNA 1I7SB 3IODA 1WM1A 1XXHB 3JD1A 4N3BA 4TVSA 1U2DA 4QREA 4PAGA 4DRZA 1W2BB 1BGVA 3FGNA 1FRVA 3C6ZA 2GBLC 1E77A 2RBEA 3AEKB 1ZRNA 5C9ZA 1QIHA 1M75A 3I76A 1OAAA 1V9CA 1IG0A 3RIMA 3R5JA 2AOTB 4MB6A 2J4FA 3Q3VA 1RHJA 5E0KB 4G5GA 3CSSA 2NPIA 4XWGA 4Y2VA 3VVBA 1KQSB 4UM7A 1GN8A 3OEED 3IAHA 2XB9A 3FDZA 1NW5A 5IULC 1JL3A 5AUQA 4D25A 3OLYA 1W6UA 1M6VB 2AXEA 2KM1A 3E6AA 3L7BA 1Q22A 4NFLA 5EWLA 1VJ5A 4S2EA 2D0IA 3W7BA 3F74A 1T3HA 3CGGA 2PT9A 3K73O 2M6LA 4LNAA 5LWQA 2RE8A 8ADHA 1MXFA 5EEGA 2NSYA 1VMIA 2BGNA 4RJ2A 4XQEA 4QGSA 3HM9A 4D0SA 4J0QA 4XGKA 3VI3B 1AXRA 1GZDA 2PL1A 4D8UA 3LFTA 4E70A 5DHRA 1E9AA 1L5HA 3R7AA 2OCBA 3JQ9A 2IEDA 5KYTA 2WVAA 4D99A 3P0RA 3WHPA 1TO1E 3GRYA 4JHXA 4J7CA 1XTVA 3G2PA 3WYNA 4ZU1X 4CV2A 3C39A 4DV2B 2X4LA 4IMJB 1FMLA 3U5TA 3T5MA 4W8HA 4EFMA 1Z28A 3L2OB 3ESCA 3UCXA 1PR2A 1UUFA 2ODPA 4AJEA 4HVTA 1X8LA 1UAGA 4BN0A 2L19A 2G4LA 1DDIA 2Z8XA 3QLVA 3BWVA 1Z12A 2VCYA 4I36A 3QFRA 2JHAA 4GQNA 1L4GA 2NUBA 3LC2O 2B2NA 3WBFA 3CCQB 2BMAA 4G1CA 3T52A 4MVYA 4DC1A 1JLMA 1E2FA 4IF4A 3BTVA 2Z08A 4P0TA 5CFMA 4ER7A 1DQZA 5JZSA 1E3IA 3K70D 2VNJA 3KWMA 1WEHA 4HAVA 1I4TD 4MS1A 5CJPA 4KMOA 3DJYA 2FW7A 1VYTA 3WK5A 1JBKA 5K3BA 1K5GA 2JIZA 1EA5A 1JMYA 1LW6E 1RI2A 2BD0A 5TRDA 1E2KA 2EERA 2F3TA 3C6YA 3F2VA 3INRA 2Q0SA 3L4BC 4MVJA 1TAHA 5AOCA 1YKGA 1BXKA 5CT4A 4E5YA 3OQVA 1J09A 3BILA 2J9ZB 4WNYA 4E7PA 1ZAYA 2EF1A 3OW2B 4AW9A 1T0PA 4BMSA 1WORA 3CEAA 3JW8A 5CXSA 5DLEA 4DDMA 1RKUA 2C3UA 4HUQA 1RZVA 1G98A 3GFTA 1QHHA 121PA 2NTNA 1NU6A 4F72A 3HXQA 4P6YA 1GKKA 3IT0A 1TI7A 5CLJA 1RAHA 3CO0S 2D1YA 3HUFA 2OUKA 5DS0A 3SCZA 3T5AA 1BWRA 1JE1A 1WD7A 1PZHA 3H9JA 1X92A 2AG8A 3HN6A 4JL8A 4PW0A 4S1OA 3ZLJA 4ZZ2A 4N47A 5ES4B 1H85A 1SC3A 4LCBA 1W5AA 5DNAA 3TINA 5ULLA 5HP4A 1HC7A 3Q85A 4DIFA 2RGNA 3AR8A 5A6VA 5L46A 1N0VC 4DUYB 3QX3A 3O8QA 2ONZA 3ILHA 1E1YA 1LPOA 3O4JA 3RU7A 4B8ZA 4C0AC 4JFRA 5AUNB 2OHJA 1UK9A 2IDZA 3CTPA 3D4IA 4KN6A 4PSCA 2AFIE 5LOVB 3MJ4A 1IZ9A 3JQ7B 2B3DA 1XIVA 5CVCA 5FOXA 1RXCA 3M3HA 1EFPB 5SZIA 1QVWA 3DCYA 1EGAA 4B5LA 1EFRA 1MN6A 3R5XA 4IXDA 1LNSA 4KZKA 2GZSA 5M3BA 1JDVA 2XDQB 1DG9A 2WVGA 4Y1EA 1K5PA 1PE0A 1ZDMA 9ABPA 3WWOA 4O3MA 1DKOA 2QRNA 4PRKA 4EVQA 2D62A 1W4BA 2H52A 1Z74A 1JVNA 2GAAA 3S28A 2VFAA 3BXFA 2Z30A 2UVPA 4ZVQA 1V3QE 3T38A 4D9NA 3KX2A 2VDLB 2X6QA 2JGFA 5FOUA 3RSZA 3WA6A 4EI2A 5CAEA 1WSAA 3P20A 1K06A 1XZHA 2JFBA 1TRKA 2ZROA 4DV7B 5B6IA 2AG0A 1QP8A 2QSYA 3HKDB 3ZCPA 4ZN6A 2PNFA 3QVSA 2UZ4A 2E18A 3PPXA 4ZDWA 2W70A 1JFVA 3QYFA 4LZLA 4D3XA 4PAQA 4DB4A 5JH7F 4LJLA 3JY6A 2QYOA 5JHHB 3HRIA 1KVRA 2Q5JA 2PRSA 2Q3LA 3O84A 3FWKA 4NENA 3G2QA 1XZPA 4J4BA 3INTA 4RMGA 2V3CC 4LDZA 4QWWA 1KE2A 4E31A 1ZD3A 2H1VA 3SQDA 3EF0A 5A4AA 4AUKA 2FEXA 4M55A 4PLYA 2EZ9A 1W30A 1I9GA 1WLSA 1PNVA 2UZ1B 1N6HA 2H4JA 1E18A 3ACBA 3AHHA 2I4TA 4KDFA 4LRTB 4NBLA 3O8RA 1JSZA 3LVFO 2Z56A 4L08A 3I9KA 2CEKA 5F7ZA 4DL9A 1YI2B 3TVYA 3KZXA 3PUWA 3AJAA 1NVFA 2QHXA 3QKTA 2D7JA 1YB6A 1G64A 1Y37A 2HA2A 3C16C 1AHIA 3G5AA 1A76A 1T6ZA 3JYQA 3EBOA 3CBQA 3NT5A 1TCAA 5KTMA 3X1XA 3IQGX 2LPMA 4G86A 1XTQA 2E9SA 4O2LA 4UW9A 4CYMA 1IN4A 4TXJA 3UCFA 4X6LA 1FEZA 4IH4A 1A27A 4RZ2A 2CV1A 4RM0A 3KLMX 4MQ4A 1ECFA 2B99A 5GV8A 4MVJP 4UM5A 4UMDA 2LV8A 4A9AA 3O2JA 2WAOA 3R4CA 3LCUA 5DISB 1XKQA 2QN6A 1KEPA 4X8HA 1MTOA 2PVSA 3R6JA 2JIPA 4RJLA 2BTQB 2JFGA 3OZFA 3FETA 2IPXA 2X0RA 3R4VA 4B2YA 2PX8A 1IEXA 2OG2A 1TEXA 5HKAA 3KHKA 1U4OA 2II6A 2QVGA 5CB6A 3P71T 3TPFA 3A3YA 1Q7GA 1WPGA 3N2KB 1ORDA 4BTEA 2MSDB 4AJLA 1SY7A 3O0DA 1F9EA 2HC9A 4FFMA 3TLMA 1ZW6A 4JJZA 4TZKA 5JSZA 1JH8A 4RK7A 4QYIB 1BXGA 1Y3DE 3N8NA 2ORED 4XARA 3ZBQA 4EF6A 1AHNA 2Q8PA 2WHRA 3HZHA 1P7ZA 3ESDA 3EC7A 4KOAA 5E1OA 2P9GA 5A9SA 4D3ZA 1WP4A 1YK0A 2VZ8A 3M49A 1KFCB 1WW3A 3LSTA 3C3KA 4G0QA 4B2LA 2P6OA 1AUVA 4RPBA 1TMYA 3NM6B 1F4PA 2GHTA 4U2BA 4UE6A 2GF0A 3LC7O 3SVTA 2FU5C 1OAOC 3LPAA 4RGBA 3T3MB 3PYLA 2DWPA 4JU9A 4JSRA 2M2IA 4UXJA 3A25A 4LHWA 1ADBA 4IEIA 1HPLA 3V8VA 4FGUA 1YRYE 1X42A 5AJUA 5IBCA 4QNMA 1AHHA 1GNVA 2NU8A 4BASA 4FX5A 2EARA 2BKXA 3EH1A 3R76A 3TW8A 3KEFA 3I39X 2KX7A 4UCQA 4CUKA 5C5EA 4DQVA 4N0PA 4F9FA 1Z26A 4QOJA 4RK1A 1WIWA 3IDSA 4OD0A 2VK1A 1U7UA 2ZTVA 2FZVA 1LBTA 3CG0A 1VHJA 1KK3A 1GRNA 1PZMA 1USWA 1VE9A 2A9RA 3TLKA 5K03A 4AZ0A 1NSYA 2FUKA 2VAXA 2FA9A 4J75A 4UFPA 1VPEA 2CC2A 4YAKA 2BFFA 3NASA 1IJEA 3WSVA 3WLTA 2CMGA 3HLYA 2C95A 1JX6A 3WGKA 1P3JA 4Z4IA 3RUPA 2ZE6A 3R0IA 1BFKA 3AF5A 3AP3A 3GRAA 4S35A 4FUQA 1Y1PA 3UO8B 4N9WA 2C31A 3ZHZA 3ML1A 4BZZA 1K66A 3Q0EA 5FFNA 1JZSA 2NXJA 1XCPA 1OB2A 2C83A 2CNBA 4MB0A 3RYIA 1FTSA 4UOZA 4WN9B 2VOEA 1JG7A 1S5PA 3TNDA 5IYWA 3RJZA 5JY6A 3PWZA 4ZCQA 2VUHB 5AKEA 1JJVA 2NWQA 4PG5A 2OILA 1F5NA 1A9SA 4CG2A 2VJJA 3CB4A 1JDBB 1NW9B 3A8KA 2YZNA 1I2ZA 3E3AA 5E38A 5EKUA 1IAQA 3GOHA 4YMWA 5AXAA 1EXNA 4AL4A 4C76A 2V6FA 1KS9A 2FF7A 4FCCA 5D5QA 5J4VA 2YS7A 5HIAA 5E6SB 2HFKA 1FMJA 5LU8A 4MJXA 4H4DA 2FK8A 4FFBA 4YR7A 1SUIA 2JIZD 4FFVA 5EJEA 1TZMA 4B3XA 1CR2A 3GJ7A 4NMMA 2YJNA 4MVJD 2R87A 1WB5A 3EEIA 4QATA 4AY3A 5B12A 5BV2P 4RDLA 1O9GA 1HZEA 4MUJA 2CCKA 2FCAA 1YI1A 1B2LA 2HMVA 2LNDA 3MWDB 3PEFA 4ZO4A 1AKYA 2Z98A 2LXNA 2H57A 4NCKA 4X3PA 3TUZC 1P1FA 1Z83A 3TJRA 5C8YB 1EDBA 4A7PA 5AVYA 5KDDA 1RIFA 1FUKA 3IMEA 4GM4A 1PTKA 2NO0A 5F1PA 2EWMA 5DXAA 2PWYA 3KHSA 1ZRHA 3WWPA 3BAFA 4LFBB 3DOOA 3F6RA 1XLVA 1PQYA 2RBGA 3G71B 4KIWA 4OL0A 3TKYA 2Z4RA 2PIAA 4AVYA 4BEVA 1NM5A 4N18A 1OXXK 3W2IA 2RHMA 2DETA 3F3YA 4XPZA 4Y6PA 2AHRA 3DD1A 3WICA 4AXXA 3SM3A 2CUNA 5IYZA 2X58A 2D0PB 3VNRA 2OVBA 3I04M 3TMAA 1TRHA 1NBWB 2O2SA 2V03A 4GR4A 3CW2A 2I4RA 2OWEA 3UAVA 4JI6B 4LFCB 1DBPA 2JFXA 2WUEA 1VJGA 1TKAA 2I3DA 2VP9A 3K0BA 3ZWAA 3SDBA 4DLBA 3P7MA 1U9IC 1XA0A 1ZUHA 1UFVA 4HWGA 4IZIA 4DQUA 1KI7A 2F1OA 4WOJA 2D00A 3UT5A 2J0VA 2OCLA 4UM9B 3NHSA 3ZXYA 4ZZ3A 3MWGA 5KOHA 4WBNF 1P9LA 3IP9A 4I2VA 3BGVA 4P8RA 2ICAA 2QORA 4HNTA 2X5JO 5TRTA 3IUJA 3QHQA 3P1JA 4C5BA 1ZLYA 1UH5A 4CETA 3ZWMA 1AUPA 2PYDA 3RSSA 2R4UA 4PXSA 3U44A 5SICE 1E9CA 1SEPA 2H85A 2JW5A 3HCWA 3LHSA 3NYQA 3ZU6A 3G2NA 4YJ2F 5BN3A 4FPXA 4BAZA 1TT5A 1Y8RB 3GWGA 5LQSA 2VIIA 5EVJA 4H7HA 4RVCA 2C98A 4JP2A 1VQNB 3AI1A 3AYZB 4HNAB 4I9FA 5E8RA 2R8YA 5FNVF 5LKAA 4FNOA 3FCAA 2YYSA 1ZLXA 3Q8XB 5CA0F 3LA6A 2TMYA 3AFHA 3KYIB 2Q7DA 4DCUA 4I1IA 1UBLS 3F73A 3O95A 1XDGA 3FN4A 4WUVA 4R0NA 1R9JA 1CP3A 4AG5A 3GJZA 2XMSA 2OFOA 4XSVA 2EFHB 1E1DA 2HO4A 2O4CA 3AEXA 3PPVA 2G6TA 4J1QA 3DO6A 4GQIA 3DPUA 4JSTA 5E4FA 3F5SA 3HB7A 4H6PA 5TVKA 4H17A 2I6FA 2VPXA 1KF0A 4PZDA 5KYGA 1V35A 4WJLA 2H63A 4TN5A 4CLHA 3DBHA 1WLYA 4YAGA 3P9RA 4KXLA 4DNPA 3ASPA 3C8HA 3TW0A 1AQUA 4LQCA 2MR6A 2PV0A 4NQRA 5EZYA 1DJOA 3TXYA 3UH0A 3YASA 1QE5A 5JS2A 4BS9A 1KS2A 2OCKA 3OJOA 4FMDF 4MI6A 2SICE 4JJKA 5FI5A 1QU2A 3ER6A 2D06A 1WX1A 4KWHA 4DMFA 3Q6QA 1TIKA 2DR3A 4G4IA 1UBSB 4HZIA 3ZJ5A 4E4TA 4F6RA 5A5EA 1O6BA 1M2EA 2QG9A 3DULA 2F7SA 4BLWA 3DAGA 3WRVA 1SFRA 4MRNA 4UXIA 1YU9A 1GQYA 3KE8A 3CX6A 3FYUC 3DT8A 4FDVA 3LF2A 4GPIB 3UWOA 2E55A 2WIFA 1DBRA 3NVAA 5D8DA 3IXMA 5KVCA 1E60A 4MDEA 3WJ1A 3A9RA 1PWEA 1QRAA 3AEKA 3SJZA 4TKMA 5D5HA 5KWJA 1TM2A 4UC0A 2GPWA 3BN3A 5IC6A 3R5HA 4BXOA 3H6KA 1KXJA 3QNUA 4ZV7A 3V9PA 1C3EA 2OD2A 5IABA 4BGVA 1KVUA 1CUIA 4FHZA 3PPIA 3JYPA 1GQFA 2OHOA 4DMKA 2IA5A 4YAFA 4R1OA 5D01A 4D43A 5CVTA 1U8UA 3MT8A 3OBIA 3KSAC 5MGNA 1CZHA 1ZNWA 2O2IA 1XE1A 2FFBA 3KJHA 3STWA 1UF9A 4ABTA 3TD2A 1M6VA 3L0SA 3E70C 4JXKA 1B6SA 2I8CA 4HRXA 1FNMA 1P0PA 2MHCA 1UZNA 3P32A 5ITZB 2Q21A 5HR5A 1DT5A 1E9RA 4I6GA 4RNCA 4WFIA 3UJPA 4HNUA 3FUWA 3HADA 5IZCC 1A5ZA 3LXUX 3OEHA 5F4JA 3HO8A 2WHQA 3L46A 1KL7A 2J87A 4CV3A 1QHNA 2P27A 1WMSA 2PSSA 3R09A 4PTZA 1PQUA 2HBQA 2JGEA 4OHKA 1FDRA 5L3RA 3F7NA 4ZOQI 5FLEX 3STUA 4M0FA 2XBUA 4RDHA 3OCYA 2GM5A 3GNQA 4P81A 1BA2A 1N25A 2P35A 1HI9A 1A69A 2Y9MB 2JAOA 4DYHA 4EYSA 4F97A 2CFTA 4IRUB 1O94A 1P9OA 4QDOA 4WHMA 1Z6XA 4I9HA 5KYNA 3JV7A 4KGVA 2EEZA 5IN5A 1H9CA 3PFGA 1JI0A 4UFOA 1A7UA 5DH9A 4CQJA 2BF4A 4OQMA 1ISPA 1TM4E 1ZVKA 1Y1TA 3TB6A 1RACA 2VHEA 1C1XA 3IAFA 1KO7A 4YO7A 5L40A 3CMMA 1VRVA 3QHAA 4NR0A 3ZPXA 1AHPA 2CFRA 3GPDG 4GZLA 4M0MA 1EGHA 1AB5A 1RZUA 4D81A 4P83A 2W42A 2NYUA 3OTHA 1T2AA 1LK0A 3QKIA 1CQJB 3AFOA 3UKOA 1VIDA 4KCGA 4S04A 1FNCA 1KEZA 1GT91 4WIAA 4JBGA 1T9KA 5FIUA 1R0SA 2G0NA 2X4DA 3NI2A 4H1TA 3SSNA 3IV7A 3K5WA 4OHPA 3SDZA 4F8YA 1N6PA 2OHFA 3GIDA 3TO5A 3KXKA 1D4OA 1VCMA 3NBQA 4Q1EA 2H2FA 1R4ZA 1Y7HA 5FBQB 4UTZA 2FX2A 2F2TA 1TA9A 1Y6QA 1XZFA 3MAGA 1OGIA 1OWNA 1XMSA 3HNPA 3PNSA 2HMUA 4IG9A 1K7YA 4OXIA 4UDXX 4WZ6A 5H16A 1RSZA 1JT9A 5IKEA 1V2GA 3TZEA 3H11A 1XKTA 1Y3IA 2WWHA 2J09A 1YZTA 2JZNA 1QHGA 3NTVA 5KQPA 3EZ9A 1V4NA 3U4IA 2HMYB 3G68A 1NGSA 5IJWA 2IYYA 1QIEA 4F4HA 1EHYA 1MRZA 3TOXA 4BN5A 3DVQX 3MERA 4KFUA 1FNDA 5LOVA 4WZBE 4F6CA 3JQ7A 2C7OA 1C3LA 3E2PA 4CUZA 4CQMA 2I80A 1EFPA 1GNPA 3ZG6A 4UUNA 4RPGA 1RE1A 2PEZA 4JQZA 2XDQA 1YMQA 2VATA 1M73E 3IBSA 2ZR0A 1G8GA 1UXKA 1UXHA 1Z17A 4CM7A 2ZR7A 2CUZA 4H7IA 4BV9A 1CFJA 4E5SA 4EECA 3TR6A 2WUGA 2HA5A 1YNSA 2E3JA 2O06A 2J6HA 1Q7TA 4MQ6A 1JA0A 2VJNA 3NC0C 1NXQA 4TTJA 2XT9A 5F7JA 4KV7A 2OBYA 4ZVRA 1EUYA 4KO3S 3SBOA 1E2DA 5LA6F 1F6BA 5B30A 1KORA 2QVYX 4GGOA 5A06A 4J0EA 1L9KA 3MGCA 5M2QA 1UT6A 2DUMA 1U3CA 1XRMA 3FHCB 3G6WA 5F9MA 1TQ6A 4UVEA 5EKDA 3HKDA 1YQXA 3TFOA 4LSWA 4QOGA 4ATNA 5J3JA 3CR3C 3DHYA 4ZO6A 3OZGA 2O8BB 3VKGA 1JXOA 2X3FA 2XH8A 4ZYLA 1OXUA 5HUJA 2HMSA 4MI9A 3WGIA 2HHAA 1FDUA 2IE0A 4W8OA 1HYBA 1IEWA 1N6RA 1JEDA 3NJ8A 1CYDA 4NFSA 2FRXA 4YJKA 4LJ8A 1IH8A 3E9ZA 3U6BA 2WIKA 1QC5A 1CZUA 1I36A 5DHPA 4ZRMA 2OV2A 2IUEA 4TYQA 1C2TA 4ARVA 5LQRA 4LYFA 1T0IA 4UAGA 1KQ3A 5BWCA 4LI3X 5IYRA 1QAMA 3H0KA 4ALMA 3MZ0A 4CN9A 4KITB 3SHFA 2WQ7A 3TN7A 1YJXA 4LRSB 4P92A 4JKOA 3B1XA 4FJ2A 4HDKB 5JH7B 3T1TA 3AW8A 4M8NE 4Q3KA 1KH2A 4LA4A 3JU3A 2W6CX 1RWKA 2VWGA 2WZBA 4BCBA 4Z3KA 1SB8A 1TCBA 1F4VA 1OB5A 2G1UA 3E58A 3IE2A 4XQ9A 4BO7A 4TN1A 3MJCA 2DUWA 2DPYA 1S3SA 1X70A 1ZNXA 2P8SA 2YXNA 1VKJA 2V3WA 4PZAA 2D5AA 2MSCB 2XADA 5AJXA 4E2XA 3D4PA 1RI3A 5CNJA 2DB3A 3EMBA 2IYFA 1XDWA 1HDOA 1MF7A 2XKJE 2CWWA 3UPTA 1JB1A 5AKYA 3BKXA 2BTQA 3DTYA 4XJXA 2CFOA 4J0CA 2FQ1A 5KVVA 3K9QO 3SZLA 3ED5A 3LQ4A 1K08A 2AVDA 4X00A 1JIIA 1C8LA 3VGJA 3VYSB 4HPXB 1PJTA 4WZZA 1M1KD 1VE5A 1FOEB 4XIJA 1DDGA 2LR0A 3B1WA 3DDYA 3I45A 3ZIDA 1NAIA 1OC2A 2Y4OA 1JJIA 3IIJA 4DANA 3KQKA 5BWNA 4QYIA 5B4TA 4UBKA 1RCTE 1QOZA 4NJEB 1IXYA 1Z47A 4YGYA 1JEQB 3RVMA 3VDQA 4F04A 1S4MA 1T8UA 3M6VA 1S9HA 2EFGA 4H0CA 4YUAA 1DHTA 1JG1A 1K73D 2NZYA 1KR5A 1C7EA 4Q1VA 3PIDA 1AZTA 1ECBA 2JJ1D 4EPWA 1RYFA 5FYQA 3T41A 4W9MC 1ZWLA 1WUKS 1XYYA 3B2QA 5NLLA 4DA0A 4OQFA 5AM3A 2YFQA 5L53A 1V43A 1V45E 1QH8A 1RYHA 2A9FA 1T8PA 4ND4A 3K9CA 5GJWC 5G0SA 4JYCA 4U00A 4U0KA 4L8JA 3IKTA 4ALJA 3RQSA 1O87A 5FT9A 3KKMA 3MTGA 1JVBA 3V3TA 3K9NA 5LZ7A 2AX3A 1RBZA 3F2IA 4IDCA 3WLJA 3P9CA 3QIAA 4ZOBA 3I5AA 2AZ4A 1LVUA 1YQDA 3GJSA 5CH3A 1CUAA 1CWUA 5HKKA 1E0DA 1Q7RA 4KJZA 1QRSA 2WQ6A 4ETIA 3WFIA 2LZ0A 5IK2A 3AOEA 4QTZA 3RAPR 4OH1A 3ZZMA 4ENRA 5FHRA 2OYNA 2WWYA 3VO8A 4YT2A 1UBNA 2R8BA 2OM2A 2ANCA 2O2XA 1T4MA 1SCQA 1DS6A 2UDPA 3VOSA 1DGQA 1J8FA 4YFVA 4ZO9A 3LYUA 1COZA 1BO6A 4LXYA 1R88A 4FZRA 1ZI6A 2F3SA 4HB3A 3VO9A 2BKEA 3FYSA 4RMJA 2OB2A 4PU0A 2ZW9A 5EL0A 3B85A 2CYAA 3B3FA 3OU2A 2QU8A 4CI9A 4DCMA 2UZIR 3QG1A 3D8BA 1XZIA 3G2KA 5FA5A 5DSZA 4X7DA 3N3BC 4WN9A 4YASA 1XXHE 5A4JA 3IHLA 1YGYA 2P77A 3ZHYA 1JSLA 1QIJA 3ZY4A 2OE2A 4ZQBA 2OTCA 2W6IA 3WNBA 2QYSA 3FUTA 4HN4B 3K09A 1H0RA 1UM9B 2NZUG 3KTOA 2G0AA 3M6XA 1LDMA 2X4GA 4TXHA 3DEIA 1TLLA 1W5TA 4HV4A 4Q7MB 2XMPA 2J6BA 4QTTB 3QUTA 2HSWA 4DR7B 2AE1A 3DMTC 1OI2A 3JQEA 4L0DA 3CX8A 5K0GA 4B7CA 2O5EA 2GBGA 3R7NA 2YMMA 3GZNB 4HYTA 1KO5A 1K63A 2X13A 2GLXA 3NMUF 3W6NA 3QOYA 5IKMA 3RIXA 1H6BA 2PEYA 4RF5A 4Y2UA 3RS2A 1MXHA 3MN1A 3UMYA 1Z5VA 2GNPA 1HQYE 2QE7D 4CF7A 4X61A 1TUIA 3MWDA 2Y1XA 3CTAA 1VHLA 1BHJA 4PIPA 4CIBA 3NHPA 5AXCA 1S8AA 4DM7A 3HI4A 3RREA 2EWVA 5COQA 5CHYA 2QP4A 5CCXA 5KOYA 1GRCA 2ST1A 2Q6KA 3F4BA 3GJ3A 2FZEA 1BDIA 2GRJA 1ZIOA 1PJ8A 3QVUA 1B1CA 4GMXA 4G6ZA 2HV8A 4F11A 3DCIA 2OBLA 2V5VA 3W2HA 3ESRA 3H97A 3JZFA 3T54A 6NULA 5M29A 4LZWA 2ISCA 5K0FA 1R66A 1LPSA 3TSCA 3ZV6A 4RJTA 5CVUA 1FS4A 3NEYA 3PC4A 1P0CA 3WQRA 3UAYA 4B7AA 1XA4A 4HYQA 3L4KA 4P7JA 3LOQA 2QOEA 1KBZA 3G5MA 4V03A 4LXQA 2IJGX 4YCMA 1AO0A 1F0KA 3WAGA 3NHBA 3ONFA 3THYB 2QN2A 5BW6B 4XTCS 1KTIA 3K32