5FORA

Cryptic tir
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
131
Chain Sequence
GCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQILTHRLGPEASFSAEDLSLFLSTRCVVVLLSAELVQHFHPSLLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Toll/Interleukin-1 Receptor (TIR) Domain of the B-cell Adaptor That Links Phosphoinositide Metabolism with the Negative Regulation of the Toll-like Receptor (TLR) Signalosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1
total genus 41
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18567 TIR_3 Toll/interleukin-1 receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 5forA00
1FYVA 2JS7A 4C6RA 4C6SA 1T3GA 3JRNA 4FZ5A 3OZIA 4DOMA 3UB3A 4LQCA 2J67A 4EO7A 2Y92A 3UB2A 2Z5VA 4W8HA 1FYXA 4C6TA 5KU7A 5H3CA 2M1XA 4LZPA 1O77A 4C6TB 3UB4A 4C7MA 3H16A 4LQDA 4OM7A 5FORA 1FYWA 4W8GA
chains in the Genus database with same CATH superfamily
2QG6A 2WHEA 3FUUA 4DZZA 5THXA 3ZKAA 4QECA 3ZHXA 2RH9B 4PC2A 3FHOA 4EW3A 2HV9A 4JQCA 1GRCA 2BF4A 4GL2A 1NN0A 1V39A 4G1BA 1WTAA 3I6ZA 4LVOA 1XMJA 1MQSA 5CJPA 2XY4A 1NFRA 2D0IA 3GZJA 5F9MA 2CUZA 4R83A 2NLOA 4KX5A 3LUAA 1I6KA 1XWWA 3SK0A 1TNDA 1OTHA 2PFKA 4F96A 1LCIA 3FIUA 3KQOA 4W6QA 4Y2UA 4JJEA 3CZCA 2R8EA 3I2FA 4IRMA 4ZQBA 3WDSA 3TFOA 3WOHA 3PR3A 4BASA 1BH6A 1M6YA 1ONPA 3EXAA 5DHQA 5JRDS 1Z6GA 3ZLVA 1CZNA 4TKVA 4QXPA 3HCRA 5C4GB 4W7HA 1E6KA 2RAUA 1EUDA 1GU1A 2N47A 2PUDA 4J29A 4XVQA 4YP0A 1U28C 3DDCA 1GYPA 4LF5B 2XXBA 2FSVC 3H1GA 4CJXA 4I8IA 4UARA 5FBKA 3MSCA 4GPTA 3CSDA 3TSCA 1ZW6A 3N28A 5K4AA 3U3ZA 5KYYB 1FLNA 1QHNA 1RZUA 2WTMA 4TTVA 3KQUA 1DQPA 1IPHA 3W2EA 4M53A 4B3MB 2NZVG 1ZSYA 1VL6A 2HPVA 3AXSA 3OUUA 3GGGA 4M8KA 5EUMA 1TTHA 3BXXA 1P72A 1IYZA 1UBTS 2VWHA 5DBEX 1MT3A 5EJMA 1LPPA 5LB2A 2EX4A 1LA2A 1P45A 5C5EA 2PZMA 1OV4A 3BGWA 5BOSA 5CJJA 4AIIA 4IS3A 1KJYA 4WSOA 2OPBA 3AZOA 4DRXB 2PQ6A 1YIOA 3WA7A 1XK7A 2JGFA 4R5MA 1F60A 4LJ8A 1ZCJA 3THYB 2XGOA 5B1YA 1VL8A 3NHYA 2B4KA 3PF8A 5L3RA 1L1FA 1YI8A 4MKRA 2YW2A 5TQVA 1HLPA 5JROA 3FSEA 1AKTA 2I3GA 2GKOA 4MO2A 5L3SA 4MYTA 3GRKA 3GPLA 4Z86A 4C0LA 3PA6A 4WN9B 5CU7A 4TTSA 4M21A 3BGSA 3K0CC 4NEHB 1XZLA 4CV3A 4KVAA 4KDCA 1T9HA 2D06A 2YIJA 2ZSBA 3FB1A 1ZVJA 4DV3B 1Q84A 3RC9A 2J5RA 3KVRA 1LZLA 1W96A 2GAOA 4E08A 2IDJA 3P2EA 1XTKA 4XR9A 1QGDA 4ZEOA 3OHPA 1HT2E 3SM9A 1EHCA 4PNPA 3ZWKA 3SHOA 3DEAA 2OXIA 3TKAA 3WNQA 4F6CA 1M1ZA 1LQ2A 3AVTA 4ZAVA 2HYDA 4CQJA 5TPZA 1AVTA 2OWDA 5IX8A 3LUGA 1NQVA 3MWDB 5C7YA 1UBNA 4DEXA 1SHTX 1Q7BA 3VNVA 4QLOA 1KYIA 5E9AA 1D8TA 4J75A 2W2MA 2XWSA 1JHPA 2VJYA 3ZTTA 4F5WA 1PGPA 2YWCA 3FMIA 4DJ5X 3U48A 1QHEA 1CQJB 4LCBA 3RREA 1QP4A 1U2ZA 4B74A 3DFFA 4WCVA 2BH2A 5JISA 3WLPA 4QELA 5KJ1A 2OZVA 3OESA 2YFQA 2RG7A 2QP9X 1R4AA 2FVYA 2AFVA 4O2LA 4X3PA 1JAIA 4MWBA 3QI7A 3VC3A 1UFQA 5TS2A 4IKOA 3MTQA 3PJRA 3ZHVA 1QK4A 4EY3A 3FE2A 4R9VA 4WXEA 4ZZIA 4JUAA 1NWHA 5KDDA 4D8TA 5C4MA 2C95A 2IZZA 4CQLB 3RS7A 3HWSA 3CC8A 3G5TA 2WU1A 3KTDA 4UOEA 5JATA 2YKGA 5CB0A 3VYRB 4RSGA 1ZMRA 3QXCA 4XYBA 1JB1A 2A0WA 5CB6A 3BCUA 5F7JA 4EPRA 2YMQA 3Q87B 2PSEA 2BC9A 1PL7A 3FLEA 3MAJA 3FMGA 1H4SA 1HG0A 2NSYA 1WHSA 4TLCA 5REQB 5SY9A 3ZH2A 2DR2A 3E23A 1FPMA 4I9UA 5FB3A 3DMTA 3IP3A 5DHUA 1EJBA 2CNWD 1GEEA 2LIPA 2R6JA 1U3DA 3H9GA 3KAJA 3MD9A 2P9TA 3S1AA 4Q4HB 4BLTA 2QE7A 3FCYA 1G38A 2WMDA 1O5IA 1Q0HA 1XDSA 2A7QA 2OOSA 4BGIA 2VYVA 5E6SB 4WERA 4RTQA 3A14A 3N6RA 3ZCVA 1A9TA 1A0OA 4LBYA 3AL2A 3DHNA 3WGVA 1I1HA 3UATA 5JCZA 3HWWA 3R23A 3T1NA 2LNDA 4MITA 4PLYA 4LRTB 5LWHA 4DLZA 3K71B 2IVZA 5COAA 3SMVA 2QGNA 3KZCA 4XCVA 3VZBA 2OZLA 5KX5A 2UV8A 2WSSD 3G5UA 3KTFA 1N3YA 3STUA 2OXEA 4FFBA 5JVDA 3EPPA 3O9ZA 1KDRA 3N8HA 4KPFC 4US0R 3BC1A 2FN9A 1C80A 1G3RA 2OHJA 3NIBA 3ZK9A 4BTLA 10MHA 2A6PA 3M5WA 1J9ZA 1HDGO 1KJZA 3AKDA 1ADCA 1HFEL 3NGXA 1MN6A 1LX7A 4IG9A 4Z9YA 3KLPX 4FYHA 4HWSA 4ASUA 2OC9A 4BBZA 3PKIA 3ESQA 3MMZA 2BBSA 1CR1A 1BA3A 2PRZA 3FMOB 1K8YB 2WP0A 2VUUA 5L6MB 3K15A 1VHTA 2BTQB 1DKNA 4M9UA 3UWOA 1ECJA 3K5WA 3RHZA 1Z82A 3TLCA 1G21A 4NEQA 3GYBA 1RHJA 3DL0A 4HFRA 1GZUA 1VL2A 2NNLD 1KXZA 3EPJA 2FPMA 4DCMA 1K8RA 5KJEA 4HDNB 5DN6A 2B7CA 2X1MA 4U7PB 3UYLA 5KPDA 2PUCA 5F3RA 4W5NA 6ADHA 1TYAE 3UMYA 5EHNA 4I1UA 5F7ZA 2GKGA 2NSHA 1EVQA 2BUBA 2R8BA 4LMBA 4DJDC 2COEA 3IB6A 1BHJA 5IZ4A 3BSYA 2QMOA 3HP4A 5CNJA 2IIQA 4F91B 1N2JA 2HSEA 2VK4A 4KO3S 1T0UA 3DA8A 1NYRA 4I7EA 2PJZA 4UMEA 1L7NA 5A04A 5C51B 2OBYA 2X9GA 5EE5B 4IQFA 3RS9A 4BFXA 1KJ8A 4HS9A 2I80A 4BJ1A 2NTYC 2JAXA 5JYCA 2PX3A 5TVGA 3E4DA 3Q3VA 4KQWA 4TLLB 4XQGA 3THYA 1M2GA 4P33A 1JQJC 2IEDA 2PSDA 3GELA 3L84A 3NDPA 4R69A 5J40A 4UVEA 4A82A 7GPBA 4S1VA 3OH8A 3SQDA 2DCUA 5IAOA 4TWZA 4RVDA 1X0VA 1XU9A 3RNOA 2XCQA 4CMIA 2PG3A 1H69A 1K9VF 1P5HA 2JGLA 3PXDA 3QLJA 4KB5A 4C89A 2AE1A 2V1XA 3PUZA 1R4NB 4V0MA 2CVHA 3V9PA 1U2RA 4C7KA 1UAGA 1PT6A 3UMFA 1AKYA 2VDKB 3GN1A 1B41A 1I4WA 1ORDA 3CB2A 1BWSA 3FPCA 2AWNA 6GPBA 1FVHA 5JXHA 2YINC 1P3JA 1UWVA 1SVNA 1YOBA 1J9GA 2HJVA 3B1VA 3D6MA 4KSBA 3HO6A 1H5UA 4CMHA 2FPPB 2VAXA 3I53A 3MGCA 4BN0A 4D92A 1Y7PA 4LNAA 2JLCA 4GFDA 8ADHA 3R3YA 1HK7A 1ABFA 1XHFA 2ZRDA 3B3FA 3VHRA 2ZJZA 3GEHA 4BB0A 5EIFA 1V5IA 1Y6ZA 5KEIA 2FPRA 2OG2A 3K9HA 4Y0NA 3EDQA 5EC8A 3U3OA 3DMRA 2E21A 1KQNA 2R8YA 2WV7A 4CG1A 2FKNA 5BV7A 2ZE6A 3NOXA 5FPYA 2HMSA 3LZDA 1O3YA 1LRLA 2FN8A 2PLRA 2MSEB 3AVQA 3LPMA 3GRUA 1JHMA 1DLJA 3C15C 1GGKA 1B00A 2GD6A 1QAQA 1MB9A 2XQGA 3LYUA 3O03A 4EHBA 4MQEB 2CB9A 4B2LA 4RPHA 1JIKA 1IXZA 3CVJA 4H7FA 4B87A 4A26A 1DX9A 4G37A 3RADC 1Q74A 2XVZA 5JADA 3GP8A 4J1TA 2PBLA 2GBCA 4MQFA 4X85A 4E5UA 3A6KA 4KQFA 1FU8A 2JJ1A 1OZAA 3QXSA 3OLYA 4ZGBA 4H7JA 5KHLB 2GETA 4X84A 3D1JA 1JHVA 4B76A 5IJ9A 2BMJA 2PBZA 2PVPA 3NBUA 2WJYA 3JV7A 4RK0A 2PJUA 1Z0IA 5B12A 2CJWB 3OQIB 4PLCA 4GDFA 2YXDA 3AHIA 4WN9A 2P41A 3PRJA 4Z9AA 4HRVA 1PE0A 1J8DA 2CDRA 5E38A 3H16A 5E4FA 5IKMA 3DQPA 1C3OB 2XB2A 1TADA 1SUFA 3W2IA 5E3IA 1Z37A 4CEIA 4E15A 4Z0PA 1E96A 3HFJA 3RC2A 4Q19A 2F1HA 3W3AH 3O7WA 2Z8ZA 5EE0A 3ZDXB 1Y3HA 2E5LB 2WZBA 2X6TA 1RKVA 3RABA 3TD6A 4G0PA 1K7SN 5L3VA 4G4JA 5AVRA 1O5OA 2PKRA 5IM4F 2X3FA 2X9LA 2SCUA 4D3YA 3PX2A 1Z7BA 1A71A 3P97A 3F3KA 1K4MA 3BX1A 1KKLA 1HGXA 3BHNA 4ITRC 4N8SA 3ZBUA 4F5YA 1RXSA 1G5PA 4KJXA 2GFIA 4PGAA 1IUOA 1GZ5A 5EAIA 4MDFA 4FYPA 4PYMA 2JFHA 3N58A 5DBOA 5JZMA 3ONFA 3D6AA 5JG7A 4YDQA 4JI8B 4QXAA 4DUPA 1VMAA 3MTGA 2XTMA 3MBIA 3W6OA 4KQ9A 3KKKA 3IUSA 4GBED 2Q5EA 3QF7A 1JEAA 2QRHA 3JPYA 3MJ4A 3FJYA 4R2HA 1A88A 3L7JA 3JAKA 1HE5A 4LYAA 2WFLB 3O94A 2G1AA 3LOUA 3PEUA 2PE5A 1G9XA 2A9PA 4B7XA 1XZDA 2D6FA 1UZLA 1J8FA 2DJ5A 2QW1A 5SY6A 3IOYA 2P0AA 1QYWA 3V4PB 4J9UE 4JT2A 3BWXA 5NLLA 2W4QA 3TIIA 4DJFC 1L9KA 2H8KA 3W5VA 4OQLA 2RGNC 2HK7A 2CLIB 4RK6A 4S0XA 3ZHRA 3U9SA 4CIBA 3IDQA 3JQEA 3K1AB 4L08A 1U65A 3C3MA 5KNBH 5KSYA 3DMHA 5B5SA 5TJHA 2ZDHA 1D8AA 4QYTA 3OKPA 4UTRA 5DBGA 5C8YB 4RK1A 1U9CA 2H4WA 4NRDA 1EX7A 2ODEA 2POQX 3L5KA 4C29A 2W2KB 5I9BA 4KE7A 4IF6A 1ZITA 2PTGA 2J5KA 4ND1A 3LA8A 1WP9A 4EMBA 3C87A 1DIHA 1RYBA 4R8RA 1NVFA 4LPSA 4EUEA 4QT4A 1YZVA 3BN3A 3BWVA 1ZN2A 3QPUA 1UJ2A 1Z06A 4TV9A 2W70A 1NPTO 3C6MA 3TNYA 2Q1UA 3K5IA 2VKTA 2OO5C 2QRLA 3GPIA 2PJDA 3ORRA 5JV5A 1TTQB 5EA2A 1MH9A 1XZHA 3N8KA 1S1MA 2EJWA 3WRYA 1FYWA 1U5BB 2KBFA 4PVDA 3CSUA 1GNRA 2ATEA 2F8LA 5FL3A 1VKZA 1PFWA 4B3BA 3CNQS 1S7CA 2JS7A 1XCMA 4FS8A 2I03A 4AUKA 4OQFA 4EAAA 5LD2B 1KMHB 1R00A 2DH6A 2G9UA 2XRYA 3LRXA 1KOJA 5EXSA 5JXGA 3DBRB 2XUIA 2C7GA 3M49A 4BC0A 2ZAMA 4C0SA 5FI5A 1WP4A 1JPNA 4CQMA 5C5DA 1LLDA 2UUAB 1B8NA 2IYVA 4CQMD 2IBSA 5GM1A 4YROA 3KYDB 2XIJA 5ILGA 3WYDA 1KAHA 4U9HS 3QQPA 5LL6P 1S96A 1A27A 4QOJA 4FINA 1L5MA 3AGPA 4B8YA 5EP1A 3R6WA 3N2YA 3PEFA 4FZJA 1TCBA 1VHLA 3K20A 3DCYA 4UTNA 5IAGA 3V1MA 5F2KA 4A91A 2Q3HA 2GCIA 1QRRA 1N2CB 3TSAA 1QH9A 5EQDA 1G3IA 3P71T 1ZONA 1BW9B 2OQ2A 3T9CA 4MMYB 3OM1A 4EZIA 3FR8A 3PHCA 2DR0A 1Y6JA 2OV2A 4NR0A 1FBTA 3OZBA 3QEOA 4JLAA 2XWQA 1UZUA 3IAEA 1RVDA 2IITA 1J8QA 3NZEA 3E6AA 1VGQA 1OZFA 3QTTA 1WV0A 4FWIB 4C4TA 2QL5A 1RM4A 4KRYA 2GPAA 2FFQA 2IZ1A 5EIXA 1CSEE 1A1SA 1V2GA 2JEYA 2Y3IA 3N39C 3GP3A 5EWJA 4XH9B 3RU9A 3MUNA 1JHDA 1NUSA 3USES 3OCCA 2OMEA 2VXCA 3OF2A 2AE2A 4TLBA 2VQFB 3A8TA 4L8YA 5TMBA 2HTEA 1NNSA 3K7EA 4FQ5A 1BRTA 1TM4E 5HUJA 4ZK2A 3EIFA 4ZXFA 1NRWA 1VDMA 1JXMA 1D04A 2HHLA 3P9PA 4IGIA 2CK3A 5I3CA 3B2QA 1FIUA 1JP7A 2PEZA 4TROA 1FTWA 1VP3A 2VUHB 4NEGA 1DAKA 4UDXX 1NQTA 5BSEA 4F3TA 4ZI3A 3L7CA 1C4WA 1DPFA 1CUXA 3F2IA 5G02A 1JV2B 3RIXA 2G76A 4OGKA 4KBFA 4OLBA 4W9NC 1NP6A 2P2SA 5KBYA 5AJTA 2JFZA 2DPXA 3WISA 3IIKA 3ZTYA 5LC1A 1HTWA 1Y3CE 4CM7A 3N1UA 2PRSA 1JEDA 1LLQA 4MUXA 4JYPA 4E31A 3PQ3A 4B8WA 2AFHB 1IOZA 4DVGA 5EPUA 2JFNA 5AI9A 2FQ1A 4B3TB 3NOQA 4K0KB 1TIPA 3LT5A 3AW8A 3KL2A 3QVMA 5AVJA 3DTYA 3GB9A 4XGQA 4QXQA 3L4JA 4BUZA 3LJKA 1CRQA 4C43A 2CWWA 1TMKA 1P17A 2J5QA 5DTRA 5EVCA 2ZJ0A 4JVLA 5JVDF 2OEPA 5ER6A 5EMHA 1F1BA 3OEHA 3PGMA 2AA3A 4Y2HA 1DELA 2HXSA 1N3IA 3RT7A 2O1EA 5JRZA 4GOLD 3LUFA 3E2IA 3QUCA 5I3ZA 1ND5A 2BHNA 4UD2A 5CGQB 2PYIA 5EGNA 1FRVA 2F3UA 4PRYA 5IJ9B 2PANA 3W5HA 1NJ5A 1SC4A 1KFBB 1BGXT 3UXMA 3WFIA 3WLQA 1Z3CA 4DG8A 5B1DA 2C0QA 4XQEA 2C03A 3ILHA 4PPGA 4K1LA 4BO4A 3NWJA 4LRQA 1FS6A 1RAEA 1XD2A 3V1TC 2RHGB 1V4VA 3GAAA 1YQ9A 2R4UA 4GC9A 5DRYA 1YBHA 2A9JA 5LP6F 2XNJA 4J0CA 4RTMA 4BB6A 2C54A 1Y7HA 5EKDA 3RI3A 3TUIC 4N1AA 1MTZA 1YQUA 3GLVA 5EFOA 4ND6A 4LDNA 1YTLA 3T0GA 3A6ZA 4ZQCB 3PITA 4Z1OA 4BGDA 4C4XA 1GTZA 2XE4A 4HBGA 1KYZA 1PGOA 1YRBA 1NT2A 3DH0A 4NY1A 4P54A 1P0QA 3MTBA 5LA6F 1MCZA 1W93A 4B2IA 2J41A 2X42A 4WJLA 1WDMA 2JAOA 3FFAA 4KQJA 3FRHA 1OXTA 1M6VB 1HM5A 5F7XA 4L3VA 4YMSA 2M6KA 1RQGA 3IUEA 3NJRA 4MO9A 3SC6A 2EGHA 2OV3A 3DKKA 3FWZA 1FDWA 4NDZA 2EG5A 4MIKA 9MHTA 1ZI8A 2BISA 2O0LA 3RARA 4BMYA 2CFCA 2YHBA 3L41A 1OI7A 4OMFG 5TARA 3NRJA 3FPHA 4NXNB 4H08A 1A2OA 2JCYA 4RTLA 3Q2OA 1SOMA 1KFCB 1KJJA 3QVJA 3EGOA 2FMXA 4KQ6A 3QVTA 3S8EA 1C3VA 1NVXQ 3OZWA 3G7NA 1SVMA 3EVGA 3E53A 3JPWA 3JS5A 4GC5A 3DTNA 1UBEA 4R6WA 4XM1A 2FUNB 1V1MB 4L9AA 4D9IA 4L5IA 2O8DA 4X66B 1FYFA 2B69A 4LXGA 3PQ4A 4NONA 2FWIA 2N1MA 1BCSA 2PKCA 2Q0XA 1Y7LA 5IW8A 4MPDA 5HF6A 2APJA 1ZS9A 2L82A 2JIOA 3TECE 3SHWA 4ZDIA 2GN8A 5A7GA 3GLIA 5KWJA 1NNLA 1KJNA 1C30A 3V2IA 1C1DA 1MFPA 1UPCA 2JVJA 3KCQA 1NXQA 1PO7A 2WKPA 5HBGA 2WPDA 1JLKA 1U3TA 2IH5A 3TJZA 4D4JA 4EFNA 1NXWA 3TR0A 2OMKA 1NLMA 4Y1RA 2B37A 1GG5A 4LZJA 4IHJF 5T4EA 1CKEA 3T1HB 4IMJB 4M0PA 5FOWA 1BN7A 5D3MA 4U02A 2ZVQX 2A67A 3GT3A 2VF8A 3BGVA 2FG6C 3FTCA 4KACA 1H23A 3IBTA 5BSFA 5ALNA 3ZHCA 3VTZA 2YZKA 1XNQB 1M0WA 2VT7A 1L5HA 5DXJA 2VCEA 4H3VA 5FFNA 2AQHA 4AG3A 4YJDA 3Q6IA 4RGVA 2C84A 2LCFA 3C3PA 1WXHA 2XIQA 2IE8A 3M6XA 3SX4A 3JALA 2LVBA 3MTEA 3QKSA 4ES6A 1ISMA 1JNYA 1XZNA 2XNDA 4OOEA 1GPH1 1KI1A 2AG0A 3K9FC 1E3WA 1W46A 2YJGA 4WDRA 3O8OA 2WTBA 2OFFA 4B3JA 1QGUB 3IERA 5JCPA 4W5OA 4WFKA 3STWA 1YK1A 5KYUB 7MDHA 2BHRA 2B99A 1VSVA 2AT1A 2CJYA 2NAPA 3OHSX 1E2GA 4NBWA 3I0ZA 5HKAA 4LJ4A 4I14A 3OZCA 2G0AA 4HAXA 4K6OA 1SCQA 3BRCA 3KUDA 5LZ7A 3T3IA 5FV7A 3VVLA 2GEFA 4RAOA 1QFXA 4YAIA 4YIKA 4DLNA 3G1UA 4H7KA 1NC1A 4E5SA 1NW9B 4QO8A 2CZQA 3GLSA 5I7HA 1J2JA 2ZIFA 1PTKA 3M5PA 2AC4A 4B35A 4HZIA 1NE7A 3BRSA 3JZDA 4L5CA 3ZC3A 2BGWA 3IMCA 4NKRA 3SZGA 1ZYUA 1B8VA 4D98A 2EEPA 1YXMA 1YZYA 5D85A 2F9MA 1P2UA 2CXPA 2YDXA 4Y2QA 3RWBA 4EG3A 1DBIA 3UMGA 4K46A 4JUBA 3ON5A 2R1ZA 4TLAA 3C24A 4X61A 4L76A 1HZJA 1XRLA 3WXBA 3N2ZB 3PQ2A 3WYEA 4BE9A 2C7VA 5KS2A 2H3HA 3B9PA 1RI4A 4RFVA 3SKVA 3ZVNA 4AJJA 2PA0A 3BWMA 3DMNA 1GD1O 3VZRA 1XO1A 1QR6A 4HT3B 1ZGZA 821PA 4RIFA 4B3GA 3EBOA 4I2VA 3HJRA 2Q41A 1BMTA 1K5GA 2ONKA 3CUEF 3DAHA 4YAOA 2IQ5A 3WBFA 1PWZA 2G04A 2DUMA 1M2NA 4P93A 3T1OA 4NBTA 3UM9A 3Q4GA 4NENB 4DSNA 3IP5A 1JQ3A 1PEDA 2XB6A 4X1KB 3T06B 1CJUC 3B53X 2NV6A 3IOEA 3D2AA 5JAUA 1FRFS 1G8KA 3ZHZA 5A06A 5BOSB 2ZUVA 3RSCA 4ZT4A 2PS3A 2Q45A 3O90A 4IOKA 3O8NA 4K05A 1NBMA 3G0CA 2V5VA 3BXGA 2DQKA 4I4TB 3C6KA 5TQ0A 3EG9A 2W6JA 4RUKA 2V7QD 1SR8A 3T3MB 3VR3D 4D0RA 5JALA 3AY6A 2UYGA 3TE7A 2A5JA 4FIDA 1J1UA 3OT1B 4Q3DA 4PHHA 2ZRAA 2H59A 3OY7A 4XPIA 3JARA 2I6FA 2NPFA 4N01A 1C8BA 1VDZA 1W4AA 3JVDA 1BMFD 1E3JA 4XJTA 1BD3A 1F9EA 2O52A 1D9XA 3OZIA 3TM5A 1Y82A 4JCOA 2YWXA 1TVKA 1FVOA 1A1VA 1REQA 4EBBA 4KITB 1KOLA 4WZBE 4RPGA 2O4UX 4Y9UA 4DCVA 4G25A 5DM4A 1XGKA 2B0JA 2Q7XA 2ZSKA 3HCCA 4GF5A 1QNLA 2GJKA 4I4TF 4YAJA 4ZC1A 4EO9A 5TIIA 4QARA 2IOYA 4O63O 5GZ1A 4XI9A 2ZSHA 2NYAA 1OF1A 1RJ9A 3FNBA 3IT3A 2XUDA 4IJVA 4R1LA 4G0YA 3SDBA 2HADA 5G4KB 4NZNA 4UUBA 3FVTA 2CE2X 5EEHA 1G2QA 5K7SA 1WSDA 3D8BA 1QZZA 3KSMA 4MVJG 1GFWA 3FVQA 1ZIDA 2V7WA 1X8LA 4F4UA 5K01A 1KR5A 2AV6A 3HLKA 4PZZA 4V0ME 1KOFA 2ANBA 3GA0A 3IAS1 4KK3A 4OYYA 4TMVA 3LG2A 3V33A 4U7FA 2C5FA 2WEKA 2IYUA 1EFVA 1OKKA 4LC0A 5DTJA 3W5SA 4B4WA 1YU9A 3ZUGA 2BFCB 3LZCA 1VLLA 2UZ0A 4G0QA 5DU2A 4CL2A 5BN5B 4A4DA 1FJ2A 1CQZA 1II9A 2FCRA 1OGIA 4RXMA 4ZRDA 4HUTA 3PUKA 3GLRA 1E1QA 2R48A 4O4JA 3RANA 3FOBA 1YFLA 2ST1A 3BE4A 4IHJA 1VLJA 2CLMB 3QWBA 2OYSA 5KYNA 3NTUA 4B7CA 3GCGA 1FNMA 5K8JB 1RWBA 1RE1A 4JUCA 5BYKA 4AQYB 3OM9A 1JHUA 1T1GA 3K72B 1E32A 4IDFA 2QRPA 3D4OA 4NYJR 4Y67A 3IT1A 5KNDD 4U8HA 3JSXA 1NBAA 2A9KA 1K9SA 4V0LA 3EVEA 3CJTA 1J5XA 3AC0A 2V7VA 2LCIA 1LFDB 4YT4A 5LZ2A 1H65A 4CE6A 4NZPA 4HDCA 5A02A 4WJZA 4ARZA 4F93B 2HBYA 5JWHA 3THWA 2OECA 1PK8A 1ZZEA 1B23P 3ICPA 3LWBA 3IAUA 1SUCA 3BQ9A 3DLBA 2JARA 5K0ZA 2PMEA 8MHTA 1FNNA 4TQUS 2VPTA 4IYJA 2ORYA 3R76A 1MMFB 3E7DA 5B2FA 5CDYA 2J31A 2XSZD 1SN7A 2YQ5A 2I76A 4CMEC 1GNQA 4IIXA 2F55A 1UFKA 3L43A 1XL0A 1TAQA 4R8KA 3EODA 3ZIDA 4QFBA 4WK2B 4BRZA 1LPMA 4G5FA 3ZGZA 4B47A 2UYCA 3LPDA 4OLFA 3U7GA 1P2DA 1TO1E 2XMGA 4PQRA 3WL3A 5KTNA 2EJVA 5LYJB 4OM8A 1RHKA 1XB2A 4KPGA 4BJ3A 3IUJA 4U7GA 3EUAA 3UWKA 3P52A 3QBVA 4C06A 4UPEA 2JA1A 3DBLB 4QDJA 4QOHA 4EPYA 1GUZA 4G8BA 1P6QA 1TKRA 4HNRA 4B6EA 2PUFA 2EGGA 5K09A 4NYIR 2W11A 4C3VA 5CFPA 1ULTA 3OQHA 4QHTA 3IV6A 1FS4A 3ECAA 5CIQA 3UPTA 1TU0A 3ILVA 2IWRA 2V1UA 3J81k 4RWZA 1D5WA 4LK2A 5K2MA 3A1FA 2WIGA 4LMPA 3LUJA 3EPKA 5F4ZA 3Q3CA 1WNTA 4KMMA 4Q39A 4WZBA 4YO8A 3CZPA 4ZO8A 2PMCA 2ZQYA 1GFSA 1NFQA 3IT0A 3W06A 5JQGA 3RK4A 5LOVA 4DQUA 3FBWA 2H7VA 1NJFA 4MK4A 1HQKA 1R9NA 1TW2A 3C98A 4OIFA 3RC3A 1P4AA 4YXWD 1T3TA 4UU0A 4XKJA 3QITA 3ZNQA 4AO7A 5ALOA 2K2QB 1XXHA 4ENSA 3L4KA 5C3MA 2XCLA 4FMPA 4BNTA 4UTXA 4UNNA 2GM3A 1R5JA 1ZX1A 2J3JA 3K0BA 1Z29A 4IV0A 1A5TA 4PM4A 3ECSA 2YWEA 4EI9A 3U1BA 1JLSA 1R74A 3DMYA 3L7OA 3RC8A 3GY0A 4DBVO 2J0UB 2P2NA 2QW0X 1ENPA 4F9GA 1WETA 5EE1A 1T5DX 2YX1A 4TUYF 4CM8B 4KYIB 1H0KA 3PCXA 4IM7A 5F4BA 5B3AA 3TBKA 3ROGA 5HA5A 1JAXA 1U1CA 2BGJA 4Q9JA 4P3NA 3R6LA 5HUQA 4E2WA 4BZXA 4OF4A 3GF4A 4K6HA 4L4RA 3TRFA 3M3PA 3IR7A 2R86A 1JDSA 1JWBB 3P0HA 1IXSB 2W2NA 4ZYXA 5KQSA 1C0LA 4OQ4A 3MWEB 1ZK0A 3R0VA 3HA5A 3L6DA 1MV8A 3UMMA 1GPDG 3ANLA 3OLWA 4HEA1 1M0TA 2HXYA 4Y6OA 2QLFA 3UO8B 3GR6A 4I9NA 1N5MA 3W77A 4X41A 3NIGB 4MI3A 1FLVA 2IL1A 3L8CA 1CF2O 1O87A 1TX4B 2QPTA 3WMGA 1KI8A 4X91A 2IH4A 4CLOA 3KQYA 5ECGC 3UK7A 7ABPA 4TQAA 3G9ZA 4YCLA 4IIBA 2DLCX 1LBHA 1AKQA 1AB5A 2ASEA 1VBMA 1XRQA 4OQNA 3WLOA 2CYCA 3H2KA 4UDOA 1T0BA 2NZ8A 1HNNA 1YC2A 2YHAA 2HQBA 4RMGA 2GLXA 3PJEA 3SX0A 2UZ4A 3EEBA 1Y8RA 1DAPA 4D45A 5HM8A 2HK6A 1P7VA 1XMSA 3ESYA 5K05A 5C35A 5DMXA 1EUYA 2BI8A 1T5HX 4AT1A 1LSUA 1MA3A 1A7AA 1P73A 2CVQA 2X0JA 3ABIA 2FEAA 3M4XA 3O2QB 2VUTA 1QRUA 3NNNA 1D1SA 1PS9A 4XX1A 4CVNA 1QTNA 2P0YA 4JVSB 2P5YA 1DI0A 4F2PA 3V7NA 4GR9A 3IPRA 4F0JA 1KO4A 1JQBA 4CLXA 4AJ4A 1QV6A 3OJFA 3SZMA 2QK4A 4H3HB 3OVMA 1MT0A 2ZI6A 2E4VA 3IJEB 3V32A 3BWEA 1E1CB 1CR2A 4LI0A 4U6SA 4XOUA 4N3CA 3U4AA 1D2NA 1BQ4A 2JZNA 2E4UA 3C4QA 5TQ2A 2IXFA 1EFUA 3S1LA 2YQZA 3CY6A 4OHOA 4BVLA 4P36A 4TN5A 4WL0A 2WF8A 1AKRA 2HDNB 4Z8YA 1QOPB 3AB8A 1EE1A 5IKPA 3D31A 4HSEA 1E5XA 4JR1A 5FNVB 3RROA 3HYLA 3RS3A 4E12A 2AXQA 2OCKA 5D2CA 4BBAA 7REQA 1R6BX 3WJ1A 2GPNA 4ZC8A 3OD5A 4D9MA 1GNTA 1CUWA 3P2KA 4TMZA 4OUKX 2OZLB 2V74B 3EEIA 1XAHA 3M8KA 3ZZTA 4EI7A 3D0RA 4QJ3A 3SSMA 3LCJA 4EB3A 2FMHA 3M3HA 2ZS9A 3BIOA 2W43A 3DVAA 3C70A 1NYQA 3EXIA 2OCAA 1YR7A 1TM2A 3M2TA 1OA1A 4IQ0A 1GQSA 5EE3A 1DL5A 1UBFA 1DXHA 3NW9A 3PNQA 3PVCA 2HXGA 4A8PA 2UZ1B 3OPVA 3TLKA 2YHIA 3L6CA 3BXEA 1TZ2A 2Y05A 3OIYA 3JQRA 4EG4A 1K89A 4MA0A 4GYWA 1DKUA 3NTVA 3TZBA 3A6PC 3E3LA 2IV2X 1M5UA 1SWWA 4BNJA 2QT1A 3L6OO 3OE7A 1N5LA 1ONOA 4K0RA 1VC2A 4QWMA 3SZLA 1BGWA 4B9AA 4AQ7A 4XDHA 4K81B 2CFIA 4PC6A 4QXOA 1PZFA 3IP7A 4EA9A 1VG0B 3CNLA 2F1IA 3CRW1 2UVDA 1BO6A 5TPWB 3LPLA 3FZEA 3C4JA 4LJRA 5GJBA 2JLSA 4ZI5A 3TVYA 1RQXA 3T7SA 3GLFE 2QTRA 3W5IA 1BYIA 2VI5A 1IUKA 3PD0A 2BHTA 1P7ZA 4U2BA 4EF5A 2QIOA 5TPWA 4XARA 5DGIA 1P33A 5A9RA 1XTQA 1K88A 1R0WA 4F45A 1BE1A 3AKCA 3MS4A 4IDHA 4KXQA 3GAMA 1SKQA 1RW4A 1DJOA 1O6BA 1ABEA 3NC0C 3RC7A 1LDYA 4DKXA 5EE9A 3WRWA 2AK2A 4DDVA 4KREA 4KYUA 2G40A 4LJAA 4MVJF 4XWTA 4ZYZA 3QKSB 5DEIA 2C4WA 3K09C 5KTSA 1WHTA 2AOTB 1ANKA 2V5AA 2BEUB 4ZTUB 1XPRA 1JLLA 1UINA 1ZD2P 2JH3A 2PRJA 1EUCA 2WMOB 3G88A 1V7PC 2JJ2D 3PP8A 3QHPA 2PJRA 5F3WB 3B7GA 4F4FA 2RHWA 1MORA 1EP9A 1VJDA 1ZD3A 2VYND 2VRCA 4GAEA 4OLHA 3RJTA 3WQRA 5AVSA 1R66A 4RW0A 1PAUA 2QBYA 3BD6A 4L5JA 4X65B 3GUYA 1L4BA 2YMMA 1PLLA 4YRCA 2DXIA 1W6UA 4C04A 5HQ3B 1GPJA 1JS1X 5FRDA 5KQRA 3ABQB 1E18A 1Z5OA 1GTMA 3B8HA 5BVGB 4YJ2A 1UP7A 3R40A 3QPDA 3FDXA 2PR7A 2D7DA 4BNDA 2P1ZA 3HB1A 1U9YA 2BM0A 5L51A 2HU7A 3SE0A 3WMXA 1TFRA 3DFMA 2R6AA 3PNSA 4HDMB 4H6WA 4OVKA 2JZOA 2Q5QA 4IIDA 1PYGA 1E4OA 4OP3A 3L6BA 5FHRA 7AT1A 3KB1A 4GP9A 4CKXA 2GRJA 1GZ4A 2I7XA 1EWRA 4D0SA 5B30A 5EIOA 3UB3A 5B7PA 3QWFA 5FJIA 1Z22A 2WJIA 1YK0A 2QLJA 4L3OA 1FFDA 5P8WA 1L4GA 5AW0A 4AF7A 4QTYA 1ZC4A 4AD8A 3BMOB 2DGDA 3PDHA 2AFHA 3AILA 1FUIA 2G06A 1XPUA 4NJEB 3HBMA 4GLJA 1IZ0A 5ENVA 4BP3A 4DMGA 4ECAA 1J4AA 5F1KA 4F3CA 1B0AA 1N6HA 1QTIA 2FMKA 4P53A 1DB3A 1QIJA 2H07A 4XX0A 2ZLBA 4DVJA 3WZMA 1MEOA 2OP1A 5IARA 1W87A 1KNQA 1X3SA 3F1LA 3FNEA 3STVA 2JLZA 2HF9A 3A4TA 3WIVA 3CXUA 1RPAA 5EIAA 4JL5A 3U16A 2PUTA 2W2LA 1SOVA 3URMA 5HRCA 1I4LD 2QKYA 5KJ6A 3U60B 4JLDA 2I2DA 2WZCA 4BNVA 4G9BA 1DG9A 4R01A 2W2PA 4PYRA 1NDQA 1UFOA 4RS3A 5DFAA 1Z0ZA 3RFVA 3BJIC 2BGGA 4CL3A 2DX7A 2WVHA 3QGMA 3PICA 1ZD8A 2D5BA 2H1SA 3UJHA 2CV0A 1JYEA 3B51X 1GEGA 2YYAA 4V0OA 1X1EA 4F12A 2RGXA 2H63A 4UBKA 4H9GA 3RVQA 2JFQA 1IDN1 2QSJA 3ACBA 1ISIA 4XDYA 3B1WA 3JAKB 4QUEA 1H94A 2G63A 3HDQA 1VBNA 4FEEA 4BLSA 2NO4A 2Q9AA 3GPBA 5JCJD 4DT1B 4Z1MD 1PW7A 3X2FA 4EMSA 3ZDAA 4OFZA 4RHFA 2HDHA 1E5QA 2HGZA 1UBKS 2VYCA 1YNSA 4LHZA 1A9PA 1XZQA 2JA2A 2YJ3A 1K3FA 3UJBA 2JLYA 4ITUA 2QLNA 2XYRA 3PXAA 3S8YA 2CGEA 2DU8A 2V0CA 1Z16A 2XX3A 1I3NA 4NJMA 4DN6A 2CNBA 4JQSA 4Q00A 1ZJ5A 1O6GA 1YB1A 4FFWA 2BM1A 2Q21A 3KQSA 4W1QA 9LDTA 4I1OA 1P1HA 3GT4A 4MUFA 4DLUA 1Z6PA 5DSTA 2D00A 3IEUA 3THXA 3IQZA 2FAXA 3EMDA 1IULA 5IUNC 2WD7A 1Q16A 3OWXA 1TEXA 1MAAA 5F2EA 5DOZA 3RF7A 2IHUA 1DG1G 3I2GA 4GXTA 3UJ9A 4Q4CA 1IBLB 3MYYA 2FHPA 4PGFA 3HCBA 3ZGXA 2HLNA 3LBNA 4LY6A 5D84A 4R8SA 5BN1A 1C4KA 1XZIA 1K06A 3GARA 2ZCJA 1LDMA 1Z2PX 1OLXA 1UPXA 2VDVE 1RAFA 3M34A 4HQRA 3SU8A 1TL7C 1YZTA 2QRNA 1ZVKA 1R6DA 2Z8YA 3A1SA 3JQ7B 3V7YA 3FX2A 4DUGA 4BQRA 3ICQB 4N9QA 2BGUA 2I7DA 2YNMC 3F9RA 4LY0A 5L40A 4ZD6A 1C0KA 2WM8A 2Y1EA 3E15A 4L4UA 3WJ2A 3DLPX 1P5FA 2EEZA 2ZSUA 4YJHA 1R9MA 2XAAA 2YWRA 3QNMA 3DBRA 3O1JC 3IA2A 4WWHA 1Z5PA 3O47A 4G8DA 1BRMA 3E05A 3B2NA 1Y80A 4PX5A 1ZOPA 4X60A 3D6NB 3UOWA 4MS4A 3UT5B 1A8IA 4GOND 5BT8A 5CXQA 4PLHA 2IF2A 3PUIA 1IXYA 3V4LA 2Y66A 2ZYHA 4OGWA 3O8QA 4ZVTA 3OZAA 4Z2YA 1GVHA 2AXPA 4LY9A 3BJRA 2AN3A 2XWBF 1GQOA 3L8FA 621PA 3A06A 3KYBA 4QATA 2WUEA 3LH5A 5ESWA 1YACA 4V3BA 5TNXA 3W6UA 2FLVA 1U4OA 4A92A 4C1BA 1ZJ4A 3FRIA 2AMYA 1P6XA 1VSUA 3K0KA 5KSZA 1BVYF 2PKQO 3DVRX 4MZDA 4YQEA 4W8GA 3ZCRA 3BRWD 1LK0A 4IO1A 2QJWA 2QIPA 4IEEA 1GGMA 2BAGA 2PBFA 4G0ZA 1I7DA 3F2VA 1XRNA 3S8MA 3NPAA 4MA4A 4E2FA 3IVGA 3TTWA 5LBIA 2Z83A 3OMLA 5KJCA 4DDHA 4DIOA 1U7PA 1OB2A 1KXJA 3HV0A 1HLDA 3HZZA 3L7MA 3OEWA 3QFRA 3O21A 4JGBA 2I3BA 4W5JA 4NF2A 3V1UA 4ALKA 5G53C 5HEKA 2R8RA 4O0LA 2FSFA 3JVIA 4UTZA 5KYWB 4MUMA 4YFYA 2VEDA 4TS3A 2X6RA 3PFWO 4LWOA 4C6TB 4C7MA 3VBCA 2EQ5A 2H52A 1ZMBA 5E1BA 1DKMA 2XDAA 5AKJA 5E7QA 4KPUA 3V46A 2R8PA 2EFCB 3AKZA 3ZGYA 4JT4A 3G85A 4IZHA 1FUKA 4NBLA 3LAWA 2WQZA 2AOTA 2QRUA 4GNKA 1V5EA 4KLRA 3IURA 1NW3A 2A1UB 2LKCA 1DAFA 2FZGA 3R7DA 3NYWA 4JUFA 3RQIA 2ZXFA 1D1PA 2VTEA 4AWXA 3BSFA 4XQ9A 1TAGA 4R7GA 3CLSC 2VQDA 4N7MA 2H6EA 1E1QD 1MRNA 1E3QA 2IZ7A 3ZQKA 3PEEA 3DDWA 2RGCA 1IFXA 4DA0A 4N3AA 1SC3A 3QYJA 4AY6A 4WTOA 4ZODA 1X7YA 3VMFA 4D0GA 2WHPA 4D1YA 1TEVA 3KLBA 4NS4A 2OXRA 4UASA 4XWYA 3RS2A 2VHXA 1ODSA 2OHVA 3TLEA 2OM2A 2XAUA 2QORA 2BMDA 2M9MA 3MEQA 4JYAB 2Q9UA 3PXXA 5J5VA 3SDZA 1MAHA 1O89A 2P7HA 3VU9B 3H4MA 1RQRA 4COOA 4N76A 3V8EA 4PICA 3OFSA 3AU9A 1I5RA 1PV1A 1IVNA 4X8LA 2J08A 1QGAA 1P1JA 2VPZA 4QGHA 4OQDA 1UPFA 3U44A 5BW6B 1L4EA 4JV5B 2IEGA 4KGZA 1H3NA 1CJBA 3EF1A 1OX4B 2CLFB 3V7UA 4EITA 2AN4A 4Z0HO 2MYNA 3AHHA 1U3WA 4MV1A 1I4DD 1YR2A 2BFAA 1ZISA 2YV3A 4WOPA 1M1UA 3RVSA 1HQCA 5KOIA 5LQRA 2WM3A 1HA3A 4X20B 4LMAA 4XLLA 4PLVA 2QD5A 2I7TA 1SB8A 4LOJA 4PFJA 2R7KA 3MXTA 2NVWA 1U8AA 1XZJA 2VL7A 3GG2A 3RIMA 2HLDA 3Q5EA 4HFNA 3BHMA 4XGKA 3PC6A 3EGIA 4KAFA 3OAAD 1ZUNA 5ITZA 2JGKA 3C1UA 5HE8A 1K6IA 3T99A 1OZ0A 1RJEA 1J8VA 4EJ2A 3KETA 5K6AA 2ID9A 1I8TA 4S2UA 4M1OA 4OU5A 3DO8A 4PSDA 2HUNA 1OXBB 1KH3A 1RXIA 1OH6A 1GG9A 1JGTA 4AKTA 2NPIA 1VP9A 3KKZA 3U5TA 1THMA 1Q44A 3U13A 1J25A 4WESA 3MB8A 4MAFA 1AGNA 3VI3B 3C3CA 2O4CA 2QMYA 2TMKA 3L7BA 4GR5A 2G08A 3N2IA 3UFXB 2WU4A 2ZSJA 3AZPA 1O03A 3PJDA 4KQHA 4Y6GB 3IV7A 2Y0CA 4UUPA 3R6DA 5DCUA 4DEVA 1WEKA 1V3UA 4NATA 4TYPA 3ZJ4A 2G9RA 5D1NA 4NZOA 1JHYA 2FFBA 3PRYA 4MUAA 4UOQA 4C5CA 2QE6A 3U7RA 3ESAA 4J7XA 3IQIX 3LNTA 4QQRA 3PYXA 4ZO9A 3OJCA 1IQRA 1ZC3A 4EHIA 2PU5A 1OI2A 4LEIA 2EFGA 1T9GS 1DC3A 3BFVA 4E11A 3VX4A 1ZR2A 3LDHA 1GXSA 1PR4A 4TTJA 4BBPA 2E4WA 3BHJA 4MQMA 3BZWA 4AZ3B 4FFBB 3MELA 2FGKA 2HYIC 2Y8EA 5HRAA 4HAZA 5JBNA 4JJKA 1F51E 4F3NA 2VRBA 2QLMA 1NLFA 1E4EA 3Q2KA 3IAAA 4Y98A 2R7LA 3AINA 3TW0A 2OENG 5IEBA 5EYPA 5FWYA 5MN5A 1AA6A 4ARIA 1JQKA 1VPDA 1GKUB 2HCTA 2AFHE 4O59O 4RHCA 4B3XA 3LBYA 4Z1MA 2BFBB 1Q91A 1LU9A 1QO9A 1KYVA 3THXB 1Z34A 5IK2D 2F3SA 2VSYA 3EXIB 4D8YA 1N75A 2CLCX 3SNKA 2AI3A 2O07A 2CNOA 1NBWB 4A36A 5JCXA 4M88A 1RTTA 5A1TA 4B8ZA 2ERCA 1HOXA 5C34B 2VYQA 5L7WA 3R9IA 3BCHA 4Q6WA 4LHWA 1T8PA 4BAZA 3K0HA 1UOEA 2FOXA 1CP2A 2JIZA 3H5LA 3L0YA 2FUEA 3RSLA 1M33A 4RMJA 1O6CA 1FTGA 1TKCA 1AV6A 4K6FA 2M32A 1R8SA 2IEBA 3HABA 4I50A 5INTA 3O3CA 3IEPA 3EVBA 1SUPA 3P8ZA 1D4ZA 3QBEA 1U9JA 5FOQA 1ZRSA 4QG7A 1RRCA 1PSZA 2YNMD 3B5JA 3I5XA 3ZGNA 4BVJA 2P6OA 3DKRA 2OYCA 1Z75A 2JAPA 2ZWIA 3ZE1B 3C39A 3LWZA 2GM9A 1V6CA 4C7OB 3F4BA 4DPMA 3ZY3A 5M29A 3VNRA 4C05A 4G85A 2BEVB 3FLBA 2C04A 5KDOA 3N9IA 5KNDA 1ZD1A 1DQRA 2CSXA 1TQDA 4XEHA 1JUDA 2FPUA 1L4KA 4IWNA 4MA5A 1MJNA 1F17A 2O7RA 1X7YB 2ZRBA 3A6EA 1XTVA 1NV9A 3BK1A 4MUIA 1MDBA 3A25A 4J49A 4X71A 1XMQB 3FHLA 2V9PA 1DNPA 3B3JA 5B58C 1UMKA 4CPDA 2OCBA 1J2EA 2C61A 3P2YA 2ZUWA 2RKBA 4UHCA 4O33A 3X1DA 4TVBA 3GCWA 4C4OA 4FFLA 3Q7PA 2ILVA 1H2YA 1HO3A 2LXNA 3CQ9A 3CVYA 3C97A 2DSTA 1TYDE 3HDVA 4X94A 4IFIA 4ML3A 5DHPA 1XTIA 2QTLA 3BBLA 1OX4A 1BWPA 1PJSA 1Y6RA 1BMQA 3GGSA 3WP1B 2J87A 3BMOA 1E4YA 5CB4F 4Y6LA 1BH2A 1DMSA 3WGKA 3ONWA 3VPCA 5B7QA 5DH9A 4XCXA 1PBNA 4MVXA 3ROKA 4YPFA 4JLSA 3FCAA 2AEJA 3RVLA 1RIIA 3A26A 3WYFA 3U39A 4Q4DA 1ZRNA 2M6LA 1KAGA 3KQNA 4M1MA 4Z49A 3TGLA 5E6RB 4FZRA 3G8AA 4QDTA 4D3XA 1U81A 3BSSA 3QK7A 5TF0A 2A7XA 2ZRPA 2HJGA 5M2QA 1Z39A 1PUIA 3EFBA 3K05A 3SR4A 4GLOA 4XSVA 2NU6B 4J6FA 1T1EA 4HLDA 3V2UA 5HX7A 3FDZA 4HADA 1P4HA 5JH7B 2FR0A 4MYUA 2VNHA 2FX5A 1VHWA 4R16A 1BJRE 2BT4A 5CURA 5LXTB 1F4LA 3RODA 4P81A 4C76A 3L6EA 1PR9A 1SUIA 4L9SA 4NARA 3HN6A 1HT3A 3IKLA 5A0FA 5EWLB 1RNLA 2ZWPA 3SVLA 4RXTA 1VJRA 2FP3A 1O97D 3UWDA 2XCIA 4X20A 1OYVA 2GBGA 4BTEA 2KS6A 5DWQA 4KBYA 1LS1A 4FLFA 3CWQA 2GJ4A 3AV0B 2Q5JA 3BULA 1N0IA 5J2TB 6REQA 3VJMA 1Y3DE 5BSWA 3LP5A 3D7RA 4JJ8A 4R1NA 3W78A 2R11A 4I5EA 4PR3A 1M74A 4WKPA 4M36A 4U2FA 1G3QA 2CJFA 2M1ZA 1E61A 3A9TA 3BRWA 3BUSA 4GPEA 3ADOA 3LW8A 4GZ3A 2OAP1 4X62B 4EJFA 2ERYA 1UMBA 2Z5FA 3NBZC 1KETA 2V9CA 2AC2A 4WNCA 3U56A 1G4UR 1LDEA 1MABB 2JRCA 2BMEA 4JC5A 1QH8B 4FYWA 1GZ7A 2EGUA 2RFLA 4LXHA 4XWOA 1Q17A 1BX0A 4K1XA 1SG6A 3U4QA 1O9GA 3DPIA 1D03A 1X13A 3IILA 4QU8A 4QUGA 5LXTA 3NDBB 3KR1A 1L7DA 3PXBA 1J1ZA 3UG6A 4CUZA 1I4EB 3VNBA 4I4IA 4QHSA 3FMPB 3ZYCA 1NV8A 2VH5R 4ALMA 1KQ3A 4I46A 1JAHA 1A7KA 4BKOA 1BAPA 1ZXLA 2A0XA 1U3VA 2J3KA 2J85A 3BHIA 4ZV9A 3KEFA 3NEAA 1EVJA 1NOKA 2ZDQA 3TR5A 4DNPA 4O1MA 1E98A 2W6CX 4DQ0A 4KIJA 3EIOA 3WLJA 1II8A 1G8MA 4EBFA 4WBNB 2PXAA 3AL3A 4DDUA 1XU7A 4H7PA 1G0NA 4DM7A 4R0MA 2J6CA 1BOFA 1WABA 4KPEC 1OLUA 1GLGA 1Z74A 4HH1A 1SQ5A 5H9WA 2BCJQ 3TZ6A 5AIBA 1VBKA 2F2TA 2W5UA 4I6JA 4F1JA 4C0JA 5JZ9A 3ULKA 5ESXA 4ZKEA 3EK2A 1N8KA 5HM6A 2VWPA 4CF7A 5GONF 4FKZA 3U4QB 2ADMA 2C5SA 3A37A 1Z2CA 2O9JA 3M6IA 4JP3A 4Y2XA 4B4KA 1UDCA 1KBOA 4YGXB 4ENWA 4LGVA 3AI1A 4JP8A 4BX8A 2KI5A 2GF9A 2Q5HA 3GROA 1RJ9B 1T0IA 3DS8A 1YVRA 3LHIA 4NESA 4RPLA 1D6MA 4B2YA 2FHSA 5A6VA 4WH0A 4YCNA 2OCLA 5BQXA 3VO1A 4US2R 2W6OA 1CUSA 4GKBA 1PDVA 3KQLA 4KIWA 1GHTA 4GO1A 3T1YB 3DNMA 3LKBA 3FBGA 1E1CA 3GLHA 4XPZA 3TXXA 1FP7A 4BO7A 1HEYA 4Y9RA 1U98A 1HE8B 5B64A 2UAGA 4TL8A 1UOPA 5C1OA 4L9WA 3UTCA 1L7MA 1BDJA 1H8ED 4IINA 4NYMR 1EDZA 2C00A 2DRIA 3Q8WA 1E6EA 3K5HA 2QUHA 1KVUA 2PGNA 1XT6A 4KW7A 4DNXA 1VPLA 1N2GA 5IHPA 4IJUA 2YQ4A 1AMNA 3R4CA 5DTMA 1XIVA 2WHYA 3M5DA 3R5KA 2NU7B 4MHSA 3H75A 3JQGB 1RHRA 1V4NA 1XTBA 1VPEA 2YRFA 1O4WA 3EHDA 4II2A 4MAMA 2ZB3A 4CL0A 1M5TA 3Q3EA 1QG4A 4X63A 3A4MA 4EAQA 1GYRA 5DN9A 2GAAA 5KAPA 5THKA 4QKQA 1XXHB 2QTBA 3P9CA 1RXYA 1AJEA 3VHQA 4UHKA 3GVCA 3V6LA 1SXJC 4PG4A 4DLVA 2ROQA 3A9SA 5AHXA 5BVHA 2JPDA 3KXIA 4I08A 1P4RA 2YXPX 4TRRA 5A5VA 1A9ZA 2CNDA 1RVV1 2XLBA 4W1RA 2QR5A 4KKVA 3GJTA 4MEAA 3IPAA 4PF1A 3QU7A 4C5AA 4OCZA 5FUYA 3FPFA 2GPJA 3WL8A 4D4MA 1IAQA 1P2TA 2HJWA 1I3CA 3T9DA 3EDYA 3N7AA 1AKNA 5KPJA 4G0UA 2NZYA 1IY1A 3ML1A 4ARCA 3BWDD 4MRPA 4GEGA 2R5FA 4LDPA 4RJ2A 3H5NA 2A59A 2Q9BA 3EQ9A 9GPBA 4FQ8A 3FYCA 1BMDA 1WSBA 1GY8A 1QHIA 3D3KA 3I9V1 1EK6A 2Y1WA 1P0PA 2CDCA 4QL3A 3GRFA 2ONCA 2CF6A 3T3EA 3ABRB 3GJ3A 4HCJA 5BNWA 4K9KA 1EH5A 1NP3A 1QB8A 1CUVA 3RGGA 3HJGA 3E1GA 3L0BA 4OXYA 1SA0A 4UU7A 2QPOA 1MG5A 1NY5A 3ZJ5A 2PZAA 3V80A 3AFHA 4B17A 4GZMA 5LMZA 3RAJA 1F12A 2XRFA 3AR5A 4Y2YA 1CR0A 1VHQA 1T34A 3OIGA 4REMA 1EK0A 3F73A 5I7WA 1N8NA 2Z1MA 4HD8A 1OVMA 2WUVA 4HPWA 1U7OA 5CDTA 2SBTA 1P18A 1TTPB 3RYCB 4DB2A 1DJNA 1Y5MA 2WTXA 3MTJA 3GGCA 3NV9A 5AI8A 5ESDA 4PGGA 5CX4A 1KSFX 3C5VA 3ZXYA 4MI1A 4AZVA 1NMXA 1EGHA 4P4NA 3E27A 1FFSA 3O9VA 3RG2A 2F3TA 1RI5A 1VGRA 1I30A 1QZUA 2B2XA 3AEYA 4K9QA 4OHKA 4MDYA 5K0FA 1EJ6A 1AQYA 2H1IA 2ZRCA 1OX5A 3NYIA 3TLGB 3R0IA 1GTJ1 4RZXA 5AVYA 2KMLA 1JN0A 2R8OA 1D6SA 2JGNA 3CB4A 5FPTA 4XB2A 4HLNA 4U0JA 3ONNA 3RAPR 4F60A 1Z25A 2CLSA 1U1DA 3M4ZA 4RQTA 4X5OA 2XI4A 5BPFA 2E6KA 1KHHA 4KXUA 4NTZA 5BSRA 4YPOA 4INPA 3VVMA 4HLQB 4M86A 3S2FA 1VE3A 3NB0A 3OA2A 1XQXA 3SE7A 2DKOA 5BWBA 1HFJA 3QEJA 2ISCA 3UMJA 1FUYB 1RS0A 2NZ2A 2PD4A 3AWIA 3FNIA 1PWXA 1QHGA 3I05A 4POAA 5C81A 4M98A 2QXUA 3H5RA 4IJKA 4URZR 4LZNA 3PYMA 4LYJA 3HCWA 2CHFA 2QRVB 4IL5A 4CKBB 1A4RA 1TGYA 3EFOA 5FNVA 4L8GA 3FUCA 3HKCB 5EWLA 4J1SA 1A04A 3G9TA 3GJSA 5AW1A 1E9AA 5KSOA 2QQEA 1ZM9A 5DT2A 5ALJA 3OUTA 1X2EA 1WU8A 1E59A 4RELA 4PPNA 2WMNB 4ZARA 5G0SA 4EUNA 1TB4A 2H2WA 2JBAB 3A04A 3LT1A 1Z47A 1L5FA 2B4TO 5HW0A 2QSYA 3INTA 3LQ2A 4HI0E 1SZCA 2WFZA 3C74A 4GOJA 4CCAA 1W2HA 1AUVA 3MINA 1U1GA 3OTGA 4OA8A 2W2QA 4R9UC 3ZU3A 2X3UA 3D3WA 5FULA 3GRVA 4XYMA 4ZT3A 3IUYA 3TNFA 3W8RA 4Z5XA 2BONA 4R0VA 2X0DA 1OE0A 2PAAA 4CL8A 1JDBB 1QTQA 3GNLA 1VJ5A 1FFXB 4O0MA 4CFZA 5AW2A 2CWDA 3B1YA 5LP6B 2PX4A 5JXWA 2ICAA 2BR5A 3DAYA 4ZVKA 1KMCA 1JT9A 1A3CA 4X6LA 1BEEA 1UC5B 4LXUA 3I2JA 3W0LB 3WWZA 4CTJA 1AZLA 1H2BA 4FVTA 3ZGOA 1IN8A 1SVUA 1U2QA 1ZQ9A 3VPHA 3RSFA 1LNSA 1AKEA 1L2TA 2O6HA 4WK0B 1FMFA 1GZVA 4MR9A 4KUHA 2NUBA 1KJWA 3ETJA 4ZRMA 5M5BA 4KAAA 2ZRJA 2YHIB 4ER3A 1ZM3A 2UUBB 3GFOA 3O31A 3DSRA 1V7CA 3Q72A 1PKXA 3DE5X 3EASA 4CM6A 2DFPA 4COKA 4F2DA 721PA 3N07A 5ALUA 3G0GA 4AG5A 2QTWB 4N6NA 4OK3A 1PR3A 3EAFA 3TXAA 4BFVA 2PIDA 2QZJA 3AR2A 5GINE 4O2AF 3D8NA 5I9SA 4EYSA 3UOAB 4F7WA 2O2HA 4ZCQA 2XZOA 3H0CA 4BC1A 3RSGA 3FKSD 2I4MA 5IK2A 4S1OA 4N5MA 4RPKA 2AXEA 2D4HA 1FDSA 1Y3AA 2OHIA 3F97A 4K86A 2CL5A 4KH1A 5F78A 4EYGA 3QY9A 4PXYA 4GUDA 1L7OA 2Y0EA 3ZXUB 2PNFA 1MB3A 2I2FA 2V4UA 1JKJB 5HHTA 2WF6A 3P7MA 3WL7A 5KVVA 1L3BA 4J4HA 4KE6A 2RHTA 3GDWA 4KXWA 1BCSB 1K7FB 1P3DA 4RSMA 4P3XA 1M1YB 1WXGA 1J22A 4LXXA 2ZJ5A 4BMOB 4DF3A 1FFAA 1XOIA 3I58A 4AJHA 4CHTA 4ENQA 1ZBDA 5FI1B 5EXXA 4YR9A 4DG9A 3HY3A 1XJWA 1NOIA 3OMWA 1WLYA 3CRZA 3AONB 4A6EA 4AWBA 1F8UA 3PDIB 1B14A 2ZBUA 3NXKA 1P7CA 4X6XA 4YCDA 2QVGA 1NJGA 4CV1A 4E03A 2W58A 3PC2A 1LPSA 4RFSA 1U1FA 1V96A 3E9EA 1G3UA 3MWFA 4N03A 4WD3A 5ALSA 3V2GA 4B80A 4REQA 2HHAA 4X7PA 4LWQA 2YDYA 2EX0A 3M89A 3ZW9A 4DCJA 1RYEA 2QRQA 4EDFA 4GLLA 1FMTA 2RGAA 1RLIA 4QVGA 4JU9A 1N6RA 4MICA 5KTTA 3BDIA 2LUOA 2QTHA 4ND4A 5CD1A 4OI2A 1R12A 1ULSA 1MHTA 3HR8A 4XSGA 2OOKA 2X0KA 1KEUA 4MVJA 3AVXA 3B5IA 4YMHA 3I4FA 3VPDA 1W48A 4FBMA 2IHYA 5BR1A 4OO3A 3D0OA 4EYOA 1ELOA 4HN2A 4JY7A 3NOOA 4BQNA 1ZSNA 3QW4B 1Y5LA 1A96A 1CB7A 1QZTA 4HB3A 1SQFA 4U9IS 3C7DB 4DCSA 5EY5B 4DCGA 1Y9DA 3SZOA 2GYUA 1JXQA 5JU6A 2B3TA 2WHXA 5E2AA 5FBRB 3RTGA 2OT3B 1YQGA 2XVAA 3RHTA 2QE7D 4UNRA 2V6IA 3OA0A 1I32A 2FE4A 5DLEA 1EGQA 2C42A 4EP1A 1MBZA 5F3DA 1N2ZA 4AU1A 4RVSA 4TV9B 5B53A 2Q0QA 3HVJA 1JBEA 1DSSG 3Q15C 4FSDA 4YXWA 4WK6A 4YXFA 1DX6A 1U0TA 4PZEA 5D5QA 5BYAA 3MQ2A 4TV8F 2C3MA 3FYHA 4PIMA 3A0RB 5A4IS 5KU7A 5EOVA 3CBGA 4FOSA 4BIIA 1CDZA 3ND7A 1LBSA 3PFBA 4RTOA 4L5YA 4D9KA 2V03A 2JLAA 2OG1A 3JATA 3N74A 2B61A 1JR3D 1IUPA 1ZWLA 2EATA 3P2IA 5COQA 4NG5A 4R1UA 4ZXPA 5HFJA 4BNGA 1U0EA 1PUJA 3E2MA 4BNNA 1CJSA 1GCAA 3M2PA 1IB6A 3TPZA 3U4MA 1WM1A 3NBKA 4RY2A 3MUOA 2IZ0A 1TT7A 2EDAA 4HDQB 1GPBA 2PGJA 4V1CA 4OHRA 5EUCA 3LQQA 4OAPA 3TB4A 2AZXA 5C4IA 5CA1A 5AVXA 2LDBA 2F59A 3M9XA 5DB4A 3QF4A 3ZDDA 1LBIA 2I2CA 3CLVA 4BCBA 5CB4A 4FYIA 1Y3BE 2PX8A 4C4SA 5KVSA 1UKYA 5EHXA 5AKZA 3EULA 4FGZA 2G8NA 3PI7A 3JY6A 4RDCA 2BFEA 2Q4OA 3ZNOA 2W4MA 5JAPA 1KJIA 5UKDA 4H27A 3SYMA 4D2IA 3KEMA 4PZ9A 3RV3A 5DEOA 2QLLA 3WO0A 1QU3A 5G1OA 1WPGA 4ZTBA 3HKDB 3HEBA 1M9NA 1UXGA 3TW8A 2JCGA 1T2CA 4CDGA 2DHCA 2WIBA 1EVKA 4ILKA 4BGUA 3ANXA 1C29B 1YB6A 3HP1A 4J8PA 3OZTA 1Q15A 4V1CB 3FPKA 5ALKA 3ZV5A 4FFDA 2QD4A 1VKNA 2WDZA 1WDWB 2QJRA 2Y92A 3NHSA 4HDKB 3STXA 3H11B 2F8SA 1TJNA 2XUHA 1PVVA 3TM4A 4DLRA 2OC4A 3WSWA 2PFGA 1J97A 1O4VA 1S2DA 4V0KA 1PT5A 4MGKR 1NJSA 4FHGA 1XF1A 2X4GA 5AKLA 2JATA 3QW2A 2I1VB 1UH5A 3HFRA 4JASB 2JL1A 4IY1A 1IVYA 3EF0A 2H1OA 4R2XA 1YVDA 2RHDA 1SRQA 1UKZA 2QX4A 2RGNA 3WGQA 3LCRA 1FNCA 3QJ5A 3LLUA 3UWPA 4F9FA 5FT9A 1XL1A 4YS6A 2X5JO 1VMEA 3IOMA 4N0EA 4DTCA 3OBBA 2O8BA 4TV8A 4Q1FA 1OV6A 1E2MA 3C7CB 1E2NA 3QVVA 5JTTA 2AKYA 3INGA 3CTPA 1S3FA 1UM8A 4OYRA 2VJLA 4ZQGA 3BL6A 1ZEJA 4YHHB 2FDCA 3AEUA 4G5QA 4LUCA 5C7OO 3OCZA 2O3TA 3H1TA 5JY6A 3A4IA 2VF7A 4ZDKA 4KNVA 1H0SA 2Y6UA 1PV4A 4YLGA 5HKBA 3TZQA 1QQ7A 2JGDB 2DB3A 3E18A 4J3FA 3DVSX 3AIOA 3I09A 2G9NA 1H66A 3IDZA 4UEKA 3CVUA 1KO7A 5DN6D 4MP8A 4UM7A 5HNKA 4YUZA 2MTBA 3IBYA 4XD7A 8ABPA 1FFYA 1IK4A 1PNOA 2WRZA 1GV0A 3LX8A 1DG3A 3N53A 4OQPA 3T3GA 4JC0A 2QAIA 4HUJA 1V7ZA 4MYSA 1EK1A 1KYQA 3AF0A 3H2SA 4IKEA 3A0UA 1JIXA 2VFAA 2ZROA 3LUHA 1GDHA 1JPJA 3LUKA 3B9BA 1OI4A 3F3MA 4K9SA 2NUAA 3IS3A 2AFIB 2PXXA 5DGXA 1C9DB 5FWAA 4OFWA 5GONA 4EX6A 2Q5OA 3U9TA 1VIVA 2CFRA 3EMKA 4P4UA 1N5OX 4W1PA 1YOVA 5B3JC 3AUXA 5IF9A 1IRIA 5JQWA 2DQYA 1G59A 1Y37A 1DRKA 3VDRA 3HUDA 4BNZA 4L2IB 1RQNA 5JS8A 5AHOA 2JKZA 4GBGA 3A1CA 3L8EA 2CHQA 4EEZA 3KYCA 3NTXA 3CM0A 4HHEA 5DGTA 2E7ZA 3EIHA 2Q46A 4WNYA 2Y0DA 3VTAA 3ANMA 4QNMA 2IS2A 2CZCA 5ICEA 1W85A 3QVXA 3LKZA 4ZOLA 3S4YA 4DDMA 1WL8A 2IHVA 1C8KA 1ENOA 3MCAA 1BWRA 1SMKA 3NT5A 1GAJA 2IXEA 3LKDA 5IJ0B 1PWHA 4GU5A 2FMTA 1X1SA 3UV7A 3AYXB 3Q12A 3VR3A 3W4JA 1PR1A 1U0JA 3SS9X 2BELA 3OZSA 2J6IA 2I8AA 2XUPA 4RYLA 2A35A 3BB4A 4ON9A 5BSHA 4M1WA 3R24A 4KE8A 5JD5A 5DOVA 1LLCA 1ZY2A 1NKSA 3D02A 3NALA 4QQKA 5EFZA 2GS9A 4P6VF 5H59A 4GECA 4KOEC 1TZJA 4EYQA 3P9YA 5J2UF 3HO1A 2N9UA 3EVCA 3QG1A 4N54A 1A2QA 3U37A 4HNTA 1DRVA 1RADA 1HSZA 3F1KA 2E9SA 3GQVA 3HEMA 2R5NA 3MSXA 1JDPA 4WY8A 1KH1A 1AXGA 1G5RA 3NTLA 1KEZA 3R0JA 4QJIA 3ITKA 4BO8A 4WVLA 2AGVA 3BORA 1N6KA 1UBJS 2RHBA 1Z8HA 2QY6A 2EERA 1IY8A 2WWGA 4K6KA 2CHEA 2OXTA 3FCSB 2VDUE 3SLGA 5BWLA 4CKEB 1ESMA 4P08A 1YJBA 1DV2A 1OT5A 1OAOC 4RDXA 2W4IA 2YIVX 3FF1A 1E2FA 3HACA 3MUEA 4HQLA 3HA7A 3Q85A 3QUSA 4HZUB 4RHEA 3S2UA 5M34A 4N65A 2UXBB 2IVFA 3B85A 2AJLI 2BR4A 2HRZA 2J30A 3DT6A 4MTCA 3ZE0B 5B4TA 4OLJA 1NOJA 3H04A 2JFPA 4IKPA 2ZR9A 2Q0HA 2Z56A 1M7GA 2B94A 4EA8A 3GLGA 1IZ7A 2ZB7A 1DTWB 4B3SB 4U1RA 4L0QA 3SHVA 2QI9C 2HQ1A 2O7QA 1HKHA 1M2OB 2NSDA 3KZ1E 1WU7A 5COBA 4BMDA 5KZMB 3P9XA 2A5GA 1EXWA 2X8JA 4H6PA 3T1TA 4IMIB 2Z58A 3BB3A 1NM5A 3FOWA 4H7HA 2RSLA 3F74A 1H4VB 1K6JA 1T6YA 4MQFB 1WDTA 2OCXA 4ZREA 5H82A 4YJ3B 5J2TA 1EWVA 3VNUA 2C07A 3JZIA 3W6NA 4RNDB 2ZSFA 4K03A 3W5CA 3PT5A 4HAOA 1KARA 2W42A 4DUGD 2GWRA 4ZV7A 1A9SA 1G8YA 3DBVO 1PJ8A 5GM2A 4UTPA 5CA0F 1XLTA 2HA7A 1QFZA 2Y99A 3QIVA 2BGMA 3TQIA 5JSUA 4R31A 1WMDA 3ISVA 5CVCA 4A2WA 4P92A 2H1WA 1UBRS 2GBLC 3CVWA 1KGSA 1YO6A 2NYUA 4MYDA 3V1YA 4BP8A 2CFTA 4DNQA 4EYKA 3B3AA 4LNUB 4FHFA 5CFRA 4PIVA 4Z3OA 3AFIA 1TIBA 2ZBGA 4IZOA 1UUFA 5FOXA 2OUKA 1NMSA 2BN4A 1J00A 2V54A 2BMVA 5CPBA 3GBVA 4B4VA 3K0FB 4AI6A 1JHRA 3CNNA 3UK1A 2J9FA 1YCGA 1HOTA 3DDHA 1YB2A 4LYEA 4MVJE 5CG2A 5AICA 4F2WA 4DV0B 3ER9A 1QIFA 4TWBA 4EHNA 1ISFA 1RMTA 1GG2A 1EP3B 2HIAA 3GT7A 2XCUA 3KQTA 4PLPA 4O6VA 3ZQUA 3VHXB 1V1MA 3NHAA 4P34A 1C7JA 1M8FA 1QNFA 2CYBA 4C30A 5JDCA 1U7DA 3QI2A 2X15A 3T1VA 2B7BA 3I5UA 4Y6QA 1CFJA 1QRAA 4I4NA 4JWKA 4KH0A 4CTOA 4MPRA 5KTRA 2WT8A 1MOSA 1IU9A 1ODFA 1XQ6A 4NPCA 2PLNA 1DWPA 2H00A 3IC5A 4QTUB 2Q3LA 1EINA 3PUJA 1WCYA 5EMLA 1AQJA 4AS1A 3VM6A 1J2TA 3ZD6A 3Q3IA 2Z2YA 2Q5CA 4ZV4A 2AXNA 4CWAA 2JHPA 3T9FA 4BFUA 4MLZA 4LJ6A 3PPWA 2WYVA 5LNK1 4ZVNA 1Y5RA 2A92A 3KOUA 4E09A 3O74A 4FI3C 4Z4FA 1PRYA 4M8NE 3OC0A 1F2TB 1R6VA 4DREA 5KYWA 1HC7A 1Z8DA 1GXSB 2FFAA 2RI0A 4HDRB 5K0SA 2ECPA 4U39A 2IW1A 3EFEA 4QG3A 4YAFA 1Z0JA 3VA7A 2BCEA 3EXHB 2PWYA 2VSQA 1OHHA 3PWTA 4GI3A 1H8HA 4GSLA 4TYQA 5FBZA 5FWXA 4CIWA 3WYBA 5ED4A 2O5CA 1ZAYA 3ROMA 1ML4A 2IY9A 3THRA 5LQCA 2O23A 1A8HA 1GNPA 3LRTA 1ZL0A 1RRMA 4GKAA 4H60A 1I2BA 1QUFA 1QM5A 4UFOA 3RRXA 4BCCA 3L1JA 2IJGX 3GN2A 2C98A 4RPCA 4M9CA 4ESOA 5LP6C 3OE1A 6YASA 5L3QB 1R18A 1QIHA 1YL7A 3IKVA 1R4MA 2FSVA 4PHTA 3FNQA 3HXTA 3QY0A 1WVGA 4YWHA 1SBZA 2HCFA 2PL3A 5DLYA 3ZTWA 2DWCA 5EUBA 1AO3A 3IDFA 4J4BA 1B42A 1XYVA 2EWMA 4TRMA 3PTZA 4OX9B 3CWCA 1Y1SA 2J09A 1O57A 3CMMA 3FOCA 3WMFA 3V42A 1YIDA 1Z15A 2CCGA 4I5DA 1PU2A 1PNRA 1JDBC 4XRRA 2OCIA 4LTDA 4CETA 2RGEA 1ZL2A 1F7VA 1CY1A 4LZZA 2JEZA 3GBPA 4EJSA 3EIQA 3G89A 2A78A 1I51A 4A5OA 4XWKA 5DLQC 1KYWA 3TF5A 2Y67A 1OB5A 5C8DA 3F3YA 1NQ5A 2F9LA 3QHQA 3R3HA 1CC1S 4MDEA 3EEFA 1OHHD 1DX4A 3KM0A 1SBQA 2F17A 5AUQA 2E4XA 2JLUA 1F0NA 5A2GA 3UJCA 2EYQA 2GTHA 3DEJA 3PR2B 1DVRA 1LUAA 5LOVB 2WKQA 5CX1B 1KZHA 4NWIA 1L4MA 2FA9A 1EWKA 2ET6A 1TD1A 1YAHA 2XBLA 1WNFA 4DLKA 2JANA 2RD2A 5AQ1A 3ASZA 1QKJA 2AJBA 4P84A 4EG1A 5MF6A 1EESA 4L2IA 3ZE8A 2B0CA 4QJBA 4PBTA 5I9MA 4GVPA 1FNDA 4EB0A 3CEPB 4DY6A 4TYWA 3UKOA 3I83A 4N5DA 3N2GB 3WAJA 1M2KA 5AKIA 2DE0X 4GM1A 1N32B 1XHEA 1UJ6A 5BYJA 5DM0A 4YR7A 1LPAB 2H0RA 2AQIA 2NT3A 1EFPB 3AUSA 4IIJA 2BGLA 3H86A 4L3WA 3TZKA 4AS2A 4XLTA 5A03A 3FVRA 1NQAO 2YY5A 1Q95A 3UJAA 5IJ0A 2I4RA 3I92A 1KAOA 3KQHA 1YB4A 3IXQA 4CKEA 1F0PA 1YR8A 4RVGA 3ABSB 4DV7B 1DARA 4JX9A 3C48A 5K8TA 4L85A 5LBTA 5TS3A 3RBXA 3ESXA 2H2IA 3N8DA 4CN9A 1CUBA 1XE3A 3VSBA 1P44A 2FPGB 4QOIA 2B7LA 5JE8A 2A0YA 4K9DA 3X1XA 4KR7A 2OAQ1 1HQDA 4P7JA 3UA3A 2O7VA 1IHDA 3NTRA 2IS6A 3MJHA 1P2BA 3B48A 3M33A 5U4XA 5K5EA 2D2VA 3DJYA 4H2DA 3VC1A 3VR5H 4FCWA 2VS1A 4A6DA 4CLRB 3K0SA 2O2SA 3UQYS 4Q4AB 2KPOA 1Y8QA 2QTFA 1JR6A 5KREA 1A97A 3GUVA 1KKMA 3H4TA 4M99A 3O4VA 4HJXA 3CFYA 1DC7A 2GUWA 2XD4A 2JVIA 3I9V6 5EIWA 2G6TA 1OPRA 2B8JA 2NU9B 4MB2A 5ICMA 1QS0A 3JYPA 2O2IA 4TV8B 3WG9A 1AHNA 3D7KA 4H15A 2WOOA 3K6SB 2PX6A 1ULAA 4FKBA 1KR2A 3NFRA 5TMDA 1OD6A 3LZ6A 1ZXXA 3WLTA 1ODJA 2Y2UA 3ONDA 5B6JA 2R84A 3EQ7A 2BFCA 1T13A 4O4LB 3OCYA 3FWNA 4ZI7F 1C7FA 1UBLS 3QLEA 2BTQA 4MWZA 1CHNA 1G7TA 2V7TA 3HKBA 1BD4A 3AM4A 4HNAA 4MR8A 3ZVKA 3KLMX 4ABTA 4YRZA 3P5BA 5DP2A 4W9NA 2K7FA 3L8GA 5HQTA 5BW5A 1TF2A 2J3EA 1A9XB 4QBTA 2MYPA 4DR1B 1T35A 3WGMA 1XNHA 1RAAA 5F1YA 4MV8A 3I23A 4PCUA 1W76A 2J6HA 1UPTA 4NV1A 3RUAA 1SVOA 3KVYA 4NDNE 1WQ3A 1BVHA 3TTTA 1F14A 3HV2A 3M1LA 4F06A 3EG5A 2B3DA 4LTNA 4PFQA 4B75A 5K3CA 4A8JC 1CX9B 3EA5A 4R9NA 4I6EA 4M4SA 1LBEA 1N33B 3GMDA 4LZLA 4P7FA 4ZPJA 4JS0A 1BXRB 4LRSB 2RHOA 4DC1A 2PO7A 4W9MC 1T8SA 2QM3A 4AICA 1MZPA 3DWEX 1J5PA 3KVNA 4JQZA 2AW5A 1VB3A 3CGWA 3MAAC 1QHFA 1VL5A 1NC3A 1XCBA 2B30A 4G97A 4OHVA 5E9JA 3T38A 3T7CA 1THGA 5HQJA 2Q6TA 1L8OA 3OPXA 5HCIA 4TZTA 2R1VA 2RHLA 3NNDA 4FDMA 1YMVA 4RA9B 4MAAA 5ALQA 5EG5A 3AVYA 3GG9A 3NT2A 1JAYA 4NE9A 4P0QB 4M1ZA 1WBJB 4R1TA 1JMYA 4IRUB 4CODB 1QP0A 3PDJA 5FA8A 4RJLA 5ALWA 4EX7A 1J0DA 4OHYA 1TJYA 7YASA 5KKCA 2DFTA 4MQ6A 4HLUC 4Z2AA 5IAEA 2VPYA 3GK3A 4L73A 1KYXA 3RVKA 3T7KA 1V6SA 3KEOA 4YP9A 3E5HA 1B7GO 3LYAA 3N5CA 2PUBA 2W6PA 3KPYA 3PFIA 5C1PA 2O8CA 3FG9A 2H1VA 5ARCA 4MV4A 4YY3B 3WSVA 3U4CA 5AOBA 3ZV3A 2J67A 5ED0A 4JA2A 1O94A 1W5TA 1MZVA 3UY4A 2QLTA 1O95C 4GLFA 2ZP1A 4D3DA 2I3ZA 5G0WA 1P74A 3MVEA 2RMKA 4B6FA 1NQXA 1M2EA 2CNKA 4JFRA 4UXJA 2LW7A 4JIMA 1FZTA 1BTOA 1O8BA 3M3DA 3ENQA 4FZ3A 2BV3A 5GIPE 2VQ3A 4TMYA 3WV4A 1Q50A 1XZMA 5TY0A 4DIBA 5CDGA 2JGMA 4O8ZA 2P11A 2VJNA 4HTAA 3WRYC 1K8ZB 4DAOA 2XYVA 3HNOA 1G41A 3JWJA 3KTAA 5BURA 3WRXC 4RJTA 4MQLA 5JARA 1XYGA 2FW6A 1SZDA 1X87A 2GPTA 2KSQA 4TVOA 1G7CA 4EVIA 2CHGA 3W8DA 1FQJA 2CB0A 1NN1A 2D2IA 4WIAA 2RHMA 2VC2B 1BNCA 1OIWA 3ESCA 3CKKA 4LC9A 4PTYA 4Y9TA 1EUQA 1H9CA 2YN2A 6CHYA 5K0CA 3PBKA 1G2OA 4OHFA 3LT4A 2FLWA 2O6LA 1M5RA 2CVPA 2GN1A 3DONA 3R41A 4NCHA 2ZE8A 4MYCA 1QQBA 2A2ZA 4PRKA 3AM1A 2AJDA 2FEXA 3KYDA 1ATZA 2PKWA 1AUQA 2R97A 2C4VA 4YI3A 1QIKA 2QTCA 4YP1A 1GOTA 3D4LA 3IEKA 1C7ZA 1T5TA 3Q8LA 3V8BA 1XALA 2P6RA 2ZAIA 3JWPA 1X0XA 3FLAA 3QTLA 1MDFA 2PBRA 5CLHA 2A14A 5ICCA 1DP4A 3N2GA 1L5GB 1YH3A 3DZGA 4RSRA 4FEGA 3I8XA 5AM0A 3NYQA 1SKYE 4OHZA 1NBHA 2IHZA 3TIVA 1G64A 3BSWA 1ISJA 2GNOA 2PL9A 3DO5A 2C2HA 3EMBA 3GFSA 3QM1A 1CZRA 1R50A 2YVLA 4I1RA 4LN1A 4O2RA 3BTVA 3GRRA 3MD0A 1NNI1 3WKBA 4RE6A 4EGFA 3I4CA 3AESB 3KSRA 4W63A 4QJ4A 1ECGA 3PC8C 3CF4G 3ZLUA 3ET4A 3S40A 3RLFA 3QWAA 1GITA 4ID3A 5CVUA 1YF3A 2F00A 4N41A 3QA9A 1REQB 3VC7A 1B26A 1W0JA 3TVTA 4ZO6A 3G8DA 3RHFA 1TYEB 2JH8A 4BV9A 4D43A 4EUSA 1YD7A 1KQGA 2E37A 2O3JA 1UWKA 3QLVC 3ROTA 3WFZA 4PY2A 2NO5A 3UPUA 1TMYA 1Z8NA 3I3OA 3KBOA 2P69A 4JQOA 3U7QB 2JBAA 5LA6A 1JE1A 2YRXA 2IX3A 2IE0A 4LJYA 3SQXA 2NTVA 2JFVA 4L51A 2BFNA 2XNSA 3WK4A 2X6QA 3EH2A 1DXQA 1OXSC 3WGNA 2V6GA 2V9ZA 3HJBA 3PNMA 5BV2P 4Q4HA 5CXSA 1N9KA 5T5QA 4E7PA 2CMHA 4OV6B 2QTVB 2I66A 2O1WA 2P9BA 2QX7A 5F5NA 1H4TA 5GTDA 1WIWA 1CBUA 1YL6A 1N2EA 2NWQA 2AN5A 1ZKMA 5CNKA 5JMPA 1B43A 2V6JA 4N4AA 2HLHA 4JXJA 4QEKA 4HWPA 4M87A 3I04A 3PNPA 3ELUA 3EW9A 4ZCIA 1VPTA 1N6PA 2CXOA 1XD8A 5HILA 3WWPA 4D44A 1NI4B 3V4RA 5FUVA 1BXZA 3AEQA 5REQA 1CUCA 2XYHA 1RR6A 1JIUA 3G5AA 1NL3A 2RGRA 3VKGA 1Q7RA 3L01A 1NF2A 2E87A 1SKAA 3VSDA 5BOVA 3O82A 2R4TA 4CM9D 3RTDA 2PV0A 1PZXA 1Z33A 3I9JA 1U8TA 5DXFA 5LD2C 4J0QA 1CZOA 3SSNA 3V6MA 4NCBA 1N3LA 5A6SA 1XD2B 1ZGAA 2V8BA 3SFTA 1DEKA 1DKPA 3EC7A 4M46A 1T9BA 2EF0A 2OSBA 4BLOA 3EQZA 1B2LA 1QG2A 2HAEA 1I94B 1FA9A 5K8IA 1LS6A 2WA1A 1XF9A 3JQPA 3NETA 2C2KA 5T7BA 1RWOA 3OQMA 4RHUA 2Q6VA 3RYTC 1TXGA 3GP5A 1KEPA 1EJ2A 2GRAA 3CCFA 3KOZA 3PVSA 1DEOA 1H2HA 4IDGA 4DWOA 3AVOA 5FO0A 2IYRA 2B4AA 1TECE 3IAS6 4PQFA 1YZFA 1DC5A 4AYTA 2JAQA 1S7GA 4HYTA 5FF9A 3A2LA 2NZUG 3EXFB 3LGAA 4FEYA 1AZWA 1Z4KA 3D3EA 2MWMA 3JALB 5IVIA 2B6HA 2FDXA 3E9MA 1NBMD 1N8TA 4O4LF 2IX9A 1SKBA 1U2TA 1TQ2A 1PJLA 2BFBA 5FBLB 3RIYA 2ZB8A 3D7LA 3AJ9A 4ZAYA 3PUHA 4YYZA 4MCIA 2LIVA 5LQUA 3UB2A 4UULA 2RC5A 3EGXB 4UMFA 4NCXA 2H17A 4LFAB 1ONSA 4DB4A 1ZU5A 2P2CA 1JJFA 1NSTA 1UC4B 1N7HA 1DJPA 2IOFA 2NXJA 2OV1A 2XA1A 2XE6A 3MIIA 3WK5A 2I6SA 2PK3A 3BIXA 3H2GA 4KR2A 3DXFA 3S5JA 3GI1A 3O93A 3M6AA 2XUKA 2OSVA 3SYKA 1J0AA 4M1EA 2BHSA 3HYTA 1P4JA 5CLFA 1V8DA 1L5YA 1PT7A 4KGXA 2BSXA 4D5GA 1V7QA 2OESA 2F9FA 5E8RA 4QVKA 1FRQA 4EHDA 5DGCA 3CRVA 4ZZ0A 3K9LA 3PG5A 1O95D 1AGPA 3PQEA 5IKOA 4NOLA 4MEJA 1T2AA 2ETVA 3DMFA 3L6RA 3MIZA 4QU0A 1UBCA 3TNDA 4KOAA 4DMHA 3QE9Y 3ITDA 1QDLB 2G1KA 3JU3A 1L3IA 5JRJA 2BFOA 1TZKA 1NVDA 4FU0A 4KXNA 4LBWA 3VYUB 3UBTA 3NOVA 3QEKA 3FI0A 3KZKA 5CVJA 2H9IA 1Z0SA 4OQQA 3F6PA 3KFLA 5CM2Z 2KM1A 3H5OA 1P9NA 1HBJA 3IMKA 5DMHA 5EVJA 3LTEA 4M1KA 4EY7A 2QZ9A 3EGEA 3LW7A 13PKA 2JLXA 3COJA 2GFQA 2FW7A 3HKEB 1CQIB 4WV3A 4GWKA 4X64B 4EK9A 2L19A 4QU9A 2DZDA 1T2FA 2PKYX 2GPBA 3GJ4A 3IBFA 3O4FA 1XZBA 1K7EB 1YDFA 2RDMA 5B2EA 3OSUA 1CEYA 1I1NA 4D7AA