5FORA

Cryptic tir
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
131
Chain Sequence
GCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQILTHRLGPEASFSAEDLSLFLSTRCVVVLLSAELVQHFHPSLLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1
publication title Structure of the Toll/Interleukin-1 Receptor (TIR) Domain of the B-cell Adaptor That Links Phosphoinositide Metabolism with the Negative Regulation of the Toll-like Receptor (TLR) Signalosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 41
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18567 TIR_3 Toll/interleukin-1 receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 5forA00
4C6RA 4C6TB 1FYWA 2Y92A 5KU7A 3JRNA 4LQCA 5FORA 2J67A 2M1XA 1T3GA 4LZPA 4DOMA 1FYXA 4LQDA 4W8GA 4FZ5A 3UB3A 4C6TA 4EO7A 4C7MA 3H16A 3UB4A 1FYVA 3OZIA 4OM7A 4W8HA 1O77A 2Z5VA 5H3CA 4C6SA 2JS7A 3UB2A
chains in the Genus database with same CATH superfamily
3GLHA 3DWIA 3EAGA 2J85A 3ANYB 4Q4DA 4ZGWA 4WK2B 2I99A 3PUYA 4QGAA 3PA8A 2WW8A 1U2RA 4PS1A 1DGQA 2AC4A 4J43A 5AT1A 2WC1A 4K6MA 4UMVA 3E27A 4FUQA 4NFLA 3KO8A 3ENQA 2PVCA 3PXXA 3W1VA 3PWSA 3TRFA 1MFPA 5I9IA 2G63A 5ICEA 2UYQA 3CXUA 3TW0A 3T3DA 3M6LA 3ZV4A 3MMNA 3MXOA 1E9FA 3NI2A 4QQRA 1UXJA 1NIJA 4QBFA 2BTOA 2CKMA 3H97A 5DSZA 5GP1A 2WHPA 3DMTA 1DC8A 2M98A 5JMPA 3FW1A 3R76A 4GNKA 3MBKA 1PWEA 2VJKA 2CWWA 5CXXA 2YRWA 2F8TA 1BO6A 1L1RA 5IC6A 3FMOB 3B9PA 2FPKA 3TBFA 1G1MA 3WSVA 4JROA 2XVXA 3U09A 4KAXA 1HORA 4V38A 2EARA 1PEYA 2Q5IA 5CT6A 4ZT3A 2BKVA 2VRWA 3EDOA 3PGMA 4HXEB 4LXGA 1Q95A 3VX4A 1THMA 3E3OA 2IXGA 5JO9A 5KC8A 1EFKA 1YR9A 4ZOLB 3DTVB 3ZDRA 1F0PA 3LH5A 3ZJ4A 1IM8A 1SVIA 5DM1A 3WDSA 2NO4A 3SQXA 3BC1A 4OQMA 1L4MA 2V6MA 3C1AA 1IU9A 1SCAA 3B85A 3AVUA 3FCOA 2VF8A 2IU3A 2V97A 4B75A 4DR6B 4JI5B 1KYVA 1TTPB 1UF9A 4A6DA 2ZS9A 4F7DA 4EKEA 1JFRA 1P17A 1XVTA 4LSMA 3U3XA 3I73A 4E30A 5C8VA 3QVTA 1IIBA 4EIWA 4JUCA 2I2WA 1DCKA 4DABA 5ADVA 2X4IA 1ODIA 3C8HA 5DWVA 1X14A 1HDCA 1CR0A 4HDCA 3S2YA 2XSZD 3REQB 1A27A 1NN0A 2DLDA 3F90A 4PZAA 3UTDA 5CDFE 5JISA 3CLTD 1WLSA 4HMPA 2OE2A 2GBIA 2H6EA 2OD2A 4TTSA 5ED0A 1MRNA 3RU9A 4A9AA 1Y8QA 2GERA 4HNUA 2XQIA 2JFHA 5JFOA 2YIJA 4X62B 4M9RA 3QEAZ 1B0UA 3RQIA 2XUQA 5U1PA 1XKLA 3U4GA 4KI7A 3QPDA 1KWGA 2QLJA 1GCUA 4DCUA 2H59A 5K0NA 3FB4A 5FYQA 5KSYA 3GYBA 3AJRA 2PUAA 1JDVA 4ND8A 2CCKA 3FNEA 4RDHA 5CNIA 3VVBA 3D9QX 1U4SA 2K5UA 4UEOA 2COEA 3OY7A 4I19A 4HVCA 5KYYB 3ONNA 1XTQA 1FMCA 4R01A 4BJ1A 3R8FA 3ADKA 3H2YA 5AIBA 1K6MA 2P2ZA 4LFAB 5LB4A 3RSSA 4A73A 1VKJA 4KV7A 3RVOA 3F78A 2B3DA 2P5UA 2WM2A 1FJHA 1QIFA 4REMA 4QUHA 3A04A 5BN4B 3ZDZB 5TVGA 4LZOA 4N0MA 1ZICA 3LQFA 3WWZA 3IV9A 1Z5WA 3F9RA 5C7LO 4R3NA 3T1NA 3A27A 2AXNA 1S2OA 1DIHA 1VSBA 3BSYA 3G2QA 3SYMA 1O8CA 2JFZA 1ZXLA 4GMXA 4X7MA 1M10A 1GYPA 3AM3A 1JIQA 4U5XA 5CCBA 4QECA 3UANA 2BM9A 1KRWA 2GXQA 2ZWVA 4N7RA 4JLOA 1JEQA 1NBAA 4IMJB 3TOXA 1WBJB 2WPDA 4ME6A 3COWA 4G2TA 2AG6A 1VRWA 4YJKA 3TKLA 3WRXA 4NDNE 2IV2X 1U7UA 2ZI9A 1W0KD 2I65A 5TB5A 2X8WA 4JNKA 1MNAA 1W47A 1SK8A 3GY0A 3JWHA 5EJIA 1F5SA 1NQTA 3WO1A 4HX5A 2HL6A 1CP3A 2RHDA 1P18A 2WM3A 3FJYA 4D6YA 1S2LA 4TYQA 1J6UA 4F2WA 4D4GA 2EFCB 2OK8A 3O21A 1Q1AA 1MVNA 1TZJA 1XTRA 1QKKA 5CDUA 1KO5A 3H1GA 3JVDA 1C7EA 3INGA 2O3UA 4ZAWA 3DV0B 1O9HA 2Q6OA 3PDWA 5BSUA 4AZ3B 3C41J 4ENSA 2GVDC 1BU8A 3HUFA 4RKRA 3UH0A 1DMSA 2UZ1A 4CDNA 1PX2A 1AO0A 1CR6A 3G7SA 2W00A 3MN1A 4NZNA 4IKOA 4S1PA 1ZBDA 1QCYA 3KQVA 2A5YB 4YAUA 1P4SA 1HDXA 5E4JA 1SXHA 5ALJA 5FXMA 1GAJA 5LCXA 4G0OA 3VBCA 2IBSA 4U6SA 1JLHA 4UVEA 4QQKA 2I87A 2C97A 3RHFA 4BNDA 4EHFA 1Z2OX 4K81B 3UUFA 2OBNA 3WVNA 5HKBA 4DSOA 4EITA 1NKTA 4UARA 2EBUA 1XFDA 2H1IA 2Y1EA 7MDHA 1HE5A 1ZP6A 4YBRA 3UIEA 1DRWA 2HCRA 3GHHA 4KWIA 1RI2A 2M6SA 4TTQA 4WNIA 2CXTA 4QO8A 5FI1B 3TDKA 4B73A 5CB4F 4DR5B 4JEIA 1VL0A 1ISGA 1KNQA 4QWMA 5F33A 5LM3A 4B3HA 2IXEA 3VZCA 6AT1A 1YZVA 1GQYA 3MIIA 3TK1A 2RKBA 3MYRA 1YTUA 4NZZA 3OU6A 4PV7A 2ENWA 1OIWA 1NLYA 4KYIB 2ZEJA 1CIPA 2ZWAA 3T3NA 4MUKA 4PYNA 2PV0A 3BRCA 2CLSA 4FZ5A 4POAA 3L41A 3UWPA 1DCTA 1DEAA 1ZK1A 2ZVPX 5B1HA 1GTSA 3OJ0A 4R3WA 3K53A 2G1JA 2PLRA 5EWLB 4QIHA 4DCOA 1UBOS 4O6VA 1KTIA 4AYTA 5TQ2B 2RGGA 1ZSYA 1X15A 1U04A 2EKZA 2P7HA 1RWWA 1XHFA 4YV1A 4DJTA 1FDIA 3IKVA 4YX9A 1JQDA 3L6BA 4RS4A 4S24A 3OUTA 3N86A 1K75A 5FI5A 1KH3A 2RARA 3IKJA 3KYDA 3PDCA 3KR1A 5F51A 5FJIA 4KQFA 1OZHA 4FS8A 1CE8A 4MJ3A 9GPBA 4DBLE 1UK7A 3DFZA 1TM4E 4ZO4A 1APBA 1EUCB 4K9KA 5FWXA 4AZVA 1RAEA 1ZNXA 5FWYA 5J4VA 4H60A 1NLFA 3P2MA 2X22A 4FYWA 2ZCUA 1CUAA 4I1OA 3A1SA 2YZGA 2O19A 3AEZA 5D01A 5D2CA 3VR0A 3Q9UA 2ZRKA 2PKQP 3AG5A 3EFEA 2YC4C 1U7TA 3MAGA 2PMFA 1M75A 4PCLA 2IDZA 4MJLA 3DDZX 1SEPA 3D1VA 4D8YA 4CF3A 3KJHA 1AGNA 4FFLA 1LBIA 1U8FO 2HA6A 4RBNA 3S8EA 3Q8LA 2PXXA 2K87A 1EK2A 5KWSA 2YYZA 1AUPA 1BW9B 5ALFA 1ZVQA 3PA6A 4U4AA 2OKCA 2Q3EA 4ERNA 3FMVA 2C0PA 1PQWA 2R8RA 4MPRA 1ZEJA 1W76A 1OX6A 2AJTA 2QPLA 1M1YE 2ZATA 4NYIQ 2E5WA 1CFJA 1TI7A 1E60A 3COPA 4RADA 1E1RD 4UEWA 2ZSFA 4G1MB 4LJYA 2VSYA 2QVXX 2QN9A 2VVTA 2FFAA 5FHQA 4DUGD 3QMPA 5FBRB 4DNXA 3Q88A 2FOIA 2YWHA 4XQ9A 2YXPX 5IWAB 3PEEA 1D8AA 1Z68A 4LPSA 4OGFA 1U28C 2Y1CA 4XTRA 4X8OA 3PYXA 1P9NA 2BZSA 2VS1A 4Z3DA 2IHZA 3DOOA 4OQ4A 4NY1A 3L1IA 4QFMA 4RIEA 4MDFA 4V0NA 3G2OA 4IIBA 5BSTA 3CM0A 2JCGA 2FY8A 4YP1A 4DCNA 4BRWA 3RJZA 1TA4A 3H99A 4TVSA 5LYJB 3GPLA 3LOPA 4J4BA 4UJ3A 2X4GA 3OLVA 2EEPA 3WMGA 3PUXA 3KOWA 5CG1A 3AP2A 2A33A 2G4CA 2PBZA 3ILHA 1G59A 3BCRA 1P0CA 4ED9A 4IXMA 1R10A 1IZ0A 3E81A 4MB2A 1W46A 4EG0A 5LQAA 5H3CA 221PA 1ZWKA 2GCNA 1FX0B 2H3EA 3FMPB 1RJDA 1LV7A 2DETA 1X19A 2XUDA 5EP1A 4QARA 4FFRA 3C2QA 3SLKA 3WV4A 1KAMA 1Y5RA 2VZLA 4U6QA 2ICAA 2CXRA 4IDOA 3ZHUA 1T5IA 2JH8A 1AURA 2P90A 4JR2A 1EQAA 1LDNA 1NF8A 5EHXA 1V0JA 2BBWA 2O06A 4FCCA 4I08A 1A2BA 1S8NA 2FH5B 2X1MA 3M9XA 3EOBI 4Q7JB 2I8LA 4Z9XA 2J08A 3E1SA 5GIOE 1I5OA 4DCPA 1NPYA 1Z88A 4C3ZA 3OQBA 2PFGA 2XCUA 4PZCA 1ZGGA 4IDPA 3SXPA 2EW1A 3M9LA 2F2TA 4EHHA 2FI1A 2JLXA 1E8NA 1ZR2A 1T4DA 5ECYA 2G36A 5GPBA 2VJQA 4A5OA 2G83A 2NVUB 1L8OA 4KJXA 1TIKA 2GJAA 3HWSA 5JMTA 4YCAA 2DWUA 2J7PA 1FDTA 1V1MA 2IS1A 1LBHA 1QO0A 5CDFA 1W5EA 4XM1A 2ZS7A 2AR0A 5KYTA 2WILA 4HNGA 5AKJA 1B6TA 1Q20A 2BBTA 4UUMA 5FWDA 5KJ1A 5KYGA 2O8FB 2DSTA 5A05A 3DZCA 5CP8A 5KBYA 3AUFA 5H0IA 4EB6B 1PD0A 2KSQA 3LW7A 4F97A 4FZVA 4TV8A 4B6JA 1FYVA 2Y66A 4B3GA 2WSIA 4KODA 3JYOA 4NEQA 1W0KA 1VB3A 2BKAA 1C14A 3BMCB 3GRPA 5DBIA 4ZT6A 2XRYA 1EA7A 3UXMA 4COOA 5A5GA 4PF1A 3UMCA 2B4TO 1X42A 4CQLB 2IELA 3H42B 1RYYA 7AT1A 4OQEA 3WLIA 5HOQA 1GAXA 4UXJA 5CBPB 2HR1A 1B8NA 1XJ5A 1WKBA 4DMCA 3H5IA 2ZCJA 1OPRA 4GI5A 4H1VA 4QJBA 3K92A 1R0WA 4UUPA 5ER6A 4JVLA 4BLQA 3ADCA 5F12A 1DKPA 1DKLA 3I28A 1F3OA 4AULA 2BFAA 4CRWB 4OSOA 1UJ6A 3VVCA 3NOXA 2ZYAA 1L3CA 1SQSA 4DWVA 4L9SA 2BGLA 1IN7A 2ZT8A 5G0SA 4ZI7B 2CV1A 2VTBA 3B1KA 1J06A 1A4XA 2WIKA 3K0SA 2P40A 2BI8A 2OD7A 3U49A 1D0SA 3A6GA 1RTTA 3EGDA 2Q4BA 3KOOA 4LJKA 5BQPA 1RXIA 3ZWPA 4AAYA 1U11A 4PYJA 1NPTO 3MS2A 5TDHA 1QKIA 1V11B 2I80A 4BNTA 2JZNA 4QXRA 1QG4A 4TVBA 2G76A 1QCCA 4XD2A 2I66A 5FORA 3IILA 4JVMA 2AYYA 2FEKA 4HR7A 3RKUA 5AESA 2BAGA 5TGTA 2DERA 2RB5A 2PSDA 2C1ZA 2WP8J 3KQMA 1P75A 3RUDA 1OY1A 2FMKA 3OIVA 1XU9A 3BA1A 2R68A 2X0RA 4UFOA 3KR0A 2WWTA 3FNGA 4N7MA 3P9QA 5D84A 4YJ3A 3DFFA 3D8SA 3EEYA 4N0QA 3RVNA 3LHFA 3KQQA 4W9NA 6Q21A 2F4VB 1XZGA 2P3QA 3KKNA 4KPUB 4DQLA 3PQ3A 1O96A 3HY4A 2GPNA 1M1UA 4FN4A 5D7NA 1BU5A 1MO3A 1ESNA 1NZFA 3RUAA 1SZJG 3IQFA 2RB4A 3BXPA 4HTAA 4J1QA 5MGNA 2XLCA 1AT1A 3Q1LA 3VNRA 4AN0A 1LI7A 3T35A 1I4LD 1KDRA 3RVKA 2VR1A 1K66A 2YY5A 4IY1A 5DHSA 1CJKC 1V48A 1N2EA 2A35A 4BWFB 1POXA 2ZQZA 3ADBA 2PEZA 3PQ7A 5JNVA 1GFWA 2BR5A 3V8EA 4MITA 4RLSA 3WOVA 3M2TA 3N2NA 1YUNA 2WF6A 4X20B 3LT4A 5IM4A 3SF0A 3OSUA 4N82A 1JSZA 4UNRA 3TUJC 3I3OA 3HVRA 3V33A 4DEVA 4NYJR 3NOOA 1FJGB 1UM9B 1LPSA 4DYVA 1Y5LA 1TXGA 4AC9A 2JGJA 1XP8A 4Y2JA 3G0GA 3FHJA 4JOCA 3VKGA 5CLFA 2BF4A 1X1AA 2BN4A 2CFTA 1I0ZA 2BHTA 3KVYA 3UJDA 5HZMA 1BDJA 1ADYA 3ZWYA 3CF2A 5ITWA 4KU4A 3H5RA 1RMTA 3IBFA 5JJKA 3KKOA 3M6VA 3CRNA 3SKYA 1AD2A 1PK9A 5TJHA 2UZIR 4CBVA 4L9WA 4YRAA 5DBFA 3TL2A 3G0BA 1KQPA 2C29D 4W5TA 1RJEA 2C5EA 2OGZA 1M7BA 1XD2B 1G5FA 1NYRA 3E9NA 4EUHA 3EX7C 4J90A 2V6JA 3ZS9A 4M87A 4M3NA 1IZ8A 1Y9JA 2PX6A 2ZDQA 4MYRA 3EZYA 4RSHA 2GLXA 3N59A 1ZL2A 4YIKA 1DWUA 3ODPA 1ZD1A 1Q7CA 1NVVQ 3SM3A 4FE4A 4Y6SA 2JJQA 1H0HA 1JSLA 3E8MA 1E1RA 2ZSUA 2VDKB 1QYCA 1NSFA 2EFHB 1UKEA 4BPRA 5KJFA 3AOGA 4JLWA 1NQAO 2JATA 4DUGA 1D4AA 3GYGA 1MPTA 2G09A 4Q15A 1LNSA 4EDFA 3U1VA 1LPBB 1G60A 1E2FA 421PA 1OU0A 3GA5A 3WLMA 4G5QA 2PE5A 3BTSA 3D6MA 3P0RA 5G2OA 5ICSA 1Q2UA 3SSAA 4EY6A 5HJ2A 4EEZA 2P4SA 3AHIA 4Q1EA 1DC5A 3CWQA 1I10A 2XWSA 5K3AA 4ASUD 2IPOA 2I6FA 4L5YA 1D0IA 3RS2A 4MRNA 3T3GA 2MDTA 1S8AA 4XEHA 4Y9SA 4DIDA 1UUFA 5BVHA 5IDYA 3ESQA 5M29A 4MVJF 1ANKA 4QLAA 1V25A 1WCV1 2E3JA 3D0KA 1RC0A 3RC2A 2EWVA 2HHJA 4K26A 3WLPA 1QPGA 4DMUB 1EG7A 2JBAA 1P6UA 2DB3A 2ZRNA 1NOKA 4GRDA 4L1KA 1XK7A 3TDNA 1Z5GA 4PCUA 1I4DD 1TC2A 4Q00A 3NNSA 1W88A 2DE0X 1M1YA 4GYWA 3V1TC 4GZ5A 5IKEA 3IHKA 1XMXA 4RQBA 5CB4A 4YDQA 2NVOA 1P7WA 2BEVA 1G3IA 1M6WA 1NJFA 1R9NA 2LVBA 5CLHA 1PEKE 1BA2A 1NR1A 3RREA 2WNHA 3O8OB 4NZPA 5E3HA 5ITZA 1GZ3A 3UUGA 4B80A 1WW2A 3MTEA 1YXMA 1RCFA 2X41A 2CLKB 4PZYA 5HRAA 1COWD 1JIKA 1JNYA 1OI4A 3TUIC 4RAQA 5HDQA 5KTPA 4ZEXA 1WG8A 1Z34A 2YJ6A 3AR8A 4GKAA 4OHFA 4EF4A 3D2CA 5NLLA 1PZHA 1HNNA 2JGDB 3DBLB 3BD7A 3M3PA 2IH2A 2IVFA 4GBJA 1PS8A 2QTVB 2Z6VA 3IAUA 3QU7A 3O7WA 3ZWKA 3DONA 1TZKA 3K7EA 4PAMA 5B2ZA 2RGYA 1HH4A 3A9CA 2QRKA 1IE3A 4LHYA 4OBBA 2GGSA 5EPUA 4EGAA 1UK8A 5AVYA 5AVKA 1KDVA 2HSWA 2JIPA 3GEPA 4EEXA 1S3FA 2AFIE 2XYQA 5BNTA 1S5PA 4XDYA 1S0UA 3QMMA 3VC7A 5ILOA 1GQ2A 4JU8A 2JHCA 3QMVA 1USGA 4CIVA 1FE8A 4HWSA 1L7VC 2HT1A 4KI0A 4YPFA 2D5AA 3VAYA 1Y4SA 2G9ZA 1KKLA 4E3ZA 1CJBA 3PC6A 1OH8A 5L3SB 4XI9A 3EZNA 2QS9A 2CEKA 5JTUA 3IAXA 1D6NA 1D6MA 3E1GA 4G07A 4L4SA 3JSAA 3D5TA 1OR8A 1Y6RA 4DRXB 4JYPA 1X9HA 2A4MA 4GLJA 3A6DA 4TROA 2JANA 4UBIA 4V03A 5GONB 3M1IA 1A9XA 2CMHA 2CJYA 2D00A 3A9RA 2GB4A 4MVJE 4O02B 4RTMA 3M4ZA 1SD5A 3GJ5A 3HBAA 5JHHB 3U7GA 1M6EX 1PIWA 1BFDA 2R3SA 2WA1A 2I3GA 2PVSA 4B85A 5ILQA 3MNFA 5DRYA 1BCSA 2V7EA 2ZTLA 3E0XA 3WY9A 2IHBA 4LJ8A 1J20A 5I7RA 2QMUA 3BREA 2ZJ4A 3PCXA 1EP3B 3GUUA 1GKKA 4FZRA 1L5LA 3H8SA 5DLQC 4V0QA 1QB8A 3EW9A 4M53A 2GPWA 4PX3A 4R1TA 1WXDA 4IX9A 2B8TA 4M46A 3QLVC 1P6QA 2QP9X 4OMCA 2RAVA 1N9GB 2NQ8A 4IDCA 2NSLA 1N0HA 1UJ2A 1AHHA 3U7RA 3F47A 1H3FA 4UCQA 4B35A 5KNDH 4KNVA 2A57A 4NABA 4WLVA 3U4QA 3QVMA 3KOYA 1KMHA 4IIGA 1H66A 1VRVA 3EY9A 4HWPA 3ZZTA 2B0CA 2Z57A 2ZI6A 2PA0A 3NAMA 4CMAA 2ERYA 1O77A 2NTEA 2OL4A 3HKBB 2B8JA 3WLRA 3CZAA 1GDHA 3CZMA 3K94A 1A69A 1W85A 1RLUA 2X6RA 3ND9A 3E3NA 4Q1CA 4TV9B 4KGVA 2XBMA 1A7AA 2ORYA 3OZAA 4V0ME 1FY2A 4CM4B 2O9JA 2PZBA 4O8CA 3ZTTA 3UPUA 3UWOA 1N8TA 3KHSA 4LQCA 3RTDA 3ZLBA 2YIDA 2BF7A 2J41A 2JC3A 5KQSA 2PD3A 3WGIA 1A9RA 2Z5FA 3OX4A 2PUCA 2YMMA 5BUSA 3T9AA 1TKCA 1A95A 4WNAA 5KWVA 3KTOA 1RRFA 3ADOA 4RJLA 3G9ZA 4GICA 4M76B 4MQEA 1EXVA 1U5CA 2CDNA 3MUEA 4OXYA 1XJWA 1H0SA 4EX7A 4IJKA 3NM4A 4LOLA 1ZMXA 1M8PA 3FBTA 3K1TA 1JHMA 1IATA 2JLSA 2E6UX 3AYXB 2H1VA 4J3NA 1BGWA 1KSFX 3T4XA 3RYHB 4BMOB 1RZRD 3KXLA 1Z2CA 4CR6A 2F9MA 1XDSA 1XNHA 4OHBA 4R1LA 3D3WA 2DT8A 1X1EA 4D9BA 3UGJA 1CQPA 3MQ2A 3E5NA 2QDXA 3LL7A 4R1MA 3I4CA 4PR0A 3UJ9A 3ZV6A 1QAOA 1ZO8A 2PKYX 4C04A 4M1KA 4JYZA 1UAAA 2WVGA 5CMLA 4AQYB 2OZLA 2BONA 4AX8A 3OM1A 4BQSA 4CKCB 1XLTC 2ZYWX 2JAPA 4UULA 4UUQA 1DKRA 3IHTA 3IALA 5CCDA 3K70D 2GPSA 2X13A 2ZYHA 2PMDA 4GE3A 4A82A 2WJAA 1Q91A 1ZFNA 3LPDA 5GQSA 1XHLA 1QS0B 4Z9FA 5JNWA 2YH2A 3OOHA 3LCCA 3DCYA 4DR4B 5AKHA 4IS3A 1BX3A 3FZQA 4EUKA 1U8AA 4LWQA 2PD4A 2YFKA 2ZDHA 1V8ZA 5AMXA 3SQNA 1SURA 3I2IA 4NCJA 2QEQA 2YOGA 2BFBB 3OICA 4EHDA 4F60A 2QV0A 4M55A 5DFAA 3OHPA 4CGYA 5L3VA 4QC2A 2XGOA 3PXDA 3KQHA 2LE0A 2M1ZA 1ZMBA 3KB8A 4DA7A 3IRUA 2DR3A 2GKOA 3MK31 1E92A 2P9TA 1KJWA 3FWYA 5AKYA 1TB4A 4JLAA 3DAYA 3PPYA 1AK1A 2FOXA 2NOAA 3DXXA 4JQOA 4ASUA 1YOVB 1W2HA 3K6SB 3WYNA 1J99A 1JQJC 3GX1A 3LO5A 5KYWB 4ZQHA 2PCJA 1GO2A 1JG6A 3IEUA 4AL4A 2XMPA 2PBRA 1KAGA 4RHEA 4D4JA 4TYYA 2JD2A 1URPA 5PNTA 2ZB7A 1T1RA 4NENA 3ETCA 1J0XO 4AJ4A 3PNKA 5I4IA 1E1DA 3D1JA 4EI7A 3GDFA 1TPYA 1E32A 2R8OA 1NRWA 1GGMA 2EFGA 4R7TA 4OFWA 1L5FA 1KYXA 3LBYA 4GKVA 3Q8MA 3EOAI 4FR0A 2H0AA 1C9DB 2B4QA 1H93A 3O4JA 1CUCA 1A4RA 1JJVA 3E1KA 4XJSA 3GLHB 5C2JB 1VPTA 2GYWA 1FQOA 3A1VA 3CO0S 3N5CA 3CF0A 4S1WA 4Q12A 4RPJA 4CUJA 4GPAA 4HJXA 2ZVJA 4BU0A 2NMVA 2JLAA 1O5IA 5ER9A 4YACA 5FOSA 1C7FA 3IP1A 5GV7A 1NC1A 3WZLA 1W59A 4HNTA 3NT2A 1G9XA 3CEMA 5JH7F 5LZ4A 4P5DA 1WVMA 3A2MA 3T38A 4BVKA 3D43A 4YAIA 4RD0A 1NPDA 3DP9A 2DPLA 3G7UA 1UOEA 2G9QA 2ATVA 3I8SA 2VYNA 1Z6YA 3BGDA 2ONCA 4TUYA 2NO1A 2DR0A 2OV2A 2GI4A 1J56A 4RK0A 4RJIA 1LRJA 1X6VA 2WHPB 2FPPA 2P2GA 3F9CA 5D8DA 3HXLA 5TGZA 4HUTA 1XZMA 3RK1A 1YE8A 3DLAA 1YGYA 3CF4G 4XSGA 5FWNA 2WAOA 1CQIA 1KPHA 3CHYA 3QG5A 3T6KA 1BZYA 1BCRA 1W30A 1TVMA 2ZYTX 2QRZA 5BWCA 3S81A 3LDFA 2WHEA 3L8FA 4EMSA 3CONA 3KKLA 4HPXB 4MGKR 2RDMA 4K8OA 5EYPA 4BTEA 3LKBA 1CDEA 1P19A 4OH1A 2OM6A 2XNDA 3ETNA 1WOMA 4GI7A 2R00C 4IDDA 5GZ6A 2EGHA 2QW1A 5BOVA 3ZBTA 5J40A 1SHJA 3UMYA 4G63A 2ARKA 1VG8A 3UKJA 3U62A 3ESRA 4M9XA 4DMLA 5LQRA 4IHAA 1TL7C 2DX7A 3BWCA 4FLFA 2HSEA 4JLSA 4BC1A 2EJUA 1B15A 1T34A 2W6CX 4Z7NB 2CCGA 5HGXA 1LB1B 4V0LA 5ALXA 5ENDA 3WDKA 2VEDA 3JASA 3QLEA 1YU9A 4V0RA 3N53A 4F5WA 3IJPA 1N36B 3A4VA 5LDHA 2C9CA 2HSGA 1E7QA 3G02A 4F38A 3V4ZA 3RRZA 1I8TA 1BH2A 1TQ2A 3LLVA 4LYYA 2CHUA 2Y1XA 3DZDA 5CT8A 3SE0A 4DMGA 1GA6A 3FYUA 4J8PA 4HNRA 2BTEA 1CULC 4ENRA 1KO4A 3AHGA 4WT7A 2EERA 1Y8QB 3ROKA 2D7JA 3PNLA 3EBOA 1C0LA 1ORDA 3BFVA 1SIOA 1NJ1A 1XZFA 1S9DA 2EFDB 3CBGA 3FHOA 1DWPA 5FFNA 1SU8A 3CFYA 3OP1A 4FE3A 1J0BA 2TMDA 1G21E 2OHXA 5F7OA 1YHZA 3LYAA 2EVWX 2QAGB 4ND8B 4Y9DA 4KHZA 4YP9A 4YV2A 5C46F 1ID8A 4HX9A 3QG1A 5DNAA 5ESXA 3O8LA 1PDVA 4NU0A 5DN9A 5B55A 3LTNC 2O0JA 3I2FA 3WV5A 2FAXA 1SUWA 1BVUA 1JI0A 4ZHQF 4CIAA 1FJXA 5EP2A 2GN0A 5G41A 1RVV1 3T0GA 2IZ1A 1I36A 2OCYC 4JLVA 4MV8A 3UT6A 3WGOA 3Q15C 5DW3A 2QG6A 2QENA 3USES 1DIBA 4YBZA 1L7MA 2WIBA 2AX4A 2CF6A 4PIVA 1BQ4A 1RLOA 3A14A 1QTNA 2Q5CA 3L84A 1QYXA 1Z4OA 4HAOA 4P1ZA 1VL6A 2A0FA 4FFNA 4IDEA 4AB1A 2R7KA 4DLUA 2IPXA 3HMQA 3QU5A 3ZGXA 2I7XA 5CDHA 2GXUA 3Q10A 1JEQB 4QTTB 4GKJB 4K87A 1JDBB 3DCJA 1I7PA 4NIMA 1YFLA 2W2NA 2EJVA 1VC2A 2G6TA 5CLJA 2Q6IA 3RGWS 1JIVA 3ZWAA 3NYRA 3F3YA 2V7QA 3OFND 1H4QA 1QOQB 3TR6A 4L02A 6ABPA 3LSTA 5G1OA 2BR4A 3CUUA 5D3QA 3UK0A 4GU5A 4K1LA 5DHQA 2ODQA 3L18A 3ZDDA 1X2BA 3IMGA 3L0IB 1GKLA 2HRDA 4QDXA 2WR8A 3TIVA 2I3ZA 3J7AC 4C7OA 4N49A 3QNWA 3UAWA 1J0CA 4RVUA 2UZ1B 4V0MA 5IDXA 1J5PA 3VGJA 2QROA 2QAGC 3QUTA 4YYEA 2Y2UA 2WV7A 1XWIA 3H5OA 3IPLA 2VDWA 1CFZA 2VHZA 3NAQA 4N39A 4AJOA 4KWTA 1QYIA 1O89A 3Q7QA 4CPDA 3NHKA 4RJ2A 4BNDB 1RABA 4L74A 2J09A 3U26A 4RVSA 1PNRA 4Y9UA 4FMDF 5B2EA 3WSWA 1RMYA 3ZCPA 4WTOA 4OAQA 1YQDA 2O5RA 2MU1A 3I04M 1QFYA 4FFBA 4MV9A 1JDPA 3WLAA 2YCBA 5FUXA 2VP3A 4PX2A 1K08A 3O2NA 2CJPA 4R2XA 4WE3A 2VCYA 1R0XA 3EJWA 4FSXA 2ZT6A 3TKYA 1BIFA 1BN6A 1JZQA 2PH3A 3FXAA 5JXGA 2ZYDA 3HBJA 1P4AA 1FNNA 1NF2A 1W87A 4FYKA 3WLFA 1T8TA 3K0AA 1E3WA 3BH6A 2ZAIA 5DK6A 3GFVA 4MS4A 5KVAA 2VP9A 1PYGA 1YRLA 3BWVA 2Q6KA 3L7IA 1G9TA 1PL0A 2P91A 4FEAA 3T0IA 3IXLA 1N7HA 1OSNA 3RSQA 3IUMA 5HXAA 1DG1G 2AMFA 1TJYA 5YASA 4DSZA 2O7SA 3KVOA 4D97A 2PZEA 3HE3A 5AI6A 1X7WA 2AOTA 1SMKA 3QTTA 2ZJZA 1EJ0A 3H1BA 3ZY5A 2QM3A 2OXFA 4L4ZA 2I4RA 3KYDB 1P2GA 3OHMA 1AS0A 4DLWA 4OM7A 3TXXA 3GP8A 2BFCA 3QPWA 4HRVA 4UBLA 4UFPA 1EWKA 1WJGA 3PNQA 5IMBA 1N9KA 1OWLA 5E7QA 5JWHA 4P2GA 4C2AA 4FSDA 4Y9RA 2HF7A 2ZIFA 1E5XA 3E6AA 1RM3A 5FWXB 4L0CA 2KX7A 4BKOA 1KO1A 4RW0A 5I7HA 3B53X 1R5NA 2XCRB 4WAUA 4NAVA 1ZGAA 3EF1A 1H4VB 3O7MA 1BE1A 4K3UA 2X2EA 3KALA 4WMLA 3SI7A 1ZZGA 4E2WA 3VPAA 2I2DA 2ZYIA 1A1SA 3WXBA 1TEXA 4LF9B 1DAIA 1AA6A 1RPJA 2XWJI 4F4HA 1ISIA 1IIRA 4PO1A 3KQKA 1E2KA 1FK8A 5E0OA 3T5DA 3ZBQA 3HDGA 1Z17A 2QL6A 4MUEA 4OJNA 4DUZB 4AMGA 1XMSA 1X9IA 4HB3A 4WKBA 1QUFA 1N5IA 2PU5A 2HV8A 2IIVA 2HMUA 2NG1A 3ES9A 3UHOA 1N77A 1IPHA 4IYJA 2J5QA 3ENKA 5DU2A 1WW3A 3KNZA 3ISTA 1B16A 1JLMA 2QTBA 2JLYA 4L6CA 3C5CA 5FBHA 5IT9A 2OCBA 4QULA 1YIAA 4OHRA 4IRUB 2QHXA 2H54A 4I6EA 5AM0A 3G8YA 1S7CA 1F2VA 1PZEA 2H92A 5JAUA 1D6JA 2NU7A 1SQ0A 1NATA 3OT4A 4ZQCB 1XROA 3PIIA 4Z53A 3L8GA 1C0PA 4WCVA 3QX7A 2QRPA 1PSWA 2QTAA 4AG3A 1DDOA 1KH1A 1WTAA 4Q3BA 1M1ZA 3UAVA 2H1OA 4LF6B 4K6KA 1L7NA 5KHAA 2C57A 5EE0A 3N1UA 3GUYA 1RZ3A 2WJJA 5FQOA 5JSKA 4RLQA 3UNXA 3GMTA 1G6Q1 4ANFA 4IMRA 4NPHA 1ZQ9A 2Y99A 2MSNA 5H83A 1W9HA 5DNYB 1E9EA 1G6HA 1RKQA 2MSKA 4DSAA 2XRZA 2GHQA 2MYTA 4PC6A 1VP9A 1UKAA 4L51A 3LGXA 1YA6A 5BURA 3Q5EA 2LUOA 3TZBA 3L1UA 1YA4A 3ANSA 1FX1A 1WMDA 1U4NA 2GUGA 4U9UA 3GUCA 5EFZA 5B3LA 4PU0A 1KJJA 2AK2A 1C7QA 3PGLA 3WMRA 2I3AA 4HGPA 3AONB 3F1LA 3LNCA 3C8ZA 1AGRA 4FHGA 1F2TA 3EG9A 1P2VA 4MZXA 3H16A 1XA0A 3BMXA 2QSYA 1E94E 3GA7A 3LT0A 4ENVA 4ZTZB 1R18A 4D3FA 2XCTB 4EGQA 5EGNA 4C7XA 2ODWA 2VDPB 1UOQA 2XUPA 1XQ9A 4TXNA 2ST1A 3I34X 1UZNA 3LZ6A 4RD3A 3DNFA 2KQUA 1WM1A 2IEGA 4O2BF 5CEEA 1W1WA 3N2KA 4AP6A 1ILEA 5FO0A 3P9SA 4LFCB 3GJTA 2OBFA 1G8SA 3ZPXA 1ODLA 1KS2A 4TLCA 2RAPA 4HQ0A 3T7IA 3V7WA 4C20A 3FLMA 4GKKB 2WU3A 1NVAA 1KA9H 3LUAA 4PLTA 2I1WA 1KKMA 4WOJA 2C58A 1SVWA 3OE1A 3HWX1 2FK7A 2F3UA 5FULA 4P7KA 1MP0A 1UK6A 5DSXA 4NCNA 2VH2A 3WYEA 4LRUA 3QWHA 1M0TA 3K0CA 4WLNA 4R7ZA 4RVDA 3QFFA 4LYHA 4CTJA 3R5XA 1P7PA 1MBZA 3HV2A 3OZGA 3QBDA 4DCGA 1HEUA 1L9XA 2B4RO 3DBHA 4II2A 4F6RA 2MYUA 4JEMA 1VJ0A 3EGOA 4QU8A 1Y4AE 2G0TA 3KKQA 2A92A 3MC1A 3MUFA 4OV6B 2JA1A 3Q3CA 2ID4A 5AK4A 1RHMA 1XNQB 2WIDA 1K27A 3H1PA 2BI7A 3JRNA 1V43A 2HFJA 2JDIA 4IWYA 4YUVA 2BWJA 4YTEA 2B4KA 3K9CA 1DEHA 2HSDA 5BMVF 1PL8A 3TM4A 1UJBA 2AOXA 2B35A 4AF7A 4DA0A 3W5IA 4PC2A 3UXEA 2PV7A 3NEPX 5JH7A 1H05A 1JA0A 2QYSA 2V98A 2Q07A 3K1AA 1PV2A 4M1SA 4NX2A 4M8LA 3S7TA 3EEOA 2YBDA 2EZ9A 3IDQA 3W9SA 3ZE2B 1UIMA 3JQ9C 1CF9A 1OU4A 2VT6A 1VTKA 4I4LA 3GFSA 3T7EA 5CCEA 3O3NB 1UQTA 1JKIA 2Q8QA 3OJWA 3WGTA 4EKNB 2CWDA 1AO3A 4QFCA 3LXRA 2NYVA 3AHCA 2O50A 1VA5A 3ORQA 4L6AA 4W5WA 1MW9X 4B17A 1GT91 2B25A 2XH8A 4OP3A 1XZEA 2Q8NA 1K8YB 4D2IA 2NSDA 1HE2A 1GXSA 2OESA 2P41A 1JA9A 3DEJA 3HMKA 3P9KA 1IWPB 2E4XA 5HCIA 1JNXX 3RLIA 3VVMA 5I7OA 4M0FA 2VTBB 3G13A 1BEZA 4QXOA 1NMXA 1N1MA 1J09A 1XQYA 2H5JA 3EUEA 3FCEA 3EGDB 5L7WA 2V3CC 1N33B 4Y2XA 1E2UA 3WHLA 5BMOA 1KDZA 4MR9A 2EF1A 2CV2A 3WXMA 4DL9A 3GJ4A 5I9MA 2Z2YA 4P84A 3TNFA 1CY6A 1YJ8A 3NG1A 4NI5A 3NVAA 3VZPA 1ZNZA 5GOZA 2B1IA 1X87A 3CH6A 4Z3KA 4JYCA 1L5WA 3B7WA 5AM1A 3K4HA 3FNQA 3KHUA 2Q9UA 1P4GA 1DADA 3EGEA 3OWXA 4EA9A 1R0SA 1O95C 3M49A 5IUNC 5K8LA 2K2WA 4TL7A 2PUFA 5CVJA 2XLBA 2R62A 4EW1A 1ZGJA 4OQDA 1GPJA 3IAM1 2VSOA 4UEQA 1O96B 4KVAA 1ID1A 3KEFA 2ZRAA 3BRSA 5TT0A 2CFIA 3FBWA 3OUZA 1M2FA 1YO6A 4CR8A 3RFCA 4L22A 1ZC3A 5EZ5A 2ZRHA 5JJ5A 3PXGA 3V3TA 2BZGA 5FWAA 2FW9A 3K9BA 1KP2A 1IUOA 3SYLA 2FR8A 3ZCTA 3S1AA 3NGLA 1FRNA 3HYTA 2PSHA 1KZ9A 2V7UA 4HF7A 2B0JA 4U7FA 1ZLXA 1GTVA 3K9QO 2XQJA 1L4EA 3AF5A 1DC3A 3PVSA 4FVTA 4BYMA 1A71A 4OJKA 5AHWA 4EOGA 2JIBA 2R7LA 4M9CA 2D54A 1QGOA 4KWHA 4ZHQA 3FHTA 1TYDE 3ZGOA 2A9KA 5EUQB 2ZIZA 2JHFA 1I13A 1UBLS 2PUTA 2R1VA 3AX6A 4J49A 4JX9A 4C89A 3T3IA 2JEYA 3H0CA 1N92A 4LQ4A 4E13A 5JT1A 4H4CA 1TM2A 5DGHA 4ZRDA 2H1RA 2GCOA 1LS1A 1DJOA 1NE7A 2DLNA 4FIDA 5JPCA 4MO2A 1YMVA 3ZD7A 2VEOA 1CS0B 5MDHA 2C7RA 1ZUWA 1PUJA 3U3OA 2D59A 1M1NA 4MARA 1Q15A 4JVOA 2EFYA 4EYQA 2I7CA 4PCAA 1W5FA 4UTXA 2VPXA 3PSHA 3RROA 3SIXA 1AZSC 1VBNA 3C3DA 3PVZA 2VH5R 2YN4A 2WT9A 1Z08A 1OASA 3BPSA 5JVDF 1VI5A 3JTMA 1WNFA 2QTCA 3IIMA 2QIPA 2CHEA 2VQ6A 1YI0A 3K1JA 4IWXA 4KN9S 4KVGA 2GMWA 4QVGA 4BV2A 2GQ0A 4FOSA 3V8PA 4D3ZA 1EYZA 5A03A 4NU6A 2AQIA 1EBUA 3Q4GA 3LAWA 1IRXA 4Q3LA 5IDVA 3WLQA 4GDFA 2TMGA 2CNKA 1P91A 1V7CA 3RRNA 3EDRA 4ZVMA 2LIVA 4PNZA 1S8OA 3GK3A 3NBAA 4I5EA 2GWHA 1S8FA 2RGCA 1CY4A 2C2OA 4LRWA 4TGLA 1ARZA 3H5TA 3M81A 3QVLA 2X9LA 3IOBA 2WVAA 3DVSX 3LX4A 2I67A 3VXKA 3WLSA 4H3KB 4MP8A 3DF9A 1L4KA 2AOVA 3CO5A 1DKUA 2R44A 4J7CA 5BVHB 2C9DA 4OHOA 4XZ3A 2JGKA 1T3LA 1JZSA 4F6CA 1IUPA 3PFHA 4ZZ1A 5CD1A 3L7NA 3E58A 2JBAB 3HBNA 4M7RA 5LIPA 2G5CA 1YZUA 1QGYA 1KEEA 1MLDA 1QG2A 4EBBA 5C51B 5CURA 2R5NA 4TMYA 2XWPA 1IWBB 3VHQA 4HXGA 3T1YB 1W88B 1M1YB 1NJ2A 3O8CA 3K32A 5TS2A 1DRUA 5CB4B 4FHDA 3U7JA 1J1IA 2CDBA 2RBGA 5K8CA 3NCHA 1VGRA 3ENWA 2B1QA 3G2HA 4GBMA 3I92A 2UUOA 1E58A 5ERGB 4EP1A 5F5LA 5ITZB 1W93A 4CEIA 1I3MA 1L0BA 1N2JA 1V3TA 4N5DA 4HT3B 3G9TA 2NUBA 2CXPA 2CE7A 2J48A 3FDXA 3VO9A 4RACA 1S2NA 4BRUA 3DR3A 2VUSA 3PLRA 5DM60 4CM1A 4XEUA 4NBWA 4RDIA 1YQEA 5E7MA 3TFQA 5A2QA 4C08A 5JZBA 3P9RA 1WS6A 3TM5A 1IG0A 1ECBA 3T1OA 2G28A 3VOAA 3K0HA 5CFZA 4DV5B 3M4XA 4MVYA 5IX8A 2O1SA 4X97A 1U6IA 3JS5A 2I6XA 4DPLA 1KI7A 2NV2B 2VDUE 3CUEF 1T3TA 2GCIA 1VPLA 1LVGA 4XLTA 5I7FA 5H68A 1Q0UA 1JFLA 4MI9A 2C95A 4JR0A 2CDRA 1SPXA 1GARA 2GN9A 1C9YA 1L7DA 2HIHA 3O91A 3ISVA 3N8IA 5EKDA 1NJGA 2ZSIA 1RJGA 2H5EA 1GPH1 2ODAA 5FPYA 1F0YA 3WTBA 3KT3A 3IVMA 3I45A 2VJPA 3WNCA 5JCJD 1RXCA 3UJHA 4C7MA 3K71B 1U2QA 3ED5A 2P69A 4YQEA 5A02A 1HE8B 2IEIA 2VBGA 5FP0A 1ZBQA 1DRVA 2EFJA 4OB7A 2WZCA 2ZBUA 4X95A 2YL2A 3DEHA 4YMSA 3G85A 1IG3A 1VZ3A 4IP0A 3T5TA 2CDCA 2ZUSA 4GSYA 3WQRA 4ZK2A 3EHEA 1DWOA 1KAHA 3LA6A 1A9XB 4YHBA 3HXQA 1VLQA 2CSXA 1MCZA 4Y2QA 3P5SA 4XM2A 4BNHA 1D1SA 3QWFA 4OQQA 2A9PA 2PMBA 8ABPA 2A0KA 2ECKA 3GVCA 5KYNA 3TOCA 1Y42X 4RY0A 1DE0A 4MO9A 4CETA 3COJA 2VF2A 3WKCA 2E89A 5BR4A 4M1ZA 3QVKA 4XW2A 4HLUC 1UK9A 3RC8A 2JAUA 3QE4A 3JWIA 4JCCA 3TX6A 5KOYA 2W58A 2IYTA 1N78A 4RVOA 2J6HA 5HKOA 3EGVA 1HXHA 2W70A 5C9ZA 1XRJA 4Z86A 1E9BA 3LUDA 4JLBA 4U63A 4EA8A 4YMVA 1KXZA 1WHTA 1I24A 1LF0A 3TAUA 3U1TA 2IEDA 3QFCA 4JXXA 1L8QA 4YUWA 1Y7IA 3NBYC 4JNCA 2YYYA 3O1HB 4X41A 4BZWA 3ZWXA 4TRNA 2GUWA 3DE3X 2NO9A 1IL0A 4GWKA 5BOSA 3DM5A 4Q4JA 2B8EA 2DCMA 3NHRA 2Q7OE 3WHIA 3WQBA 3WB2A 1KETA 3FOEC 1ECLA 3U4QB 5D5PA 1KMHB 1XF9A 1CUZA 3NPAA 5BSHA 3DZIA 2EWWA 5SZHB 2QXUA 1KMMA 4F92B 2W5UA 3MHPA 4Q02A 3C6MA 1W85B 4O08A 4V2UA 5EJEA 1KWKA 4GBGA 3VNVA 2HPZA 2RONA 3BK1A 2ZQ5A 3D8BA 1WMBA 2CXXA 4WK6A 1J2TA 1L4FA 2C3OA 1Q1GA 4M99A 2GF9A 3IKMB 3ZHOA 4NARA 2WWRA 2OQVA 2I6SA 2W2LD 5T64A 2HA4A 2XQGA 4BB5A 2VA9A 1FDRA 1AK9A 1LI4A 1SIWA 5CTAA 3MOIA 2AEMA 4GOXA 4IS2A 4J94A 4WNAB 1A8PA 3DPIA 2XV1A 1LVHA 1V37A 2QTLA 4X5OA 3SXUA 4M8SA 3T9FA 4MQEB 2C8VA 3R3WA 1T29A 4XCXA 1Q74A 3S8MA 2O5EA 1VXOA 4YGXB 1PQPA 2BFMA 3HL0A 3NHLA 1N3BA 1N0UA 1NVTA 5GV8A 4LZWA 3D6HA 4E21A 5B7GA 5BORA 5IFKA 1PS9A 4TN1A 4HPWA 3JD1A 3MFQA 5E6SA 1XX6A 4XJXA 4N40A 3QY0A 3D3WB 5ALGA 5JS1A 1JHVA 2ID8A 1GFSA 1ZUNA 1N6LA 2PL5A 4GYJA 1BKYA 4A0GA 1C9JA 1P31A 4UMEA 3M89A 4O25A 1D1TA 2IHVA 3HU2A 1ZRHA 1U0TA 3GFFA 1QHNA 2CLDX 2QUBA 3RRFA 3X1JA 4DVJA 4HAUA 1OTYA 2OZLB 2WJVA 5MN6A 2YIMA 4CFSA 3BCUA 5C7YA 4R68A 1RFLA 2ZREA 5FQNA 2F48A 1W49A 2M2IA 1EUYA 1KO8A 2ZBQA 4B1FA 1ZN9A 1V8FA 4H9GA 5CUQA 3RJTA 1JXQA 2JB9A 4R6XA 3WB1A 3BM5A 3Q2KA 3HJFA 3ZVNA 4V0KA 3MT7A 3IDZA 4GEGA 4PGGA 5DXFA 5H3HA 3UPDA 5KYWA 1JLRA 3O90A 5E0KB 1V1RA 3GROA 5JOQA 3TJZA 4FBLA 1T26A 4YN3A 3GAMA 6LDHA 5IJ0A 1N3IA 2FVYA 4FQ8A 1VL2A 4OP2A 1LX6A 2HMYB 4S1TA 5AD1A 3L4KA 1E2LA 1K4MA 1I33A 3COSA 1SC1A 4NDZA 1YOBA 4QJIA 3OC0A 1K2VN 5F1KA 5ADWA 2JFWA 5LDDC 1G3QA 1ICEA 4OFZA 1KFEB 3OEWA 3ZZNA 4F2PA 4IICA 4BMYA 1B14A 3CJQA 4YP5A 5KTRA 4GQAA 4ILKA 3MJEA 5FD8A 1KK0A 4XD7A 2NU8A 5LD2C 5L4SA 3CXRA 4ES6A 4LXYA 1RPNA 1XV5A 4U1RA 3HADA 2ZRJA 3IDOA 1I3KA 3V97A 3V00A 1IN1A 5U4XA 4ZAVA 2Z83A 1ZKDA 5CXQA 1XOIA 3PDIA 3SK0A 1O6FA 4L0MA 2OCPA 2XIQA 4DR2B 1WZNA 2NO5A 2HXGA 5AVZA 2UKDA 1QV9A 2MSDB 1QZ3A 2VN8A 4L57A 5H80A 3W3ZB 5LQDA 2GRJA 4NENB 3DHEA 4NOKA 4X8MA 1H4SA 1SHKA 5CDYA 5BWBA 3CUYA 5KDLA 1ZM2A 2FB9A 4TKVA 3KETA 1CW2B 3RT1A 3OE7D 4H35A 1FU4A 1EVEA 3MB8A 5BYBA 5T6BA 4DAOA 1MO2A 2EJTA 1NE2A 1PV4A 4JL8A 4RQAA 4ZZ0A 1PD1A 1QMGA 2AZ4A 1U65A 3IO5A 3BN3A 1WP9A 3THYA 3WFIA 2ILVA 1YRAA 4DUYB 4B3MB 4EFKA 3DHWC 4BU1A 1ECCA 3OWHA 5B4TA 1POWA 3DZFA 2AYZA 2GARA 2WYOA 4OLJA 5ALRA 2K7ZA 3R24A 1W6RA 2B8WA 1NW9B 2X4LA 3FPCA 4ZVRA 1HSZA 3HG7A 2IZ0A 3ZJ5A 3Q2IA 5JY1A 4MV3A 5AKIA 4FDTA 1YS7A 3TCXB 4QUJA 2GESA 2VYVD 4TN5A 3KKMA 3ELWA 5LPNA 1NW8A 2C84A 2C88A 1JTEA 5DH9A 2YV1A 5A3VA 2HK7A 4TUYB 3ZJUA 4FILA 2RGAA 4DY4A 4INZA 1QGUA 3MSXA 1X3SA 3KU1A 2FPPB 2DP4E 2Z6QA 3QXGA 3S2ZA 1LDYA 2VHEA 2PL3A 4ZN6A 2B30A 4OTZA 3I6YA 1RYMA 1CQIB 1RXYA 3KFLA 5KAMA 3TRKA 4LZPA 2WWYA 4OIFA 1BCRB 2BVNA 1SVKA 3EPPA 1EBBA 3OWOA 3QE0A 7GPBA 4OBWA 1UC4B 3D4OA 3GCWA 1XZ8A 5JCPA 1OAAA 4GBED 1ELOA 3A1NA 1T6NA 4KDCA 1O57A 3VR5D 5DN6D 1A9YA 1B1AA 3JATA 5BNFA 3W8EA 4MH0R 4MJXA 4REOA 5EJAA 3ZU4A 2Q5JA 4EDHA 1L5YA 1RXEA 1T2FA 2FZEA 2OC9A 2I6TA 3RYIB 4LI0A 2FSHA 3AF4A 4Q9NA 3RIEA 2H1SA 3LRPA 4G24A 1YBAA 2O0KA 2B4AA 2VZ8A 5JZSA 1ZAYA 3B1WA 1TUGA 3KP1A 1RVDA 1JYSA 2HHLA 4ZHSA 4UNIA 1E2JA 1P9RA 3A9TA 5DX1A 3F6PA 3FUXA 1P39A 1L4YA 3ASZA 3CEHA 2XA9A 1MQ9A 2ZSAA 4Y2TA 3JASB 1QHXA 1GJRA 1LUAA 1GZ7A 2EP8A 4F8EA 3VZSA 3IQIX 1FSPA 4HP8A 2O2CA 2JZOA 3MS7A 1K3UB 4KXQA 3RJ9A 1ECGA 3GDOA 2A1TS 2HAEA 2AHRA 2D0IA 4DA6A 2FZLA 2HPHA 2PQ0A 2QLLA 2V7VA 3FYUB 1CUJA 1GGJA 1II8A 1PEDA 2AFIB 4MA4A 2C31A 1Y89A 5UKDA 5JW6A 4HKTA 2BSAA 5EIWA 3NGMA 5A5DA 3G2MA 1SUSA 2NYRA 4HSEA 2HMWA 2CNWA 3GJ8A 1MF7A 3V1KA 1XRNA 3QELA 4FD3A 4U6NA 5EGSA 1E1MA 1W5TA 2JVIA 5AO9A 5H5JA 3G79A 4YRTA 2EKBA 4RNCA 3BZWA 1KE2A 4CG0A 2VYFA 3NATA 4U2GA 4AJLA 3PDHA 3EQ2A 1PFWA 3D4LA 4KL8S 1OXKB 4DB4A 5GADl 3EISA 2AXQA 3GG9A 4B3DA 3IT2A 1N0VC 3PFFA 3QP9A 1UL1X 1NVXQ 3EEQA 1HPLA 1W5AA 4QA9A 3FDZB 5I47A 1XZLA 5HKLA 2O8CB 2C54A 3KL4A 3CJRA 1I4EB 1GFIA 3RB8A 1P7YA 4UVIA 5AW6A 3T7DA 4P6VF 3W8FA 4I4TF 2VSQA 3VC2A 1FS6A 2Y9PB 3P0EA 1SGWA 1NU6A 2C77A 4JA0A 4S35A 5HDBB 3HM9A 1DQRA 3E23A 5IAKA 4GG1A 4EZEA 3CZ4A 3INNA 3LQKA 3GFGA 4E5DA 1AQIA 4YQYA 4ARVA 4CMIA 3IEVA 2GEFA 4TXJA 1AHNA 1K89A 3H3FA 3H19A 3UVEA 4CLRB 1AUQA 4LW8A 4GVLA 2NXEA 2OHVA 4DHWA 3LQRA 1VE3A 1D1QA 1I4OA 2H17A 4UHDA 2ATEA 4TZ6A 3HPQA 2XWBF 5ALTA 1H1LA 2D1FA 4AWBA 1UDCA 3LHDA 1G2PA 2IF0A 1OHHD 3G3EA 4XDHA 2DAPA 4ZOCA 3PYLA 2XYGA 3ACDA 2OPHA 3G9QA 3EVEA 4JC8A 4MVJM 4S1OA 4GPBA 2QORA 4BB6A 3BGSA 3QFRA 5AJYA 2X9NA 3ONDA 2XVMA 1A2KC 5IM5A 4MCHA 5CJ2A 5TQVA 4Y2RA 4O4JA 3GCXA 4O4HF 2IYWA 1E9CA 2JLRA 4Q9LA 4C7OB 4DV1B 2PH5A 4XM0A 3PX7A 2HGZA 4JXKA 5TMBA 2XYHA 3ACBA 3K70B 1M8KA 1O94A 2AYXA 2JLBA 3KVRA 4OJQA 1VDZA 4QYWA 3W0LB 4C22A 2IUSA 2W6IA 4JUFA 2JPDA 2RHBA 1Z4PX 3QBJA 1FCJA 3FPEA 2VP6A 1OFHA 2AS0A 3CRRA 2NQ2C 3OH8A 1FXWF 1HZZA 1K5HA 3Q9SA 4AUNA 3GFTA 4G1BA 5DNVA 3DHNA 3R3ZA 1V6AA 5EJ7A 4XWTA 2XD9A 2ZE8A 3E7DA 4IJMA 5KAPA 4Q24A 3OHSX 4B7ZA 2BBOA 4HNVA 1TF2A 3O94A 5JDIC 3B52X 3D3KA 2HNBA 2R4TA 1Y37A 3I23A 4YO8A 3D2AA 3LWZA 4QPDA 3OLQA 1RHQA 1BOFA 5KOHA 5C3UA 2Q9BA 1JSCA 1XCBA 4ND1A 1C8LA 3DV9A 4WXEA 3B1FA 1QNFA 3HVUA 1A9OA 3N7UA 5JAPA 3UGQA 3EIQA 2YNMA 3VU3A 4L4RA 4PSDA 2OXTA 3EF0A 4CMEA 1DVRA 1ITZA 1RI5A 1J8VA 2W8BA 2PTHA 4HG2A 4TMKA 4XPZA 4E31A 1UKZA 3K0AB 3HL4A 2YCLA 2GYYA 3OZXA 4F2GA 5J47A 1LDMA 2NT3A 4MS4B 5HM6A 4FMCF 4YMTA 3ICOA 4RDCA 2KLHA 4TL8A 4JMPA 4GYKA 1H23A 4BP8A 8ATCA 5HCNA 1L1EA 1Q7GA 1NUQA 2PT7A 4LOHA 2ZU6A 4RTNA 4IDGA 1YH3A 1WF3A 2ECFA 1UXHA 2IEAA 3IELA 4GP9A 3L7DA 1X7WB 1GDDA 1MN6A 2AOTB 5B7QA 4GR9A 5DTQA 3WAJA 4M1YA 4TXLA 1UXKA 5A9SB 4BZPA 5BUCA 3OE7A 1U8TA 3UFBA 3CH4B 5F35A 2W6QA 1DHTA 3QLJA 1EMDA 5DLYA 2XUIA 3JQFA 1TEHA 3FZYA 4G37A 2XOEA 4IFIA 3OTOB 1P4HA 1M83A 3CVJA 3EN0A 1LBEA 4KO8A 4N3CA 2G9NA 5LKRA 5F9MA 4HWKA 3O4HA 4NCKA 3H05A 3KJQA 3SFTA 2ZXFA 1L5OA 1U0HC 2W2VA 3ZXYA 5AW9A 4Q7KA 1EESA 1VLJA 4BNJA 5K6AA 1WXEA 3HXOA 1DC6A 3CW2A 3M6FA 3ZLVA 4E1VA 3MAJA 4F2HA 2PKXA 4TMVA 3ORYA 1ISSA 2VNJA 4H6XA 3C87A 3DKVA 4HQKA 4BFXA 2NIPA 4Z7JA 1YCFA 2QT0A 2QXYA 3RQSA 3GN1A 1PZMA 4EL0A 2Q1SA 3ZDXB 3K8QA 5F1PA 2QKYA 5IKOA 4QU0A 1YR8A 5DM2A 2J9GA 3PHJA 5CB0A 3AWDA 1YA8A 2RJOA 2FKNA 4F4JA 1DBRA 3BHMA 2OUIA 4QT4A 2QVCA 6GPBA 3OOWA 2R8YA 4DRZA 2QX8A 2FSSA 3Q3JB 1KHTA 3GELA 4E5NA 3JQBC 8MHTA 1K7YA 1GCAA 3MERA 3O8QA 3EDMA 3QITA 1PQ4A 4K0RA 5PGMA 3UHPA 3ZBUA 4YYZA 4W1SA 1CR4A 1CZNA 4BB0A 4DTIA 3WAGA 2Q0HA 2VOJA 3LTEA 3VR5A 1RDFA 1AY0A 1DIOB 1Y1RA 3FPKA 4AQ7A 1REQA 2VSNA 4J0GA 2GBCA 4TWBA 3JQQA 1YS6A 1PFUA 3AC0A 4JB3A 3W9BA 4ATNA 2XQKA 2BE9A 1CJCA 2O0LA 1LPAB 1R4MA 1YL6A 4DM3A 2C5SA 1F6BA 1ZK3A 3P20A 3NR2A 1ZMTA 4WZ6A 2JARA 4N18A 1P44A 1X1QA 3H4VA 3VAAA 3ZHQA 4BP1A 4DMKA 4DQDA 5AW4A 1J1UA 3C39A 4NBKA 2FDRA 4Z8XA 4TRJA 3KTAA 1K6XA 2J9ZB 1KIAA 2HFKA 1G16A 4GSKA 2QL9A 5HMMA 1XVIA 2XXBA 4C0JA 4RZHA 1V2HE 3I1YA 5DHAA 4GL4A 1GTJ1 3I58A 4S04A 1Y8RA 3OD1A 2VDQB 3OCCA 4MW5A 1ZD3A 5FFFA 3W8DA 2IH5A 4I8IA 1P72A 2GM5A 3EQ7A 3MILA 4Y2SA 5DGIA 3U4CA 1YR1A 1I2ZA 4NG5A 4C78A 4DKXA 1U0FA 3DMGA 4UHJA 3TLZA 3GNQA 3L6CA 3NM5A 1P73A 2GTPA 4CM9A 1ADJA 4A36A 3TZ6A 1CF4A 3RR2A 1F2TB 3EG9B 2IHNA 3TLGA 3WK9A 4RHXA 3RLFA 1DX6A 4IOMA 3RHZA 5CITA 4OSEA 2Q4TA 4GPEA 5DLDA 3GCDA 1BAPA 3HK2A 4Q3DA 1GILA 3GJ3A 1GVHA 4W5NA 4INJA 2EL7A 1VIVA 2IX3A 3KE8A 3N2KB 1U0RA 1H42A 2PVPA 3SLRA 4A2QA 1T2UA 1GDTA 5EZYF 3AVOA 1ILWA 4D99A 2AG5A 3FVVA 1ZW6A 5D5HA 4KYVA 3A06A 4DLVA 1FTNA 1LLUA 2OY0A 2PS1A 4I8DA 1JLLA 5C3MA 5JECA 1R4AA 3O95A 2YJGA 1K97A 3C8DA 2WU0A 2GK7A 4UQOA 4AJHA 4DDVA 5DMXA 2R8PA 3B38A 3P9ZA 5DW0A 3TX2A 2Y92A 1CX9B 1JECA 2OHGA 3R7BA 5HJ7A 3GRFA 5IH7A 2D1RA 1KXJA 5BSRA 3A4NA 3T12A 1QYWA 2OHFA 4M89A 1ZHHA 3DBHB 2YJ3A 2ZJ3A 1MV8A 1W75A 3EXHC 3LGAA 3W06A 2DQZA 4ZJZA 3UMGA 3D02A 1WF6A 3IBSA 3PBKA 4K40A 2NPFA 4WZBE 5BT8A 1VSVA 4YAOA 1GAEO 3IIEA 1FYEA 2PA3A 3GFQA 3OECA 3P52A 4L5IA 3WRYA 4CCAA 2CMDA 3AETA 1XGKA 3BEDA 1Q17A 3ILYA 4TMFA 4EVIA 4WLOA 3ZEIA 5FI3A 4X65B 3WIOA 1QORA 3P97A 3PEYA 3B20A 1G21B 4O1IA 4PQEA 1OHHA 1Y6JA 2I6QA 1SCUA 4HDOB 2GS9A 5JH7B 4J75A 1RC1A 4E4YA 2FW0A 4Z99A 3T7JA 3NFRA 2P68A 4LMRA 1XN1A 3MZ0A 3K1AB 1XMPA 5ALWA 2EJWA 2PXHA 2WIFA 5ADHA 4YEDA 1LX7A 4GGMX 521PA 1P1KA 2DBVO 1PFKA 4ESHA 4URWR 3D4NA 1CUFA 5KPJA 5LOVA 3GDHA 1G2QA 1WPRA 3YASA 4DA9A 5L9AA 2POCA 2ODBA 4R40A 1B8VA 3F7TA 4YT5A 1NAHA 2O0MA 1YQQA 2AMVA 1N6IA 4MMXB 3HCEA 3GBVA 3M6WA 3WL8A 5J63A 121PA 3NUZA 4JZYA 3SWWA 3A11A 1I2BA 1ZHOA 3D7SA 1Q5PA 2O2ZA 4L8FA 5IXYA 3Q5GA 5H8WA 3SGLA 5F64A 1GXSB 3FSEA 4G8JA 4MW9A 5FUVA 3UATA 3V6MA 4X1IA 3MRTA 2AUMA 4CQMD 3G0DA 2AG0A 4YIHA 3W5DA 3H18A 2R4QA 3K5HA 4FEYA 4FJ0A 4P4NA 4H1TA 5JNRA 2F55A 3AI7A 4FYMA 2QT9A 3RYTC 2Z98A 4PGAA 3RASA 3G2NA 2QNBA 2IEZA 3NKFA 4LV6A 3PK0A 4EHJA 1TMGE 3KVVA 4KKXB 4DSNA 5IHPA 5FLXA 1KGSA 4WNCA 2R47A 2OV3A 2FWNA 2W37A 1AKMA 1NVFA 1XCJA 3MCVA 4QO7A 1PJ2A 3I09A 1EK1A 1XLWA 2IC5A 3LXUX 1ZMRA 3EXG1 1PCXA 3PNOA 1KH2A 4C0WA 2P2DA 4E5MA 4I1PA 4EW6A 4JC5A 1USVA 2Y0EA 4UBJA 4CJXA 4ZT4A 4L8LA 1ORVA 4MUNA 2FFBA 2R97A 3PEFA 3ZE1B 2HY7A 2P6PA 4AROA 3EGIA 4LBZA 3RWBA 1TW3A 1GOTA 1KI2A 4A2CA 3K15A 1J39A 1IHOA 3ABQB 1UINA 3MT8A 4LX0A 1A8QA 1OWNA 1XUOA 3VYTB 2XNCA 3BXGA 3ZIAA 2AGVA 1JG2A 2D62A 3K2QA 4GXNA 5KYUA 3ZI7A 5JFGA 1JRLA 4CW7A 2FQWA 1C9MA 3VR3D 1JDSA 4PYQA 3S1AB 5BN5B 2IS2A 1M8JA 4BNIA 3A1TA 4X91A 4RHYA 2A9OA 1EQUA 2A14A 3AR7A 1P1FA 3DAFA 1DIGA 4IJQA 4JQYA 1WB9A 1JA1A 1W8IA 1Q57A 1KDTA 2AN3A 1YGPA 2H4XA 4D6XA 5CFPA 3OCJA 5AICA 2X3UA 2C2BA 3FRIA 4Q7EA 3LX6A 3OZRA 4BFYA 4ZHQB 1G2OA 2QJFA 1IZ9A 4FWIB 3FFAA 1UBEA 2QBYA 3ND6A 4HWGA 1ZH2A 2CFRA 1MJGA 3AIMA 4EWLA 2R1VB 4MIKA 2HNAA 4YV0A 4B9AA 2P6MA 2DPMA 1Y7HA 2JBHA 1Q0LA 4TSRA 4A27A 4M98A 3JQ8B 4O2RA 3CLUC 2C7BA 2G0NA 2MHCA 2OOKA 5DM0A 2GCOB 2G7ZA 1Z3IX 1BMQA 1V7ZA 3X2FA 1NQUA 4P83A 3CG4A 3KIPA 1ND6A 1YC5A 5FI0B 4ALJA 1XLUA 3VDNB 1ULZA 4MHOA 3X1XA 4W7SA 1M1NB 5G0VA 4JBWA 2QTNA 4EQZA 4NOLA 2OGTA 3ICWA 4UE3S 1LQ2A 4ZCQA 5DMHA 2WNSA 4QSHA 5DWDA 3ZDQA 1EVZA 1NP6A 2BJHA 4NP6A 3SU8A 4BVFA 1VPWA 5AVSA 4EECA 5IUJC 4LXXA 3WYGA 4MR7A 3P9YA 3NLLA 5ICCA 1W1IA 5CYFA 3SCZA 1W44A 1JQLB 5L4NA 2A3RA 4ESVA 3KQWA 3HM2A 4V24A 1L7PA 1OCEA 4LWPA 3CEAA 2EQ5A 4RM2A 5AP9A 1GUDA 3PDUA 4XIJA 2OXRA 4K46A 1XPUA 3PTLA 4R6WA 1FC0A 5TMEA 3ZZ0A 5EINA 3AKDA 3OMWA 3TTYA 3HH8A 4HS4A 5JEDA 5EIFA 1XMQB 4BLPA 1GNVA 3B89A 3GUZA 1LCIA 3QW2A 3UWSA 2H48A 1YULA 3ZOZA 4R3UC 1Y4ZA 1DI0A 1H65A 2H2WA 5HCUA 2B36A 3O93A 1C4WA 3KZMA 3UENA 1FXWA 3UB2A 1ZD9A 1RD4A 2AWOA 5GOTA 3BFPA 4TMTA 3HCDA 3TXAA 4K6CA 5MHTA 5MN5A 3FLAA 3FNIA 1N1EA 2JK0A 2XT9A 4YVFA 1RAGA 1C50A 1KEEB 2JFNA 2MINA 1OA0A 4L8VA 4KSBA 4EB0A 1PKEA 1KDPA 2FYTA 4QGSA 1U7XA 1N5KA 1TIBA 5LJLA 2VHTA 5HEKA 1KY2A 1ODJA 3NPMA 4GHWA 3ANXA 5DHFA 4K7JA 5D87A 5JSZA 1DEKA 4PO8A 4PLZA 1M5TA 4PPGA 5EXTA 3PJRA 1A8UA 1JEOA 4A6XA 3NKVA 1EINA 1XE3A 2DUJA 2R6DA 1EX9A 4G0MA 1T9AA 4UD6A 4CEIB 1V5WA 1VPEA 2HLDA 2QZZA 4Q82A 3ORSA 5KWJA 2JS7A 4KR9A 1GNTA 3RT9A 2RMKA 5BWOA 5EE1A 2C2XA 4TT8A 1KI3A 4BJ3A 1D2EA 1E0JA 4JELA 1P1JA 4AMVA 4G1FA 2NUPA 5LIRA 4U7HA 4CN8A 1T43A 4MKRA 1WCYA 1ZESA 4UREA 1N57A 3SX2A 1T2VA 1NQ5A 1B2RA 3CX3A 3PUWA 2P4QA 2GO1A 2R2AA 1CQZA 4JL6A 4LVCA 5DBOA 3BGOS 4UDYX 5FH9A 5JAHA 4WADA 4PONA 5HG0A 4DLZA 5JAOA 5JI3E 2J3QA 4G2NA 2QGFA 2GBLA 1LSJA 1RYEA 3N75A 4Q93A 2GD2A 4G4JA 4RA9B 4ZDJA 1SCKA 3OTWA 2O54A 1WY7A 4C7VA 2JLQA 1JVSA 1TLFA 3TTWA 1P1BA 1NC3A 3V7FA 3NEAA 1BXZA 1M33A 1MQAA 1DKNA 4NBTA 3EZ9A 3PC3A 4ZA2A 1FMJA 5H81A 7ADHA 5KNBA 1EM8A 2RGBA 3STTA 1E79A 1YZNA 1LBTA 2GBFA 2VBFA 2Y1FA 4KH1A 1UPXA 3UKOA 5KQMA 3ETEA 5DPMA 3FWHA 5CRIA 3EFOA 2Z2IA 2A9JA 2QZ9A 4AW9A 1RP7A 5F3RA 3KSZO 4FOOA 4M8NE 3INTA 3ENZA 3S28A 3JZFA 2H2DA 1JHZA 3U4HA 3ZWVA 1SBCA 1SUPA 2H9YA 5CIWA 3TAHA 1UKVY 4HN9A 1AKWA 2FP4A 3RTBA 2XTZA 3UK7A 1B76A 3IAEA 1DKQA 5K2MA 2O59A 2NM0A 2CYCA 1JHOA 1LNZA 5FUWA 1EWVA 4YMHA 5L8VA 3R5JA 2Y8EA 3D0QA 2NZ2A 3IH5A 1GNQA 4EBFA 4CQMA 1U3TA 2WFZA 4WZBA 4IGEA 2BPOA 3HHPA 3VSBA 5ANRB 1TQ6A 1WLYA 1Z16A 3ILXA 4OU5A 4Q7QA 1CJTC 5A5FA 2OXEA 4DA8A 2CXQA 1ZVVA 1WHTB 3IP5A 3GT3A 4C0AC 3C4JA 2G72A 4G5RA 5D3MA 3GEIA 4B7AA 2YFYA 5JAMA 4EHBA 1GPYA 1M34A 2RBEA 3AR2A 3HLTA 2WVHA 3JQEA 2CL5A 4JKOA 3VH3A 5BOSB 1HETA 3S27A 4Q4JB 1VM6A 1RQLA 1MH9A 3E48A 3BICA 3GJ0A 4NECA 1U2SA 4WRRA 4WXMA 4BDSA 5K6TA 2GDJA 3LG2A 3U9SA 1B41A 1YJAA 3SICE 4B6SA 1N8SA 4D9KA 4OHVA 2J4CA 2X6QA 1Z29A 4XYMA 3RGGA 3DOFA 4ONEA 3MUNA 2DH6A 5IPFA 1GZHB 2C2YA 3E9ZA 1NFFA 1F51E 1OVMA 4BO5A 4CLDA 1XDWA 1F9AA 4MGZR 1IMOA 1JAXA 1V9CA 2DFKB 4TX1A 4DXHA 4FYVA 2X14A 3BK2A 2IU0A 3U3MA 1YACA 1K98A 4MXDA 4U00A 3WC4A 3SXUB 3BJIC 3CVOA 3SM9A 13PKA 3B8HA 4JQZA 1L1QA 4MPJA 2Z9DA 3CTMA 4RVCA 2YZ2A 3VDQA 2PRIA 3G1TA 1GY8A 3OZEA 4ACAA 1HQCA 1MDFA 3L9WA 3R9WA 1V71A 3D3NA 2XQVA 3TSWA 3O2JA 4GKBA 3OZBA 1X70A 1HT1E 5ADUS 2FW8A 3GN2A 3T5AA 1IY8A 1GV1A 4OMUA 2NV6A 3MMZA 3TL3A 1Z7YA 4DMHA 3IR7A 3ZHRA 1XXLA 1ZUNB 5EMLA 1Z2PX 4LXIA 1FUIA 2GJKA 5HP4A 2FKAA 2Q46A 1G8AA 3L46A 4PFJA 4XDGA 1W36C 3ICEA 5AI0A 4ZI3A 5JIBA 2JD0A 3BS4A 3KV1A 3QWBA 3EMBA 2WMNB 2ZZNA 4LV5B 3KOUA 5CM9C 2XB8A 1B0ZA 5CEJA 1XTKA 2A1TR 1HE1C 3ROQA 4K8RB 1EE9A 3NCTA 4EJ0A 1OKKA 2PLWA 1BN7A 1XI2A 3SIRA 2WSLA 2X0DA 3VQTA 4V1CI 1ZI6A 4RD2A 1LSSA 2IPLA 1UP6A 3H11A 3L49A 5JZ9A 1OXUA 1V1RB 1LDEA 1XD9A 3QNUA 2KM1A 4UU0A 1TVKA 2HOQA 3VKFA 3GPIA 2PZAA 2ZCVA 2FRDC 2VNIA 1H2RS 3VH1A 5IJ0B 4I4CA 1LLCA 4UE6A 3SHWA 1N3YA 1OB5A 4QUKA 4MYCA 1C4OA 1M7GA 1O0CA 3U5ZB 4X64B 1U2GA 2BLLA 1YS2X 2Q29A 5ISMA 5L3ZA 2H2GA 2ZIEA 5K3SA 4C3VA 3TLMA 1KY4A 2VZ0A 2H1WA 1KO7A 5EIXA 2BCGY 4DARA 2NU8B 4FD2A 3CLSC 3N05A 4OXIA 5FBKA 1YZTA 2AD1A 2NZUG 3RF7A 3BE8A 5I8ZA 1Z2NX 2Z08A 4EABA 1FOEB 4YT8A 5HQTA 2IH4A 1TAUA 3P2IA 2TYSB 2QQ5A 2CL0X 3GJ6A 3W5UA 3PDIB 4LDPA 1D4ZA 3KPVA 2C42A 3MWGA 4RABA 1F8FA 2H2AA 2O4CA 3EARA 3LC0A 4MWDA 3SHQA 4JJZA 1LZLA 1MG0A 2ZULA 3OAAD 2J59A 1QH8A 5E2AA 1XZQA 2E0IA 3NW9A 5CVUA 3SEAA 5IKMA 1CEEA 3VPXA 4U0KA 1NV8A 1RXSA 3WMWA 2IP2A 3RO7A 2PNFA 3LUFA 4TKVB 3EXFA 3ABRB 4C4ZA 4MLCA 3QEOA 4GD3Q 2EKQA 3NHWA 4PSVA 5FTMA 5LVAA 2HJGA 1XCLA 3KE9A 1H6DA 2SCUA 4YWJA 3THYB 5SY9A 1MG5A 2HWYA 4YJ2F 1FDSA 1GPLA 1RPAA 4MWCA 5CEFA 3SBEA 1QKJA 2EEZA 1RXWA 2PR2A 2JIZD 2ZJ1A 2DLCX 3BMOA 3H9BA 4KO2S 5FPKA 3QPBA 4IH4A 3PICA 4RTRA 3OE5A 1GITA 5EAIA 2RD2A 2QB5A 4NZOA 4BVEA 4B45A 1R27A 4CFYA 3BGIA 4KPFC 4PC3A 1WCXA 1Q83A 4FWBA 4G4GA 4I4NA 5AI9A 3OCUA 3X2EA 1GCIA 3FZGA 1EU1A 3GZTB 4E88A 3D6AA 3L8ZA 1QQBA 3HA3A 1L5HA 3G6KA 1A5TA 5J3JA 4M0MA 3H9CA 3IP8A 4GUAA 1DAKA 2QG4A 1DUIA 4FC7A 4PTZA 4GQIA 4TWZA 2KPOA 4C4TA 5I7WA 5JQGF 1QGUB 1R50A 3WGUA 4C4PA 1HDOA 5F9HA 4RA6A 4DNPA 1XCGB 3RJMA 2OAP1 4BEJA 4UVGA 5HA5A 1MQSA 2UUAB 3DE4X 4JFAA 1JB1A 3M34A 1LF5A 3DVLA 3OT1A 4HVAA 4N5LA 5B30A 2ZZKA 5DM70 4EGCB 1P8AA 4WKOA 3IBYA 5DYGA 3IYLW 2O57A 2QVZX 3DO6A 4FOTA 3F8WA 2PZFA 3EXIA 3IHWA 2GNAA 4RNDB 2UYHA 3H1FA 4LF4B 2RSLA 4PZLA 2JH9A 2BMAA 2FUEA 1I2CA 2G0AA 3JATB 3O4IA 8OHMA 4CF6A 3KOMA 1GNLA 1UWLA 5JPDA 2HTEA 3K2IA 2FPWA 4HMQA 3VZRA 2VDOB 4W6QA 2O5VA 4JT4A 3BL5A 2BI4A 3B7GA 3G89A 3M4NA 1YVEI 1F5NA 4G9EA 4PPQA 5ALUA 3T1QA 1G38A 2QRQA 2VRCD 1GA1A 3VGPA 3J80A 4FGJA 3VDRA 1RXVA 5AVUA 1XIVA 4YLGA 1KJQA 5EG5A 3PDJA 4ZT5A 3BTUA 3CCBA 2IS4A 4QAQA 3RAPR 1JQ5A 5AJUA 5DZSA 2JLWA 1UAYA 2J07A 4E70A 2OEPA 4EQ6B 3MJ4A 2NN3C 4XCVA 3WRWA 5AKKA 3AR5A 1M0WA 1OFTA 3B78A 4HBZA 4CEHB 1LTQA 1LZKA 1OC2A 2Z58A 4LYFA 5IRCD 1WKVA 1X1BA 4RELA 5JVDB 1S89A 2YXLA 4JVSB 5K09A 1AKTA 2FUG6 4D8VA 4FS3A 3IX7A 4AY3A 5B64A 1UEJA 4DLTA 1S7GA 1KF0A 1RE0A 4QREA 1Z39A 4UNSA 3DAOA 2RGXA 3QELB 3R0IA 2AI1A 3KJFA 1JDUA 1ZH8A 4IXNA 3PI7A 1FU8A 1R5OA 3GLGA 5I01A 2QRGA 4MV0A 4MS1A 3AF3A 2GR9A 3MWEA 3P9XA 4HZUA 5EVJA 5IDWA 3EVZA 4DNQA 5DSTA 4EG1A 4REQA 2BFWA 2SECE 3GEDA 3WBBA 2NX2A 3C3WA 2RH8A 4ON9A 1Y1TA 2FLVA 2RGUA 3TEJA 5FLYA 4DZZA 4YCLA 3L8DA 2DH5A 4WXRA 5LA6F 4ESOA 2W9XA 3HB5X 4HHEA 5B57C 2G04A 4UTRA 3J7TA 3K5PA 5DRTA 4YC7A 1PN3A 4PN7A 4NVRA 3JVIA 1KQNA 4D8XA 1C8BA 1NVWQ 4U9HS 1P7ZA 1F1BA 4H7KA 4J1TA 5CNKA 3SFVA 2PWZA 3NYQA 2OYRA 1T9HA 5KS2A 2WM9B 5SV2A 3C6BA 4J4TA 2I8AA 3W9YA 1O5TA 4CMIB 1ZEMA 3GJYA 2RGDA 2WHXA 3ABOB 2GZRA 3MOGA 4N47A 3ZJYA 1IVYA 1ZI8A 4K5QA 2OA0A 3KT6A 1I0IA 1CUYA 3H2GA 3MSCA 1GQQA 3KELA 4RMHA 3GJXC 4KIJA 2VJAA 2ZWIA 3NZEA 4JIGA 4KACA 2CXNA 1Y6QA 1BDHA 4DKJA 5JSFA 4Y1EA 1R6AA 3DZJA 3OEYA 5G1NA 3O31A 1PNTA 2WJ4A 3BFJA 2I4LA 3DDWA 4O29A 3S44A 3SR4A 5AUOB 1MX3A 5DTRA 1OBFO 3A6HA 3LUHA 3EPKA 1Y6GA 1SKYE 1Z4MA 4JYBA 3ZVRA 4BL5A 4PHCA 4LF5B 1RP1A 3EK2A 5LNK6 5AYVA 1P7CA 1ATIA 2BEUA 1JJBA 3LF1A 3ETJA 3MT9A 4JGBA 1LA2A 1FIUA 4ZRMA 5EP3A 2PS3A 3VPBA 1B8UA 3F98A 2C1EA 4RIIA 5K3FA 4TTIA 5GVRA 4IHJA 3V6LA 2H11A 1F1JA 1F6DA 2J0VA 3SC6A 2VPPA 4LIPD 2VBIA 5EXSA 4ETWA 4EL5A 3U5TA 4UNQA 3C85A 3NBFA 2AJCA 1RAAA 4IFTA 3VR1A 1KYZA 2HNKA 2OZPA 4CT5A 3VSAA 1BMFD 2IXBA 5DCYA 1U1DA 5BRNA 5BW8A 1T8PA 3QSYA 3MBIA 3RS5A 1KVQA 2Y0PA 4EF6A 4U7TB 3B9QA 4E5KA 3S1SA 2LP4Y 4DV6B 2VUUA 5ALYA 5A06A 2X4DA 5ILGA 2MWMA 4RMJA 5KOHB 4LDNA 2PX8A 3SDSA 2G08A 1BWQA 2ODTX 2CNLA 2ET6A 3VMFA 1MB4A 2PSFA 5M7EA 2VKQA 4LRQA 3C3PA 2I7TA 4LVUA 1KZ1A 4X1OA 2GZ3A 3W4JA 4F85A 3W79A 4P33A 5E4FA 2W8BB 3TTVA 3W5BA 2HCTA 3V46A 4I5DA 3P2JA 4ZVKA 3FNFA 3I1JA 1QIIA 6CHYA 4JA2A 3O83A 3AZQA 3BJZA 3EVNA 3OPYA 4FGUA 5B37A 4CU5A 2JIMA 1LK0A 3EGXA 1NBHA 1R37A 1F0KA 3OOJA 2A5GA 4AY5A 5D7BA 3KZ1E 3OAAA 3RU2A 4AKEA 2Y1OA 2F67A 1UKYA 5DNCA 4KE9A 3ZX4A 2JNWA 2G07A 3HJHA 3KZNA 4B8WA 4EG5A 3QU4A 1LV8A 5B58C 3ZGZA 2VG8A 3LP8A 1WUTA 3PF8A 4R2WA 4MQMA 1DOZA 5B53A 2G67A 3TR0A 1JJ7A 2HYDA 3MYYA 3I42A 1MC4A 4L5JA 2WV9A 4WOBA 4D4IA 4I55F 4JP2A 1X86B 4JI7B 4JI0B 3QH4A 2ZAYA 2ISCA 2JIZA 4XAQA 1GRCA 2R9VA 1MXFA 5G3YA 1KI8A 3ZZMA 1JG3A 2WIJA 3LUCA 4AU1A 4PG6A 5KIAA 3VA7A 2DWPA 3LXMA 3IXQA 1KI1A 3KEGA 4R9NA 2GETA 2IPAB 2IIQA 1Q12A 5I7UA 5JY6A 1GGEA 4OY3A 1B2LA 1K8RA 4KDRA 4R05A 1KE1A 1NJSA 4KWCA 3U4IA 2XI4A 1NM5C 5K01A 4Q21A 1A5ZA 1ZD5A 2E37A 4HNSA 3JQCA 5E1OA 3V80A 2AC7A 2FJPA 3E2IA 4WEQA 1YKFA 1PTJC 1YS4A 4ARZA 5HPYB 2HRBA 4BNVA 5HK9A 1A9SA 2QX9A 1JSXA 1MH1A 2B7BA 3TO5A 4BLOA 4Z49A 1J0AA 3HTXA 4KKVA 4M1TA 1XWWA 3WIEA 1S1MA 3LY8A 3GFRA 4C0BA 3HGMA 3KJZA 3O8QB 2WE8A 2XRFA 4Y2VA 3FY4A 2HT6A 1C1HA 4GXQA 4I9HA 1SBNE 2ZJAA 1NNI1 3PVCA 5A3RA 4ZQGA 2G6BA 2P2CA 4EJ6A 3S2FA 2HXYA 4RF3A 4ROTA 1QVRA 2XE6A 4PLCA 3CUKA 4ER5A 3OQ1A 1R4MB 1XRPA 4TTPA 1WBBA 3L05A 3ASUA 4LGMA 4QTXA 5D6NA 3X1YA 4DLRA 4OQNA 1NOIA 4BMCA 1P33A 3VKWA 1CS4C 2PUEA 1Q6ZA 3JQFC 3KTAB 1LRKA 2R1UA 5K2OA 3RFFA 3DFKA 2H9IA 2ZITA 4DJJA 1PG2A 2UYYA 4KQKA 1PE0A 1V96A 3RDPA 2JKVA 3V55A 3TLEA 1Y8RB 3H4MA 1G8JA 1E5LA 3JQGA 3WYCA 1MIHA 2WSBA 1E3IA 4FFMA 1W8DA 4FLEA 1XJCA 2W2MA 2IUUA 2GZSA 3A1DA 3K4PA 1ZN7A 3Q6MA 4L3OA 3PWZA 2P9HA 3QX9A 3FNHA 5P8WA 2ZSEA 4P53A 2E4AA 2L42A 4PZZA 3TLGB 4AJEA 5JI2E 3EQ8A 4KR2A 5JD6A 4ISBA 4PN3A 2VAMA 4L76A 3G6WA 5A62A 2VDLB 4LHEA 3S7ZA 3P26A 2XQFA 3ADPA 2WMYA 3PR1A 4J3FA 2C5HA 3OBBA 3DXZA 2PPVA 1GUZA 4H4DA 5LMNB 4DN6A 1Z6XA 2JFGA 1G20E 1NJ8A 3AB8A 3Q9LA 1CUBA 1Z0IA 3H9UA 4OGGA 2LXNA 1QJ4A 2BISA 3K0FA 1EAMA 5KPDA 1THGA 2P4HX 5CHEA 4C6HA 3WG9A 3NTXA 5HVNA 5IXJA 3TE6A 1JLLB 1GZ5A 5AK6A 4BN5A 2OQIA 5L40A 4B5LA 4IUBS 2N46A 3OFVA 4TLLB 2CLOB 3A0UA 2BW0A 3FPFA 2DTEA 3G0OA 1YNSA 4JUIA 5ES3A 4YUAA 5LQUA 2I6UA 1BWRA 1SC6A 1J70A 3DB2A 4HWRA 4QJ4A 3DPSA 1FP4A 1NSTA 4I8XA 1JIJA 2IL1A 4OOFA 2CY0A 4P22A 3VPHA 1UZAA 4I2VA 1SBIA 4MEBA 1P60A 9ABPA 2AZMA 5D85A 3T15A 5A7FA