5FORA

Cryptic tir
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
131
Chain Sequence
GCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQILTHRLGPEASFSAEDLSLFLSTRCVVVLLSAELVQHFHPSLLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1
publication title Structure of the Toll/Interleukin-1 Receptor (TIR) Domain of the B-cell Adaptor That Links Phosphoinositide Metabolism with the Negative Regulation of the Toll-like Receptor (TLR) Signalosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 41
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18567 TIR_3 Toll/interleukin-1 receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 5forA00
5FORA 4EO7A 4W8HA 3UB2A 3UB3A 2Z5VA 4OM7A 3H16A 4C6SA 4LQCA 4DOMA 5H3CA 1FYVA 5KU7A 3UB4A 1O77A 4FZ5A 1FYWA 2J67A 1T3GA 3OZIA 3JRNA 4LZPA 2JS7A 4C6RA 4LQDA 4C6TB 4C7MA 2M1XA 4C6TA 2Y92A 4W8GA 1FYXA
chains in the Genus database with same CATH superfamily
4NFLA 1WLSA 3MJSA 1H6BA 4XEHA 1MPTA 1P5JA 3VX4A 1UODA 2J3IA 4D8YA 3B82A 4KEAA 1PWEA 1CK4A 2BW0A 3GH1A 4BMOB 1PI3A 1F6WA 4HDNB 3RC9A 4BVLA 2PYDA 1OI4A 5IVHA 2WZQA 1L5QA 2ONZA 4H77A 1K66A 1KPGA 3KDPA 3KTFA 3P8ZA 5DZSA 2BEVB 4QDKA 3RVPA 2E1RA 4QE3A 3RK0A 2E82A 4B4KA 4EY3A 2FWPA 1MFPA 2HMWA 2E87A 4TQGA 3K0BA 1M8KA 1R8SA 2MYNA 3OZSA 4RD3A 3P71T 4EMTA 1QAMA 1OFUA 2I78A 1RAHA 1REQB 3C7KA 5KNBA 2HIMA 3EZXA 4MVJI 1QIIA 5I7AA 2WTBA 1ENPA 4BPBA 3DEZA 5E4TA 2XUIA 2FFHA 4W1RA 1U7DA 2NAFA 4EVQA 3W34A 1D1PA 1Y1RA 1YR7A 2FCRA 4U7WA 4Z9BA 1G3IA 1OY1A 5ENVA 1VCIA 2FG7C 3F9RA 4Q00A 4S2UA 3D43A 1IPFA 3HBFA 4B83A 4EPXA 5LJLA 3K9BA 1T3SA 4NV3A 5JANA 2IHBA 4FFWA 3B6EA 3ASYA 2PLWA 1VZ3A 9GPBA 3FB1A 2GX6A 2P2CA 5DO9A 2DPYA 3RVNA 4YRPA 3OQNA 2BP7A 4EAAA 2CNKA 1IWOA 3OHMA 2PGAA 1X1SA 4EB3A 1TW3A 1E9EA 3ROFA 3HLTA 4YAGA 1XPUA 3NBQA 2QGNA 4MWTA 1VLJA 1XQWA 4PC2A 4Q12A 3LBIA 3PUHA 2YIDA 2FZLA 2AUNA 2LCIA 3J7TA 2R7LA 1Z4PX 1Z7EA 1KJYA 3DDHA 5DXFA 3WXMA 2F1JA 3SE0A 4N5HX 2LR0A 4JKIA 3N7UA 4PX3A 2FPPB 1L4GA 3UT0A 5I9LA 3OQOA 3NYIA 4N3AA 2GZRA 3BRCA 3NIBA 1WXIA 1L8LA 2EHJA 3COVA 4K9NA 3RUDA 3M3DA 4B3CA 1UK6A 1XD9A 1J9EA 3FKSD 1X19A 1EK1A 1LCIA 1TVCA 1L5KA 2C7PA 2YJZA 1QE3A 5J43A 2X40A 3VPBA 1JKXA 5ALKA 1NW6A 1X80B 3VH3A 3LP6A 4L7VA 1O4VA 1ZD4A 5FTJA 3N0TA 4HUTA 1RYMA 3GRUA 3CNEA 2W8BA 4Z0TA 3TLBA 3AR3A 3HWX1 1Q0LA 3FR7A 5K2OA 1NFFA 3C3CA 4W1SA 2CVPA 2GN2A 1WHTB 4N8DA 4WFJA 3ZJTA 2PSDA 3OTWA 2AHRA 4M76B 1VIDA 5AW0A 1XF9A 3LWDA 4MWCA 3GLGE 4ZV7A 4C0SA 1AM4D 5I3CA 3RSHA 4RPLA 2BFBA 5AVSA 1SCIA 3JQGB 4NK5A 3FFBA 3DDZX 3NJ4A 3M6XA 2W2PA 1LBIA 9LDTA 2GPNA 3DONA 2HLHA 1ZRNA 2VN8A 3G82C 2CLFB 3PPVA 3C3YA 4TTQA 3I05A 3DNPA 1DC7A 1GGEA 2Q5HA 5G1NA 5C7OO 5HJ7A 3IR7A 2D4HA 4TYPA 2PU7A 3WIDA 4YJ2A 1JHQA 1A9YA 5F98A 4DMGA 3PZRA 1S01A 4FXOA 2HQBA 4ZXPA 4YK7A 2FMXA 4N12A 3IVRA 3OO0A 5JASA 2QN3A 2I4OA 2QD5A 1A5ZA 1PFGA 2RHWA 1E6KA 2VF2A 2SKDA 2A9OA 3DQPA 1JFLA 2IHVA 4L4RA 2VJOA 5DSZA 3UW1A 3HBLA 2QIPA 4XCQA 1EFPB 1JEEA 5ALDA 4DYHA 1AKYA 2AOXA 5ICFA 3E22A 1CY8A 3W8RA 3V42A 1I7QB 3TAHA 4JV5B 1FS5A 3I64A 4HLQB 4KVFA 3MRTA 3C6ZA 1GPKA 3WMRA 4FT4A 3C97A 5KNCD 3FTPA 2O0JA 4YMIA 3S3TA 1H8ED 2HV8A 3G17A 1Q0RA 2BFCA 2GEJA 2PZEA 1IY9A 1MBZA 3QKWA 1CRPA 4H0FA 5DBOA 2GK6A 4TZ6A 2ZYGA 1X7WA 3HR4A 1SKQA 3EIUA 5COAA 1HLGA 2I6FA 3KQMA 1ZJ4A 1ZONA 3QOFA 3L06A 5IEBA 1E79A 2QE7A 4FLFA 3VISA 5IT0A 2KBEA 1HQYE 2PUCA 1L4FA 3KQTA 4X63A 3BMNA 2PYZA 1JG6A 5J63A 3TCKA 4C3ZA 3OPYB 3K0FA 3HVJA 4BKRA 1O6FA 1U8TA 2RI0A 4HS4A 1C3VA 4PYLA 2FVYA 1YS2X 5TJ9A 3TXAA 4Z4IA 4OYYA 3FRJA 2B1RA 1J7KA 4MO9A 5REQB 4YWJA 5TJHA 1KBOA 5JXHA 4JYZA 1C2YA 1QWOA 3OPVA 4PAOA 1FDVA 1Q3HA 1GNTA 2GTHA 2XUGA 3PHJA 5JVDA 2RGNC 5TB5A 4IDQA 2LCFA 4I4TF 4EG5A 3KELA 5KKAA 4E4RA 3G7UA 3HB4X 1ZC4A 2QBYB 3SSOA 1SQFA 3QFCA 2B5WA 3KYCA 4RY9A 3ZGVA 2DQKA 1NXPA 5B6JA 5LQUA 1FLVA 3CLHA 1MJ5A 3ICEA 2XSZA 3MB5A 4HNVA 5AKZA 1EZZA 3T7RA 1WIWA 2RHMA 3TQQA 4UE3S 2EU8A 2AD1A 4MIYA 4XLTA 5EWJA 3ZCSA 4YUWA 5HS4A 1G20E 4OL0A 3CRRA 3L8MA 3LZCA 4POAA 2VDOB 1JFTA 1XCLA 1YB6A 3V4FA 2P5TB 2XBLA 5HF5A 3EQ6A 3PRJA 1V41E 3U4QB 1UBJS 4BRUA 3G5TA 2XB2A 1GCAA 1WETA 5I9SA 2H4HA 3WGQA 1YB7A 4DUPA 1KDYA 5JJLA 1MV8A 4E46A 1EFHA 2CJWB 1RADA 2QRHA 3MLAA 5HIJA 3UHFA 3RANA 5DNEA 3OKPA 1D3AA 4YJGB 3ZKWB 1XU7A 3D0KA 1H2ZA 1U3GA 5I4BA 2ZWAA 1RRPA 2JK1A 3TLYA 1MP0A 1Y8RA 4UVHA 1CD5A 2OMKA 3I83A 5LYJA 4FHDA 5DN9A 4KGVA 2Q1SA 1TA4A 1F2VA 1CRWG 3FUXA 4LY9A 2C4HA 3COSA 3Q9UA 1K6XA 2H2WA 1LJ8A 2FSHA 3JZDA 2XYPA 4TXHA 1I94B 3TQIA 1AXGA 1YNOA 3HUFA 4RIFA 4YRLA 4OHZA 3T3IA 4CF7A 4OLBA 1DLJA 3LBNA 4TSRA 3CEPB 3VPCA 3F67A 2AG6A 1MF7A 1RE1A 2FHPA 3AOEC 4EYSA 2AN3A 3GRYA 5K8TA 2QT0A 3QF4B 4N3CA 1DPGA 1DTWA 3CX8A 1ZRMA 1BWRA 4C5AA 4DCNA 1PRYA 2W6ZA 1PFUA 1UFVA 3P9QA 4RKWA 1Q3TA 2X0FA 4B4UA 1VL2A 4KH0A 2XUAA 3EEFA 2Q4OA 2GCPA 1I1HA 1ZJ6A 5FI3A 1QVWA 2PSFA 1HR0B 4O4LF 3BQ9A 1RYNA 4MHOA 4V0QA 5CA1A 1A9OA 2EHDA 2C5BA 3GFBA 3JWPA 5I47A 2KB0A 1H05A 3IDFA 4B46A 1M5UA 3KPUA 1RYEA 1HT1E 4QBKA 3ZK8A 4AJJA 3P2JA 1F0KA 1IDOA 3I04M 3KQHA 4ANFA 4XWOA 2CNWA 3N6XA 1CUFA 2VYND 1GT6A 5F9MA 3P2YA 4X20A 2ZW9A 5FPHA 3TAUA 3U81A 4D9GA 5KTRA 1DKQA 3O73A 1U1GA 1AKWA 3QLVA 1FC0A 5I4IA 2A84A 1TZBA 4L4ZA 3BWCA 4B6FA 3AV3A 4B80A 1X39A 2D5IA 4ZRDA 3UKJA 2ZYIA 3RIGA 2HB6A 2H8KA 3A6DA 3P9PA 3DWGA 3HPRA 3EQ9A 4G9GA 4UD2A 2P35A 4KZKA 3EVCA 4DLZA 3F3MA 1MNQA 3BAFA 3ZE9A 3IXMA 2EFDB 2H1SA 3C3MA 1CJKC 3WLTA 3ESXA 1QU3A 4Y2YA 1QVRA 4K1LA 4WNCA 4TTIA 1U9IC 3EZ7A 2FZ5A 1GPJA 3D6NB 3EE6A 4HH0A 3R7SA 3RD5A 1PVVA 1NQUA 2QLJA 3BL8A 4IXDA 1QJCA 1D2NA 4FHZA 5F1KA 5G41A 3UY4A 4IDPA 2GVNA 2H7VA 3L2OB 4U0KA 2RHTA 4DMCA 5B6IA 1AF7A 2GBLC 2OUIA 2VYQA 3QVMA 1C0PA 3K5PA 2VBCA 3UQZA 1RS0A 7YASA 4JHLA 1BN7A 1GPDG 4UPVA 1FFYA 4GE0A 3C5CA 3DLTA 1ZOIA 3H9EO 3AF5A 3S1AB 1XNQB 2EERA 3WNDA 2CCGA 5IFKA 4EI7A 3GEBA 2HUPA 3I4CA 4MUHA 3HDHA 5EHNA 3HA5A 2YVQA 4Q47A 5B57C 2VF4X 5HKKA 3EDMA 2ZUEA 1P91A 2R6DA 2RC5A 3KXKA 2FSUA 4CL8A 4MV9A 1Z75A 4V2IA 3U37A 3RADC 5F5LA 1U0OC 4U7GA 3WB9A 4M8KA 2GM4A 1YZKA 5JAZA 4CR7A 5KSZA 1DRUA 3DV0A 3O9ZA 5LPNA 1W5FA 2A1UB 1KO1A 2XGJA 1VKRA 2EZ8A 2SICE 4YFYA 2ADFA 3MBOA 1QIHA 3PJFA 3ZOZA 1A5TA 2A88A 2E9SA 1SN7A 2BVNA 2ZE5A 4HNRA 4R1QA 3ASVA 4ZV9A 4G56A 5T3UA 2Z6AA 1KEPA 2CBGA 4DLWA 3WSWA 1Y9EA 3IPCA 1UQUA 4ZZ1A 4QGFA 2XV1A 3CH6A 1XNHA 1QRUA 3IQWA 4G4IA 2WYHA 4QYWA 3JAKB 4E08A 4WZZA 1LBSA 3U4GA 3FWKA 3MYYA 2HHJA 4I4LA 1JT9A 4KQKA 3GL9A 3ZXXA 1D2HA 5JEDA 3KEFA 1T8YA 2FHSA 5JALA 2PRSA 1NJ2A 4HUQB 3A25A 1L7AA 3NM6B 2PGIA 2GSWA 3FYDA 1RMQA 4OXXA 4WRRA 5EP1A 1US8A 5F64A 3ZWDA 4EGAA 3BORA 4KO1S 5AJUA 1V8DA 2ZPAA 4XDHA 5JLJA 3ILVA 5J4YA 3N2GA 3M5CA 5H3CA 4OHPA 3P4UA 4RULA 4HGNA 4JOBA 4RSRA 3ZG6A 1AV6A 1X86B 2ZUCA 4NEQA 1ORTA 5BR8B 2PJRA 1DIOB 3WGHA 3PQ3A 1LW7A 4RETA 1U0FA 1GGNA 1HOXA 3DD5A 3C1AA 4H3SA 5D51S 3R5HA 2Q29A 4LWOA 5CVDA 1TUBA 1PGPA 3DDNA 3UV6A 1TPZA 3MUNA 1XQ1A 2IUTA 4GKAA 3ZWPA 1NF8A 2VDKB 4XDZA 3PXGA 3WS7A 1XXHE 4B6EA 2B1JA 4CI9A 3L0IB 4LHYA 2FOIA 2GCIA 5DYWA 4OP2A 4Z4CA 1O0SA 4KPEC 1RRCA 3BMOA 2WM9B 1N5KA 1WUIS 3AP3A 3O3OB 4K2AA 3SDZA 4C4AA 3HYCA 3OT4A 2DU8A 3E53A 5EHQA 3CUSA 2UUCB 4UULA 3C6MA 4V0ME 1MIOA 1QHXA 4F8EA 3F4BA 5G3YA 4L02A 2JH3A 5CNIA 3EGXA 4TWZA 5FL7D 1I9GA 1DQPA 1MRZA 1RJWA 1USVA 1YBMA 1CS4C 1XQVA 4IIEA 1CZNA 4WE3A 4TS4A 3HY6A 2V74B 3ODGA 2DOKA 2ZAOA 3HV0A 1RPJA 5ISMA 2OSVA 2P7HA 4CMAA 4A4DA 5JQGF 1XG5A 3L8HA 2YRXA 4NJMB 4QHTA 4BMPB 1V5GA 3PTLA 4RZUA 3Q3JB 4L76A 1KFJB 4P58A 4V24A 2FYTA 1BCRB 5AOCA 1XTKA 1NBMA 2Z57A 4H18A 4JQSA 4M1OA 4KGXA 5ECDA 2Z0MA 1H8HD 4TT3A 2HHCA 3UHJA 4AP5A 3ZWBA 4EI8A 3D6MA 3O4VA 2QX6A 2FEAA 1DADA 1EBUA 4TVBA 1CRZA 3CRMA 1XRLA 1MD9A 4WA8A 1TVKA 1Y1LA 2BTQA 1YSCA 4N9WA 4TKZA 5DNUA 2IODA 2PXXA 3NWEA 3DEKA 4FZ5A 4E5KA 3NB0A 1NBEA 4B2IA 3C3DA 2AR0A 1G4UR 4GD3Q 1EA7A 1T13A 5EGSA 1C1HA 3FCEA 4WY8A 4LYGA 1RWNA 3X1KA 1OH5A 4PX9A 4ZOLA 4YRQA 3E84A 3JYNA 3TZLA 4M87A 1YA4A 2XUFA 3A6HA 2YYAA 5L3SA 1E7QA 2W2KA 2A9FA 1RFLA 2YFHA 1SVUA 5ESWA 1P2VA 3GZNA 3DTNA 1RJEA 5CCXA 5ALQA 4RX1A 1DBWA 3ZY2A 2GI4A 2QTTA 4CL3A 1KO8A 4RGQA 4DOMA 2GK7A 1KQGA 1NAHA 3V9PA 1OYVA 2XCSB 5KU7A 3ZX4A 1N25A 4K6MA 1NVXQ 4C0KA 3O38A 1RZ3A 3ILYA 4C7KA 1B26A 5CPFA 4BY9E 4XWAA 1Z5VA 5FWDA 2JC3A 2XQFA 1RW4A 3L0YA 4AF7A 5MGBA 2Y4NA 3Q10A 3EBPA 3SZMA 5I7SA 4OGLA 1E1RA 2E4YA 4G1FA 3B3JA 4BASA 1ABFA 4KYVA 1KJJA 3GPDG 3JQCA 4UM5A 3KOMA 4JR0A 4MV8A 2OD7A 4RLHA 3PGXA 4IV5A 5EPEA 1QIEA 3N2IA 5AJTA 4Y2UA 2YHIB 2X8WA 1CDOA 3E3LA 1JH8A 2EQ5A 2P6OA 4W7HA 3LGXA 3WFZA 4RVHA 1OJLA 1IY8A 3O3CA 3FCUB 2FA9A 2G09A 1F1JA 2FWRA 1TM3E 3D6FA 4M0FA 4UVIA 1QMPA 1NE2A 1YU6A 1E89A 3A3OA 3C14C 3L1VA 3QMPA 4IICA 5DFAA 4ZT4A 1TJPB 2FWIA 4AF6A 1LPNA 3M82A 4C0XA 2RIRA 5IK2D 3DBOB 5KDDA 2FZEA 4YI5A 5A4IS 4MP6A 3H0CA 4TX1A 1U2SA 2FFQA 3I3SR 2IZ5A 2NUPA 5K51A 2Z95A 4M8SA 1ZUD1 3RU2A 3HB7A 4H6PA 1Z17A 2VDVE 1EHCA 3NTQA 3Q6IA 1W93A 1T10A 3LVQE 1QUFA 1H5UA 4R05A 3PA6A 4G65A 4Q3BA 3IT1A 3NAMA 4C20A 2PEYA 1DQYA 1PK7A 2YV1A 1GPMA 1IXZA 4IZOA 3L7JA 2VTBA 4LC9A 4FDMA 4B3MB 4N3GA 2IEAA 4QFCA 1E1DA 4MRVA 3ENVA 3KFVA 4C5BA 3TVTA 1ZUWA 4OHMA 1UZAA 1BVRA 2DFPA 2ZTUA 3HDYA 3W0LB 3ZJ5A 5F2NA 4DKJA 4O2LA 4CQJA 4RS4A 2W6ID 2HMVA 2Y1CA 3G8AA 3K1AA 5EMJA 1JMVA 2AI2A 1VSVA 2JW5A 3OIGA 3IV6A 4HYYA 3B9QA 2UYGA 5LZ9A 1GTMA 1MQSA 2OHIA 5BR1A 3BMCA 2Q4BA 2VZ8A 4NVRA 2WWVD 1JEJA 2DWPA 3SZRA 3AR4A 3V1TC 4E4TA 2O05A 1Z36A 4FTWA 3G8DA 3VRHA 2HMTA 3MYRA 1ZVJA 5LM3A 5DK4A 4A3SA 2GM3A 2NAPA 5CDYA 2BD0A 3P19A 2D6FA 3KUUA 4YJKA 5KVQA 3TSAA 4BO4A 4AMUA 3AHIA 1H1LB 3ZY6A 1X1RA 9MHTA 1JDNA 4JSTA 2QAIA 2VRBA 3EVAA 4QUEA 3ZIAD 2ZPTX 1DFHA 1KERA 3AQIA 4RVNA 3N2ZB 4UU0A 2G25A 1E1CA 3DM9B 4B5LA 2V7QD 1H1TA 1LK0A 1FRZA 1ID1A 2MINA 2NZVG 4A10A 4LMPA 4H1HA 2ZYVX 1FX0A 4Y18A 4Q3LA 4RYDA 5ESDA 3VR4D 4G2TA 4ZHQA 3DULA 1ZEMA 2AK2A 2FQQA 1PBTA 4MITA 1CY1A 1WLYA 3F3YA 3DWEX 2JLQA 2BDUA 3BOSA 3RUEA 2PN1A 1TU3A 3HZZA 4FFBB 2FZWA 2P4UA 5ARDA 4WDQA 2XWSA 2YXNA 3H99A 3L8ZA 4FGJA 5KNDA 2V5UA 2OUKA 3DFFA 3FPJA 4UAJA 2H18A 2I2XB 3RYHB 3T7EA 4B4DA 2VHUA 1OT3A 3MINB 2O0LA 4TOIA 4WZBB 4FOPA 4EF5A 5KB3A 1QRAA 4ZO9A 2DUWA 1FJXA 3IA7A 2ZGVA 2W6JA 3MERA 3P0RA 4BV3A 2YNMC 3LT4A 3V7YA 3R9IA 4RV9A 4WJZA 3KB1A 4XQ9A 2WVJA 1QGYA 3MB8A 4Q7JB 3SQLA 2UYOA 4WKNA 2GGSA 5JSZA 2YICA 4L5YA 1VHTA 3UXEA 1O3YA 1HDIA 3DNMA 4BO0A 1SHKA 2NXNA 4FFVA 3FVTA 1SXJA 4UAUA 1OOEA 2GFQA 2C9BA 3ZLUA 5FLXA 2ZCJA 5HMLA 2W6MA 5C18A 4KSYA 1GILA 3EISA 3QBJA 5KYXB 5EZYF 3GF4A 2MSDB 1X38A 4GGMX 4WOKA 3L7OA 2JD1A 4L74A 5CLQA 2PX3A 2VNIA 4LHWA 5DP2A 1ISGA 2C04A 5D1NA 5FTNA 3RK1A 1J25A 1JHPA 3UA3A 3CJRA 4DLSA 5B2FA 1Y48E 4W5HA 3VPHA 4NDZA 3CVWA 2D13A 5HF6A 3KOOA 3ELYA 3LJKA 3N8KA 1E2IA 3LT5A 3OJFA 5JAQA 1GGHA 1DL5A 4GLLA 1UK8A 1RZUA 1QH1B 5EIWA 3OU7A 2VTKA 2MR6A 3P9IA 4I2VA 3U0VA 3MT7A 4WCDA 5B3JC 1L5GB 1Z4NA 3CVUA 3KD2A 6YASA 3ZQUA 3T6KA 3LT2A 3WK5A 2VKQA 4WFQA 3AFNA 1Z3CA 1I4OA 3P9NA 1NMQA 2BI4A 5K1ZA 1BG6A 4JQZA 4Z7NB 5IH3A 2G70A 3LUGA 1GL3A 3KLOA 1KK3A 2L42A 1E96A 1E0JA 1V8PA 1WKVA 5CBKA 1AK2A 4OCZA 1T8TA 4ZI2A 3EJ6A 2XT6A 4G3XA 3MTQA 1JJVA 3QW4B 3MA0A 1YRAA 3IB3A 2X0IA 1PDWA 4JAVC 2JASA 1HI9A 4MWZA 4TRRA 4BIIA 1DBQA 1IQRA 3FNIA 4IGAA 1M76A 2XCQA 4G1CA 5JC1A 1A1VA 3R0IA 1RXUA 4PINA 1L9XA 3C6KA 3JVDA 2DRIA 4JBWA 5BQOA 5BRNA 1CC1S 1ZHOA 5TNXA 5DMXA 5K3DA 4NZMA 4O4JB 3AZOA 2CSUA 2W7TA 3CF6R 1M8JA 4ASUD 1EFAA 4K9PA 3A6KA 1OI2A 3MQFA 2PVPA 3BH0A 3D7LA 4HAYA 3IPAA 5H0IA 2K7ZA 3QPUA 4OI0A 3SY8A 1TQDA 3DZCA 4P7BA 2QK4A 3REGA 3UZUA 4BGIA 4BQSA 3A26A 2QGZA 4RJ2A 2RHRA 1KVRA 2BDEA 4RTSA 2YJTD 2QT9A 3T38A 5TS3A 1GN8A 3U2QA 5ALVA 3TFQA 2R7AA 4TPKA 1RJ9B 3Q72A 4DLVA 4QPNA 4ZEOA 1LVUA 4O4IF 3RYCB 5AH0A 2ATVA 3VZQA 5KX5B 2BL4A 4Y1EA 1OXVA 1SC9A 1MAWA 2ZRFA 3CF4G 4P34A 2KMLA 1NU8A 5K0ZA 4ZREA 4BFZA 1AF4A 1RLUA 3WRWA 4E22A 1EYZA 3EPHA 1JFFA 3VGPA 4K6GA 1FFBA 1U2GA 3FFXA 4FMPA 1QOPB 3G9UA 3GEGA 3JWJA 4P2GA 3GPCA 4Z5XA 2CHQA 2PAAA 4UQOA 1Z8NA 1JHVA 2D2VA 3BEOA 3EWSA 4PRYA 4EUFA 4TSFD 2OFFA 4MZXA 3EXHB 3OCUA 4R2XA 4YR7A 2IU3A 2JFOA 1KEWA 1ZG3A 3AEYA 3GRKA 2I2CA 1R00A 2B83A 2FR0A 2ZRPA 2XGMA 4I99A 5A6SA 3G85A 3FKQA 1FQOA 1ZNXA 5BUQA 1RWMA 3MTEA 4LPSA 4TSKA 3AEQB 4ZCSA 1XTJA 2FUG6 1TTHA 3BH6A 4FNOA 4ERXA 2OYCA 3IGFA 3OURA 3MRXA 4HN2A 3TPZA 4QLAA 2JI4A 3BHJA 3HFSA 2WYUA 4KXQA 3EEOA 2D0PB 4TL6A 2O3JA 2NV0A 2OCIA 2QAJA 3KAPA 3KEQA 3NU1A 4O3FA 4F1JA 5CLJA 5IXYA 1MR3F 4QJ3A 5K0JA 1E9AA 1HE5A 2XAUA 3IXLA 4PYOA 2ZT6A 3MT0A 1XZBA 2WMOB 5IKMA 4QSMA 2XCOA 5ALGA 3DZGA 1HZJA 1NE7A 2VJNA 2D59A 3QKSA 1LC0A 5IYZA 2JNWA 2FK8A 3HU1A 5CW1A 1QORA 4XM1A 5H3LA 1RAAA 1SXPA 4MS1A 3B2QA 1OTXA 1RLOA 3F5DA 2Z8ZA 4ZYLA 1KTVA 2YY5A 3AV0B 4HY3A 2DAPA 3C41J 2AGVA 5F35A 3C4QA 4D92A 4US2R 2ONYA 1EVLA 1F5NA 2ZWIA 4TM7A 3UMSA 5BSEA 1A7UA 3AJAA 1OVGA 3GLHB 4X3CA 3RSOA 3W8FA 4DCSA 1QG0A 2BN4A 4FB4A 5AM2A 5EE5B 1OBOA 4X1YA 2ZBFA 5B1SA 4KLZA 4MYDA 1UJMA 2ZSEA 1G66A 2ZYTX 3H9QA 1CIPA 5D00A 3RYIA 5BMVF 4NENA 4Q19A 1H0KA 1RQXA 1FYFA 3G8BA 5C37A 4M4SA 4ARVA 2JLBA 3R5XA 1GQFA 2YY6A 1ESDA 1E1QA 1I4TD 1P5ZB 3E1GA 3ETEA 3V2UA 1ZXLA 1COWA 4TTJA 4Z3OA 3ZE2B 1YQUA 1U4OA 4HWPA 1OIWA 1WPRA 4NV1A 1QGUB 1OLXA 4X8LA 2G9UA 3HSKA 2P0AA 4KQCA 1NJ8A 3KXDA 2AG8A 2WWRA 4G5YA 4YRRA 5KAMA 1M2VA 1U7XA 4HQRA 4IOJA 2YN4A 1ZGJA 1UFKA 2E5WA 2IPLA 3MN1A 3WNZA 5BWBA 5C32A 3NASA 4AT1A 1PR6A 5EJIA 3UGTA 1JNXX 1ZX1A 4GL2A 5IUKC 2AFVA 4OJQA 5H70A 4DCOA 3AI3A 1OFUX 2WTMA 4NJEB 3FCXA 2OYRA 2WF8A 3WGIA 1G6Q1 1OV4A 1M2NA 4EA7A 5TQVA 3MPOA 2R8YA 2HPHA 2DUMA 3KVYA 3CPHA 1OFTA 2FUG1 3ANMA 4J0JA 5JW6A 1A8HA 3A7EA 3GUHA 2VDMB 3GFOA 1JG4A 3WWDA 3I01M 3R9XA 5AXDA 3NHPA 4MWGA 5LZ5A 1IUOA 2QUHA 4PRZA 2ZIVB 4YJ3A 2VBIA 4CMGA 4RD0A 2AI1A 3G7SA 2C3PA 3PV0A 4PLCA 5AVYA 4L28A 1N2BA 1A5AB 1D0VA 3CLUD 3LCMA 1H0HA 3EASA 1BE8A 4OK5A 3BRSA 4MDYA 5HEKA 1O4WA 1PG2A 1COZA 1KAMA 3JALA 1WHSA 2EQAA 1L4BA 2XXAB 2JIZA 1PZEA 1XPJA 4IX9A 5AVVA 1JW9B 1SU8A 2Q5EA 5GQSA 3L6UA 5LOVA 2E1PA 1T25A 5BYAA 2GYUA 1ML3A 1P4SA 3FYUA 4O4HA 4YP1A 2QUJA 3WL6A 1ABBA 3S8EA 3H1TA 4YP5A 1T2EA 4NNJA 5HCUA 5DLPA 2WSMA 3PXDA 4O29A 1L1FA 1UIRA 4BNLA 4CQMD 1KE2A 1YCHA 3RJTA 1IBKB 3CNLA 1L5RA 3M6FA 4IIXA 4JI7B 3K73O 4GZLA 5B7QA 3FJ1A 2DHQA 4BC1A 3SI7A 5IBPA 5IBRA 4DY4A 4DR4B 3UT5B 2UVDA 1M1YA 2XTMA 4AZ0B 1N33B 2V4MA 3JYHA 1C2TA 2C8JA 3EDRA 1IDN1 3DHNA 3RS0A 1X8KA 4RV4A 5F78A 1EFRA 1YMQA 3Q41A 3HRHA 3A1NA 5H7XA 4HDKB 5JJKA 1XXHA 1QF6A 4RZXA 4O59O 4YT5A 3T0IA 2WQZA 1VI2A 3CR7A 2V3CC 3ACBA 1XC7A 4M1EA 1E4VA 2JKYA 4P53A 4AS1A 4OH1A 2QNBA 3MJHA 2UZ1B 3PEWA 4XPZA 2GSDA 4WV3A 4HX5A 1AUOA 2HMAA 4IF4A 3ZE1B 1NASA 2PWYA 4DBLE 4AU1A 3HWRA 5K8JB 4P0QB 3CT4A 2Z2IA 1RBYA 1T0IA 4DXAA 2WU0A 4Y6QA 3GEMA 4PPFA 5BV7A 5CG2A 3UPTA 1TJ4A 2JZNA 3NDBB 4KQEA 2AE1A 2AUMA 2GMWA 2P6NA 1J06A 4RVUA 1NP7A 2CFRA 3ROXA 3OBBA 4RTQA 1ONOA 1Z5OA 1B0UA 2J6IA 2ZR0A 2OXFA 4D4KA 1VLVA 1KY4A 1BRTA 2WDZA 4BNDB 5CXQA 1GWNA 3S7ZA 5IM5A 4LVUA 5JI3E 4RIEA 4J0DA 5FT9A 4CEHB 4D42A 1NBOA 5JS2A 1ENOA 3UAYA 3RSSA 3AK4A 4AG3A 4F3YA 4UNNA 4MUEA 2WHRA 5JCXA 4A8PA 1NFQA 5AI9A 5I7HA 2JD2A 3BFPA 3IV9A 1O94A 4OHKA 2G5PA 3R0ZA 2C84A 2B34A 2E21A 2ERYA 2W58A 2YDYA 3OY2A 1CIVA 1UR5A 1OZHA 3IR5A 3S70A 3TX2A 1HQCA 3CLSC 5KQGA 2CF6A 2E85A 4CBVA 1R9NA 2GAFA 2RARA 1EB8A 2C61A 3D7KA 5EI5A 5GP1A 3CRW1 1VLQA 2WKPA 1GGJA 2PQ2A 1FQKA 2Q0SA 4MKHA 5G0UA 4RA6A 3FM9A 1TW2A 2GN9A 3U62A 2AR9A 1M2WA 4N18A 4FCTA 4MVYA 1MT0A 3VX3A 2QRQA 5K9ZA 2JGDB 1UBRS 4UVDA 5AK6A 3C7TA 2XIJA 1YR3A 2CXPA 5AIAA 3O4RA 2Z2XA 1SWVA 4ND8A 5EE3A 3FDIA 3AHCA 1XZAA 3LG2A 3LMKA 4Q4JB 1II8A 2XVMA 4RKEA 4DABA 6LDHA 1NT2A 5KQLA 4MUIA 2TECE 2PDAA 4LG1A 4AULA 2ZBEA 3GFQA 4H7HA 1X87A 1F12A 3AKDA 3DGFC 3I6YA 4RGVA 4F9GA 4G0WA 1GTRA 1MOSA 3C3EA 3TW8B 2YW2A 4B9EA 4Q4AA 3W78A 1N5OX 1TZMA 3UXHA 4KQMA 3FD8A 1CY6A 3HFRA 1OGIA 1Q1ZA 2C4NA 3AM4A 3CKYA 2V5AA 3ER6A 3IKMB 3MRSA 4DDMA 4XRGA 2WJWA 2H17A 5C8ZA 1C41A 3M5PA 1CR1A 1JUDA 1AZLA 4FQ8A 2Y0PA 4KBGA 3L6EA 4N7MA 3CGWA 5JNWA 3HV2A 3OEHD 3DE4X 3OKFA 1JBKA 1Y3IA 3AIKA 5DRTA 1AQIA 4HD8A 3QJGA 2OZLA 3CHYA 4HLUA 1HZZC 3VOTA 1R27A 1NVUQ 5AKXA 3QE9Y 2JATA 2P4QA 4JSRA 4Q7LA 1XMIA 2A0KA 4NBWA 2CXRA 2PUAA 2CVZA 2QZJA 4BMZA 3EGDA 2C5EA 5HUJA 4QXMA 3QLEA 2C8LA 4P84A 1MPXA 2HI0A 4RADA 3HXMA 3ZY5A 4LGCA 2CCJA 2D5LA 5BN3A 5HXAA 1G1MA 3OMXA 1NG1A 5HOEA 3GJ0A 1NM5C 1KI6A 3NOVA 1JPUA 4G0VA 1SD2A 4YRNA 2VAVA 3TIGA 5A6VA 2ZWPA 2D54A 5EEHA 3B5EA 2W6PA 3H9GA 4MUFA 2OMEA 1T1IA 5IZ4A 4XDGA 1GZHB 1E2PA 1LU9A 2AOUB 1MO4A 4FSHA 1TEXA 4TRJA 1K4KA 5DGCA 1YD7A 4ZPJA 3OVMA 5ALEA 3KYBA 3ZNNA 1P5FA 1SUEA 1DJPA 1SIBE 3PRHA 2QROA 3SYRA 1M2HA 4B3SB 3TCXB 1G2OA 1WSDA 3MTAA 2B99A 3TBFA 1KORA 5K4AA 4ZI5A 3OQHA 4KVZA 3QJ5A 3RBZA 3D1JA 2P27A 2I1QA 3RABA 3EPLA 5C31A 4CM1A 4BO6A 3JRNA 4FW9A 2B61A 1X7ZB 5DM0A 4OP1A 2O1WA 2ZUDA 3ETJA 3WOHA 2G0TA 4Q15A 2POCA 5TQ0B 4D4IA 5K0EA 3BT7A 1F2UA 4Q7MB 2II6A 1F6DA 1LDGA 1P74A 1LTKA 4IFEA 1PR9A 2OCBA 2O0HA 2E4ZA 2ARKA 2B7LA 4Y0AA 2IEYA 2G1AA 1NXWA 2B2XA 2CJXA 2X1HA 2IU6A 2R6ZA 3G9XA 1SCQA 2W0MA 4JEMA 1OFVA 2LIPA 1Z2OX 3B60A 4K9DA 2ZRAA 3CSDA 3ZEIA 5FTLA 4BCDA 3QGMA 2PUHA 2H65A 3P9KA 1RPNA 4JJZA 3ASUA 3GJ5A 8OHMA 3L1JA 2Q1WA 3CW8X 3PL1A 5EHXA 1E2LA 2PFKA 3UBTA 5KWVA 3FSRA 4IQ0A 1HFJA 4Q3NA 4IIJA 1DOAA 3GLKA 3JWHA 3R7WA 2F9FA 2A1IA 1VE1A 2OO5C 2W90A 1I3LA 3U3ZA 4FDVA 3N0RA 1GSIA 4EKDA 2R6JA 2R6GA 4M7WA 3K4PA 1POWA 2DKFA 3WVNA 4B2LA 4CV0A 4BO2A 4PHFA 5LZ7A 2A5GA 4BAUA 1T1JA 2I76A 3BK1A 3GFSA 2H7CA 3R0QA 2BMEA 5L3ZA 3H11A 3I92A 1G8KA 1R3UA 3CF4A 3AJRA 1X92A 2GA8A 4MXDA 5DOZA 1YOVA 5LN1A 1D9ZA 4A82A 4B3GA 1WUHS 3UJ6A 4WIAA 1V2GA 1SQ0A 2H9YA 2I29A 3JAWB 3RC3A 2XKKA 1H3EA 2O8FB 2QXYA 4RE6A 4AXBA 1M54A 2JAWA 2OXCA 3O3MB 4RWZA 3UIEA 4R84A 1TMYA 4U2CA 4DR3B 1APBA 3V48A 3WGTA 4FB5A 1RCTE 2FR1A 4OXIA 1PWZA 1NI3A 1NKSA 2H0QA 4FYXA 4QECA 1A9PA 2Y3IA 1NQWA 2ZLBA 1UPXA 4Y3UA 4EHDA 1IWPB 5CAEA 3A0RB 3CIFA 3RHTA 2JLUA 1VJGA 4ZK6A 4CKWB 4EMUA 4Y6OA 1ZBQA 4RJLA 4R83A 2FPKA 4DCTA 1ONPA 1CFZA 1S2IA 3GOHA 1LVGA 4ACBA 4BOYA 1CEQA 4AKEA 2Q62A 3JASB 3EDOA 1Z4LA 3NBMA 3M7IA 4JKOA 4BE4A 4EJSA 3UMBA 4AQ7A 2YQZA 4UE2A 4UBKA 3SNKA 3E3NA 5JRJA 4LZWA 4MHTA 3GRCA 3FZEA 2ZRHA 1SD5A 2PSEA 2UV8A 1H42A 2QXTA 3PC8A 4D0NA 5SY9A 4HH3C 2QI9C 3C3WA 2WWGA 1QZTA 1KZ1A 1NOIA 4KPUA 4Z3KA 1QYIA 4N8EA 3ZBQA 2BR3A 3KEMA 4I08A 5A4KA 1Z9BA 1GOTA 2GA9A 2WM3A 4GUDA 5FWXA 1ZP6A 4WUTA 5AKLA 3C5HA 3TLKA 1QGED 4HWGA 5TGTA 1YF3A 4L8WB 4NHEA 1QFSA 3UGQA 4F93B 3PB3A 5BSKA 1E2BA 2FSGA 3IPXA 2WKRA 3VDQA 4DL9A 1RHMA 3JU3A 1JPNA 2ISQA 4LZZA 1U9CA 1AMOA 1SFRA 3RRYA 2JA2A 3CB2A 1TJYA 4LQCA 3OCVA 4JBYA 4BGEA 4LGMA 1JIIA 2H2AA 4B7UA 3ZV6A 1RYDA 2BE9A 2C54A 1PDOA 3VMFA 2P6PA 3LPMA 3GG2A 3QG5A 3QX9A 3RVLA 4INOA 4OAOA 3LVFO 2RDMA 3EZNA 3FSGA 5FH9A 1M1NA 2F3UA 4OKIA 4ZA2A 3KVNA 2NIPA 3CRVA 2FP4A 5HKOA 3AP1A 2DCUA 2PR2A 3EXFA 4TXNA 4ADSG 5JFGA 2Z08A 3GLFB 1IN1A 2DZDA 3ZGNA 1T5SA 4QWWA 1N5LA 1ZLXA 3V4LA 1Q22A 5JCZA 7MHTA 2G28A 3JQ7B 4M46A 1X7XB 4K88A 1CP2A 4B7ZA 5DN6D 1G4AE 2CKMA 1QOQB 3GA5A 5BVHA 1ZR2A 2JAPA 1VCOA 5LNK6 1VSTA 1T4DA 4ARZB 2XMDA 2QTVB 4QKQA 2Q3EA 1ULSA 1EH5A 3LQRA 3DEJA 5GPBA 3K9LA 4NYJR 1OAKA 2R65A 1LRLA 4PBSA 3ADDA 1P1KA 2V3VA 3NUZA 4V0KA 5F4ZA 2D8AA 2UYCA 2V6MA 4IDDA 3AL3A 3NVKI 4LDPA 1XO1A 2A58A 5CNMA 4YRDA 5JADA 1XXLA 2HCRA 2ZYDA 4CFSA 2XWJI 3IVAA 3ZU4A 1CUYA 3HPQA 1QWSA 3VH1A 4WBNF 1UWCA 2Z30A 3OX4A 2OHJA 4QJBA 1MVNA 2ODNA 4TRMA 2W2OA 3I04A 4NQRA 1UMDA 3UAGA 5A5EA 1KXJA 1T1SA 2BFAA 2ZE6A 2XD4A 1IXRC 4P98A 4L78A 3T1YB 1U94A 2BEWB 3MF4A 1LVHA 1XTSA 3NW9A 4MARA 4C08A 5DGHA 1QNLA 4HDNA 1ZCZA 4IGEA 5TXGA 1RCFA 1IQUA 3OTGA 1UT6A 2Q3LA 2FP3A 4XWGA 2BEVA 3ZGLA 4BKUA 2PPLA 5AR1A 1NXVA 1ZK0A 2C9MA 2JVIA 2JZOA 2OFOA 3O9VA 1V39A 4G0MA 3UGKA 4B6OA 3RAEC 3KT3A 2ATIA 1RDFA 3T1TA 2CDBA 1VOTA 3LQFA 1P77A 1XMPA 2C77A 3P0EA 3R7DA 5ERGB 3RS5A 4E70A 1REQA 2K2QB 1CEYA 5GV8A 1G5QA 4G0ZA 3ITKA 3NHSA 3QMVA 3PFFA 3PJDA 4P4GA 3BD9A 1QFMA 2F3RA 1JG2A 3HN6A 5G4LA 2F8MA 5D3KA 1PJRA 5LLDA 2VSXA 3FKSA 1Y7LA 4E5DA 1U63A 3BXHA 1IXKA 3EC7A 1IMJA 3BL5A 1P8JA 3CR8A 4LAFA 3FDXA 4E94A 1YS7A 3M4ZA 4GZMA 1HLDA 3LSYA 4BNNA 4EQ6B 4Z6KA 1ZIYA 3JCZA 4X90A 3KKPA 3OCCA 4YAKA 3HO6A 1IUPA 2OXRA 5LXTF 4MHSA 5DWQA 1TAUA 3DE1X 2Q0XA 1AB6A 1ZGBA 3N2KB 3NETA 4IIFA 4AUKA 4KTVE 4EA8A 5LNK1 1LFDB 1YRHA 3G7NA 3HXOA 3BWDD 1K7YA 4R7GA 4I55B 3L8FA 1V11B 4KWTA 5AUQA 3ZS9A 4CM5A 5B3AA 2KI5A 2HWYA 3EFBA 4C3OB 1FF9A 4W5WA 5BUCA 2XCUA 1F60A 2AMLA 3IPYA 4NARA 1PQWA 1FLDA 3BQMB 1WZ2A 1HDRA 2FPPA 4OKSA 3Q3HA 4N0DA 1YMVA 3H5VA 2A78A 3WYAA 1CZRA 3ZY3A 4DAOA 1V4VA 5I8ZA 1ZR4A 5BV1A 2JJ1A 3UWKA 2VTDA 4L15A 4L5AA 4NZPA 5CFLA 4JEIA 1UBMS 5EJ6A 2IZZA 3LLSA 2XGOA 4UATA 1X80A 3RRJA 4GPIB 4OO3A 2JLWA 1OGYA 3ADCA 2ZUFA 1GLVA 2RH9B 3JQEA 3QM1A 1KETA 1JSRA 3ZYZA 2AF3C 1P75A 1SZJG 1U6JA 4HX2A 1YWGO 3T5DA 1OE0A 1J0BA 1DOHA 2ZVPX 4JKYA 3GUYA 1WHTA 2OVFA 1PWHA 2YOHA 1K8ZB 3ETHA 4XPIB 1XDGA 5HPYB 2Z4RA 2H1CA 3EUEA 1XU9A 4LRQA 4NEGA 3ZJVA 1H9BA 2HPAA 1BMFA 1T2VA 3WKEA 3BFJA 2WD7B 4QDOA 4EI9A 5TQ2B 3WSTA 2RCYA 3Q7EA 1UXKA 5KNCA 1ANKA 3D3WA 4MTLA 5JBIA 3JQGA 3FTFA 5DISB 2C92A 3TQCA 4EG1A 3G9QA 4FT2A 3OPXA 3ZH9B 4S12A 3K9CA 3ZWXA 1E9CA 2EAUA 1S3FA 4M54A 4A03A 821PA 1XU4A 2PFSA 4V3BA 1BD3A 2J0SA 1R8XA 1ID8A 1B6SA 1EXDA 3OX1A 1C9NA 1G64A 1K5PA 1RLMA 2R8EA 4PAQA 5A4FS 2D8MA 1W87A 3C7CB 2HY7A 1MW9X 2IEDA 1FUYB 2LUOA 4DWOA 2IP4A 4N8SA 2DB3A 4BNZA 3QUSA 4TTVA 1PJSA 2QTHA 2GLXA 3E7WA 5EQJB 1OFHA 1LSUA 1EFPA 2CLDX 4RTLA 2Y0BA 3KCQA 4WT7A 3K92A 3PC7A 4XGIA 2RBKA 4YRFA 4KL8S 5B7NA 1YVEI 5J2UF 1DUIA 5JE8A 1Q44A 4EFKA 1TCUA 3SICE 2DMRA 2QHXA 4DHEA 4DYDA 1GQ2A 4XLLA 2BHLA 3ZHBA 1X1QA 4Z3DA 2JH8A 4TLCA 5FR2A 1NW7A 3ETGA 3GVCA 4V2UA 3S99A 3OMLA 2NVBA 3F49S 3S2YA 3WICA 3U09A 2AV6A 4FDUA 3F9IA 1M0WA 2I6UA 5IVKA 2DR2A 2I7DA 3SQWA 2BGIA 4JWTA 4ZI7F 5ERXA 1PHPA 4GBED 1PYDA 4OJMX 1P39A 2Q4RA 2WIAA 3CC8A 3TQSA 3W1WA 1FSZA 2NXCA 2P2DA 4P4TA 4PFJA 3QH4A 1IK6A 2FSSA 1UAYA 4D26A 1AH2A 3TW6A 2PX4A 5KIAA 3OPYA 3U3MA 3SM9A 4DCMA 1OD6A 4KQWA 5AKKA 4Q7EA 2CHFA 4FGKA 4BBPA 1QGZA 1RYBA 2W11A 4TWBA 5KI6A 1F38A 1GAXA 3UQYS 4YMVA 2AEFA 2G9ZA 4PPGA 3B6ZA 1GTZA 5REQA 3A4NA 4RVCA 4S1OA 4LCEA 1SU6A 4TLAA 3FIUA 3FYHA 3WGMA 3FOCA 5E1DA 1SEPA 3WO0A 3IH5A 4GR9A 2BFFB 4ETNA 1DAGA 4NYJQ 3WIUA 1Y6FA 2OE2A 2QBYA 4UM7A 2EDAA 4DQLA 5LWQA 3FGNA 3P2KA 3FMFA 1DTSA 1GNPA 2WW8A 1HH4A 2GERA 4MUYA 5EY5B 4CM9D 4BNKA 3IQXA 4I1YA 3COPA 4ZYVA 1M2EA 2CJPA 3Q0EA 5K8IA 2XEDA 5FNVB 4EF4A 3EFEA 3QEBZ 3G8YA 1A9TA 5FI1B 5FPYA 5CA0B 3U5ZB 3D31A 5BVGB 3HH8A 2VDRB 2UYYA 1PFVA 3QELB 1G63A 1Y1TA 3C70A 3OPYI 1YBHA 5K3AA 5LA6F 4M0MA 1FMFA 2WJAA 3AHHA 4M3NA 4QUBA 1J2YA 4M1SA 4HN9A 3C7DB 4KKXB 4M9QA 4QDZA 2I99A 4FP9A 3U4QA 3ER8A 4G0XA 3V55A 1QTQA 3ZCQA 2A2ZA 2QTWB 2VUUA 2G0NA 2JHAA 4I1SA 4KYIB 3RREA 4GI1A 5HIAA 2CUKA 4C06A 2FN8A 2YV4A 3RJ5A 1Q1BA 3KJFA 3L82B 2CJWA 3PL5A 1EGAA 3RS2A 4C7XA 2R3SA 3ZKWA 2QDKA 5C5EA 4XYGA 1XTIA 3Q3CA 2YN0A 1ADJA 2CUTA 3X1XA 3T34A 1E3DA 3F3SA 3ONWA 4MB0A 4GW3A 4UNRA 1T6BY 3FROA 2FQWA 1W0JD 1OFGA 1PT5A 3DHYA 3CZPA 3H6HA 1VMDA 1NIPA 1UZLA 2Q3JA 3GLQA 1AUQA 1RMYA 3DAHA 4C30A 3VDMA 3ZNOA 1JTEA 4IQFA 4OKNA 4LYFA 1OV6A 5GJVC 3U3OA 2ROQA 3L49A 4E2ZA 1TD1A 2VYNA 4WERA 3D54D 3QF4A 1KL7A 1LQ2A 2JI9A 2Z5FA 1V1JA 2HLDD 2VSYA 1QHGA 2H16A 2WVHA 4OLFA 5AVXA 1AT1A 4UDNA 4BV8A 4YA6A 1JKJB 2ESRA 2FX2A 3AUYA 4IJMA 1ECPA 1JG7A 2PH1A 1INLA 2X42A 3NYWA 3S2IA 2YZGA 3JQ8B 4WQMA 4ETIA 1PP4A 3HEMA 1BXZA 1QPGA 3LW7A 2AL7A 1O77A 4I4CA 4IKOA 4LMBA 4YFVA 3IP6A 4D25A 1EVEA 1W1IA 4LJKA 4UNQA 2J6BA 2P65A 3V8BA 1U2RA 4ABTA 3SC3A 1C80A 1SAYA 2HV9A 1PJ8A 2B8NA 1UWKA 2WHPB 2H2FA 5AI6A 2RHOA 1NQ5A 3G5UA 2I4MA 5DJ5A 3WAGA 4UMDA 2I87A 5K6RA 5DLEA 2V58A 4R1MA 5ESXA 1POXA 5D5HA 5BW8A 4GH5A 3K9FC 2ZK7A 1JIJA 2IZ1A 4A16A 1Z4OA 4J07A 2C4TA 3GELA 3UJAA 1ISFA 3HZRA 1KU0A 2Z04A 2JVKA 3FX2A 3PWTA 3Q6MA 4LXUA 3EA4A 4N3NA 3RU3A 4UBIA 1Y4AE 3HXQA 1A50B 5GAJA 5SYMA 4Q9NA 2HSGA 4PS0A 1M7GA 4M86A 3IILA 3PPIA 5EPUA 1UXJA 2F62A 3OD1A 3HNRA 4EEKA 5CITA 2IYQA 3QTLA 4EY7A 4KXLA 5F12A 3ZJYA 3UW3A 2RHDA 3KAJA 3LE8A 4RHTA 5B2ZA 2KS6A 4MI3A 2DHCA 1XD8A 3HACA 2YFQA 4TYMA 4X84A 2ZRDA 1NW4A 1KIAA 3NNNA 3JPWA 1D2EA 3RUIA 3JVEA 2LDBA 2WT9A 4QQRA 4R2HA 2GN0A 5M3BA 3KYJB 1JJ7A 3QV2A 3B1ZA 1PGQA 4O1MA 4TTTS 1IM8A 2JFBA 3KB6A 4ICIA 1G7RA 2BTOA 1XQ9A 4GYWA 4KQXA 1JFRA 3QBVA 3IRUA 2DH6A 3PWZA 3R3WA 2Y76A 1D6MA 3U4IA 4NCIA 4R1PA 1H23A 2DQZA 1B0ZA 1N2XA 1LBEA 1YOBA 3AILA 3HKDB 3OTIA 2IU4A 3S1AA 1Y6GA 3V1NA 4I9HA 1GR0A 1B93A 2C5SA 2OCYC 2YY7A 4U39A 5KJFA 1A7JA 1HE4A 1M1XB 4AMZA 4B84A 3B20A 4AUNA 5JZ9A 4QU0A 2P6MA 5EJ7A 6PFKA 1FP4B 3WBFA 1P33A 4M0KA 2ET6A 2YZ7A 3A9RA 5ER6A 4FYWA 2XADA 3VHXB 3G59A 1G4HA 1J1IA 2BEKA 2O2YA 3KJHA 1QR6A 1GQSA 5DX0A 1SZDA 2XODA 1EE1A 5JAOA 3SSNA 3CISA 2A1UA 5BP7A 4RD2A 2MMCA 1PJ2A 5FPTA 3GT3A 2HM7A 1C5KA 4HWOA 4RL4A 1WMDA 1J0EA 1J9ZA 2CE7A 3F8TA 4YN3A 3NQ41 5DYTA 5A9TA 5IN4A 4DC9A 1IZ0A 2XB8A 2CL6X 1LI4A 3IC5A 1VJRA 3QZUA 4Z7OB 2ZSHA 3OO1A 4U5XA 2O3RA 3CWCA 3B5JA 1FTNA 2VJKA 5KTYA 2ZUUA 1XTUA 4X1KB 2FDRA 4UBNA 1UAAA 3K0EA 4HHEA 3JAKA 4NCKA 5TMBA 5DM70 1P2GA 1WW3A 1I7LA 4PLHA 1WDTA 4YRTA 4E30A 4E5YA 1ZJWA 1E5QA 3SYLA 3AI2A 3FNQA 4Y7CA 1RQGA 1R8QA 4HUQA 1SK9A 5JD3A 3ML1A 3DFZA 3PCTA 3SXJA 1V9SA 2ZB8A 1BHJA 3CR3C 4QNRA 3VDNB 1E4EB 5FL7A 3V80A 1U1DA 2GWHA 1LH0A 2QUIA 2V9CA 4B2PA 1Z7YA 5CB4F 3HDVA 3DMGA 4DTIA 4NX2A 4JXXA 2C1EA 3X43A 1VE5A 4GX0A 4KQGA 3T9CA 1PT9A 2IPNA 3FUTA 4YLEA 1O89A 5IVDA 4D44A 3GLRA 3E7PA 3B9BA 4WWHA 1V8FA 2ZEJA 5HDQA 2BGGA 2ENUA 5BWMA 3QXGA 4F1KA 1UBFA 3H2ZA 4BU0A 4EKIA 5AW3A 4DR6B 2OCXA 1J21A 4V1CB 2XMSA 5JWRA 1R1DA 2IYFA 1R6XA 4J4TA 4XIFA 2APJA 1H8HA 1BHSA 2ZPUA 3QA9A 2J3DA 5CT5A 5AJYA 4LF8B 1VLHA 5HF8A 2X7JA 3VYRB 3AVVA 1AO3A 2PMFA 3KBOA 4OIFA 1WZIA 3EULA 5U4XA 5IT9A 1UAGA 2C97A 1VHDA 1BYIA 1GZ4A 3FIJA 3JD1A 4HDQB 1FYVA 5HNKA 4JI3B 4IDBA 2OV8A 4JH0A 4PGGA 1LDYA 3IIJA 3I9FA 3PSAA 3M81A 1Y1KE 5JBQA 2PMDA 5HSGA 3TTTA 1DCFA 1BMDA 2BFWA 2EP7A 1X7HA 1WRBA 5FHRA 5J9FA 1PZNA 3PUIA 2N75A 2QRNA 1P7WA 2ZAYA 1KSGA 2D7CA 2Z2KA 3A1VA 2XCLA 1I80A 4CJXA 3G9ZA 5JECA 1OH6A 1W88B 3ES9A 4QQKA 4C7MA 2GZSA 3ZVLA 3ME5A 1VMEA 3AG6A 2JHPA 1V3UA 2NO6A 4YJHB 1C7RA 1R0CA 1BCRA 2AFIE 2Q46A 2VT6A 1U7HA 2A94A 2IYEA 4OOFA 3TIFA 3GUCA 5LP6F 3ULKA 2HT1A 4R81A 3NC4A 5KC9A 2P9FA 1VA4A 3AHGA 3NDRA 2EXXA 2FZKA 4Z54A 1FRNA 4YPFA 3SS9X 4ENSA 2HXSA 1QIGA 2ZCVA 1KO7A 3LW8A 1ZWKA 1T5TA 3EIXA 3L8EA 4LSMA 4TLDA 1GYRA 4IOLA 2J9YB 2EW1A 3QVGB 3FPKA 2BFDB 3RDPA 3MW8A 3IL2A 1BVUA 3OQBA 3U48A 2PQMA 2YIMA 1JQEA 4LX8A 1JI0A 2VSQA 3DYIA 3HCOA 4EUKA 5BNTA 1O0BA 1K06A 3QX8A 3W7AA 3P9XA 4EHIA 3X1WA 1DG1G 5IYZF 5T57A 3NHMA 2B0CA 3ICOA 5MFPA 5DVZA 4OBWA 1WKBA 3G2NA 4QX6A 1YK1A 2IS4A 3FMGA 1OILA 1U7OA 3NFRA 5AM3A 3ZDDA 1X9GA 1L5HB 3GPBA 4P81A 3O0TA 4LWQA 1E4YA 3O91A 1OSNA 3DKPA 3UOAB 4AJOA 2I3ZA 1IC6A 5GZ3A 1YRBA 3W2IA 3LP5A 5ALOA 4NH4A 2PZMA 4LOAA 3RUCA 3MWLA 4A8JB 1XJ0A 2GEKA 4WASA 5LZ8A 5IK2A 1TK3A 2IV7A 4PGMA 4WEQA 3VTKA 3ZZ0A 1NN1A 4GI5A 3WJ2A 4JNKA 1WVGA 4EG3A 2YHSA 3L6OO 1GU1A 3NHKA 2FSVA 1SXJC 1ZNZA 4M38A 3S5UA 5EWLA 1V95A 3VZSA 4F4IA 3GP8A 3MWFA 1FXWF 2F7SA 5K8LA 1H2BA 1M73E 2O23A 1X1CA 1LNZA 2GN6A 3IAS6 2Y68A 3KVRA 5KSPA 5KQRA 3DLHA 2YHIA 1QZZA 3ASZA 1KZ4A 3IE0A 4JVNA 3ZYCA 1FUUA 3IBCA 5FAXA 2QNIA 3WGVA 4FWTA 1XQXA 1X8XA 4GUAA 4LJ5A 2QRZA 2CVOA 1JL3A 4JUIA 2R79A 1W4RA 2GK3A 2NACA 2Q5IA 4LYHA 5JPIA 1KOJA 2W6IA 3PFWO 4OLJA 5KVSA 3RIHA 4R54A 1P9NA 3Q9LA 1WXEA 1O97C 2AMYA 2M6LA 2B4RO 2P78A 3CG4A 3QXCA 2XXBA 4JT2A 5JMOA 1U8XX 1VP3A 4MJXA 4CDNA 5C3MA 3U3RA 3HB5X 3UC9A 3Q3IA 3O4GA 1P0MA 2NSYA 4A0GA 2F90A 3LK6A 2HWXA 4GMFA 1MNAA 2V6GA 1CYDA 2KQUA 4KIWA 5K3SA 3HNOA 2WJVA 4OFBA 2C5LA 3FTQA 3O94A 1ISPA 4N39A 1YQWA 2VAXA 2HF8A 2W2XA 4LECA 4H7KA 3VH4A 1H5NA 3DZFA 4PZUA 5A3SA 4D8VA 4PLPA 5BPFA 5L40A 2W0SA 1DKMA 3SVLA 1I4EB 4NI5A 2NW6A 1OXUA 2V7QA 1GYPA 3BYZA 3KWFA 2B69A 2FFRA 4KOAA 1BZYA 2P9QA 1KU6A 5EHIA 3N0VA 1SBYA 1KE1A 1NBHA 3VR4A 3RIXA 2Y1LA 3DFMA 1T1RA 2JIOA 4IOMA 4BFUA 5D2CA 2IYSA 3L0ZA 1D9XA 1TAHA 3VJRA 2BEUA 3ELWA 4UD6A 1FYXA 3G13A 3ND5A 4BRZA 3FWHA 3N39C 3X1ZA 3I01A 4KE7A 4GX5A 4OFWA 4XWYA 3T12A 2Y93A 3V5NA 4AY3A 3AUFA 1XCJA 3QPAA 5EHGA 2WI8A 5J2TF 2I34A 1H1LA 2NNWB 1HC7A 4BLQA 4F8YA 3FHLA 1NT4A 3U7FB 1JR3D 2EWMA 1U7ZA 4FUTA 1XZIA 3IDSA 2YZKA 2C98A 3OZIA 4EFNA 2XMPA 3KDAA 3R5FA 1M75A 5DNDA 4LRWA 2XNCA 1YCGA 3GFPA 3NVAA 4RKRA 2K7FA 3BD6A 5U1PA 3PLAE 2XVZA 3PR2B 2QVXX 3RVSA 3IAS1 5BYKA 4CL2A 2J0QA 3TMKA 1ADBA 4EG0A 1KYQA 5A4DA 2WAXA 4Y2PA 3H04A 1UWLA 2JF0A 4HDSB 4ZO6A 5B5SA 4CF6A 2PKRA 4I14A 3QVTA 4ZQHA 3EXAA 1U2GC 2FN9A 1S8AA 2FFAA 1IVYA 1G6OA 4R0MA 1KRWA 3VKGA 1Q2UA 4EPTA 4FFBA 1LQTA 1HT0A 1NI4B 1OAOA 4IEIA 3UPDA 2AA3A 3LNCA 4PLTA 3A1CA 5D6OA 5ALMA 3RYHA 3SYTA 2IQIA 3PPYA 2IIQA 4WZBA 3MINA 4E2XA 3UK6A 3HXKA 3R3ZA 3ABRB 3B12A 3UMGA 2QEQA 4DRZA 5G1PA 3BRQA 2CW5A 1W4ZA 1L9KA 1YXMA 3HCEA 2QVZX 3KKOA 3OEWA 9ABPA 2ETVA 4IV0A 5HZKA 3PG5A 3FPGA 4MICA 5FTKA 3OECA 5CW2A 1N2IA 1PGOA 1A96A 2GCOB 1YJCA 5FD8A 3OQMA 5K0CA 2GHIA 4OI1A 2REXB 1RIIA 1E3MA 4PC3A 3OESA 1P61B 3M6WA 3TEJA 5L3RA 2BMJA 4EY4A 5KYXA 1E99A 2YVKA 3GZTB 3MXOA 4N9QA 5C2JB 1AD2A 3UOGA 2GAAA 3ONEA 1JQBA 2GEFA 3GRRA 5HILA 2OLKA 4HOYA 1GU7A 1RZRD 4YPOA 1ONNA 2PSSA 3KQWA 4ONEA 5ALFA 3WYEA 3WJ1A 5DI3B 2IYZA 3AYXB 4BDTA 4HDRB 3D1VA 4Q9JA 1DBSA 4JI5B 2CL0X 4AZSA 3UAXA 2B3DA 1HF3A 1WCXA 4N65A 1NN5A 1XDBA 5CJ2A 3EBOA 1YDHA 1QH1A 3TW4A 1NJFA 4I8DA 2GOYA 1F48A 1D0SA 1E6CA 3O90A 2HRDA 2PMCA 5GMOA 5TEWA 3FF1A 2IZ0A 4OXYA 1Y5RA 4ASUA 1JWBB 2Q5FA 1Y9JA 4ZZ0A 1LWNA 4EATA 1VFNA 2ZM5A 3M89A 2X1VA 2GXSA 1V26A 4XX0B 1Q1GA 1AKQA 4DE5A 5K45A 1XPRA 1Z15A 2ZSJA 5ICEA 2NMVA 1L4LA 2B4AA 2WVGA 3M1IA 5CJJA 2GBCA 2Q5OA 4Y2HA 5PNTA 3ZZ1A 3EF1A 4AJHA 1QV7A 3PEEA 1GPNA 1CZKA 3Q5DA 4KXMA 2P9CA 2Y8EA 5FWAA 4D1YA 4ND5A 4D4HA 2XT0A 4U63A 1UDCA 2O7NA 2HH9A 3WWYA 4DKXA 1Z0KA 4G85A 4F2HA 1JHDA 4R9UC 3E9YA 4WKBA 1RXVA 1MG5A 1ZC3A 2Z9DA 1YFZA 2V59A 1SBCA 1QH0A 3PDJA 4G09A 1E2QA 4EL0A 1RVV1 4PAWA 1FW6A 3SX2A 2FSFA 4QVGA 3MWKA 4R7TA 4TSFA 1D4ZA 3FSJX 3GOQA 4JB3A 4ER0A 1T3LA 4PHHA 2CHGA 5J58A 1MOQA 3ORFA 4GVLA 1ZD9A 2WV9A 4KN8A 421PA 1ODLA 1XI2A 4HAWA 3THRA 4UZSA 1QLHA 3GD7A 3G2OA 2HRBA 4AS3A 2WQ7A 2PL5A 4QGSA 3GAAA 4PG7A 3BFVA 1JQ5A 1LBQA 3K96A 3F4LA 4ZAYA 3VTAA 1CP3A 1P5HA 5KPJA 1RJ9A 1UKEA 2IITA 1T91A 2K2WA 3A6EA 3IIKA 3RYCA 2ID4A 2IXDA 2AXPA 1JIQA 2D7JA 3O8LA 2EJWA 1SQ5A 1DQSA 2XB9A 4HLDA 1N3LA 4KRXA 4DDUA 1PGNA 2Q5LA 3B1WA 3O95A 5KX5A 3K3PA 1ZIOA 4X24A 4HAZA 2ISCA 2D4AA 5F76A 4DMRA 4B82A 3P0JA 4Q3CA 1MC4A 3EVBA 3LP8A 4ZO7A 2C42A 5L6MB 4ZEWA 1Z8FA 4G63A 2AJCA 3W8DA 3AERB 1V71A 3IVGA 4KHPB 3FYUC 3BK7A 4NRDA 3UHOA 1NLUA 1KYWA 4B5KA 4FC7A 1N0HA 2AQHA 3QYFA 1W2GA 4MH0R 2PGXA 1E2EA 3GA0A 3W5IA 2GDJA 3EXHA 5JSKA 2OECA 3NEJA 2E18A 4CKYA 1FJHA 2EYUA 3AJDA 3L9XA 1P9RA 2Q21A 4GEKA 4CTNA 5NLLA 5HGJA 3ENZA 1DVRA 3LSTA 3SIWA 3B3FA 4MB6A 4HXFB 3GJXC 3WGYA 3AEQA 4HDOB 4BQPA 1A7KA 1PW5A 1VLMA 3MCZA 5G40A 4AJNA 4QATA 2GPBA 2HBYA 1MVOA 1T1EA 1JE0A 3A4YA 2OZPA 1ZO8A 4IM7A 1W19A 2BFEB 3P32A 4M21A 2VHCA 3GPLA 3N2YA 3UB4A 2JJQA 3LI2A 3IT2A 1UKZA 4OHBA 1YIAA 5JMPA 4JR1A 3OZVA 4D41A 1Z6QA 2G08A 3QEJA 4Q0MA 2J85A 3A4LA 3GEHA 1OI7A 1LKZA 2UVPB 5HBGA 3FA2A 2B4TO 1MOPA 1O96B 1N78A 2P9BA 1P1RA 1OWMA 3EC1A 5M29A 3ZR4B 1NNLA 2RAUA 3PNQA 1IN5A 4UCFA 3UMVA 2HWKA 4Q18A 3RC7A 5MN4A 4AY2A 1V16B 2BGKA 4N5DA 3VHRA 1NNI1 3ZDFA 2R62A 3ABQB 3EUFA 2FDXA 1NQAO 4KUGA 4D96A 3LKVA 1JVBA 3THOA 3WA6A 2E2WA 4QBIA 3WRYA 3ZBPA 3KG2A 3H5WA 2X9LA 2XUDA 1TK2A 4KXXA 4QOSA 1U0EA 1E2NA 1VCHA 2IYTA 3WTCA 3VR5H 2GBFA 3R3JA 2V6JA 4RKQA 4CV3A 1G18A 5KOJB 1FMJA 1QQAA 4F4DA 3Q7IA 3B3GA 5EXTA 2LBPA 1T8PA 1T4CB 2QRVB 4L9RA 2O3TA 2VZEA 4KR0A 3VC1A 2X2FA 5IEJA 1JYSA 3V1UA 1X77A 4ZMSA 3C8DA 2I2DA 4JUFA 1HTTA 1GV0A 5TVKA 4CKXA 3H7AA 1NR1A 2EIXA 1EM6A 1VL5A 3GVPA 1TM2A 1P3Y1 3QYAA 4G4SP 4XOIA 3UH0A 5EIBD 4YUXA 3PFGA 5KDLA 4BECA 1GQRA 4G89A 4EY6A 4MP3A 3EZGA 3K6KA 4ZT5A 1AKMA 1QGUA 4UARA 4EGFA 3IJPA 4OM7A 4UKDA 3KD3A 1T35A 1D2RA 3PSHA 5BN4B 1TO1E 3CNBA 4ENVA 2EQBA 3GT0A 2H1LA 2LVBA 1TMGE 4E0BA 4EENA 5KTOA 1UXGA 3AY6A 1LLQA 1EXMA 4IJKA 4IUBS 2DWOA 1U5AA 3C45A 3CUUA 2WYOA 4NJEA 1ZCAA 6REQA 4L85A 3TSYA 1CUSA 4BCBA 1LLFA 2KYRA 3EUAA 3I9MA 1FEZA 2HHAA 2CHUA 4NBNA 5DHFA 3ZXSA 5AFSA 1OI3A 5JD6A 1WMSA 3MUFA 4H35A 1ZSVA 3RCBA 3FAZA 1LW6E 4KR9A 3BXEA 4M0LA 4EX7A 1UBKS 2ILTA 4TL9A 2AEMA 4UJ5A 2I6XA 3E61A 3RBAA 4YT4A 2ZULA 5DKFA 3TRIA 1ZM9A 1XZKA 1TL7C 2PGOA 5B1DA 4U6QA 4A2PA 3K9WA 2R1ZA 1V8ZA 5EFOA 3BFXA 3H5LA 3I37X 4D4JA 1YIOA 3FNBA 1YZTA 1AURA 2AI3A 2B94A 2G5CA 4WSOA 2PLRA 2ZETA 4BZWA 3SQDA 2GFHA 2ZB4A 2YRFA 3RVOA 1K0UA 4QIHA 4W5NA 4U3JB 1ZM7A 1OXMA 1TQ4A 2A5LA 2J4DA 4KBFA 5EUCA 5IC5A 1U8UA 1DKLA 4GGPA 3S27A 2CEAA 4HLUC 3F6SA 4S1TA 2P2GA 4DIUA 2YV2A 2VH5R 3PQFA 1SH7A 2NVOA 3NTOA 5TARA 3W4IA 1DKNA 1J42A 1P4JA 1UJNA 2FEMA 2Y1WA 4MRAA 5E6SB 3SP1A 4OGKA 1K4MA 2QLFA 1XNGA 2GEDA 2ERXA 5F51A 4FKZA 5K3FA 5TS2A 3RFFA 1KQFA 4OHCA 3VNAA 1FFHA 5CVEA 4YGYA 3UT5A 4F86A 5HKAA 1QYWA 4AZ0A 1ZDMA 3T94A 1TPYA 4D45A 3RTDA 1KS2A 4LY6A 2VQDA 1YZNA 3AEZA 4ISBA 4PHGA 5EYPB 3F2IA 3WZMA 1SVMA 2AH5A 4HDKA 1KDPA 5A6SB 6AT1A 4ZPXA 3C1UA 3VR5A 3EX7C 5A7FA 4JLBA 2C2OA 1ZVMA 3RGWS 4DG9A 1OC2A 1NV9A 1CERA 4KO8A 4OXNA 4P36A 1PT8A 1D6SA 3VA7A 2J6CA 4Z51A 2C9DA 1Z6ZA 1QS0B 2CDRA 4QOGA 5F7ZA 3U80A 3IBTA 5CDSA 3JQ9A 4N4AA 4LJSA 1SB9A 1CLEA 1XCOA 2QN1A 1THMA 4KQHA 3TJRA 4EKGA 3DLBA 4P93A 1ZJJA 2CV1A 2YJ4A 2G07A 2R84A 3O2SB 4IRMA 1Y6RA 2LKCA 1YB2A 4PBRA 5M34A 4GRAA 1KMNA 1UOEA 1L5FA 4Y2RA 3I1IA 1I01A 3DDUA 1ULHA 2O1XA 3DB1A 5DASA 3Q7TA 2XKBA 1DC5A 1D1SA 1TYDE 4LK3A 3FYSA 5H3HA 2WTNA 1Z12A 2G36A 3DVSX 4J1TA 4BNDA 1Z6TA 4HFNA 1W25A 1TQ8A 1XZHA 2DHEA 2MYUA 3DFUA 5IJ0B 3MCTA 4I7EA 4CEHA 2JFPA 1OIVA 4IF6A 4YDHB 1WUYA 5T8KA 3TZQA 3ANLA 3PD1A 3O4HA 1CYEA 4KHZA 3V7WA 4HH1A 4NCXA 4QQ8A 5DHPA 3WLLA 3FGZA 1BE6A 1JEAA 4QT4A 1NMYA 2C2KA 2CHEA 1GV1A 3T9AA 3TIXB 1WUJS 1UCFA 2NQTA 1QUEA 3ABOB 3NHRA 1T2CA 4TV8B 4H7PA 3SMQA 4E03A 5BN5B 2MTBA 1X1AA 4GR5A 2J7KA 2J08A 5FPPA 2DQ4A 1PBNA 4YUZA 2I8AA 4AROA 2FPGB 4P32A 2H29A 2GD6A 4LOKA 1QIMA 1L7VC 3L46A 1IZZA 5SY6A 1QHFA 2OLJA 3VSCA 4D3XA 4EK9A 3SMVA 4DSOA 1VCMA 2JGDA 1ESMA 4FYJA 4KOEC 2GJKA 1UBHS 3DHWC 3I2FA 2O3QA 2P3QA 3F7OA 3R5JA 3RASA 2ZRCA 2OP1A 1X7YB 1DWPA 4HRAA 1YUNA 4ME6A 3NRBA 4ZRNA 4FNAA 4BWVA 1BC5A 4KW7A 1R9GA 3EARA 1LI7A 2RGDA 3EXIB 1VDZA 3TW8A 3W5AA 1EQAA 1KVUA 1SKAA 2PKYX 1Z18A 5F3WB 1G5TA 3WWEA 5AYVA 2G6BA 3QX7A 4M7OA 2CMKA 1VSBA 4I4IA 3TLAA 1JVSA 3RK4A 3VR1A 1XEXB 2V7EA 3FCAA 4WLEA 3CEJA 5HFJA 4LJ9A 5H81A 3I2GA 3IKVA 4IHQA 2NOAA 4HX9A 1CUVA 1KKMA 3VU8A 4EMBA 5A3JA 2PKQO 3ZC3A 5C8YB 2PUDA 2JIMA 2Y92A 4LY0A 2WV7A 3SKXA 4BVJA 1KAQA 1JU4A 1S1MA 1DZIA 4GWGA 2PTHA 3GBPA 4QPZA 4RPGA 2F8LA 4KQ2A 2PL9A 4Q7QA 2H5IA 4AN1A 3FGPA 3I8OA 4GRDA 3DAPA 3LL7A 1EGQA 3PNYA 4TMWA 3V7UA 2HKIA 3IUNA 1KQOA 5CH3A 1AZWA 3VYUB 3WIOA 5LD2B 2P2LA 1YH3A 4LZLA 1ZNQO 3UNXA 5IS2A 4IMPA 1U80A 1J24A 1FDTA 4C2UA 3AWDA 5AW8A 3PC8C 3UUWA 2WJYA 2QG6A 2G8NA 3RPEA 4BNVA 1EX6A 3BCHA 2AYXA 5IKEA 5I7OA 5KOIA 2LRHA 2PH3A 2GXAA 1ZZGA 5A9SA 5HR5A 1WQ3A 1ISIA 1JGTA 2XZOA 1JJFA 1I6KA 3E5HA 3GFVA 1KJNA 2WNSA 4JA0A 3TXXA 2A59A 4V1CI 4Z0NA 5KPDA 1AG9A 4R2JA 4ZK2A 1PLJA 1PK8A 3I0MA 4EL5A 1M72A 1JDBB 3OE5A 2QR5A 2AOUA 4GT1A 5IABA 2Z5LA 3NTLA 3V8MA 5CEEA 3O8OB 3KOYA 4P7GA 1M67A 4UOQA 4YMUA 4EDFA 1Y1SA 1XKXA 4QU5A 3ZU3A 1B0AA 3L01A 1P1HA 5GOTA 4Y9UA 2FJUA 2C03A 3OHPA 5HX7A 5KQSA 2JIDA 4J03A 3I23A 3T3DA 3ZHXA 2BFCB 5I9MA 2HA0A 1A9XB 1KMHB 2CYAA 1FVXA 2I3AA 3IUMA 1RM4A 4E2YA 2EEPA 2O2IA 2YBDA 3RS3A 1X7ZA 2P2NA 3ABIA 1XK6A 5TQ0A 3OT1B 1G41A 3NTUA 2A0FA 4B47A 4MIEA 4HPJB 2WYVA 3V2GA 1B8PA 1F5SA 4QTYA 4ZJPA 2YWXA 4L4YA 5H16A 5G2OA 1K7SN 3IODA 3F4KA 1XLWA 3QWAA 1HYBA 1IJFA 3M83A 1NY6A 4JGIA 5DIFA 1FX1A 1VJ5A 3MD9A 2IOHA 4ZAZA 521PA 2B98A 3WQSB 1ZJZA 2WOOA 4EUEA 1TM1E 1WY7A 2VEOA 4LUCA 4X9XA 2ECKA 2W22A 3G9TA 4F21A 2FCAA 1VHQA 4Y9RA 5ILOA 3LA6A 3EA5A 4DXDA 4JJEA 5GOZA 2Q9AA 3ADOA 3V8PA 4NE7A 3KHSA 2G71A 1BH2A 2Y2VA 1XRQA 2J5BA 2KLHA 3OM0A 4RD6A 4BPRA 1TT7A 2V0NA 4H27A 2WF7A 2XWPA 3NWBA 4RDXA 1Z4JA 4LPKA 3RSQA 4Q03A 4RZIA 3WFJA 1E79D 2QE7D 2XD9A 3CUKA 1FY2A 2DFDA 5FORA 1T2AA 3WGGA 3BWMA 3VYSB 4M1QA 2NUTB 2YASA 2CT8A 2OV6A 4RANA 4WLNA 3SYKA 3RC8A 2VPWA 2WTAA 5TDHA 4RQAA 2GRUA 5FEUA 1YAHA 1GL9B 1UKBA 1SBNE 1UPTA 1XN4A 1Z07A 2XQJA 3DR3A 3GJYA 1O5IA 3UWDA 1U1CA 3CX7A 5C5DA 2O8FA 1KWGA 1A71A 3Q1KA 3JYQA 1ZW6A 4M37A 5K0SA 1BQ3A 4O1IA 4PSAA 1BO6A 3O9MA 4LIPD 4MV1A 3GEEA 4KVAA 4PQFA 4LXGA 1IYZA 1GKIA 3LUPA 4TTAA 2GD2A 3GYBA 3OLQA 2XE4A 4IHAA 4JLDA 3L7MA 4BX8A 1R15A 3H6GA 3QEAZ 4WCFA 1FQJA 4OMUA 1BQEA 1I33A 4LN1A 3FDJA 1G5IA 3N9IA 3M4NA 4M55A 4IIGA 2QVLA 4IR7A 4CKWA 1Q1NA 2WAOA 2RHBA 2I6SA 2XSZD 3X2EA 2UZ0A 1TF2A 2Y05A 1SMKA 2DE0X 2FXIA 1HDOA 3BMXA 1P8AA 3JASA 1WVMA 3JQDA 3KOXA 4GQAA 4NJOA 4WOCA 3ZDRA 4G8JA 4FWBA 2RGXA 4P3NA 2IQ5A 3FDFA 5JMTA 3HWWA 4IZ6A 1R37A 3DH0A 3I12A 3IKJA 2C7RA 1J4AA 4HLNA 3SR0A 1GL6A 1W94A 2DWQA 3HVKA 4KQ9A 1I0IA 4PFSA 3SEFA 4DNFA 5AKJA 3D0RA 5U4QA 1TLFA 2C3MA 1J0DA 4NG5A 1L5LA 1CJVC 2NM0A 4E21A 1W5TA 2RI1A 3IP3A 4D5GA 4C89A 1RXEA 2F67A 4WZ6A 5B3KA 1YR9A 1MMFB 1N8NA 2Q1TA 1LTHR 5AESA 1F4VA 2WE8A 3USES 4WH0A 1I2ZA 4GXQA 3URKA 1VFPA 1ZGZA 4ARBA 4B79A 3KPJA 4C6SA 3LYUA 2CL5A 4GKBA 3M5DA 3QK7A 3K09A 1GKYA 1QKIA 3KQUA 2HYIC 4U7PB 5H9WA 3R1IA 1E7SA 3DE7X 4F9FA 1DG3A 1KYYA 1GCGA 4YMTA 2VLBA 3AW9A 4DLBA 2MSNA 1AS3A 2RHJA 3K4QA 3E9QA 3J80A 1PLLA 3ANTA 2Q1XA 1BS1A 3WNCA 3BVPA 3GLFA 1N2OA 4P8RA 4M8IA 3KE8A 4JD5A 3TRJA 4JI2B 1M10A 1TEHA 2V65A 4XB6B 1X7XA 3HR8A 1M7HA 4LDZA 1MX1A 3WWPA 2BR4A 1ZINA 4Q1EA 4ER7A 1GA4A 1ZGGA 5TF0A 3QYPA 4HMQA 4ARZA 1G3RA 2QTVA 3OCJA 3HM2A 2ZM6B 3HL4A 5T7BA 3C2QA 7GPBA 4O3MA 1AOXA 1B2LA 3FFAA 1P1IA 4L16A 4QUGA 4DTCA 1I7DA 3ZQ6A 3RJ9A 4H60A 4HGRA 1YASA 3KB2A 4FN4A 2XI4A 2CBXA 4RQBA 3T5GA 2PIAA 5CTJA 3RSLA 4HT3B 3BXPA 3K8ZA 4L07A 2BMAA 1EAYA 2DR3A 2G04A 3HU3A 4J1NA 1ULTA 2JCVA 3KWJA 3VNQA 1JX6A 1QDEA 1UOOA 5L3QA 1MDBA 5EAIA 3R7FA 2ZWVA 4A15A 2SBTA 3EPRA 1E3TA 1SBQA 1XWFA 1WUTA 2Z58A 1GR1A 5CVVA 2B21A 3ZN2A 2P0YA 5K7SA 1HNNA 2J7PD 4M6WB 3QMMA 1K5HA 2AYYA 5JD4A 1QZUA 3NVMB 3QXJA 1UOQA 4RK4A 1ZD2P 5T4BA 3PXUA 1I4LD 4RZ3A 4EMSA 5CG1A 4B3IA 5DLYA 3NHLA 1U1FA 1WB4A 3TLMA 4EHFA 1DCMA 2CDCA 2BEWA 4RLQA 4UREA 1FMCA 1EFLA 1MA0A 2TMYA 2FE4A 1YMUA 1TTQB 4TGLA 4Z9XA 2ONJA 2PZGA 4HAVA 1UL1X 3UFXB 1GAQA 1RBZA 1O6ZA 2CYBA 3SZGA 3GLIE 4B48A 4C2AA 3G02A 2IP1A 1Z28A 2JEYA 2VXYA 1A9RA 4FDAA 4IUCS 3DCNA 3UJ8A 2Q28A 4R68A 2I80A 4OLAA 1SVOA 1UBNA 4K6OA 3T3NA 3DV0B 3BB1A 2HF7A 2XKAA 3FG9A 1K8QA 3NXSA 4QOFA 2AWOA 2YS7A 3BULA 1CCWA 1UEIA 2ZRNA 3KAQA 2ZDQA 3IDOA 1NXXA 2WFLB 4B45A 3BPSA 2IF0A 1ELOA 1JSZA 1NAIA 1YI1A 4C1NA 3F2VA 5JZOA 3BDAA 3SS8A 1TLTA 2V9ZA 3KXIA 3ZZUA 5DM2A 1JQJC 4N54A 3F7NA 2OA0A 2WZCA 4WD3A 2QMQA 4GOLD 1BN6A 3RSCA 2PGDA 4COOA 3W2HA 2QRKA 3M3PA 1Y3HA 1IY2A 1QHHA 3EXG1 3JQAB 4I0WB 1VE3A 2QTZA 1KZ9A 3EIWA 5DT9A 2FEPA 1N2SA 2VPYA 3K4HA 4EQ6A 1AJEA 4PNZA 2Q6OA 3GPIA 1QMGA 4URFA 3M4YA 2ZROA 5ALSA 3WL8A 2RONA 4C2BA 3N2KA 1Q0PA 2AZTA 1BDBA 1ZJYA 2IXTA 4XZ3A 5CVUA 4EW6A 2GILA 1OF1A 2GJ9A 2AFHE 2WMNB 1T5DX 4GPD1 4GQIA 1RQ7A 4I55A 3C6QA 2R96A 1GEEA 3B9RA 3RT9A 3Q3VA 4DJAA 3EZ9A 3DZJA 3E18A 4P5PA 2H4FA 3N8GA 4Y1FA 4ZI3A 5CD1A 1V25A 1NHGA 4EPRA 3G2IA 3UH1A 1NATA 4ZVOA 3QUQA 3MJEA 5HK8A 5IKPA 1KVQA 2REBA 1XAJA 2XQVA 4PZDA 3W2GA 2FMUA 1T6YA 1G0NA 4R2MA 3TTUA 5SV2A 5BPHA 2AXNA 2J0UB 3Q8XB 4FD2A 2ZBQA 2JGAA 2OK7A 3OE4A 1DAFA 3DEFA 3JQAD 4HG2A 4I6GA 4O0LA 4LXHA 4RFLA 3WBJA 5EIEA 3LPCA 1UKAA 3WBKA 3WIBA 1JB9A 1R6DA 4WECA 2HU2A 3AHJA 2FMFA 3TEFA 4JA2A 3TZEA 4XPIA 1DC4A 3I9KA 3ZDAA 2PO7A 2WUDA 4PCAA 3V7FA 1WQ4A 1R4ZA 4J9UE 5CYFA 4AKGA 5HCNA 4EG6A 2WD7A 5TQ2A 4FYHA 3E7DA 3LIPA 1T2UA 2VJLA 1OB5A 1JHZA 1RM0A 4TXLA 4G9BA 4YNBA 4Q9IA 2H00A 2B5VA 2G5GX 2FEOA 4QBFA 4X6YA 1QBKC 1Q83A 3KU1A 3SAJA 4Z7JA 4F91B 3T5MA 1FVHA 2VP9A 3FTNA 3ZGOA 4D3FA 1NGSA 2HX1A 1GQQA 4CDGA 2DETA 4ESVA 1ISRA 1JBEA 3VO8A 2JLVA 2J6HA 2VDJA 4K9MA 3TNFA 5K09A 1Y4DE 5H68A 3QEOA 3CVJA 1UJCA 3I34X 3STUA 1JWLA 4HC4A 1K6IA 3BA1A 1M5RA 1FVFA 1C7EA 4EZEA 3M9XA 2F3QA 2G9RA 1PEKE 1W4CA 3WYBA 4JJGA 1KRHA 1M6HA 1UBOS 3FZNA 1K3FA 2WWFA 4FCWA 4ZXFA 4ERNA 4GVPA 5FLKA 5HTKA 3LUAA 4H7JA 1XHEA 2VT3A 3AHDA 1AQ6A 3ZI0A 3X0DA 4C5CA 1TXGA 2FZCA 3ROEA 4ZOLB 3UMRA 1HDYA 4KQIA 4LK2A 1EVYA 2ECOA 1JXMA 1CJSA 2PRIA 1OXKB 2PU5A 3LCRA 5KS2A 4X6XA 1I30A 2OFWA 2P40A 1V1RB 3FXAA 4KE9A 4RY0A 2OAEA 4UDXX 1XZDA 1IZ9A 4YCBA 3ZI4A 10MHA 2A6PA 3EMKA 4KTTE 2VBGA 4CM9A 3B1XA 2ZJOA 1TEVA 1ECLA 4FI3F 4J1QA 5E8JA 3R7LA 4CF5A 1W5EA 2M6SA 2R68A 3EIQA 4U8HA 4G37A 2QMUA 1BA3A 5LUAA 1Y33E 4ZD6A 1G98A 3UICA 1WCV1 3H5IA 1G21B 1CR0A 1SWWA 1NBIA 3LF1A 4FGZA 4QJIA 5EFZA 4K87A 5HIMA 3CQ9A 3ZZTA 1MZPA 1BS9A 1Z35A 1RPAA 4U7HA 2QU8A 4NCHA 1KYZA 4D0GA 2KM1A 1S2MA 4IH9A 5FO0A 4WZAB 1JYEA 1KVTA 3TE7A 1FTYA 4ENQA 1RI4A 3CZCA 1PD1A 3DLAA 3DLIA 4ILKA 4C4TA 4F4CA 3E23A 2OCLA 5EE0A 3WG9A 4RS3A 4CTMA 2DQYA 2BFFA 3T8YA 3ZXUB 1G8GA 1K75A 2LTAA 3N5CA 1ITZA 2L82A 2XA2A 3SIPA 4W6QA 1A69A 1HK7A 4LDNA 1BD4A 1H65A 4ND1A 5FPQA 4BJ3A 3BBPA 3P20A 1A72A 1W0JA 1BXKA 3PI6A 2PUGA 2EEZA 1ILWA 2QL5A