5FPVA

Crystal structure of human jmjd2a in complex with compound kdoam20a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
345
structure length
337
Chain Sequence
SARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 337
sequence length 345
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fpvA01
5FY9A 5FZ3A 2YU1A 2OX0A 4GD4A 4NUBA 5FY1A 5K4LA 5FZOA 4D6QA 5FP8A 4UF0B 5FZGA 5FP7A 3RVHA 2GP5A 4AI9A 5CEHA 3PUSA 5LY1A 3N9NA 5IVJA 2YBPA 2P5BA 4URAA 5FZ7A 5ANQA 4QX8A 3U78A 5FPAA 5F5CA 5FPVA 3DXTA 2YPDA 3DXUA 5FXVA 5FZBA 4EZ4A 4BU2A 5FPLA 5KR7A 5FZ8A 4BISA 3PURA 5FZCA 3KV6A 3U4SA 5FY0A 4C8DA 4CCNA 5IVCA 3LDBA 3PUAA 5FYBA 4QXBA 5FWEA 4QXHA 4XDOA 5FYCA 3LD8A 4AAPA 5FZ4A 2VD7A 5FYYA 2XDVA 5F5IA 4CSWA 4IGOA 1VRBA 3N9QA 3OPWA 5FYTA 4QXCA 5IVEA 2GP3A 5IVYA 5FZAA 5F37A 2OQ7A 2OS2A 4Y33A 3K3NA 5FYZA 5A3NA 5FJHA 2XXZA 5FUNA 5F2WA 5FZ6A 5FV3A 5FYUA 3KV4A 3PTRB 3PUQA 5F39A 4V2VA 3ZLIA 5F3CA 4LIUA 4QWNA 4GJYA 5FZMA 5A7PA 5LWBA 3PDQA 2XUEA 4LIVA 5FZHA 5FP3A 5A1LA 4E4HA 4CCKA 5F32A 4ASKA 5FXZA 2Q8CA 5FY4A 3AL6A 4CUGA 5FZOB 3N9PA 5FYIA 5A80A 5FP9A 5FZ9A 4CCOA 5A3TA 3KVBA 5A7SA 4IGPA 3AL5A 3ZPOA 5A7QA 4D6SA 4V2WA 5IW0A 5A7WA 2WWJA 5FZIA 4UF0A 3N9LA 4HOOA 5A7NA 4D6RA 2YBSA 5FUPA 3KVAA 3KV5A 3PU3A 5F3GA 2OT7A 5FZDA 5FWJA 4TN7A 4Y4RA 5FYHA 5A1FA 4EYUA 5A3PA 2WWUA 4CCMA 3AVRA 3K2OA 2YU2A 5FY5A 5FZLA 4CCJA 2PXJA 5A7WB 5LY2A 3K3OA 3UYJA 5IVFA 2Q8EA 4BXFA 4XDPA 3AVSA 3N9MA 5FYSA 5FZFA 4DO0A 3NJYA 2Q8DA 5LW9A 4Y3OA 5E6HA 5F2SA 5FZ1A 3N9OA 4EZHA 5IVVA 5FZ0A 2XMLA 4GAZA 4HONA 5FBJA 5FY7A 5A3WA 2W2IA 3OPTA 5FPBA 5FPUA 5FJKA 5F3IA 2OQ6A 4LITA 5F5AA 5A7OA 5FP4A 4LXLA 4GJZA 3KV9A 2YBKA 5FZEA 5FYMA 5IVBA 5FYVA 5ISLA 5IWFA 4DIQA 4QU1A 4CCLA 5FXXA 4IGQA 5F3EA 4QX7A 5FZKA 3PU8A 5FY8A 5FXWA
chains in the Genus database with same CATH superfamily
3AMMA 2XLAA 1OURA 1Y9QA 5FZ3A 2I74A 4COUA 3VBUA 3CJXA 1R1ZA 5FP8A 1D2SA 3F95A 3G7DA 3M3CA 2Y6JA 1R093 5FFOC 2C4XA 3POFA 2J1VA 5LRRA 1W8NA 4KBZA 2RM22 5IVJA 5FAXA 3FBYA 5DAVA 3ZSEA 1RHI1 2HBUA 4AEKA 2FDIA 4QX8A 1H6YA 1LEMA 1OUXA 2WFF1 3OEAA 3PMSA 2EICA 1W03A 4JQRA 3ROUA 4AI1A 1OOPB 3I2FA 3SMHA 1I5PA 2NQYA 4NPLA 1FPN1 4S2FA 1BBT3 3VBOC 3OSDA 1BMV2 2LM3A 2AH2A 2VOTA 4ZKTB 5C3OA 4QXHA 3VBSB 3A21A 4A2UA 1EV12 4Q0UA 1KFXL 1LOFA 2RDRA 4XAEA 2EIDA 4Y26A 4A3ZA 3OY8A 4QKNA 3SCFA 2YZ4A 4K8RB 5DAPA 1BHGA 2R061 3HVDA 2OZJA 4QM9A 3D4KA 1RUOA 2BFUS 2OQ7A 3VZLA 3WEZA 4BQ1A 2XXZA 3SISA 4K1YA 1DFQA 2C1FA 1MQTC 2QDNA 2WQZC 2V5DA 4Q29A 3TN93 4I2OA 1GOHA 2RJKA 4QB6A 3VD3A 4C91A 1DLLA 4V2VA 5FDBA 5JAXA 3JB8A 2HWB3 4AGRA 4LBMA 2F6BA 1UCXA 2VXRA 3IAPA 1UY1A 3AZWA 3DECA 2SLIA 4LIVA 3DGTA 1JYVA 3H1WA 4UFLA 4LPLA 1D0HA 2XKPA 4MVTA 4E8CA 3ZFEC 4FAGA 2RJ2A 4CDUC 2A7AA 3NV1A 2D6MA 4FPKA 1W9WA 2YY1A 4W6XA 5HCAA 3ZFFB 4NO4A 4Z8BA 5M0TA 3WNXA 1FOD1 1QQP1 5A7SA 1PX3A 3GZTB 1DG6A 2BNNA 2DTYA 1NUKA 5C9AB 1CPMA 1C8NA 1EAH3 2V5YA 4COWA 2HWC3 4OUSA 3KCCA 2VCMA 4ES9A 4R52A 1DGRA 4IUGA 1DQ5A 4ZXEA 4EWDA 2OIIA 4MADA 1YYNA 3LA7A 3KB5A 4LBKA 3FC0A 4QB2A 2YB7A 2ZJCA 3J8F3 4AI3A 5J7MA 1OKOA 3O1SA 4NIIA 2DUPA 2Q0AA 2JJ6A 3POIA 5CFCC 2WS92 1N1TA 1VMHA 4HXCA 4MO3M 2Y26A 3AC0A 1QJU2 2QZ3A 4KMQA 2YC0A 4YG0A 5A32A 1YQ5A 3JCIA 3FHQA 1X8MA 5JSPA 2ZZQA 1DZQA 4IV1B 1GQPA 2B45X 3GZAA 1SLCA 1ZRIA 1EV11 1Z0HA 4LJHA 4I09A 4WM7C 4QKFA 4LK7A 3O1RA 4YM2A 4JTNA 4LKFA 4Q4X2 1JOJA 1IKQA 3FBMA 1QGLA 3BB6A 2BPA2 4QQ2A 1XB9A 3MYXA 5AFEA 4AEDC 2VXJA 3P1IA 1ENSA 5GLZA 3U75A 4DRVA 3R6SA 4YWAA 3MZHA 1SFYA 1C8M3 4QU1A 3G6JB 2JEMA 5L73A 3IDBB 4FPLA 2OW4A 4LNVA 3PU8A 5FY8A 2EAAA 2RR13 1YHFA 3DN7A 5A6QA 2Y0IA 1NX9A 3BGAA 3RGBA 2JDNA 3IIAA 3KS7A 3NJZA 2XKOA 1LEDA 2WO3A 1Y9GA 3M3QA 4MLOA 1UW8A 4GMP0 1WGPA 1Y3TA 4LBQD 4OMCA 2BQPA 4CP9A 1XU2A 1SBDA 4HFSA 1VBD2 2P3JA 5DUUA 5FZ7A 3KM5A 3KCYA 4BIOA 1JZ4A 2X5IA 1V9U2 3ACGA 4C1WA 1IKPA 3LFIA 4LTAA 3TB0A 3VBHA 5LA9A 3SC7X 2QQPA 4K1ZA 1OT5A 3RRDA 1W8ZA 3WUDA 2GC2A 4XJZA 4Y5SA 1MZFA 1X33A 5ACA3 2UU8A 5FWEA 5FUIA 3O1PA 2Q4SA 2K9ZA 3EYPA 1RUJ2 3DEMA 4O9EA 1N3QA 2D3RA 1QJEA 1LHNA 3WDVA 4C0BA 5J36A 4XJUA 4B7EA 5IVYA 1VE0A 3LB9A 4R9AA 3R0RA 3RZGA 3H8OA 2WS91 4A7ZA 3VD9A 2CDPA 5F2WA 3ZXEA 1C4RA 1DHKB 2JICA 5FZ6A 5JI9A 2UYBA 2OKXA 5DZEA 4BYYA 4EN0A 4CU6A 2FZ2A 2WZPP 1QJX3 2JG9A 2WINB 2VZ1A 4PT6A 3RZHA 5E89A 4XHBA 2P6HA 1NY71 4PI2A 1O4ZA 2W47A 2VCAA 4E4HA 5J98B 2NM1A 3OBZA 4JQTA 3LSDA 1ZZBA 1HJGA 1VRH2 3U11A 4H7MA 2JDYA 5FY4A 3VD5A 4DXRA 3VBRA 2ARAA 2VZQA 2YG0A 4W6YA 3LEKA 5FMCA 4QX0A 2V4AA 4XVHA 2XOMA 3IDCB 5FP9A 3ZXGA 1X9TA 1N1VA 5FZ9A 2AEZA 2ARXA 2XJQA 3MHZA 4YYOA 2VQUA 4SBVA 1Q3EA 4GALA 5A7QA 3NO8A 2VBPA 3N3HA 2B9VA 3T2TA 5C7GA 4DPNA 5H9QA 3MV01 5FO8B 5JSRA 2R32A 4CUBA 1XNBA 1VBD1 1W2OA 3ZXJA 4CEYB 5C8CC 4QXKA 1OLQA 1V9U1 1XNKA 3A7QA 5FLJA 5JOYA 4M3CA 3U37A 2D40A 1W8UA 3AP5A 5KXCA 4SLIA 2Y34A 1FMD2 1GUIA 1DGRN 1YUDA 3HBZA 2Y6LA 5HCBA 1ZRCA 1TME3 2X10A 3I3BA 2Q8EA 2VOXA 5AC92 1UOGA 5EYYA 5FYSA 5C4WB 5I0SA 2E26A 4JTOA 3RZLA 4HETA 5EP9A 5FZ0A 1RUJ1 2XVLA 4CU9A 4N53B 2N7GA 2DBIA 4QDRA 2EF6A 3BIWE 2H6BA 4FT8A 4GWMA 4NHYA 1O7FA 5CFDB 3QD6A 2XL9A 2RHPA 4NPRA 3ZYPA 1RUD3 5JVVA 3I54A 4F3JA 3I8TA 4D0QA 5BNOA 3KF3A 1EUUA 2QQLA 3ZDSA 4A41A 2IXCA 4XILA 5CYYA 4YW4A 4XEZA 1OOPC 1RINA 4M0NA 1WCDJ 3MIDA 4MGSA 1LU2A 2YYOA 2BDRA 2WO2A 3FE5A 4UF0B 5FZGA 3PMEA 2Z42A 2LRPA 3ZSLA 2HKXA 3AKQA 3I59B 3VBSC 4TWTA 3ZN6A 1RUF3 5EJ3A 2CDOA 5JXJA 4FTEA 5C8WA 1AL23 4I01A 2W1WA 4E2QA 3GNEA 1TZOA 1V6NA 4GWNA 2VAUA 4N43A 4AK3A 1WCQA 2R49A 1XJAA 5FMOS 2VBDA 3AMHA 5FPLA 2WO1A 4B1LA 2A3XA 4L11A 5KR7A 1JI6A 3EXUA 4WZFA 4OFGA 3U07A 4AHYA 3WZ1A 3AX4A 3OEBA 3I2OA 2ILMA 3M4FA 2Y60A 3PHMA 1NA1B 4CUCA 1U5YA 3C8XA 4XURA 1F5FA 4XMIA 2P1BA 2J1AA 4O9GA 1UY2A 4UAPA 3AP6A 1SMVA 4HLTA 2YDEA 5T5PA 1OFSA 2IXLA 5IUQA 4XF1A 5FYZA 3VDDB 1FMD1 2BNOA 3AXEA 5DPNA 3UETA 1W9TA 3FMGA 5FV3A 2EXIA 4YZ3A 5AC91 1NLSA 2E63A 1QNWA 3ZFFC 2PELA 3DKWA 2DCKA 1UZZA 4ZPIA 1NQJA 2ZHLA 4IEVA 5FZHA 2JDPA 3VKOA 3WF1A 3E97A 1IS3A 1NLRA 2WFF3 1R092 5C9AC 4Q27A 2Y6KA 3USUB 4OUEA 1H1IA 2DF7A 3WR0A 4DXZA 1A8DA 4MXWB 4ZHNA 5BYNA 1H2LA 3GJBA 1W6OB 5A80A 1F35A 2PTMA 4HMZA 4N90A 1GWKA 3ORJA 1EUTA 5JXGA 4XCAA 4COZA 4Q1RA 2WN3A 1SDDB 4PLNA 2VQTA 4J6GA 1ZVFA 2GMEA 2XQRA 1BBT2 4MGYE 5IK5A 1OUSA 3BU7A 4XF3A 2R063 5DQ0A 1SCSA 3BIEA 1JYCA 2Q1FA 2KR2A 4NHKA 1B35B 4IV1C 3WF2A 3CL1A 2LW8A 2E33A 1ZZ9A 1FV2A 1PO21 1WA6X 5LCWL 2ZGTA 4KWJA 4E2GA 2JDAA 2K2SA 1W39A 4P9XA 4DMIA 5FYHA 1PK6A 3IPVB 4MGQA 4PF1A 1D4M3 1BYHA 2BW8A 1ODNA 2WWUA 2G1MA 1LODA 3K2OA 4WBBA 2Q8OA 3LA2A 1ZRFA 1XXNA 2HWB2 3ZVXA 1LNSA 1W9FA 4B4QA 3QLQA 4ASLA 3IB3A 2ZGNA 1QXRA 3C7HA 4GH4B 4QKBA 5SV5A 3K51A 1JZ7A 3OPTA 4XTMA 1W99A 3SCHA 5HV4A 1DZTA 5FJKA 5FTTC 3VZKA 1BEV1 2GC1A 5A7OA 3B9CA 3WINE 5LK7B 1K3IA 1W6NB 2I07B 1YFYA 3H7JA 4GJZA 3WNPA 5IFPA 2JDZA 1HIXA 1R082 5DDJ3 2R6QA 4YLZA 4QPGA 2W39A 3PL0A 4M3CE 2WFPA 4PDWB 1GV9A 4PF5A 4PQQA 4DIQA 1SG3A 2RM23 5FZKA 4AQTA 2P2KA 1EY2A 5FIXA 4J1WA 1OQ1A 3M3OA 2JXAA 3J7HA 3RWKX 2FCTA 3LIHA 3HQUA 4AQ2A 2VUCA 1EPZA 1R091 2VZVA 2GNMA 3RYRA 2DCJA 3O5SA 2HWE3 1AR63 1O6UA 3C7FA 2BGOA 3VZMA 1WBFA 3AKSA 2C6SA 5EIYB 2P5BA 1KRIA 5FQ0B 1WMDA 3VLBB 2W08A 3THPA 4CDWA 3HPNA 2A1XA 1BBT1 4Z82A 4B4PA 3I3MA 3FJSA 2NN8A 1I1EA 2LTNA 2AGSA 5K0UA 3ZX7A 1OF3A 4CZSA 4ATEA 4QXBA 3I3EA 2KXLA 3DKQA 3CKHA 4XJ8A 2C5DA 4S2GA 2PLV3 4YW5A 3WG3A 1CAUA 1VMFA 2SBAA 2ZXQA 2ZGOA 4WVZA 4LA2A 4Y24A 5FYTA 3THTA 3WXPA 5F1RA 5ABJA 3TN91 4BMEA 4OMDA 4B7KA 2G4IA 3I3DA 2HWB1 4YPJA 1ND2A 4HKWA 2QFEA 1RL3A 3RNSA 3PTRB 2QBXA 2JG8B 4HN0A 3ZLIA 4QWNA 2PHFA 1GWMA 3RSJA 5LWBA 2GH2A 3AP7A 1QOSA 4CCKA 2PAKA 3D0JA 4ASKA 1RUNA 4HL0A 1JZ2A 2E7TA 4I0AA 1HLCA 3UGFA 4XTPA 5LASA 3UKTA 3HR9A 2VZ3A 2W94A 3WDUA 1FNZA 1H8TA 5F9TA 5LZ6A 1U5ZA 2C26A 3WX5A 5C5UA 1H0BA 1JUIA 4DUWA 4CEYC 2F17A 3M7AA 1VPHA 2WC2A 2VPVA 4L2NA 5L9VA 5IW0A 5A7WA 4NVPA 2VQ0A 5EJZB 5LATA 2QQVA 1G7YA 5T55A 2VUDA 1QJU3 2IVJA 3KVAA 3Q8AA 3PU3A 3J8F1 4CCEA 3ACHA 2D6LX 2XQXA 3AZVA 4O61A 1JYWA 1DLCA 3BTYA 4NHXA 4LO4B 4N53C 5A1FA 4ZS3A 3JXSA 4AW7A 3T4VA 4WVMA 2BVBA 3FN9A 4P9IA 1I5ZA 2WR9A 1JW6A 4JDNA 3ME2A 1V6KA 5LA1A 4Q4X3 5CFDC 1LU1A 1QJX2 2JD9A 4X6QB 5LY2A 3SQOA 5E8AA 4EE2A 3MEPA 5I91A 1GBGA 3HJRA 2GU9A 1EP0A 2Q8DA 1JYXA 4Z2WA 3IWZA 1POV3 5EPAA 1Y43B 2VTXA 4GAZA 1YCIA 1SPPA 3DYMA 1ASJ2 1MS1A 4HG6B 3ZXAC 3M8LA 5IYYA 3V0BB 1H2KA 1MEC3 4LBOA 3K46A 3IAQA 1YLLA 1C8M1 2A3YA 2RJLA 4XBNA 2AACA 2FQPA 4OZOA 4FXGB 5FYVA 4RGKA 1RUI2 2AREA 2PHDA 4LKEA 4A6OA 1YIFA 2RDSA 1R1A2 1P8JA 4AOCA 1BK0A 2E53A 4QQLA 2HBTA 4CA9A 2JE9A 1MS0A 1O5LA 1ZYBA 1UPSA 1ULDA 4S2DA 3RVHA 4CXWA 4RQPB 2DURA 2G9ZA 1XQNA 1X82A 2VH9A 2YHJA 4QGLA 5HXVA 5JI7A 1NA1C 1LR5A 4MX3A 1AZDA 1DCSA 1X50A 1RUJ3 4N9HA 1XBFA 4UFIA 3F2ZA 1TME2 3MBWA 2PHLA 4RFT0 3VDDC 1IGOA 5ACA1 1S2EA 2GH8A 3DYOA 4XUOA 2A3WA 2JKBA 4CRQA 1LKNA 4YM1A 1MVQA 5D8AB 1LHWA 3ST7A 1UL9A 2UY8A 3CZJA 3I4IA 4CDUA 4UFHA 4ES8A 2VD7A 3I2GA 1CESA 4YFWA 1HQWA 4R8HA 1AR83 1S0JA 1XNDA 1XYOA 2VECA 3AYAA 1O91A 2FHRA 2WNEA 4E8DA 4CDQB 2D6NA 4Y1YA 3PJQA 2ZX2A 1V6MA 1UY4A 4TLFA 2DV9A 1J84A 1VRH3 3USSA 1QJX1 1XRUA 4XUQA 1S0BA 4GKXA 3VB9A 4Z1VA 5BNPB 2XPJA 3JU9A 4W4ZA 5HXMA 3R4UA 1YQ6A 3WUCA 3WDWA 5GZGA 3E1F1 3TAYA 4QU2A 1L7RA 5KC6A 5FP3A 3OGGA 4K6BA 1ASJ1 5F32A 1BCXA 2G19A 3VBFA 4AI8A 4HN1A 1OH3A 4JKKA 5DXDA 1CAVB 4AVAA 5BUVA 5CFCA 3HNMA 1RUF2 4H55A 1JZ6A 4FPEA 1B35C 4IV3B 1DQ4A 2QQNA 2TBVA 2ES3A 2O8QA 4NAMA 4PCRA 4Y22B 3T2OA 2IFRA 4Q2FA 3RDIA 1R1A1 2EXKA 4WM7A 1DZRA 2VOWA 3ZFGA 5F6KA 3HBKA 1ENQA 3JQXA 5I93A 4Q0QA 3N7LA 4ARXA 1JTZX 1ZM1A 3CDZB 2ET7A 1V6IA 3GM8A 4WM8A 5FZIA 1XSQA 3CJIB 4NIAA 4AVCA 2E51A 4HBNA 5AC93 5L9RA 4KL1A 4FQZA 1J1TA 4GH4C 1S0EA 2O1QA 3U4XA 1W6QB 4QHBA 4D7TA 3SKJE 5CKQA 1H4GA 1WLDA 3B3QE 3HOBA 5DUWA 5C33A 3L2YA 4EYUA 4HT1T 1G9FA 1TME1 2F4PA 2UWAA 4RYDA 1AVBA 3H3LA 4QKDA 1NXMA 1PZ7A 4ATFA 5G04L 3U10A 5C70A 4FCAA 5JIAA 3POWA 3A23A 3MFAA 4FQ4A 5FZFA 1TMF2 4IE7A 4PDWC 4LO7A 5F2SA 2QQWA 2RVAA 3KLSA 1O3SA 4JGYA 5D2AA 4QX2A 4BM8A 5B4NA 4BHPA 3OG2A 1UO9A 4Q26A 5IAXA 3OBAA 1K5MB 4LITA 1LECA 4JZRA 3PVBB 3AJYA 2VL4A 4KU7A 4DRRA 1V00A 2ZABA 2ZGMA 4LORA 4XZPA 1NE6A 3W58A 5IVBA 2ZX3A 1AXYA 1OPOA 4G9SB 2XWJB 1G9DA 1ZRRA 4OHXA 4A7YA 4CP0A 2ZAHA 1ONAA 2P3YA 2VOKA 4FSJA 4NE9A 4UBHA 1YQ8A 2YGLA 4CYDA 3ENRA 5FZOA 2CWMA 1RUF1 1AL21 1C57A 2ZEWA 1VMJA 2Q5TA 4B29A 1W9SA 4QB1A 1PVC3 4AI2A 4U36A 1F8VA 1F4AA 1AJKA 2C0ZA 3DL3A 1W8OA 4ZU5A 4DEQA 4OLLA 4PBOA 3I2HA 1XE7A 3KQ4B 4Z2AA 4LMFA 4P9GA 2VVDA 1NCQC 3UGHA 3PUHA 3VBUB 3WP4A 2ETEA 4BISA 2A73B 3T2QA 5LBCA 3KHCA 1MS4A 3J26N 2P17A 2Y0OA 4IEYA 1YC61 4AVBA 5H9PA 1PGSA 2IWGB 4QDSA 1C3HA 3AMPA 2GMMA 5FPXA 3IDAA 4IGOA 3NVCA 4XF4A 3NSTA 2NLRA 5EZWA 5C3RA 2DCYA 3WW2A 5JOXA 2VW2A 3FFZA 3ON7A 2PHWA 3EQEA 1IPJA 4KG8A 5DDJ2 1HRI3 4Q1PA 5I8SA 3AB0A 4WZCA 2WWSA 4FP3A 1S4CA 1S0FA 3KV4A 3PUQA 1QH6A 3O0VA 5H9RA 1XYPA 5CU1A 1JYTA 3VDAA 3ZSMA 2YROA 4BIFA 3IBMA 4UT5A 3V65A 1UMZA 4B8EA 3KT1A 3U14A 2EXHA 3OOXA 3OY8B 4KWUA 4MSVA 1AJOA 2HWE2 2IVIB 4RSUA 2Q8CA 4MG2A 1Y9MA 3UT0A 1AR62 4P9WA 4RD7A 3LPGA 2PHRA 2ARBA 4XMAA 1ULEA 3T0BA 5A3MA 2CU5A 4C90A 5JOWA 1OKQA 1ULPA 2RDNA 3WF3A 5I0RA 2DTWA 3AM2A 3FLPA 1MZ6A 1F31A 2XJVA 5DABA 3RYPA 4DXTA 2JKXA 2BWAA 2D5HA 3NKTA 4CCCA 1AR92 5J48A 1OMIA 2D5FA 3WNMA 4UI9L 1UWWA 1GR3A 4CEWC 1DIWA 3NMBA 3X29B 4N7UA 2OYZA 4NJ4A 3T2PA 2PLV2 2HH9A 1LOEA 1UXXX 2ADEA 2HYKA 2MEV2 4KQ7A 2OT7A 1ZZ8A 3AMNA 4M01A 1G6NA 3MIFA 1D4M1 1FAYA 3LE0A 2NYYA 4XUTA 2Y33A 1H30A 5T50A 3S7EA 2ZMLA 4IEQA 3SHRA 5JR2A 4YW3A 1XSRA 5A3PA 3KMHA 4NAOA 1W8WA 3H50A 5ANNA 3HQRA 5IVFA 3UYJA 1VB2A 4ARYA 4TTGA 4XDPA 4DO0A 4AVTA 1K45A 3NJYA 3K4AA 1W2AX 1R083 5FKBA 4LQRA 3VBSA 3OBTA 4EZHA 5JIUA 1NE4A 1NT0A 1POQA 2W2IA 4LKSA 2QQKA 3OYWB 2ENRA 1F5JA 3BTAA 5LA2A 5DDJ1 4DINB 3L9JT 4Q4W3 4R9DA 2W91A 1UU5A 4LUKA 3VZJA 4RQPC 1CONA 3UK9A 3MUZ1 2RM21 4OUMA 3Q8CA 2V72A 4Y4YA 1OA2A 2YBKA 5A32B 3ZN4A 5IK8A 4QGNA 2EIGA 4P5HA 1AX2A 1WMXA 5FXWA 2Q1ZB 2D93A 3D0SA 1H8VA 5CKNA 3GCXA 2VBBA 4PIZA 2HWE1 5IAVA 5K4LA 1AR61 3POEA 1BMV1 2JD4A 4A4AA 3SXWA 5T5OA 2FMYA 5GZFA 3ZYFA 5D8AC 1AR72 4PIYA 4YVSA 2D98A 1W6MB 3C7OA 3ZFFA 4CCNA 3T0AA 1RUH2 2XR4A 3OGSA 4ISRA 4XABA 3WW4A 4CDQC 3SH3A 2GC0A 2Q30A 2BVVA 2CY6A 2PQQA 3DPRA 3ETQA 3UJOA 2WZR2 1DGWA 4DZGA 3ZDVA 5BNPC 1Q8VA 1S0CA 2R073 4XIKA 1LCLA 3WP6A 1LB2A 1MZ5A 4JHTA 2PLV1 3ETPA 5FYCA 3W21A 2EIEA 4OCTA 2CNAA 3QBQA 1HB3A 1A78A 1KD7A 3D5OA 4JRAA 4KH9A 3Q8BA 1MEC2 2H0VA 5A6ZA 4Q0VA 1E5RA 3VHOA 2EALA 1ND3C 3RQ0A 4LHLA 3T08A 3S5QA 3VBHB 1RXGA 2JB8A 3LDRA 1XE8A 5FJHA 3SNMA 4DB5A 1UU6A 4IV3C 3HT1A 2RS12 3ZO0B 4IXLA 1VR3A 3T4HB 5T5JA 1VLNA 5FZMA 4A3XA 3T09A 4JGZA 5A1LA 2XUEA 2FZ1A 2AYHA 1GMMA 2GC3A 2WT0A 1NYWA 2ZA9A 3JUUA 4HZFA 4E27A 4LBQA 2OVUA 1Y4WA 1KGYA 3CJIC 3AFKA 3QACA 1RMU3 4QHOA 5AVAA 1GWLA 4XXAA 3O1OA 1NG0A 5BPXA 5KXBA 4XJWA 1WWYA 3HQXA 4RS5B 2RV9A 3VV1A 5FCCA 1UQXA 2EIBA 5I0DA 2MNGA 4OYUA 1X36A 2ZGQA 5JXIA 3OB8A 1LHVA 3I97A 2ZPXA 2XL7A 1QJU1 4F83A 2XGXA 2PQSA 2JDKA 1AR71 1FX5A 1AR82 3KV5A 1OQEA 1UU4A 4FPOB 1AYN3 3RG0A 3E6CC 3P6BA 3PJYA 2A75A 3T1MA 3FHIB 4Y4RA 3QH6A 4Q4X1 1DF0A 1STMA 3ZMOA 4BQWA 3CO2A 3BOWA 3K48A 5DN2A 1ASJ3 1K5MC 4UFMA 2YU2A 5FZLA 3ZIXA 5BNNA 1POV1 3O0WA 5KHGA 2YC2A 4H7LA 3NKGA 4Q4Y3 1I3HA 4LR4A 3ITQA 1RUI3 5LK5A 1HX6A 1MEC1 4IESA 1YI9A 2ZMKA 1R1A3 4I0WB 5FPBA 2YUEA 5JPMB 4YZ2A 5F3IA 2VZRA 1VP6A 2R1BA 2Y38A 5FP4A 3VZNA 2QVSB 1DQ2A 2RS11 3O7OA 4L0PA 4EWAA 3UESA 2ZEXA 1ACCA 1PGW2 1GQHA 1ZZ6A 3A0NA 4IEXA 4IGQA 4W8JA 4OHZA 4MV2A 2K46A 3GZEA 2VW1A 5A33A 3CBNA 1Q5OA 1W3VA 1GZ9A 2A6XA 3NQHA 3VGIA 3S57A 2BV4A 2BU9A 2XLFA 5DG2A 3ES4A 4GZ9A 3VBUC 1GNYA 4FO9A 3NJVA 4FPFA 2R042 4OHYA 1LOBA 1VALA 3D8CA 2VNRA 1GZWA 2NMNA 3EB7A 3WG2A 1N3PA 4NRMA 2QQMA 1IZ3A 5EJ1B 2A6ZA 2D3SA 1UYZA 5BNOB 1SDWA 3KGLA 3DXUA 5FZBA 3MLLA 2QUOA 1APNA 1CAWB 1GP5A 3DUIA 5FY0A 5L36A 3HIFA 4EV0A 1RC6A 2D6OX 4QPIA 4EN7B 4UFJA 5FYBA 4LO8A 2Y6GA 1AR81 1JN2P 3HNBM 3WDTA 5LA0A 2YGMA 3LD8A 3O1MA 2D6PA 1MACA 2VY0A 4OHWA 4AFCA 1AX0A 1T2XA 4CEYA 2OPWA 1LOFC 2ZAAA 2W1SA 1VRH1 4NWVA 5JWPA 2GDFA 1DYOA 1J3QA 2BBAA 4N43B 3WF0A 4C0HA 3ABZA 4K3UA 2RE9A 4AHXA 3HN1A 4RR3A 3WNLA 1J59A 4WVVA 3CQOA 5HV0A 4ISQA 3RI9A 5C4WA 1ZBE3 1N47A 4N53A 2PMWB 1CN1A 5JMCA 1W28A 4CXXA 4YZ1A 1S0GA 4BXSV 1O3RA 4AWDA 2K0GA 3O1VA 1Z78A 1WUVA 2KA3A 1JOPA 1PVC2 3UL2A 1V0AA 3UKNA 2WA3A 3V64A 5IFTA 1IS5A 3UKVA 5APAA 4MGIE 2AEYA 3CMGA 2YXSA 5HPOA 2R30A 1PGW1 3NNJA 2CAVA 2FBEA 2TEPA 3AXDA 5T54A 3VZOA 4CCOA 3KVBA 5DG1A 4LOSA 2VMEA 3MDPA 1HJFA 1JHNA 2JDHA 3AL5A 1H2MA 4GB33 3AP4A 1LESA 4IGPA 1W9YA 4JDMA 5CVRA 2VZSA 1D0GA 2D44A 1BVVA 1ZX5A 3FX3A 1UF2C 2B7YA 1GICA 4XJAA 1TNFA 4UF0A 3H8XA 1GYKA 2R041 3JQWA 2OA2A 3NNLA 4FOVA 1LAJA 3I59A 2FDKA 3LOIA 1XNAA 4LEJA 3ZIWA 5FOJB 4Y20B 1TMF3 4RFRB 3JB4C 1J1LA 2W68A 2WNVA 4A42A 5FWJA 4RGGA 1URXA 3TBDA 1HRI2 3CF6E 4QQOA 4AEMA 3TOJA 1MZEA 3BCWA 2UURA 2XVGA 1TG7A 2G9GA 1J3PA 4H3WA 3I2IA 5L7OA 1YFXA 1ULGA 1YJLA 4N8MA 4X8PA 4CCJA 3RZJA 1W0OA 2OUJA 2WAOA 3ZR5A 1W2TA 4ONUA 5E6HA 1H4HA 1SHWB 1WLWA 5FZ1A 1NA1A 4AFBA 4DQAA 5IVVA 4GXLA 3NNMA 1CR7A 5CB7A 4XF0A 5FBZA 5JZGA 3NL1A 3ZYGA 1OD5A 4U2AA 3KWVA 1GNZA 1PK6B 1SBFA 1ENXA 4I02A 4XUPA 3SEEA 1UN1A 3RWNA 5CADA 4IE6A 1PNGA 1S55A 5T52A 1BVP1 3OBRA 3VKFC 1NXD1 1REFA 4QX7A 3T1LA 1SLAA 3TNPB 4C1XA 3BYWA 4IE0A 4ZS2A 4JHZA 4PI0A 5EHDA 1XU1A 1HQNA 3FL7A 3MF9A 4XW3A 2NP0A 3USUA 1MS3A 3ZYRA 4UFKA 4MXWA 1W3XA 2Z69A 5JDBA 1TQ5A 1PVC1 1W6OA 4R9BA 3ZN5A 5FREA 3KD4A 1H2NA 4IDZA 2FDHA 4XBLA 4M00A 1VBB2 4QPGB 5GLWA 4CDXB 1PX4A 1C28A 2DBNA 2VULA 1DQ1A 2XG3A 3IIIA 3IMNA 3Q8EA 4EZ4A 4YVWB 5A70A 1HXS2 1QF3A 2XJUA 3QCWA 2DVFA 4HPKB 3VBHC 1YFWA 1SQ4A 3H42B 3KV6A 4AXOA 5CZKA 3UV9A 3WNKA 1MS5A 4FPCA 5A3UA 3W5MA 2DVDA 4AGVA 3I3QA 4CPBD 1XC6A 4BLIA 5JMOA 5ERLA 1VRBA 2XJTA 5HBAA 3J9SA 4Q4W2 1HRI1 3ZR6A 2WDBA 3IPVA 4CTEA 1US2A 3B01A 1CPNA 2EAKA 5FMOL 1S0DA 5LEKA 1GU3A 2VUAA 5DZGA 1OHFA 4MGKE 2AC1A 3RZZA 5KHKA 5DZFA 1SLIA 3RPQA 1HDKA 1CQ9A 5K0UB 1VIWB 3MUY1 4FOYA 4MH0E 4RS5C 1LGBA 1W6PA 4K20A 2DFCA 2V09A 4OVEA 2QE3A 1CAUB 4Y5TA 4BQ5A 1W0PA 3WF4A 2RDQA 4IE4A 1CAXA 1VB4A 5GZEA 1AR93 2R0HA 5ABJB 2VGDA 5L19A 5FR3A 3WLUA 1ND2B 3M70A 2H0BA 2R16A 3WCSA 1EYBA 2MEV3 4HK8A 3V0BA 2P6CA 1QIQA 1SACA 5GJ6A 1CD3G 2R072 3A4UA 3BKZA 3LPFA 1NCQB 1Q8SA 4GULA 5GALA 3LKJA 4IERA 1VAMA 5AFBA 4LBJA 2DU1A 1O5UA 3N7MA 1QH7A 4BLJA 5KXDA 1QJFA 3K4ZA 3RJRA 1C5HA 1NCRA 1UNBA 4AHZA 1KDMA 5FZDA 3MI8A 2PYTA 2WNUA 3GHMA 3M3EA 2PFWA 2RS53 1KJLA 5BXXA 5FLIA 4D94A 3BI3A 1I6XA 3O12A 5A7WB 1R081 4HKLA 3AVSA 3N9MA 4NHLA 3VHNA 2A6YA 4IW3A 2QTWB 2Z4FA 4UXAA 4INDA 2VZPA 2XBO2 3NJXA 5LBFA 1POV0 2ZHKA 4TSVA 4FOQA 5A3WA 4Q4W1 3WQ7A 4N9IA 4LK6A 4WVMB 1RMU2 3HNYM 1L7LA 4BWOA 4DS0A 1UXZA 1JU3A 4BK5A 4XC9A 3TEXA 2VMHA 3A22A 4V1PA 4YM0A 1DDLA 2Y64A 5FYMA 1AR73 2VE1A 4UBGA 3NV2A 1PHMA 2JG8A 1WW5A 3IN9A 5EYXA 1KDKA 5FZCA 3HD8B 5BNOC 4QGMA 1RUH3 2B8MA 1SPPB 3LFMA 4CEWB 2PAMA 4YG6A 1WLCA 2Z79A 1FV3A 1AYN2 1F4HA 2WZR3 3PVEA 4W6WA 5FP7A 3V56A 4BZ4A 2J22A 3CNAA 1LOAA 1QEXA 4A7KA 5LY1A 2HWF3 3U0ZA 5J3UA 1QXPA 4URAA 1YI7A 4QHZA 3B7MA 1PZ9A 4LOTA 4DY5A 3BUCA 5FPVA 3ACIA 2R071 4N43C 1DYPA 1HRV2 4C8DA 3VBOA 2DCTA 4UW6A 2JECA 1TE1B 2IUWA 1F2NA 3NWKA 4PQ9A 2E32A 3Q8FA 4Q4Y2 2A5ZA 2B39A 3AYDA 3SLIA 4QPYA 3WY6A 2OZ6A 2RS13 2WYFA 4BCUA 4P5YA 1UX6A 3BODA 2QKDA 3MV11 1AL0G 3V0AA 3EJKA 4NIHA 4AFDA 2ERFA 4YGBA 2HYXA 5F5QA 3CZUA 2NMOA 2QNKA 3FZ3A 1MQTA 4HK9A 2GMPA 1QJZA 1SEFA 3HMYA 2OXBA 1RUC2 2C9AA 1LHUA 2ZHMA 1IOAA 4TZDA 2CGNA 3D3AA 1ULFA 1XE0A 2Y8KA 2WT2A 4ZY9A 2GALA 3MLJA 3NRUA 2ATFA 3VL8A 4FTBA 2VTFA 1RMU1 1GP4A 1O3TA 1BKZA 2C9KA 1MPXA 2BEOA 2ORXA 3ZFEA 3AZYA 4ASMB 5FYIA 2G9FA 1YNAA 1OH4A 2HWD2 2V73A 1Q8PA 2TUNA 2W3JA 3AKRA 2ZEZA 4K7JA 1G8WA 1CJPA 4XXPA 3OGJA 1N3OA 4LBLA 4AEJA 1OSGA 3HT2A 4YZ5A 5A6YA 3HEIA 4UW4A 4N7IA 4XZUG 3VBFB 1VAVA 2VVEA 2WWJA 1AYN1 3POGA 3L2HA 1UOFA 3N9LA 3NAPB 3TNQA 1KEXA 2UY9A 2WKKA 4KGGA 2PA7A 3K75B 4L97A 5F8PA 4L92A 3CHXA 2QQUA 2OPKA 3VUOA 1ND3B 1UMHA 4KWLA 3GXUA 5CAZA 2BOJA 5T3NA 1PK6C 3ZFGB 5KHIA 1HRV1 1Q8QA 2PXJA 4Q0PA 1ZBE2 1IG3A 5K9YA 3WP5A 2ZMNA 4Q4Y1 4WM8B 5D8AA 1RUI1 3I49A 2GNBA 2RMU2 4XHXA 3P3PA 3WQ1A 4IQPA 3ZXDA 4GWIA 1SBEA 4OULA 5BV6A 4KG0A 3BVCA 1UD1A 3MPBA 3W9AA 2D43A 2QZ2A 3JBG3 4CDQA 5FPUA 1UMIA 3H8RA 2IXKA 4AEDA 2WN2A 1OI6A 1E5HA 2ADDA 2R043 1RUC1 1RTVA 2VC9A 4QPGC 2P3IA 4LBNA 4GB32 4PBPA 4AL9A 4BQ3A 4OHVA 4CDXC 3KT4A 5C3SA 1SCRA 4D8MA 1VAKA 4XFHA 4XAAA 2DWRA 2BJSA 3AYCA 4JGYB 2CV6A 1DYKA 2YU1A 3GYDA 4YVWC 4QQPA 4LO6B 2D7FA 4QDQA 1CAVA 3W20A 4AG4A 4IEUA 4D6QA 4MGTA 1QXJA 2W1UA 3PVOA 1DBNA 1UIKA 3S30A 4LHNA 5CEHA 3O14A 1J83A 2QDRA 2XVKA 4EJRA 2NZ9A 4Y22A 3WSOA 4HVOA 1PNFA 3VKLA 2DUQA 3NV3A 5HCFA 4CDWC 1UOBA 4E2SA 2Z5WA 3R05A 4FFHA 2VU9A 3QH7A 2VCBA 3I2DA 1KS4A 1NAEA 3PURA 4DUVA 4EQVA 2VW0A 1VBC2 3CJIA 4YM3A 4XUNA 5K0UC 2CHHA 5J09A 4AAPA 4TLGA 4CSWA 4AQ6A 3E6BA 3S6PA 1RHI2 1V70A 3EHKA 3MFCA 4JX0A 4XE9A 2H6CA 4Y33A 5A3NA 3TYJA 2VMDA 1CZSA 4CP2A 4LHKA 5ABJC 3R4SA 1ZBE1 1OVPA 1S2KA 3PUIA 4I3GA 2J7MA 3HN3A 1ND2C 4X8NA 3B9IA 2AENA 1REEA 2YPJA 1KQRA 5F39A 4AVVA 5F3CA 2RMU1 4DOUA 2JENA 3MIHA 4AAXA 1LOGA 2WABA 3PDQA 5A1AA 1U12A 2A70A 4KNCA 3RMYA 2W95A 3RS6A 2ZS6B 1K42A 3T0DA 3AL6A 3K77A 4FTSA 1RJ8A 2HEVF 3FWEA 3ASIA 4AE2A 4AHWA 2BUKA 4NN0A 1WBLA 4BK4A 2VQAA 3VN4A 3POSA 1HQLA 4GB31 1R64A 1UOJA 1GNHA 4HSJA 3RMXA 1XYNA 1NOVA 4UYBA 3WG4A 5C71A 2VO5A 1XOYA 5DMYA 4FOWA 2VM9A 3BTXA 2WSUA 1ZZ7A 1ZA7A 1ULOA 3IT8A 4QAWA 1TMF1 3JZVA 1UZ0A 4UWDA 3MICA 2WIIB 4GQ7A 1GOGA 4PJYA 4XFAA 4YGCA 3GZUC 1QDCA 4LLFA 1YXWA 2Z2SB 5C8CA 3NNFA 4XFGA 3VKNA 1H9WA 3ZKUA 2GAUA 3LEIA 3ZM8A 4CU7A 1FOD2 1LHOA 1RIRA 2E7AA 1W04A 3LAGA 3MF6A 1GOFA 4Y5Z0 5D21A 1UY0A 2BNMA 1D7PM 1G9AA 4M4PA 5A6XA 5K8SA 1NZCA 3K3OA 5KBFA 4CE8A 1VBC1 4NWWA 2BYVE 3WP3A 5C6CA 1YO8A 1ZBA3 2VJXA 2C24A 4XOGA 1Z7S2 4J25A 5BNQA 2XWBB 1V6OA 1LRHA 2RG4A 5F5AA 4F8AA 4YARA 4LXLA 2R7EB 1ZNPA 3SITA 2KD7A 4LLOA 2XHNA 5F6LB 3WCRA 4E4SA 5D1IA 1WD4A 5F3EA 1KITA 1W8HA 4FPGA 3WQ0A 1VBB3 3UGGA 4FFGA 2PAEA 4M4RA 1OOPA 1ODMA 2XJRA 1WD3A 3EBRA 4QD2A 2FCUA 3S0MA 2FDGA 4NUBA 1MR5A 2RS33 1BXHA 4OI2A 1OFNA 1IS6A 1HXS3 1GZTA 3IM0A 4K8FA 4BA6A 4DXSA 4FAHA 2GP5A 3MW3A 4NIGA 1VBE2 1QKQA 1W2NA 1BK1A 3N9NA 4XQDA 2RS52 4FVVA 5CNAA 2GNDA 2ZKNA 1F15A 3U78A 3GHNA 1DU3D 4JCKA 2DVGA 4XACA 3OD0A 3W5NA 1RVF3 4FP2A 3ZYBA 4CUAA 1RJ7A 3GF6A 3MIBA 3KZ4C 5FZ8A 2XB6C 2XHKA 4YW6A 4BE3A 3U4SA 5C3QA 2CL2A 5JCTA 1GZCA 4HANA 1RUG2 3POYA 3MIGA 1IQDC 1HN1A 1YFUA 2DYCA 2CYFA 3D6EA 4YVSB 3I2KA 4O7XA 2P4EA 4UOJA 3N36A 3IMMA 2JE7A 3LDKA 1JUHA 3WDXA 1UPIA 3WOGA 1FT9A 5F37A 3DPRB 1QWRA 3AKTA 1AYM3 4B4RA 4AF9A 4QPWA 3ZPYA 4EN9B 2UWBA 2FDJA 3ZXKA 1MS8A 3VHPA 1LGNA 3E5UA 4CP1A 2BZDA 4E9KA 3B94A 4COYA 1AXKA 4XFCA 5A7PA 1QDOA 3RYKA 1COV3 1SLTA 1Z7S1 1AR91 2PHXA 3OD4A 4W65A 4YZ4A 5C9AA 4K9SA 5FXZA 3OYWA 4ZZ5A 3NV4A 3VBFC 3VDCA 4CUGA 2HWF2 2A6VA 3PIJA 3C7EA 3NAPC 4LE4A 1QU0A 2MEV1 4CP9B 5AVPA 1ST8A 2MHFA 3QOPA 3B69A 2BERA 5FPZA 2DVAA 5A3TA 3IZOA 1C5IA 2X5IB 1GP6A 1QJY3 3Q9OA 1NY72 1OQDA 4JGZB 3LQCA 3AK0A 1VBA3 3ZFGC 2BBVA 2VVFA 2B46X 4RA0A 4V2WA 1YRZA 4ET7A 2WO7A 3TWIA 3WW3A 3FFQA 1O59A 4IV1A 4LBQB 4WM8C 5KWRA 1VBE1 5A7NA 4K40A 3RI8A 4O65A 5GZDA 1WCUA 1W6MA 2RS51 3BPZA 4ORFA 1JH5A 4A6SA 1OLMA 2J1SA 2XBO3 1NQDA 3IKWA 3THDA 3WV6A 5IK7A 4S2HA 1FNYA 2BFUL 5EQUA 1IQAA 3GDBA 2D97A 4CCMA 1HB1A 5FY5A 4EN8B 1U5XA 4FPJA 3GGLA 2YFUA 1W05A 1YQCA 4M3CF 3J7NA 4A44A 4KU8A 1N1SA 1RUG1 4BXFA 2HJIA 5LW9A 1KXGA 1VJ2A 2JG9B 4DUXA 4MZUA 4M0HA 2JB4A 3AYEA 3C3VA 3N9OA 4IEWA 2QQIA 2HLEA 2XMLA 1JYNA 3DV8A 4JGYC 3LSEA 5FY7A 4IEZA 3C7GA 4B1MA 2I2SA 5KC5A 1AHSA 3S5AA 4HVRA 2OQ6A 2JIGA 4Q4V3 1KFUL 3VBRB 1M06G 1XNCA 3GBWA 2TNFA 2IXHA 4BMBA 3BALA 1HB4A 5BNNB 3GALA 4XDQA 1RUH1 2XUMA 3K4DA 1O4YA 5JLVA 2YMZA 3FUOA 5FZAA 4P08A 1UAIA 1H6XA 1L7QA 3IDEA 4XQ4A 2XLGA 1X9PA 2WZR1 5FY9A 3PIGA 1LJ7A 5FO9B 4GD4A 1GSLA 1JZ3A 1UKRA 4JAAA 2CGPA 2HWF1 1LULA 1HRV3 3AZZA 3KHBA 4GMP3 4P9LA 4G3YC 1UYXA 4NR1A 4DEVA 2NPIA 4ZXKA 3ZMNA 2P34A 3M2MA 1HV0A 4LT5A 4RS5A 5ANQA 2ZKLA 5EV7A 1QHDA 1GLHA 1YIPA 1RXFA 3PTYA 2AR6A 3N35A 1QMJA 4M3CB 2YPDA 5A33B 1TVGA 3OTFA 3WNNA 2HEYF 2QQJA 1H9PA 3OUIA 4XFBA 3VL9A 2ZX4A 5JOZA 2W92A 2BGPA 2VZOA 4P00B 5DAXA 1CWPA 1WW4A 3UJQA 2WNOA 1GZWB 2ZGKA 2LALA 2W5FA 5FYYA 1RUC3 3JBG2 5F5IA 1I9RA 2YC4A 1W8FA 1QY4A 1KJRA 1PIV3 4FI9A 1S2BA 5H9SA 5IVEA 1ZA4A 5FUNA 1ZREA 1UKGA 1W8TA 4QX3A 3T30A 5GLTA 3VHRA 4QPIB 1C1LA 1K12A 4IETA 4CU8A 2HWD3 3ZYHA 4J1XA 1C1FA 1PVXA 3VDBA 3ZXLA 2D3PA 3MO4A 5DUXA 1IHMA 3VD4A 2VOVA 2WLPA 4MYEA 1CZTA 1UYPA 1MVEA 2MPFA 5K7PA 1WA4A 4IEOA 1CVNA 3ZN6B 4RR3B 2BGCA 2J1TA 2VCCA 4TYSA 1G9CA 3T3YA 5JR7B 4MHUA 3JD73 2AZ5A 1HKDA 4YW7A 1ZRDA 1A3KA 1MS9A 1AF9A 1RYYA 3LIGA 3SEPA 4ZU7A 4Y1VA 2WQ4A 2YBSA 2LS6A 2IC1A 2W9XA 4BDVB 1RUE3 1Q56A 1QNYA 5I8YA 1IPKA 4RN5A 3R4DB 5FLHA 4KI5M 1NKGA 4BB3A 4EWEA 1AXZA 2RMU3 2WRAA 3OGVA 4DY3A 2A6WA 1O8PA 1PO12 2W52A 2KM2A 4R9CA 5LBEA 5CFDA 5GLVA 4OQ8A 1PMHX 1QOOA 1CAWA 1H1MA 2WJSA 5CISA 4BOWA 2WAAA 5LRSA 4D7YA 2EVXA 4YGDA 4Q5OA 3S7IA 2A71A 4JKMA 4BPZA 5E16A 3JBG1 4AVSA 1PO22 3AKPA 4RL7A 1GQGA 2WNVB 5DAQA 1NZIA 3DCQA 1GFF2 3H3UA 4CXYA 4RHV3 4GIQA 5J37A 4OI1A 5L7OB 4JC1A 2ZBJA 1PM7A 2CWSA 1E57A 2DFBA 3A0KA 1OLME 4XBQA 4ZU4A 1T6BX 2UWCA 2VMIA 2Y6FA 5IWFA 5HCHA 5I8TA 3FLRA 2EXJA 2DUOA 1ZZCA 1JYIA 3NW4A 4X6RB 4XCBA 2OX0A 3FUQA 3POJA 2BWCA 5LBBA 5FY1A 3SH4A 5JZGB 5J96B 3KCXA 1BEV2 1F9KA 5GM0A 4LA3A 3RZKA 3APBA 3DYPA 3PUSA 4YW1A 1VBC3 3THCA 5CG9A 4YVSC 3N4MA 4DFSA 4PLOA 1OF4A 1BLZA 1RHI3 4B3NA 5FXVA 3VDDA 3DPRC 5IVCA 4QQHA 2ZEYA 4L99A 5B2GB 3MW2A 1ZBA2 4XDOA 4MXVA 1FPN3 1ULCA 2WZ8A 3MLKA 2GN3A 2CGOA 1X7NA 3FLTA 3OF1A 4FPHA 3MW4A 2XDVA 4Y20A 4BH9A 2ZX1A 1JODA 1XPWA 1PO11 3GCWA 3LF7A 3POBA 4OQ9A 3SKVA 4DNYA 4E4DX 2W1QA 1JU4A 3HWJA 3K3NA 3LWCA 3E6DA 4XETA 1OD3A 1JHJA 2VNVA 2L9LA 5L9BA 4XJ9A 1CJDA 2X5IC 4XIOA 1JXNA 1OPMA 2RS32 4JGZC 4URTA 5B4XA 5BY5A 2J1RA 3OJBA 5DAWA 2GN7A 1HN0A 2QJVA 1K5JA 4LHSA 2XJSA 4LKDA 3TN92 1B35A 1X8EA 4KBBA 3BN6A 3CLPA 4LUMA 4QM8A 3PLQA 1RVF2 1UZYA 4FFFA 4XYXA 4JVAA 3AFGA 2GNTA 4NIDA 2ZX0A 4CDWB 2BOIA 1V6LA 1W6PB 2EA7A 2D6KA 2VG9A 5E88A 3WHUA 3ZPOA 2V4VA 4AFAA 1FOD3 2CTVA 4D6SA 1QQP3 3AP9A 1LOCA 5I0UA 1CAXB 4CPBA 3EMRA 1S0IA 1CIWA 2JG9C 4Z07A 2DU0A 2FDFA 4GH4A 5TSWA 4FFIA 5KXEA 2B4KA 2WSVA 2XJPA 3VD7A 4AFMA 4CDXA 1JMUB 3J7MA 1AYM2 5GKAC 1RB8G 2BRTA 3B93A 1EAH2 1Z7S3 4XFIA 4YVWA 5EWSA 2O8OA 2DDUA 2HWC2 1RITA 1W6NA 3AVRA 1OXCA 4HPKA 3VBRC 1IG0A 2JWPA 4QX5A 4PDWA 3D82A 1COV2 1ZBA1 2PHUA 4QT6A 5BNNC 4Y3OA 2ZGRA 3J4UH 4YFZA 2P3KA 3H7YA 3LEGA 4IE5A 3J8F2 3O0XA 1NCRB 3ZYJB 2E6VA 4PIXA 4HONA 5IATA 1DGLA 1EV13 2WNUB 5A3OA 4Y1XA 3TEYA 4EN6B 4YW2A 3NNGA 5IHRA 5J1XA 3ECQA 2IZWA 1REDA 2HEWF 4W50A 5FKCA 5C5TA 5GZCA 3J7LA 4WVWA 4WV8A 4AYUA 3KV9A 5KHJA 4Q8KA 1H8TB 1TNRA 4FPYA 1UY3A 1VBE3 1VBB1 1BZWA 2E7QA 2X53S 4YSFA 1QJY2 5FQ0A 3ACFA 3H3ZA 1GANA 2ZZJA 1VBA2 1LTEA 1WW7A 1CGPA 2ZTNA 2RS31 1HXS1 1WLTA 2VTXJ 3RZMA 4YNIA 2J42A 4IL7A 1OLRA 3LA3A 4QX1A 4MUVA 5T5LA 2ID4A 3MPPG 4HVQA 3OUJA 3WQBA 4AI9A 3DF0A 4H2AA 1C8M2 5DUVA 4IEPA 1RUG3 5FO7B 3RFRA 2Q1MA 2YBPA 4XQWA 1Y7BA 1RVF1 2RR12 2LUWA 2VMFA 3ILRA 5FPAA 4CCDA 2WA4A 2YV8A 3GJAA 3LCPA 3DXTA 4ZONA 5F5CA 2X8KA 5IJRA 1A8MA 1WKYA 5E1RA 1JOBA 4Q0SA 5KHHA 4BU2A 1NCQA 2VMCA 4LULA 2QQOA 4AI0A 1H1AA 1YQ2A 2QCSB 5EXOA 2VZTA 2ZGUA 3LDBA 3P5BA 4QPIC 1PMJX 4OZXA 4PLMA 1O4TA 1JZ8A 1WZXA 3ZYIB 2Y6HA 3ATGA 3N7JA 4Q4V2 1LGCA 1AYM1 4YGEA 3N9QA 5FK7A 1EAH1 4QXCA 1A34A 2GP3A 2FD8A 5CKMA 2OS2A 2WL1A 2HWC1 3VKMA 4BQ4A 5ACA2 1XNTA 3VBOB 4P02B 1CZVA 4RR3C 1G86A 1O8SA 1COV1 2WS93 3GBFA 1JBCA 4NOTA 1Q8OA 3SCGA 5C4WC 1Q43A 1IPSA 2F4LA 4GJYA 4MOAA 3BTZA 5FMBA 1W90A 2IFWA 4XF9A 2XH6A 3H9AA 1YJKA 1PGL2 4NMIA 1SLBA 4UW3A 5JSOA 3V0AB 1J58A 4XFFA 4I3PA 2BP6A 1D2QA 1MQTB 4QMAA 3ELNA 3TEZA 1PM4A 1TEIA 3I7DA 1QJY1 4AR2A 2B5HA 1VBA1 1G9BA 1D4VB 3MGUA 1UIJA 2FMDA 3ZXFA 4I0BA 3AZXA 2ARCA 2AUYA 3C2UA 4CEWA 1U5IA 1YWKA 2OUHA 1DQ6A 4HOOA 2R0FA 3ZFEB 2B9UA 2I45A 4D6RA 5FUPA 4CDUB 5CA6A 1PIV2 4YG3A 2XBO1 1US3A 4FBFA 2GSYA 2WQ8A 3KF5A 2RR11 3P3NA 2WNVC 4NROA 2J1UA 5JXHA 1PZ8A 2ZGSA 1SFNA 1VBD3 5F7UA 2ZHNA 2BTVC 4Y1UA 1V6JA 3OGRA 5SV8A 1L3JA 2ORZA 3KQRA 5LEJA 1V9U3 2J1EA 2ZOEB 1QOTA 3HAGA 1AX1A 5L7OC 3RJ2X 1E5IA 4NRQA 1OC1A 1WMFA 4LE3A 5IT6A 4ZZ8A 2O14A 2X09A 3BOPA 4JKLA 1J3RA 2CAUA 4K21A 1DQ0A 4KWKA 4D69A 5HI0A 3WD5A 1FXZA 1CX4A 4Q4V1 2JE8A 2W46A 1OVSA 4G4FA 4KGQA 3AMQA 3E5QA 5JZGC 2DCZA 3OPZA 4GWJA 5CFCB 3ZSKA 1WW6A 4RQPA 1JS9A 2VNOA 5FK8A 3B00A 4Z92B 3ZSJA 4OI4A 3E5XA 4ITCA 2GZWA 2LROA 3WDYA 5ISLA 3EO6A 3JD72 3N7KA 3OUHA 4YRDA 4AQSA 3MIEA 4CCLA 5FOBB 4WM7B 1GKBA 1HB2A 4BQ2A 3O1UA 4META 1JZ5A 1PGL1 2UYAA 3KGZA 3H8UA 3LGRA 4GMP1 2WBKA 2VMGA 3WHTA 2VUJA 1T6GC 3O1TA 4HSLA 4EROA 1N1YA 1RUE2 3ALQA 3ILNA 4AEDB 5FMDA 1RUD2 2WUHA 3B02A 1W2UA 5A3LA 4JDOA 2B42B 3M1HA 3U1XA 2X05A 2ZGPA 4RGAA 1OA3A 2VR4A 5JPNB 4FXKB 3FHAA 1AUYA 3M3IA 4MGZE 4Y1ZA 5FRAA 1S1AA 5BNPA 1A6CA 1OA4A 2JIJA 3W59A 4MHRA 3NAPA 3PUAA 2VNGA 3ACLA 5LB6A 3WT3A 1AL22 2W0XA 1PIV1 5FZ4A 3LEMA 1UZWA 2R1DA 4P14A 4OI0A 3H1MA 1ND3A 4GA9A 4RHV2 3OPWA 1CIYA 4P9JA 5EFUA 1O3QA 1UYYA 1EPWA 5IK4A 2X29A 4BQXA 1CX1A 1M4WA 2HWD1 2P37A 4IV3A 3UNPA 3ES1A 5FYUA 4L8QA 1FMD3 4GKYA 1SFPA 1UZVA 3PNAA 4LIUA 4P9YA 4CVUA 2E9QA 5CBLA 4BQYA 1B09A 1WCSA 3BU0A 3ILFA 2JX9A 1YEWA 2PHTA 3GBGA 3WW1A 2YFZA 4JV4A 5FZOB 1WCKA 2ZGLA 2IXIA 3N9PA 3WVJA 1HV1A 5JUVA 2WYSA 2ZACA 1OBNA 3INAA 3CU7A 1W6QA 3JD71 5CG8A 1UX7A 1BQPA 2WFF2 1ENRA 1IS4A 1FI2A 1E5SA 4COVA 1PO13 1SZBA 3I2JA 2WZEA 1FPN2 1RUE1 3WNOA 4E4ZA 1FATA 2VZUA 1RUD1 3KT7A 1LENA 5I0TA 2E31A 1RGSA 4UW5A 2JDUA 1DGWX 2O0OA 3PVNA 5F3GA 3LOBA 2ET1A 5GLUA 4R4ZA 1NCRC 4D7SA 4Q8LA 3TEWA 2FCVA 4LO5B 4TN7A 1FYUA 2IXJA 2WT1A 3AJZA 2WNUC 1PO23 3CIHA 2R062 1K5MA 2XONA 1DP0A 1HW5A 2DVBA 3B5LB 3SH5A 3WG1A 4XPVA 4AGGA 1BJQA 1H8TC 4NRPA 3CEWA 4F7ZA 3KSCA 4HKOA 3ZOIA 4I30A 3H0OA 4PHZA 1W0NA 1W06A 5C8CB 1D4M2 1NLQA 5FBJA 3TRSB 4RHV1 4H14A 1U0AA 4AZZA 1ALYA 5CIRA 3ZKYA 2CSGA 3BPSA 5G05L 3URFA 2W87A 5C3PA 2JDMA 4JRLA 4L9BA 4NHMA 1BEV3 4D3WA 1KS5A 4R4XA 4TXWA 5FZEA 2WLQA 1WMEA 1PMIA 3H1YA 2PN5A 4BJ0A 4NPMA 2JG8C 2ZCWA 5FXXA 4A45A 1QQP2 3LZZA 1SLLA 3OCPA
chains in the Genus database with same CATH topology
5FY9A 5FZ3A 2YU1A 2OX0A 4GD4A 4NUBA 5FY1A 5K4LA 5FZOA 4D6QA 5FP8A 4UF0B 5FZGA 5FP7A 3RVHA 2GP5A 4AI9A 5CEHA 3PUSA 5LY1A 3N9NA 5IVJA 2YBPA 2P5BA 4URAA 5FZ7A 5ANQA 4QX8A 3U78A 5FPAA 5F5CA 5FPVA 3DXTA 2YPDA 3DXUA 5FXVA 5FZBA 4EZ4A 4BU2A 5FPLA 5KR7A 5FZ8A 4BISA 3PURA 5FZCA 3KV6A 3U4SA 5FY0A 4C8DA 4CCNA 5IVCA 3LDBA 3PUAA 5FYBA 4QXBA 5FWEA 4QXHA 4XDOA 5FYCA 3LD8A 4AAPA 5FZ4A 2VD7A 5FYYA 2XDVA 5F5IA 4CSWA 4IGOA 1VRBA 3N9QA 3OPWA 5FYTA 4QXCA 5IVEA 2GP3A 5IVYA 5FZAA 5F37A 2OQ7A 2OS2A 4Y33A 3K3NA 5FYZA 5A3NA 5FJHA 2XXZA 5FUNA 5F2WA 5FZ6A 5FV3A 5FYUA 3KV4A 3PTRB 3PUQA 5F39A 4V2VA 3ZLIA 5F3CA 4LIUA 4QWNA 4GJYA 5FZMA 5A7PA 5LWBA 3PDQA 2XUEA 4LIVA 5FZHA 5FP3A 5A1LA 4E4HA 4CCKA 5F32A 4ASKA 5FXZA 2Q8CA 5FY4A 3AL6A 4CUGA 5FZOB 3N9PA 5FYIA 5A80A 5FP9A 5FZ9A 4CCOA 5A3TA 3KVBA 5A7SA 4IGPA 3AL5A 3ZPOA 5A7QA 4D6SA 4V2WA 5IW0A 5A7WA 2WWJA 5FZIA 4UF0A 3N9LA 4HOOA 5A7NA 4D6RA 2YBSA 5FUPA 3KVAA 3KV5A 3PU3A 5F3GA 2OT7A 5FZDA 5FWJA 4TN7A 4Y4RA 5FYHA 5A1FA 4EYUA 5A3PA 2WWUA 4CCMA 3AVRA 3K2OA 2YU2A 5FY5A 5FZLA 4CCJA 2PXJA 5A7WB 5LY2A 3K3OA 3UYJA 5IVFA 2Q8EA 4BXFA 4XDPA 3AVSA 3N9MA 5FYSA 5FZFA 4DO0A 3NJYA 2Q8DA 5LW9A 4Y3OA 5E6HA 5F2SA 5FZ1A 3N9OA 4EZHA 5IVVA 5FZ0A 2XMLA 4GAZA 4HONA 5FBJA 5FY7A 5A3WA 2W2IA 3OPTA 5FPBA 5FPUA 5FJKA 5F3IA 2OQ6A 4LITA 5F5AA 5A7OA 5FP4A 4LXLA 4GJZA 3KV9A 2YBKA 5FZEA 5FYMA 5IVBA 5FYVA 5ISLA 5IWFA 4DIQA 4QU1A 4CCLA 5FXXA 4IGQA 5F3EA 4QX7A 5FZKA 3PU8A 5FY8A 5FXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY9 A;  5FZ3 A;  2YU1 A;  2OX0 A;  4GD4 A;  4NUB A;  5FY1 A;  5K4L A;  5FZO A;  4D6Q A;  5FP8 A;  4UF0 B;  5FZG A;  5FP7 A;  3RVH A;  2GP5 A;  4AI9 A;  5CEH A;  3PUS A;  5LY1 A;  3N9N A;  5IVJ A;  2YBP A;  2P5B A;  4URA A;  5FZ7 A;  5ANQ A;  4QX8 A;  3U78 A;  5FPA A;  5F5C A;  5FPV A;  3DXT A;  2YPD A;  3DXU A;  5FXV A;  5FZB A;  4EZ4 A;  4BU2 A;  5FPL A;  5KR7 A;  5FZ8 A;  4BIS A;  3PUR A;  5FZC A;  3KV6 A;  3U4S A;  5FY0 A;  4C8D A;  4CCN A;  5IVC A;  3LDB A;  3PUA A;  5FYB A;  4QXB A;  5FWE A;  4QXH A;  4XDO A;  5FYC A;  3LD8 A;  4AAP A;  5FZ4 A;  2VD7 A;  5FYY A;  2XDV A;  5F5I A;  4CSW A;  4IGO A;  1VRB A;  3N9Q A;  3OPW A;  5FYT A;  4QXC A;  5IVE A;  2GP3 A;  5IVY A;  5FZA A;  5F37 A;  2OQ7 A;  2OS2 A;  4Y33 A;  3K3N A;  5FYZ A;  5A3N A;  5FJH A;  2XXZ A;  5FUN A;  5F2W A;  5FZ6 A;  5FV3 A;  5FYU A;  3KV4 A;  3PTR B;  3PUQ A;  5F39 A;  4V2V A;  3ZLI A;  5F3C A;  4LIU A;  4QWN A;  4GJY A;  5FZM A;  5A7P A;  5LWB A;  3PDQ A;  2XUE A;  4LIV A;  5FZH A;  5FP3 A;  5A1L A;  4E4H A;  4CCK A;  5F32 A;  4ASK A;  5FXZ A;  2Q8C A;  5FY4 A;  3AL6 A;  4CUG A;  5FZO B;  3N9P A;  5FYI A;  5A80 A;  5FP9 A;  5FZ9 A;  4CCO A;  5A3T A;  3KVB A;  5A7S A;  4IGP A;  3AL5 A;  3ZPO A;  5A7Q A;  4D6S A;  4V2W A;  5IW0 A;  5A7W A;  2WWJ A;  5FZI A;  4UF0 A;  3N9L A;  4HOO A;  5A7N A;  4D6R A;  2YBS A;  5FUP A;  3KVA A;  3KV5 A;  3PU3 A;  5F3G A;  2OT7 A;  5FZD A;  5FWJ A;  4TN7 A;  4Y4R A;  5FYH A;  5A1F A;  4EYU A;  5A3P A;  2WWU A;  4CCM A;  3AVR A;  3K2O A;  2YU2 A;  5FY5 A;  5FZL A;  4CCJ A;  2PXJ A;  5A7W B;  5LY2 A;  3K3O A;  3UYJ A;  5IVF A;  2Q8E A;  4BXF A;  4XDP A;  3AVS A;  3N9M A;  5FYS A;  5FZF A;  4DO0 A;  3NJY A;  2Q8D A;  5LW9 A;  4Y3O A;  5E6H A;  5F2S A;  5FZ1 A;  3N9O A;  4EZH A;  5IVV A;  5FZ0 A;  2XML A;  4GAZ A;  4HON A;  5FBJ A;  5FY7 A;  5A3W A;  2W2I A;  3OPT A;  5FPB A;  5FPU A;  5FJK A;  5F3I A;  2OQ6 A;  4LIT A;  5F5A A;  5A7O A;  5FP4 A;  4LXL A;  4GJZ A;  3KV9 A;  2YBK A;  5FZE A;  5FYM A;  5IVB A;  5FYV A;  5ISL A;  5IWF A;  4DIQ A;  4QU1 A;  4CCL A;  5FXX A;  4IGQ A;  5F3E A;  4QX7 A;  5FZK A;  3PU8 A;  5FY8 A;  5FXW A; 
#chains in the Genus database with same CATH topology
 3AMM A;  2XLA A;  1OUR A;  1Y9Q A;  5FZ3 A;  2I74 A;  4COU A;  3VBU A;  3CJX A;  1R1Z A;  5FP8 A;  1D2S A;  3F95 A;  3G7D A;  3M3C A;  2Y6J A;  1R09 3;  5FFO C;  2C4X A;  3POF A;  2J1V A;  5LRR A;  1W8N A;  4KBZ A;  2RM2 2;  5IVJ A;  5FAX A;  3FBY A;  5DAV A;  3ZSE A;  1RHI 1;  2HBU A;  4AEK A;  2FDI A;  4QX8 A;  1H6Y A;  1LEM A;  1OUX A;  2WFF 1;  3OEA A;  3PMS A;  2EIC A;  1W03 A;  4JQR A;  3ROU A;  4AI1 A;  1OOP B;  3I2F A;  3SMH A;  1I5P A;  2NQY A;  4NPL A;  1FPN 1;  4S2F A;  1BBT 3;  3VBO C;  3OSD A;  1BMV 2;  2LM3 A;  2AH2 A;  2VOT A;  4ZKT B;  5C3O A;  4QXH A;  3VBS B;  3A21 A;  4A2U A;  1EV1 2;  4Q0U A;  1KFX L;  1LOF A;  2RDR A;  4XAE A;  2EID A;  4Y26 A;  4A3Z A;  3OY8 A;  4QKN A;  3SCF A;  2YZ4 A;  4K8R B;  5DAP A;  1BHG A;  2R06 1;  3HVD A;  2OZJ A;  4QM9 A;  3D4K A;  1RUO A;  2BFU S;  2OQ7 A;  3VZL A;  3WEZ A;  4BQ1 A;  2XXZ A;  3SIS A;  4K1Y A;  1DFQ A;  2C1F A;  1MQT C;  2QDN A;  2WQZ C;  2V5D A;  4Q29 A;  3TN9 3;  4I2O A;  1GOH A;  2RJK A;  4QB6 A;  3VD3 A;  4C91 A;  1DLL A;  4V2V A;  5FDB A;  5JAX A;  3JB8 A;  2HWB 3;  4AGR A;  4LBM A;  2F6B A;  1UCX A;  2VXR A;  3IAP A;  1UY1 A;  3AZW A;  3DEC A;  2SLI A;  4LIV A;  3DGT A;  1JYV A;  3H1W A;  4UFL A;  4LPL A;  1D0H A;  2XKP A;  4MVT A;  4E8C A;  3ZFE C;  4FAG A;  2RJ2 A;  4CDU C;  2A7A A;  3NV1 A;  2D6M A;  4FPK A;  1W9W A;  2YY1 A;  4W6X A;  5HCA A;  3ZFF B;  4NO4 A;  4Z8B A;  5M0T A;  3WNX A;  1FOD 1;  1QQP 1;  5A7S A;  1PX3 A;  3GZT B;  1DG6 A;  2BNN A;  2DTY A;  1NUK A;  5C9A B;  1CPM A;  1C8N A;  1EAH 3;  2V5Y A;  4COW A;  2HWC 3;  4OUS A;  3KCC A;  2VCM A;  4ES9 A;  4R52 A;  1DGR A;  4IUG A;  1DQ5 A;  4ZXE A;  4EWD A;  2OII A;  4MAD A;  1YYN A;  3LA7 A;  3KB5 A;  4LBK A;  3FC0 A;  4QB2 A;  2YB7 A;  2ZJC A;  3J8F 3;  4AI3 A;  5J7M A;  1OKO A;  3O1S A;  4NII A;  2DUP A;  2Q0A A;  2JJ6 A;  3POI A;  5CFC C;  2WS9 2;  1N1T A;  1VMH A;  4HXC A;  4MO3 M;  2Y26 A;  3AC0 A;  1QJU 2;  2QZ3 A;  4KMQ A;  2YC0 A;  4YG0 A;  5A32 A;  1YQ5 A;  3JCI A;  3FHQ A;  1X8M A;  5JSP A;  2ZZQ A;  1DZQ A;  4IV1 B;  1GQP A;  2B45 X;  3GZA A;  1SLC A;  1ZRI A;  1EV1 1;  1Z0H A;  4LJH A;  4I09 A;  4WM7 C;  4QKF A;  4LK7 A;  3O1R A;  4YM2 A;  4JTN A;  4LKF A;  4Q4X 2;  1JOJ A;  1IKQ A;  3FBM A;  1QGL A;  3BB6 A;  2BPA 2;  4QQ2 A;  1XB9 A;  3MYX A;  5AFE A;  4AED C;  2VXJ A;  3P1I A;  1ENS A;  5GLZ A;  3U75 A;  4DRV A;  3R6S A;  4YWA A;  3MZH A;  1SFY A;  1C8M 3;  4QU1 A;  3G6J B;  2JEM A;  5L73 A;  3IDB B;  4FPL A;  2OW4 A;  4LNV A;  3PU8 A;  5FY8 A;  2EAA A;  2RR1 3;  1YHF A;  3DN7 A;  5A6Q A;  2Y0I A;  1NX9 A;  3BGA A;  3RGB A;  2JDN A;  3IIA A;  3KS7 A;  3NJZ A;  2XKO A;  1LED A;  2WO3 A;  1Y9G A;  3M3Q A;  4MLO A;  1UW8 A;  4GMP 0;  1WGP A;  1Y3T A;  4LBQ D;  4OMC A;  2BQP A;  4CP9 A;  1XU2 A;  1SBD A;  4HFS A;  1VBD 2;  2P3J A;  5DUU A;  5FZ7 A;  3KM5 A;  3KCY A;  4BIO A;  1JZ4 A;  2X5I A;  1V9U 2;  3ACG A;  4C1W A;  1IKP A;  3LFI A;  4LTA A;  3TB0 A;  3VBH A;  5LA9 A;  3SC7 X;  2QQP A;  4K1Z A;  1OT5 A;  3RRD A;  1W8Z A;  3WUD A;  2GC2 A;  4XJZ A;  4Y5S A;  1MZF A;  1X33 A;  5ACA 3;  2UU8 A;  5FWE A;  5FUI A;  3O1P A;  2Q4S A;  2K9Z A;  3EYP A;  1RUJ 2;  3DEM A;  4O9E A;  1N3Q A;  2D3R A;  1QJE A;  1LHN A;  3WDV A;  4C0B A;  5J36 A;  4XJU A;  4B7E A;  5IVY A;  1VE0 A;  3LB9 A;  4R9A A;  3R0R A;  3RZG A;  3H8O A;  2WS9 1;  4A7Z A;  3VD9 A;  2CDP A;  5F2W A;  3ZXE A;  1C4R A;  1DHK B;  2JIC A;  5FZ6 A;  5JI9 A;  2UYB A;  2OKX A;  5DZE A;  4BYY A;  4EN0 A;  4CU6 A;  2FZ2 A;  2WZP P;  1QJX 3;  2JG9 A;  2WIN B;  2VZ1 A;  4PT6 A;  3RZH A;  5E89 A;  4XHB A;  2P6H A;  1NY7 1;  4PI2 A;  1O4Z A;  2W47 A;  2VCA A;  4E4H A;  5J98 B;  2NM1 A;  3OBZ A;  4JQT A;  3LSD A;  1ZZB A;  1HJG A;  1VRH 2;  3U11 A;  4H7M A;  2JDY A;  5FY4 A;  3VD5 A;  4DXR A;  3VBR A;  2ARA A;  2VZQ A;  2YG0 A;  4W6Y A;  3LEK A;  5FMC A;  4QX0 A;  2V4A A;  4XVH A;  2XOM A;  3IDC B;  5FP9 A;  3ZXG A;  1X9T A;  1N1V A;  5FZ9 A;  2AEZ A;  2ARX A;  2XJQ A;  3MHZ A;  4YYO A;  2VQU A;  4SBV A;  1Q3E A;  4GAL A;  5A7Q A;  3NO8 A;  2VBP A;  3N3H A;  2B9V A;  3T2T A;  5C7G A;  4DPN A;  5H9Q A;  3MV0 1;  5FO8 B;  5JSR A;  2R32 A;  4CUB A;  1XNB A;  1VBD 1;  1W2O A;  3ZXJ A;  4CEY B;  5C8C C;  4QXK A;  1OLQ A;  1V9U 1;  1XNK A;  3A7Q A;  5FLJ A;  5JOY A;  4M3C A;  3U37 A;  2D40 A;  1W8U A;  3AP5 A;  5KXC A;  4SLI A;  2Y34 A;  1FMD 2;  1GUI A;  1DGR N;  1YUD A;  3HBZ A;  2Y6L A;  5HCB A;  1ZRC A;  1TME 3;  2X10 A;  3I3B A;  2Q8E A;  2VOX A;  5AC9 2;  1UOG A;  5EYY A;  5FYS A;  5C4W B;  5I0S A;  2E26 A;  4JTO A;  3RZL A;  4HET A;  5EP9 A;  5FZ0 A;  1RUJ 1;  2XVL A;  4CU9 A;  4N53 B;  2N7G A;  2DBI A;  4QDR A;  2EF6 A;  3BIW E;  2H6B A;  4FT8 A;  4GWM A;  4NHY A;  1O7F A;  5CFD B;  3QD6 A;  2XL9 A;  2RHP A;  4NPR A;  3ZYP A;  1RUD 3;  5JVV A;  3I54 A;  4F3J A;  3I8T A;  4D0Q A;  5BNO A;  3KF3 A;  1EUU A;  2QQL A;  3ZDS A;  4A41 A;  2IXC A;  4XIL A;  5CYY A;  4YW4 A;  4XEZ A;  1OOP C;  1RIN A;  4M0N A;  1WCD J;  3MID A;  4MGS A;  1LU2 A;  2YYO A;  2BDR A;  2WO2 A;  3FE5 A;  4UF0 B;  5FZG A;  3PME A;  2Z42 A;  2LRP A;  3ZSL A;  2HKX A;  3AKQ A;  3I59 B;  3VBS C;  4TWT A;  3ZN6 A;  1RUF 3;  5EJ3 A;  2CDO A;  5JXJ A;  4FTE A;  5C8W A;  1AL2 3;  4I01 A;  2W1W A;  4E2Q A;  3GNE A;  1TZO A;  1V6N A;  4GWN A;  2VAU A;  4N43 A;  4AK3 A;  1WCQ A;  2R49 A;  1XJA A;  5FMO S;  2VBD A;  3AMH A;  5FPL A;  2WO1 A;  4B1L A;  2A3X A;  4L11 A;  5KR7 A;  1JI6 A;  3EXU A;  4WZF A;  4OFG A;  3U07 A;  4AHY A;  3WZ1 A;  3AX4 A;  3OEB A;  3I2O A;  2ILM A;  3M4F A;  2Y60 A;  3PHM A;  1NA1 B;  4CUC A;  1U5Y A;  3C8X A;  4XUR A;  1F5F A;  4XMI A;  2P1B A;  2J1A A;  4O9G A;  1UY2 A;  4UAP A;  3AP6 A;  1SMV A;  4HLT A;  2YDE A;  5T5P A;  1OFS A;  2IXL A;  5IUQ A;  4XF1 A;  5FYZ A;  3VDD B;  1FMD 1;  2BNO A;  3AXE A;  5DPN A;  3UET A;  1W9T A;  3FMG A;  5FV3 A;  2EXI A;  4YZ3 A;  5AC9 1;  1NLS A;  2E63 A;  1QNW A;  3ZFF C;  2PEL A;  3DKW A;  2DCK A;  1UZZ A;  4ZPI A;  1NQJ A;  2ZHL A;  4IEV A;  5FZH A;  2JDP A;  3VKO A;  3WF1 A;  3E97 A;  1IS3 A;  1NLR A;  2WFF 3;  1R09 2;  5C9A C;  4Q27 A;  2Y6K A;  3USU B;  4OUE A;  1H1I A;  2DF7 A;  3WR0 A;  4DXZ A;  1A8D A;  4MXW B;  4ZHN A;  5BYN A;  1H2L A;  3GJB A;  1W6O B;  5A80 A;  1F35 A;  2PTM A;  4HMZ A;  4N90 A;  1GWK A;  3ORJ A;  1EUT A;  5JXG A;  4XCA A;  4COZ A;  4Q1R A;  2WN3 A;  1SDD B;  4PLN A;  2VQT A;  4J6G A;  1ZVF A;  2GME A;  2XQR A;  1BBT 2;  4MGY E;  5IK5 A;  1OUS A;  3BU7 A;  4XF3 A;  2R06 3;  5DQ0 A;  1SCS A;  3BIE A;  1JYC A;  2Q1F A;  2KR2 A;  4NHK A;  1B35 B;  4IV1 C;  3WF2 A;  3CL1 A;  2LW8 A;  2E33 A;  1ZZ9 A;  1FV2 A;  1PO2 1;  1WA6 X;  5LCW L;  2ZGT A;  4KWJ A;  4E2G A;  2JDA A;  2K2S A;  1W39 A;  4P9X A;  4DMI A;  5FYH A;  1PK6 A;  3IPV B;  4MGQ A;  4PF1 A;  1D4M 3;  1BYH A;  2BW8 A;  1ODN A;  2WWU A;  2G1M A;  1LOD A;  3K2O A;  4WBB A;  2Q8O A;  3LA2 A;  1ZRF A;  1XXN A;  2HWB 2;  3ZVX A;  1LNS A;  1W9F A;  4B4Q A;  3QLQ A;  4ASL A;  3IB3 A;  2ZGN A;  1QXR A;  3C7H A;  4GH4 B;  4QKB A;  5SV5 A;  3K51 A;  1JZ7 A;  3OPT A;  4XTM A;  1W99 A;  3SCH A;  5HV4 A;  1DZT A;  5FJK A;  5FTT C;  3VZK A;  1BEV 1;  2GC1 A;  5A7O A;  3B9C A;  3WIN E;  5LK7 B;  1K3I A;  1W6N B;  2I07 B;  1YFY A;  3H7J A;  4GJZ A;  3WNP A;  5IFP A;  2JDZ A;  1HIX A;  1R08 2;  5DDJ 3;  2R6Q A;  4YLZ A;  4QPG A;  2W39 A;  3PL0 A;  4M3C E;  2WFP A;  4PDW B;  1GV9 A;  4PF5 A;  4PQQ A;  4DIQ A;  1SG3 A;  2RM2 3;  5FZK A;  4AQT A;  2P2K A;  1EY2 A;  5FIX A;  4J1W A;  1OQ1 A;  3M3O A;  2JXA A;  3J7H A;  3RWK X;  2FCT A;  3LIH A;  3HQU A;  4AQ2 A;  2VUC A;  1EPZ A;  1R09 1;  2VZV A;  2GNM A;  3RYR A;  2DCJ A;  3O5S A;  2HWE 3;  1AR6 3;  1O6U A;  3C7F A;  2BGO A;  3VZM A;  1WBF A;  3AKS A;  2C6S A;  5EIY B;  2P5B A;  1KRI A;  5FQ0 B;  1WMD A;  3VLB B;  2W08 A;  3THP A;  4CDW A;  3HPN A;  2A1X A;  1BBT 1;  4Z82 A;  4B4P A;  3I3M A;  3FJS A;  2NN8 A;  1I1E A;  2LTN A;  2AGS A;  5K0U A;  3ZX7 A;  1OF3 A;  4CZS A;  4ATE A;  4QXB A;  3I3E A;  2KXL A;  3DKQ A;  3CKH A;  4XJ8 A;  2C5D A;  4S2G A;  2PLV 3;  4YW5 A;  3WG3 A;  1CAU A;  1VMF A;  2SBA A;  2ZXQ A;  2ZGO A;  4WVZ A;  4LA2 A;  4Y24 A;  5FYT A;  3THT A;  3WXP A;  5F1R A;  5ABJ A;  3TN9 1;  4BME A;  4OMD A;  4B7K A;  2G4I A;  3I3D A;  2HWB 1;  4YPJ A;  1ND2 A;  4HKW A;  2QFE A;  1RL3 A;  3RNS A;  3PTR B;  2QBX A;  2JG8 B;  4HN0 A;  3ZLI A;  4QWN A;  2PHF A;  1GWM A;  3RSJ A;  5LWB A;  2GH2 A;  3AP7 A;  1QOS A;  4CCK A;  2PAK A;  3D0J A;  4ASK A;  1RUN A;  4HL0 A;  1JZ2 A;  2E7T A;  4I0A A;  1HLC A;  3UGF A;  4XTP A;  5LAS A;  3UKT A;  3HR9 A;  2VZ3 A;  2W94 A;  3WDU A;  1FNZ A;  1H8T A;  5F9T A;  5LZ6 A;  1U5Z A;  2C26 A;  3WX5 A;  5C5U A;  1H0B A;  1JUI A;  4DUW A;  4CEY C;  2F17 A;  3M7A A;  1VPH A;  2WC2 A;  2VPV A;  4L2N A;  5L9V A;  5IW0 A;  5A7W A;  4NVP A;  2VQ0 A;  5EJZ B;  5LAT A;  2QQV A;  1G7Y A;  5T55 A;  2VUD A;  1QJU 3;  2IVJ A;  3KVA A;  3Q8A A;  3PU3 A;  3J8F 1;  4CCE A;  3ACH A;  2D6L X;  2XQX A;  3AZV A;  4O61 A;  1JYW A;  1DLC A;  3BTY A;  4NHX A;  4LO4 B;  4N53 C;  5A1F A;  4ZS3 A;  3JXS A;  4AW7 A;  3T4V A;  4WVM A;  2BVB A;  3FN9 A;  4P9I A;  1I5Z A;  2WR9 A;  1JW6 A;  4JDN A;  3ME2 A;  1V6K A;  5LA1 A;  4Q4X 3;  5CFD C;  1LU1 A;  1QJX 2;  2JD9 A;  4X6Q B;  5LY2 A;  3SQO A;  5E8A A;  4EE2 A;  3MEP A;  5I91 A;  1GBG A;  3HJR A;  2GU9 A;  1EP0 A;  2Q8D A;  1JYX A;  4Z2W A;  3IWZ A;  1POV 3;  5EPA A;  1Y43 B;  2VTX A;  4GAZ A;  1YCI A;  1SPP A;  3DYM A;  1ASJ 2;  1MS1 A;  4HG6 B;  3ZXA C;  3M8L A;  5IYY A;  3V0B B;  1H2K A;  1MEC 3;  4LBO A;  3K46 A;  3IAQ A;  1YLL A;  1C8M 1;  2A3Y A;  2RJL A;  4XBN A;  2AAC A;  2FQP A;  4OZO A;  4FXG B;  5FYV A;  4RGK A;  1RUI 2;  2ARE A;  2PHD A;  4LKE A;  4A6O A;  1YIF A;  2RDS A;  1R1A 2;  1P8J A;  4AOC A;  1BK0 A;  2E53 A;  4QQL A;  2HBT A;  4CA9 A;  2JE9 A;  1MS0 A;  1O5L A;  1ZYB A;  1UPS A;  1ULD A;  4S2D A;  3RVH A;  4CXW A;  4RQP B;  2DUR A;  2G9Z A;  1XQN A;  1X82 A;  2VH9 A;  2YHJ A;  4QGL A;  5HXV A;  5JI7 A;  1NA1 C;  1LR5 A;  4MX3 A;  1AZD A;  1DCS A;  1X50 A;  1RUJ 3;  4N9H A;  1XBF A;  4UFI A;  3F2Z A;  1TME 2;  3MBW A;  2PHL A;  4RFT 0;  3VDD C;  1IGO A;  5ACA 1;  1S2E A;  2GH8 A;  3DYO A;  4XUO A;  2A3W A;  2JKB A;  4CRQ A;  1LKN A;  4YM1 A;  1MVQ A;  5D8A B;  1LHW A;  3ST7 A;  1UL9 A;  2UY8 A;  3CZJ A;  3I4I A;  4CDU A;  4UFH A;  4ES8 A;  2VD7 A;  3I2G A;  1CES A;  4YFW A;  1HQW A;  4R8H A;  1AR8 3;  1S0J A;  1XND A;  1XYO A;  2VEC A;  3AYA A;  1O91 A;  2FHR A;  2WNE A;  4E8D A;  4CDQ B;  2D6N A;  4Y1Y A;  3PJQ A;  2ZX2 A;  1V6M A;  1UY4 A;  4TLF A;  2DV9 A;  1J84 A;  1VRH 3;  3USS A;  1QJX 1;  1XRU A;  4XUQ A;  1S0B A;  4GKX A;  3VB9 A;  4Z1V A;  5BNP B;  2XPJ A;  3JU9 A;  4W4Z A;  5HXM A;  3R4U A;  1YQ6 A;  3WUC A;  3WDW A;  5GZG A;  3E1F 1;  3TAY A;  4QU2 A;  1L7R A;  5KC6 A;  5FP3 A;  3OGG A;  4K6B A;  1ASJ 1;  5F32 A;  1BCX A;  2G19 A;  3VBF A;  4AI8 A;  4HN1 A;  1OH3 A;  4JKK A;  5DXD A;  1CAV B;  4AVA A;  5BUV A;  5CFC A;  3HNM A;  1RUF 2;  4H55 A;  1JZ6 A;  4FPE A;  1B35 C;  4IV3 B;  1DQ4 A;  2QQN A;  2TBV A;  2ES3 A;  2O8Q A;  4NAM A;  4PCR A;  4Y22 B;  3T2O A;  2IFR A;  4Q2F A;  3RDI A;  1R1A 1;  2EXK A;  4WM7 A;  1DZR A;  2VOW A;  3ZFG A;  5F6K A;  3HBK A;  1ENQ A;  3JQX A;  5I93 A;  4Q0Q A;  3N7L A;  4ARX A;  1JTZ X;  1ZM1 A;  3CDZ B;  2ET7 A;  1V6I A;  3GM8 A;  4WM8 A;  5FZI A;  1XSQ A;  3CJI B;  4NIA A;  4AVC A;  2E51 A;  4HBN A;  5AC9 3;  5L9R A;  4KL1 A;  4FQZ A;  1J1T A;  4GH4 C;  1S0E A;  2O1Q A;  3U4X A;  1W6Q B;  4QHB A;  4D7T A;  3SKJ E;  5CKQ A;  1H4G A;  1WLD A;  3B3Q E;  3HOB A;  5DUW A;  5C33 A;  3L2Y A;  4EYU A;  4HT1 T;  1G9F A;  1TME 1;  2F4P A;  2UWA A;  4RYD A;  1AVB A;  3H3L A;  4QKD A;  1NXM A;  1PZ7 A;  4ATF A;  5G04 L;  3U10 A;  5C70 A;  4FCA A;  5JIA A;  3POW A;  3A23 A;  3MFA A;  4FQ4 A;  5FZF A;  1TMF 2;  4IE7 A;  4PDW C;  4LO7 A;  5F2S A;  2QQW A;  2RVA A;  3KLS A;  1O3S A;  4JGY A;  5D2A A;  4QX2 A;  4BM8 A;  5B4N A;  4BHP A;  3OG2 A;  1UO9 A;  4Q26 A;  5IAX A;  3OBA A;  1K5M B;  4LIT A;  1LEC A;  4JZR A;  3PVB B;  3AJY A;  2VL4 A;  4KU7 A;  4DRR A;  1V00 A;  2ZAB A;  2ZGM A;  4LOR A;  4XZP A;  1NE6 A;  3W58 A;  5IVB A;  2ZX3 A;  1AXY A;  1OPO A;  4G9S B;  2XWJ B;  1G9D A;  1ZRR A;  4OHX A;  4A7Y A;  4CP0 A;  2ZAH A;  1ONA A;  2P3Y A;  2VOK A;  4FSJ A;  4NE9 A;  4UBH A;  1YQ8 A;  2YGL A;  4CYD A;  3ENR A;  5FZO A;  2CWM A;  1RUF 1;  1AL2 1;  1C57 A;  2ZEW A;  1VMJ A;  2Q5T A;  4B29 A;  1W9S A;  4QB1 A;  1PVC 3;  4AI2 A;  4U36 A;  1F8V A;  1F4A A;  1AJK A;  2C0Z A;  3DL3 A;  1W8O A;  4ZU5 A;  4DEQ A;  4OLL A;  4PBO A;  3I2H A;  1XE7 A;  3KQ4 B;  4Z2A A;  4LMF A;  4P9G A;  2VVD A;  1NCQ C;  3UGH A;  3PUH A;  3VBU B;  3WP4 A;  2ETE A;  4BIS A;  2A73 B;  3T2Q A;  5LBC A;  3KHC A;  1MS4 A;  3J26 N;  2P17 A;  2Y0O A;  4IEY A;  1YC6 1;  4AVB A;  5H9P A;  1PGS A;  2IWG B;  4QDS A;  1C3H A;  3AMP A;  2GMM A;  5FPX A;  3IDA A;  4IGO A;  3NVC A;  4XF4 A;  3NST A;  2NLR A;  5EZW A;  5C3R A;  2DCY A;  3WW2 A;  5JOX A;  2VW2 A;  3FFZ A;  3ON7 A;  2PHW A;  3EQE A;  1IPJ A;  4KG8 A;  5DDJ 2;  1HRI 3;  4Q1P A;  5I8S A;  3AB0 A;  4WZC A;  2WWS A;  4FP3 A;  1S4C A;  1S0F A;  3KV4 A;  3PUQ A;  1QH6 A;  3O0V A;  5H9R A;  1XYP A;  5CU1 A;  1JYT A;  3VDA A;  3ZSM A;  2YRO A;  4BIF A;  3IBM A;  4UT5 A;  3V65 A;  1UMZ A;  4B8E A;  3KT1 A;  3U14 A;  2EXH A;  3OOX A;  3OY8 B;  4KWU A;  4MSV A;  1AJO A;  2HWE 2;  2IVI B;  4RSU A;  2Q8C A;  4MG2 A;  1Y9M A;  3UT0 A;  1AR6 2;  4P9W A;  4RD7 A;  3LPG A;  2PHR A;  2ARB A;  4XMA A;  1ULE A;  3T0B A;  5A3M A;  2CU5 A;  4C90 A;  5JOW A;  1OKQ A;  1ULP A;  2RDN A;  3WF3 A;  5I0R A;  2DTW A;  3AM2 A;  3FLP A;  1MZ6 A;  1F31 A;  2XJV A;  5DAB A;  3RYP A;  4DXT A;  2JKX A;  2BWA A;  2D5H A;  3NKT A;  4CCC A;  1AR9 2;  5J48 A;  1OMI A;  2D5F A;  3WNM A;  4UI9 L;  1UWW A;  1GR3 A;  4CEW C;  1DIW A;  3NMB A;  3X29 B;  4N7U A;  2OYZ A;  4NJ4 A;  3T2P A;  2PLV 2;  2HH9 A;  1LOE A;  1UXX X;  2ADE A;  2HYK A;  2MEV 2;  4KQ7 A;  2OT7 A;  1ZZ8 A;  3AMN A;  4M01 A;  1G6N A;  3MIF A;  1D4M 1;  1FAY A;  3LE0 A;  2NYY A;  4XUT A;  2Y33 A;  1H30 A;  5T50 A;  3S7E A;  2ZML A;  4IEQ A;  3SHR A;  5JR2 A;  4YW3 A;  1XSR A;  5A3P A;  3KMH A;  4NAO A;  1W8W A;  3H50 A;  5ANN A;  3HQR A;  5IVF A;  3UYJ A;  1VB2 A;  4ARY A;  4TTG A;  4XDP A;  4DO0 A;  4AVT A;  1K45 A;  3NJY A;  3K4A A;  1W2A X;  1R08 3;  5FKB A;  4LQR A;  3VBS A;  3OBT A;  4EZH A;  5JIU A;  1NE4 A;  1NT0 A;  1POQ A;  2W2I A;  4LKS A;  2QQK A;  3OYW B;  2ENR A;  1F5J A;  3BTA A;  5LA2 A;  5DDJ 1;  4DIN B;  3L9J T;  4Q4W 3;  4R9D A;  2W91 A;  1UU5 A;  4LUK A;  3VZJ A;  4RQP C;  1CON A;  3UK9 A;  3MUZ 1;  2RM2 1;  4OUM A;  3Q8C A;  2V72 A;  4Y4Y A;  1OA2 A;  2YBK A;  5A32 B;  3ZN4 A;  5IK8 A;  4QGN A;  2EIG A;  4P5H A;  1AX2 A;  1WMX A;  5FXW A;  2Q1Z B;  2D93 A;  3D0S A;  1H8V A;  5CKN A;  3GCX A;  2VBB A;  4PIZ A;  2HWE 1;  5IAV A;  5K4L A;  1AR6 1;  3POE A;  1BMV 1;  2JD4 A;  4A4A A;  3SXW A;  5T5O A;  2FMY A;  5GZF A;  3ZYF A;  5D8A C;  1AR7 2;  4PIY A;  4YVS A;  2D98 A;  1W6M B;  3C7O A;  3ZFF A;  4CCN A;  3T0A A;  1RUH 2;  2XR4 A;  3OGS A;  4ISR A;  4XAB A;  3WW4 A;  4CDQ C;  3SH3 A;  2GC0 A;  2Q30 A;  2BVV A;  2CY6 A;  2PQQ A;  3DPR A;  3ETQ A;  3UJO A;  2WZR 2;  1DGW A;  4DZG A;  3ZDV A;  5BNP C;  1Q8V A;  1S0C A;  2R07 3;  4XIK A;  1LCL A;  3WP6 A;  1LB2 A;  1MZ5 A;  4JHT A;  2PLV 1;  3ETP A;  5FYC A;  3W21 A;  2EIE A;  4OCT A;  2CNA A;  3QBQ A;  1HB3 A;  1A78 A;  1KD7 A;  3D5O A;  4JRA A;  4KH9 A;  3Q8B A;  1MEC 2;  2H0V A;  5A6Z A;  4Q0V A;  1E5R A;  3VHO A;  2EAL A;  1ND3 C;  3RQ0 A;  4LHL A;  3T08 A;  3S5Q A;  3VBH B;  1RXG A;  2JB8 A;  3LDR A;  1XE8 A;  5FJH A;  3SNM A;  4DB5 A;  1UU6 A;  4IV3 C;  3HT1 A;  2RS1 2;  3ZO0 B;  4IXL A;  1VR3 A;  3T4H B;  5T5J A;  1VLN A;  5FZM A;  4A3X A;  3T09 A;  4JGZ A;  5A1L A;  2XUE A;  2FZ1 A;  2AYH A;  1GMM A;  2GC3 A;  2WT0 A;  1NYW A;  2ZA9 A;  3JUU A;  4HZF A;  4E27 A;  4LBQ A;  2OVU A;  1Y4W A;  1KGY A;  3CJI C;  3AFK A;  3QAC A;  1RMU 3;  4QHO A;  5AVA A;  1GWL A;  4XXA A;  3O1O A;  1NG0 A;  5BPX A;  5KXB A;  4XJW A;  1WWY A;  3HQX A;  4RS5 B;  2RV9 A;  3VV1 A;  5FCC A;  1UQX A;  2EIB A;  5I0D A;  2MNG A;  4OYU A;  1X36 A;  2ZGQ A;  5JXI A;  3OB8 A;  1LHV A;  3I97 A;  2ZPX A;  2XL7 A;  1QJU 1;  4F83 A;  2XGX A;  2PQS A;  2JDK A;  1AR7 1;  1FX5 A;  1AR8 2;  3KV5 A;  1OQE A;  1UU4 A;  4FPO B;  1AYN 3;  3RG0 A;  3E6C C;  3P6B A;  3PJY A;  2A75 A;  3T1M A;  3FHI B;  4Y4R A;  3QH6 A;  4Q4X 1;  1DF0 A;  1STM A;  3ZMO A;  4BQW A;  3CO2 A;  3BOW A;  3K48 A;  5DN2 A;  1ASJ 3;  1K5M C;  4UFM A;  2YU2 A;  5FZL A;  3ZIX A;  5BNN A;  1POV 1;  3O0W A;  5KHG A;  2YC2 A;  4H7L A;  3NKG A;  4Q4Y 3;  1I3H A;  4LR4 A;  3ITQ A;  1RUI 3;  5LK5 A;  1HX6 A;  1MEC 1;  4IES A;  1YI9 A;  2ZMK A;  1R1A 3;  4I0W B;  5FPB A;  2YUE A;  5JPM B;  4YZ2 A;  5F3I A;  2VZR A;  1VP6 A;  2R1B A;  2Y38 A;  5FP4 A;  3VZN A;  2QVS B;  1DQ2 A;  2RS1 1;  3O7O A;  4L0P A;  4EWA A;  3UES A;  2ZEX A;  1ACC A;  1PGW 2;  1GQH A;  1ZZ6 A;  3A0N A;  4IEX A;  4IGQ A;  4W8J A;  4OHZ A;  4MV2 A;  2K46 A;  3GZE A;  2VW1 A;  5A33 A;  3CBN A;  1Q5O A;  1W3V A;  1GZ9 A;  2A6X A;  3NQH A;  3VGI A;  3S57 A;  2BV4 A;  2BU9 A;  2XLF A;  5DG2 A;  3ES4 A;  4GZ9 A;  3VBU C;  1GNY A;  4FO9 A;  3NJV A;  4FPF A;  2R04 2;  4OHY A;  1LOB A;  1VAL A;  3D8C A;  2VNR A;  1GZW A;  2NMN A;  3EB7 A;  3WG2 A;  1N3P A;  4NRM A;  2QQM A;  1IZ3 A;  5EJ1 B;  2A6Z A;  2D3S A;  1UYZ A;  5BNO B;  1SDW A;  3KGL A;  3DXU A;  5FZB A;  3MLL A;  2QUO A;  1APN A;  1CAW B;  1GP5 A;  3DUI A;  5FY0 A;  5L36 A;  3HIF A;  4EV0 A;  1RC6 A;  2D6O X;  4QPI A;  4EN7 B;  4UFJ A;  5FYB A;  4LO8 A;  2Y6G A;  1AR8 1;  1JN2 P;  3HNB M;  3WDT A;  5LA0 A;  2YGM A;  3LD8 A;  3O1M A;  2D6P A;  1MAC A;  2VY0 A;  4OHW A;  4AFC A;  1AX0 A;  1T2X A;  4CEY A;  2OPW A;  1LOF C;  2ZAA A;  2W1S A;  1VRH 1;  4NWV A;  5JWP A;  2GDF A;  1DYO A;  1J3Q A;  2BBA A;  4N43 B;  3WF0 A;  4C0H A;  3ABZ A;  4K3U A;  2RE9 A;  4AHX A;  3HN1 A;  4RR3 A;  3WNL A;  1J59 A;  4WVV A;  3CQO A;  5HV0 A;  4ISQ A;  3RI9 A;  5C4W A;  1ZBE 3;  1N47 A;  4N53 A;  2PMW B;  1CN1 A;  5JMC A;  1W28 A;  4CXX A;  4YZ1 A;  1S0G A;  4BXS V;  1O3R A;  4AWD A;  2K0G A;  3O1V A;  1Z78 A;  1WUV A;  2KA3 A;  1JOP A;  1PVC 2;  3UL2 A;  1V0A A;  3UKN A;  2WA3 A;  3V64 A;  5IFT A;  1IS5 A;  3UKV A;  5APA A;  4MGI E;  2AEY A;  3CMG A;  2YXS A;  5HPO A;  2R30 A;  1PGW 1;  3NNJ A;  2CAV A;  2FBE A;  2TEP A;  3AXD A;  5T54 A;  3VZO A;  4CCO A;  3KVB A;  5DG1 A;  4LOS A;  2VME A;  3MDP A;  1HJF A;  1JHN A;  2JDH A;  3AL5 A;  1H2M A;  4GB3 3;  3AP4 A;  1LES A;  4IGP A;  1W9Y A;  4JDM A;  5CVR A;  2VZS A;  1D0G A;  2D44 A;  1BVV A;  1ZX5 A;  3FX3 A;  1UF2 C;  2B7Y A;  1GIC A;  4XJA A;  1TNF A;  4UF0 A;  3H8X A;  1GYK A;  2R04 1;  3JQW A;  2OA2 A;  3NNL A;  4FOV A;  1LAJ A;  3I59 A;  2FDK A;  3LOI A;  1XNA A;  4LEJ A;  3ZIW A;  5FOJ B;  4Y20 B;  1TMF 3;  4RFR B;  3JB4 C;  1J1L A;  2W68 A;  2WNV A;  4A42 A;  5FWJ A;  4RGG A;  1URX A;  3TBD A;  1HRI 2;  3CF6 E;  4QQO A;  4AEM A;  3TOJ A;  1MZE A;  3BCW A;  2UUR A;  2XVG A;  1TG7 A;  2G9G A;  1J3P A;  4H3W A;  3I2I A;  5L7O A;  1YFX A;  1ULG A;  1YJL A;  4N8M A;  4X8P A;  4CCJ A;  3RZJ A;  1W0O A;  2OUJ A;  2WAO A;  3ZR5 A;  1W2T A;  4ONU A;  5E6H A;  1H4H A;  1SHW B;  1WLW A;  5FZ1 A;  1NA1 A;  4AFB A;  4DQA A;  5IVV A;  4GXL A;  3NNM A;  1CR7 A;  5CB7 A;  4XF0 A;  5FBZ A;  5JZG A;  3NL1 A;  3ZYG A;  1OD5 A;  4U2A A;  3KWV A;  1GNZ A;  1PK6 B;  1SBF A;  1ENX A;  4I02 A;  4XUP A;  3SEE A;  1UN1 A;  3RWN A;  5CAD A;  4IE6 A;  1PNG A;  1S55 A;  5T52 A;  1BVP 1;  3OBR A;  3VKF C;  1NXD 1;  1REF A;  4QX7 A;  3T1L A;  1SLA A;  3TNP B;  4C1X A;  3BYW A;  4IE0 A;  4ZS2 A;  4JHZ A;  4PI0 A;  5EHD A;  1XU1 A;  1HQN A;  3FL7 A;  3MF9 A;  4XW3 A;  2NP0 A;  3USU A;  1MS3 A;  3ZYR A;  4UFK A;  4MXW A;  1W3X A;  2Z69 A;  5JDB A;  1TQ5 A;  1PVC 1;  1W6O A;  4R9B A;  3ZN5 A;  5FRE A;  3KD4 A;  1H2N A;  4IDZ A;  2FDH A;  4XBL A;  4M00 A;  1VBB 2;  4QPG B;  5GLW A;  4CDX B;  1PX4 A;  1C28 A;  2DBN A;  2VUL A;  1DQ1 A;  2XG3 A;  3III A;  3IMN A;  3Q8E A;  4EZ4 A;  4YVW B;  5A70 A;  1HXS 2;  1QF3 A;  2XJU A;  3QCW A;  2DVF A;  4HPK B;  3VBH C;  1YFW A;  1SQ4 A;  3H42 B;  3KV6 A;  4AXO A;  5CZK A;  3UV9 A;  3WNK A;  1MS5 A;  4FPC A;  5A3U A;  3W5M A;  2DVD A;  4AGV A;  3I3Q A;  4CPB D;  1XC6 A;  4BLI A;  5JMO A;  5ERL A;  1VRB A;  2XJT A;  5HBA A;  3J9S A;  4Q4W 2;  1HRI 1;  3ZR6 A;  2WDB A;  3IPV A;  4CTE A;  1US2 A;  3B01 A;  1CPN A;  2EAK A;  5FMO L;  1S0D A;  5LEK A;  1GU3 A;  2VUA A;  5DZG A;  1OHF A;  4MGK E;  2AC1 A;  3RZZ A;  5KHK A;  5DZF A;  1SLI A;  3RPQ A;  1HDK A;  1CQ9 A;  5K0U B;  1VIW B;  3MUY 1;  4FOY A;  4MH0 E;  4RS5 C;  1LGB A;  1W6P A;  4K20 A;  2DFC A;  2V09 A;  4OVE A;  2QE3 A;  1CAU B;  4Y5T A;  4BQ5 A;  1W0P A;  3WF4 A;  2RDQ A;  4IE4 A;  1CAX A;  1VB4 A;  5GZE A;  1AR9 3;  2R0H A;  5ABJ B;  2VGD A;  5L19 A;  5FR3 A;  3WLU A;  1ND2 B;  3M70 A;  2H0B A;  2R16 A;  3WCS A;  1EYB A;  2MEV 3;  4HK8 A;  3V0B A;  2P6C A;  1QIQ A;  1SAC A;  5GJ6 A;  1CD3 G;  2R07 2;  3A4U A;  3BKZ A;  3LPF A;  1NCQ B;  1Q8S A;  4GUL A;  5GAL A;  3LKJ A;  4IER A;  1VAM A;  5AFB A;  4LBJ A;  2DU1 A;  1O5U A;  3N7M A;  1QH7 A;  4BLJ A;  5KXD A;  1QJF A;  3K4Z A;  3RJR A;  1C5H A;  1NCR A;  1UNB A;  4AHZ A;  1KDM A;  5FZD A;  3MI8 A;  2PYT A;  2WNU A;  3GHM A;  3M3E A;  2PFW A;  2RS5 3;  1KJL A;  5BXX A;  5FLI A;  4D94 A;  3BI3 A;  1I6X A;  3O12 A;  5A7W B;  1R08 1;  4HKL A;  3AVS A;  3N9M A;  4NHL A;  3VHN A;  2A6Y A;  4IW3 A;  2QTW B;  2Z4F A;  4UXA A;  4IND A;  2VZP A;  2XBO 2;  3NJX A;  5LBF A;  1POV 0;  2ZHK A;  4TSV A;  4FOQ A;  5A3W A;  4Q4W 1;  3WQ7 A;  4N9I A;  4LK6 A;  4WVM B;  1RMU 2;  3HNY M;  1L7L A;  4BWO A;  4DS0 A;  1UXZ A;  1JU3 A;  4BK5 A;  4XC9 A;  3TEX A;  2VMH A;  3A22 A;  4V1P A;  4YM0 A;  1DDL A;  2Y64 A;  5FYM A;  1AR7 3;  2VE1 A;  4UBG A;  3NV2 A;  1PHM A;  2JG8 A;  1WW5 A;  3IN9 A;  5EYX A;  1KDK A;  5FZC A;  3HD8 B;  5BNO C;  4QGM A;  1RUH 3;  2B8M A;  1SPP B;  3LFM A;  4CEW B;  2PAM A;  4YG6 A;  1WLC A;  2Z79 A;  1FV3 A;  1AYN 2;  1F4H A;  2WZR 3;  3PVE A;  4W6W A;  5FP7 A;  3V56 A;  4BZ4 A;  2J22 A;  3CNA A;  1LOA A;  1QEX A;  4A7K A;  5LY1 A;  2HWF 3;  3U0Z A;  5J3U A;  1QXP A;  4URA A;  1YI7 A;  4QHZ A;  3B7M A;  1PZ9 A;  4LOT A;  4DY5 A;  3BUC A;  5FPV A;  3ACI A;  2R07 1;  4N43 C;  1DYP A;  1HRV 2;  4C8D A;  3VBO A;  2DCT A;  4UW6 A;  2JEC A;  1TE1 B;  2IUW A;  1F2N A;  3NWK A;  4PQ9 A;  2E32 A;  3Q8F A;  4Q4Y 2;  2A5Z A;  2B39 A;  3AYD A;  3SLI A;  4QPY A;  3WY6 A;  2OZ6 A;  2RS1 3;  2WYF A;  4BCU A;  4P5Y A;  1UX6 A;  3BOD A;  2QKD A;  3MV1 1;  1AL0 G;  3V0A A;  3EJK A;  4NIH A;  4AFD A;  2ERF A;  4YGB A;  2HYX A;  5F5Q A;  3CZU A;  2NMO A;  2QNK A;  3FZ3 A;  1MQT A;  4HK9 A;  2GMP A;  1QJZ A;  1SEF A;  3HMY A;  2OXB A;  1RUC 2;  2C9A A;  1LHU A;  2ZHM A;  1IOA A;  4TZD A;  2CGN A;  3D3A A;  1ULF A;  1XE0 A;  2Y8K A;  2WT2 A;  4ZY9 A;  2GAL A;  3MLJ A;  3NRU A;  2ATF A;  3VL8 A;  4FTB A;  2VTF A;  1RMU 1;  1GP4 A;  1O3T A;  1BKZ A;  2C9K A;  1MPX A;  2BEO A;  2ORX A;  3ZFE A;  3AZY A;  4ASM B;  5FYI A;  2G9F A;  1YNA A;  1OH4 A;  2HWD 2;  2V73 A;  1Q8P A;  2TUN A;  2W3J A;  3AKR A;  2ZEZ A;  4K7J A;  1G8W A;  1CJP A;  4XXP A;  3OGJ A;  1N3O A;  4LBL A;  4AEJ A;  1OSG A;  3HT2 A;  4YZ5 A;  5A6Y A;  3HEI A;  4UW4 A;  4N7I A;  4XZU G;  3VBF B;  1VAV A;  2VVE A;  2WWJ A;  1AYN 1;  3POG A;  3L2H A;  1UOF A;  3N9L A;  3NAP B;  3TNQ A;  1KEX A;  2UY9 A;  2WKK A;  4KGG A;  2PA7 A;  3K75 B;  4L97 A;  5F8P A;  4L92 A;  3CHX A;  2QQU A;  2OPK A;  3VUO A;  1ND3 B;  1UMH A;  4KWL A;  3GXU A;  5CAZ A;  2BOJ A;  5T3N A;  1PK6 C;  3ZFG B;  5KHI A;  1HRV 1;  1Q8Q A;  2PXJ A;  4Q0P A;  1ZBE 2;  1IG3 A;  5K9Y A;  3WP5 A;  2ZMN A;  4Q4Y 1;  4WM8 B;  5D8A A;  1RUI 1;  3I49 A;  2GNB A;  2RMU 2;  4XHX A;  3P3P A;  3WQ1 A;  4IQP A;  3ZXD A;  4GWI A;  1SBE A;  4OUL A;  5BV6 A;  4KG0 A;  3BVC A;  1UD1 A;  3MPB A;  3W9A A;  2D43 A;  2QZ2 A;  3JBG 3;  4CDQ A;  5FPU A;  1UMI A;  3H8R A;  2IXK A;  4AED A;  2WN2 A;  1OI6 A;  1E5H A;  2ADD A;  2R04 3;  1RUC 1;  1RTV A;  2VC9 A;  4QPG C;  2P3I A;  4LBN A;  4GB3 2;  4PBP A;  4AL9 A;  4BQ3 A;  4OHV A;  4CDX C;  3KT4 A;  5C3S A;  1SCR A;  4D8M A;  1VAK A;  4XFH A;  4XAA A;  2DWR A;  2BJS A;  3AYC A;  4JGY B;  2CV6 A;  1DYK A;  2YU1 A;  3GYD A;  4YVW C;  4QQP A;  4LO6 B;  2D7F A;  4QDQ A;  1CAV A;  3W20 A;  4AG4 A;  4IEU A;  4D6Q A;  4MGT A;  1QXJ A;  2W1U A;  3PVO A;  1DBN A;  1UIK A;  3S30 A;  4LHN A;  5CEH A;  3O14 A;  1J83 A;  2QDR A;  2XVK A;  4EJR A;  2NZ9 A;  4Y22 A;  3WSO A;  4HVO A;  1PNF A;  3VKL A;  2DUQ A;  3NV3 A;  5HCF A;  4CDW C;  1UOB A;  4E2S A;  2Z5W A;  3R05 A;  4FFH A;  2VU9 A;  3QH7 A;  2VCB A;  3I2D A;  1KS4 A;  1NAE A;  3PUR A;  4DUV A;  4EQV A;  2VW0 A;  1VBC 2;  3CJI A;  4YM3 A;  4XUN A;  5K0U C;  2CHH A;  5J09 A;  4AAP A;  4TLG A;  4CSW A;  4AQ6 A;  3E6B A;  3S6P A;  1RHI 2;  1V70 A;  3EHK A;  3MFC A;  4JX0 A;  4XE9 A;  2H6C A;  4Y33 A;  5A3N A;  3TYJ A;  2VMD A;  1CZS A;  4CP2 A;  4LHK A;  5ABJ C;  3R4S A;  1ZBE 1;  1OVP A;  1S2K A;  3PUI A;  4I3G A;  2J7M A;  3HN3 A;  1ND2 C;  4X8N A;  3B9I A;  2AEN A;  1REE A;  2YPJ A;  1KQR A;  5F39 A;  4AVV A;  5F3C A;  2RMU 1;  4DOU A;  2JEN A;  3MIH A;  4AAX A;  1LOG A;  2WAB A;  3PDQ A;  5A1A A;  1U12 A;  2A70 A;  4KNC A;  3RMY A;  2W95 A;  3RS6 A;  2ZS6 B;  1K42 A;  3T0D A;  3AL6 A;  3K77 A;  4FTS A;  1RJ8 A;  2HEV F;  3FWE A;  3ASI A;  4AE2 A;  4AHW A;  2BUK A;  4NN0 A;  1WBL A;  4BK4 A;  2VQA A;  3VN4 A;  3POS A;  1HQL A;  4GB3 1;  1R64 A;  1UOJ A;  1GNH A;  4HSJ A;  3RMX A;  1XYN A;  1NOV A;  4UYB A;  3WG4 A;  5C71 A;  2VO5 A;  1XOY A;  5DMY A;  4FOW A;  2VM9 A;  3BTX A;  2WSU A;  1ZZ7 A;  1ZA7 A;  1ULO A;  3IT8 A;  4QAW A;  1TMF 1;  3JZV A;  1UZ0 A;  4UWD A;  3MIC A;  2WII B;  4GQ7 A;  1GOG A;  4PJY A;  4XFA A;  4YGC A;  3GZU C;  1QDC A;  4LLF A;  1YXW A;  2Z2S B;  5C8C A;  3NNF A;  4XFG A;  3VKN A;  1H9W A;  3ZKU A;  2GAU A;  3LEI A;  3ZM8 A;  4CU7 A;  1FOD 2;  1LHO A;  1RIR A;  2E7A A;  1W04 A;  3LAG A;  3MF6 A;  1GOF A;  4Y5Z 0;  5D21 A;  1UY0 A;  2BNM A;  1D7P M;  1G9A A;  4M4P A;  5A6X A;  5K8S A;  1NZC A;  3K3O A;  5KBF A;  4CE8 A;  1VBC 1;  4NWW A;  2BYV E;  3WP3 A;  5C6C A;  1YO8 A;  1ZBA 3;  2VJX A;  2C24 A;  4XOG A;  1Z7S 2;  4J25 A;  5BNQ A;  2XWB B;  1V6O A;  1LRH A;  2RG4 A;  5F5A A;  4F8A A;  4YAR A;  4LXL A;  2R7E B;  1ZNP A;  3SIT A;  2KD7 A;  4LLO A;  2XHN A;  5F6L B;  3WCR A;  4E4S A;  5D1I A;  1WD4 A;  5F3E A;  1KIT A;  1W8H A;  4FPG A;  3WQ0 A;  1VBB 3;  3UGG A;  4FFG A;  2PAE A;  4M4R A;  1OOP A;  1ODM A;  2XJR A;  1WD3 A;  3EBR A;  4QD2 A;  2FCU A;  3S0M A;  2FDG A;  4NUB A;  1MR5 A;  2RS3 3;  1BXH A;  4OI2 A;  1OFN A;  1IS6 A;  1HXS 3;  1GZT A;  3IM0 A;  4K8F A;  4BA6 A;  4DXS A;  4FAH A;  2GP5 A;  3MW3 A;  4NIG A;  1VBE 2;  1QKQ A;  1W2N A;  1BK1 A;  3N9N A;  4XQD A;  2RS5 2;  4FVV A;  5CNA A;  2GND A;  2ZKN A;  1F15 A;  3U78 A;  3GHN A;  1DU3 D;  4JCK A;  2DVG A;  4XAC A;  3OD0 A;  3W5N A;  1RVF 3;  4FP2 A;  3ZYB A;  4CUA A;  1RJ7 A;  3GF6 A;  3MIB A;  3KZ4 C;  5FZ8 A;  2XB6 C;  2XHK A;  4YW6 A;  4BE3 A;  3U4S A;  5C3Q A;  2CL2 A;  5JCT A;  1GZC A;  4HAN A;  1RUG 2;  3POY A;  3MIG A;  1IQD C;  1HN1 A;  1YFU A;  2DYC A;  2CYF A;  3D6E A;  4YVS B;  3I2K A;  4O7X A;  2P4E A;  4UOJ A;  3N36 A;  3IMM A;  2JE7 A;  3LDK A;  1JUH A;  3WDX A;  1UPI A;  3WOG A;  1FT9 A;  5F37 A;  3DPR B;  1QWR A;  3AKT A;  1AYM 3;  4B4R A;  4AF9 A;  4QPW A;  3ZPY A;  4EN9 B;  2UWB A;  2FDJ A;  3ZXK A;  1MS8 A;  3VHP A;  1LGN A;  3E5U A;  4CP1 A;  2BZD A;  4E9K A;  3B94 A;  4COY A;  1AXK A;  4XFC A;  5A7P A;  1QDO A;  3RYK A;  1COV 3;  1SLT A;  1Z7S 1;  1AR9 1;  2PHX A;  3OD4 A;  4W65 A;  4YZ4 A;  5C9A A;  4K9S A;  5FXZ A;  3OYW A;  4ZZ5 A;  3NV4 A;  3VBF C;  3VDC A;  4CUG A;  2HWF 2;  2A6V A;  3PIJ A;  3C7E A;  3NAP C;  4LE4 A;  1QU0 A;  2MEV 1;  4CP9 B;  5AVP A;  1ST8 A;  2MHF A;  3QOP A;  3B69 A;  2BER A;  5FPZ A;  2DVA A;  5A3T A;  3IZO A;  1C5I A;  2X5I B;  1GP6 A;  1QJY 3;  3Q9O A;  1NY7 2;  1OQD A;  4JGZ B;  3LQC A;  3AK0 A;  1VBA 3;  3ZFG C;  2BBV A;  2VVF A;  2B46 X;  4RA0 A;  4V2W A;  1YRZ A;  4ET7 A;  2WO7 A;  3TWI A;  3WW3 A;  3FFQ A;  1O59 A;  4IV1 A;  4LBQ B;  4WM8 C;  5KWR A;  1VBE 1;  5A7N A;  4K40 A;  3RI8 A;  4O65 A;  5GZD A;  1WCU A;  1W6M A;  2RS5 1;  3BPZ A;  4ORF A;  1JH5 A;  4A6S A;  1OLM A;  2J1S A;  2XBO 3;  1NQD A;  3IKW A;  3THD A;  3WV6 A;  5IK7 A;  4S2H A;  1FNY A;  2BFU L;  5EQU A;  1IQA A;  3GDB A;  2D97 A;  4CCM A;  1HB1 A;  5FY5 A;  4EN8 B;  1U5X A;  4FPJ A;  3GGL A;  2YFU A;  1W05 A;  1YQC A;  4M3C F;  3J7N A;  4A44 A;  4KU8 A;  1N1S A;  1RUG 1;  4BXF A;  2HJI A;  5LW9 A;  1KXG A;  1VJ2 A;  2JG9 B;  4DUX A;  4MZU A;  4M0H A;  2JB4 A;  3AYE A;  3C3V A;  3N9O A;  4IEW A;  2QQI A;  2HLE A;  2XML A;  1JYN A;  3DV8 A;  4JGY C;  3LSE A;  5FY7 A;  4IEZ A;  3C7G A;  4B1M A;  2I2S A;  5KC5 A;  1AHS A;  3S5A A;  4HVR A;  2OQ6 A;  2JIG A;  4Q4V 3;  1KFU L;  3VBR B;  1M06 G;  1XNC A;  3GBW A;  2TNF A;  2IXH A;  4BMB A;  3BAL A;  1HB4 A;  5BNN B;  3GAL A;  4XDQ A;  1RUH 1;  2XUM A;  3K4D A;  1O4Y A;  5JLV A;  2YMZ A;  3FUO A;  5FZA A;  4P08 A;  1UAI A;  1H6X A;  1L7Q A;  3IDE A;  4XQ4 A;  2XLG A;  1X9P A;  2WZR 1;  5FY9 A;  3PIG A;  1LJ7 A;  5FO9 B;  4GD4 A;  1GSL A;  1JZ3 A;  1UKR A;  4JAA A;  2CGP A;  2HWF 1;  1LUL A;  1HRV 3;  3AZZ A;  3KHB A;  4GMP 3;  4P9L A;  4G3Y C;  1UYX A;  4NR1 A;  4DEV A;  2NPI A;  4ZXK A;  3ZMN A;  2P34 A;  3M2M A;  1HV0 A;  4LT5 A;  4RS5 A;  5ANQ A;  2ZKL A;  5EV7 A;  1QHD A;  1GLH A;  1YIP A;  1RXF A;  3PTY A;  2AR6 A;  3N35 A;  1QMJ A;  4M3C B;  2YPD A;  5A33 B;  1TVG A;  3OTF A;  3WNN A;  2HEY F;  2QQJ A;  1H9P A;  3OUI A;  4XFB A;  3VL9 A;  2ZX4 A;  5JOZ A;  2W92 A;  2BGP A;  2VZO A;  4P00 B;  5DAX A;  1CWP A;  1WW4 A;  3UJQ A;  2WNO A;  1GZW B;  2ZGK A;  2LAL A;  2W5F A;  5FYY A;  1RUC 3;  3JBG 2;  5F5I A;  1I9R A;  2YC4 A;  1W8F A;  1QY4 A;  1KJR A;  1PIV 3;  4FI9 A;  1S2B A;  5H9S A;  5IVE A;  1ZA4 A;  5FUN A;  1ZRE A;  1UKG A;  1W8T A;  4QX3 A;  3T30 A;  5GLT A;  3VHR A;  4QPI B;  1C1L A;  1K12 A;  4IET A;  4CU8 A;  2HWD 3;  3ZYH A;  4J1X A;  1C1F A;  1PVX A;  3VDB A;  3ZXL A;  2D3P A;  3MO4 A;  5DUX A;  1IHM A;  3VD4 A;  2VOV A;  2WLP A;  4MYE A;  1CZT A;  1UYP A;  1MVE A;  2MPF A;  5K7P A;  1WA4 A;  4IEO A;  1CVN A;  3ZN6 B;  4RR3 B;  2BGC A;  2J1T A;  2VCC A;  4TYS A;  1G9C A;  3T3Y A;  5JR7 B;  4MHU A;  3JD7 3;  2AZ5 A;  1HKD A;  4YW7 A;  1ZRD A;  1A3K A;  1MS9 A;  1AF9 A;  1RYY A;  3LIG A;  3SEP A;  4ZU7 A;  4Y1V A;  2WQ4 A;  2YBS A;  2LS6 A;  2IC1 A;  2W9X A;  4BDV B;  1RUE 3;  1Q56 A;  1QNY A;  5I8Y A;  1IPK A;  4RN5 A;  3R4D B;  5FLH A;  4KI5 M;  1NKG A;  4BB3 A;  4EWE A;  1AXZ A;  2RMU 3;  2WRA A;  3OGV A;  4DY3 A;  2A6W A;  1O8P A;  1PO1 2;  2W52 A;  2KM2 A;  4R9C A;  5LBE A;  5CFD A;  5GLV A;  4OQ8 A;  1PMH X;  1QOO A;  1CAW A;  1H1M A;  2WJS A;  5CIS A;  4BOW A;  2WAA A;  5LRS A;  4D7Y A;  2EVX A;  4YGD A;  4Q5O A;  3S7I A;  2A71 A;  4JKM A;  4BPZ A;  5E16 A;  3JBG 1;  4AVS A;  1PO2 2;  3AKP A;  4RL7 A;  1GQG A;  2WNV B;  5DAQ A;  1NZI A;  3DCQ A;  1GFF 2;  3H3U A;  4CXY A;  4RHV 3;  4GIQ A;  5J37 A;  4OI1 A;  5L7O B;  4JC1 A;  2ZBJ A;  1PM7 A;  2CWS A;  1E57 A;  2DFB A;  3A0K A;  1OLM E;  4XBQ A;  4ZU4 A;  1T6B X;  2UWC A;  2VMI A;  2Y6F A;  5IWF A;  5HCH A;  5I8T A;  3FLR A;  2EXJ A;  2DUO A;  1ZZC A;  1JYI A;  3NW4 A;  4X6R B;  4XCB A;  2OX0 A;  3FUQ A;  3POJ A;  2BWC A;  5LBB A;  5FY1 A;  3SH4 A;  5JZG B;  5J96 B;  3KCX A;  1BEV 2;  1F9K A;  5GM0 A;  4LA3 A;  3RZK A;  3APB A;  3DYP A;  3PUS A;  4YW1 A;  1VBC 3;  3THC A;  5CG9 A;  4YVS C;  3N4M A;  4DFS A;  4PLO A;  1OF4 A;  1BLZ A;  1RHI 3;  4B3N A;  5FXV A;  3VDD A;  3DPR C;  5IVC A;  4QQH A;  2ZEY A;  4L99 A;  5B2G B;  3MW2 A;  1ZBA 2;  4XDO A;  4MXV A;  1FPN 3;  1ULC A;  2WZ8 A;  3MLK A;  2GN3 A;  2CGO A;  1X7N A;  3FLT A;  3OF1 A;  4FPH A;  3MW4 A;  2XDV A;  4Y20 A;  4BH9 A;  2ZX1 A;  1JOD A;  1XPW A;  1PO1 1;  3GCW A;  3LF7 A;  3POB A;  4OQ9 A;  3SKV A;  4DNY A;  4E4D X;  2W1Q A;  1JU4 A;  3HWJ A;  3K3N A;  3LWC A;  3E6D A;  4XET A;  1OD3 A;  1JHJ A;  2VNV A;  2L9L A;  5L9B A;  4XJ9 A;  1CJD A;  2X5I C;  4XIO A;  1JXN A;  1OPM A;  2RS3 2;  4JGZ C;  4URT A;  5B4X A;  5BY5 A;  2J1R A;  3OJB A;  5DAW A;  2GN7 A;  1HN0 A;  2QJV A;  1K5J A;  4LHS A;  2XJS A;  4LKD A;  3TN9 2;  1B35 A;  1X8E A;  4KBB A;  3BN6 A;  3CLP A;  4LUM A;  4QM8 A;  3PLQ A;  1RVF 2;  1UZY A;  4FFF A;  4XYX A;  4JVA A;  3AFG A;  2GNT A;  4NID A;  2ZX0 A;  4CDW B;  2BOI A;  1V6L A;  1W6P B;  2EA7 A;  2D6K A;  2VG9 A;  5E88 A;  3WHU A;  3ZPO A;  2V4V A;  4AFA A;  1FOD 3;  2CTV A;  4D6S A;  1QQP 3;  3AP9 A;  1LOC A;  5I0U A;  1CAX B;  4CPB A;  3EMR A;  1S0I A;  1CIW A;  2JG9 C;  4Z07 A;  2DU0 A;  2FDF A;  4GH4 A;  5TSW A;  4FFI A;  5KXE A;  2B4K A;  2WSV A;  2XJP A;  3VD7 A;  4AFM A;  4CDX A;  1JMU B;  3J7M A;  1AYM 2;  5GKA C;  1RB8 G;  2BRT A;  3B93 A;  1EAH 2;  1Z7S 3;  4XFI A;  4YVW A;  5EWS A;  2O8O A;  2DDU A;  2HWC 2;  1RIT A;  1W6N A;  3AVR A;  1OXC A;  4HPK A;  3VBR C;  1IG0 A;  2JWP A;  4QX5 A;  4PDW A;  3D82 A;  1COV 2;  1ZBA 1;  2PHU A;  4QT6 A;  5BNN C;  4Y3O A;  2ZGR A;  3J4U H;  4YFZ A;  2P3K A;  3H7Y A;  3LEG A;  4IE5 A;  3J8F 2;  3O0X A;  1NCR B;  3ZYJ B;  2E6V A;  4PIX A;  4HON A;  5IAT A;  1DGL A;  1EV1 3;  2WNU B;  5A3O A;  4Y1X A;  3TEY A;  4EN6 B;  4YW2 A;  3NNG A;  5IHR A;  5J1X A;  3ECQ A;  2IZW A;  1RED A;  2HEW F;  4W50 A;  5FKC A;  5C5T A;  5GZC A;  3J7L A;  4WVW A;  4WV8 A;  4AYU A;  3KV9 A;  5KHJ A;  4Q8K A;  1H8T B;  1TNR A;  4FPY A;  1UY3 A;  1VBE 3;  1VBB 1;  1BZW A;  2E7Q A;  2X53 S;  4YSF A;  1QJY 2;  5FQ0 A;  3ACF A;  3H3Z A;  1GAN A;  2ZZJ A;  1VBA 2;  1LTE A;  1WW7 A;  1CGP A;  2ZTN A;  2RS3 1;  1HXS 1;  1WLT A;  2VTX J;  3RZM A;  4YNI A;  2J42 A;  4IL7 A;  1OLR A;  3LA3 A;  4QX1 A;  4MUV A;  5T5L A;  2ID4 A;  3MPP G;  4HVQ A;  3OUJ A;  3WQB A;  4AI9 A;  3DF0 A;  4H2A A;  1C8M 2;  5DUV A;  4IEP A;  1RUG 3;  5FO7 B;  3RFR A;  2Q1M A;  2YBP A;  4XQW A;  1Y7B A;  1RVF 1;  2RR1 2;  2LUW A;  2VMF A;  3ILR A;  5FPA A;  4CCD A;  2WA4 A;  2YV8 A;  3GJA A;  3LCP A;  3DXT A;  4ZON A;  5F5C A;  2X8K A;  5IJR A;  1A8M A;  1WKY A;  5E1R A;  1JOB A;  4Q0S A;  5KHH A;  4BU2 A;  1NCQ A;  2VMC A;  4LUL A;  2QQO A;  4AI0 A;  1H1A A;  1YQ2 A;  2QCS B;  5EXO A;  2VZT A;  2ZGU A;  3LDB A;  3P5B A;  4QPI C;  1PMJ X;  4OZX A;  4PLM A;  1O4T A;  1JZ8 A;  1WZX A;  3ZYI B;  2Y6H A;  3ATG A;  3N7J A;  4Q4V 2;  1LGC A;  1AYM 1;  4YGE A;  3N9Q A;  5FK7 A;  1EAH 1;  4QXC A;  1A34 A;  2GP3 A;  2FD8 A;  5CKM A;  2OS2 A;  2WL1 A;  2HWC 1;  3VKM A;  4BQ4 A;  5ACA 2;  1XNT A;  3VBO B;  4P02 B;  1CZV A;  4RR3 C;  1G86 A;  1O8S A;  1COV 1;  2WS9 3;  3GBF A;  1JBC A;  4NOT A;  1Q8O A;  3SCG A;  5C4W C;  1Q43 A;  1IPS A;  2F4L A;  4GJY A;  4MOA A;  3BTZ A;  5FMB A;  1W90 A;  2IFW A;  4XF9 A;  2XH6 A;  3H9A A;  1YJK A;  1PGL 2;  4NMI A;  1SLB A;  4UW3 A;  5JSO A;  3V0A B;  1J58 A;  4XFF A;  4I3P A;  2BP6 A;  1D2Q A;  1MQT B;  4QMA A;  3ELN A;  3TEZ A;  1PM4 A;  1TEI A;  3I7D A;  1QJY 1;  4AR2 A;  2B5H A;  1VBA 1;  1G9B A;  1D4V B;  3MGU A;  1UIJ A;  2FMD A;  3ZXF A;  4I0B A;  3AZX A;  2ARC A;  2AUY A;  3C2U A;  4CEW A;  1U5I A;  1YWK A;  2OUH A;  1DQ6 A;  4HOO A;  2R0F A;  3ZFE B;  2B9U A;  2I45 A;  4D6R A;  5FUP A;  4CDU B;  5CA6 A;  1PIV 2;  4YG3 A;  2XBO 1;  1US3 A;  4FBF A;  2GSY A;  2WQ8 A;  3KF5 A;  2RR1 1;  3P3N A;  2WNV C;  4NRO A;  2J1U A;  5JXH A;  1PZ8 A;  2ZGS A;  1SFN A;  1VBD 3;  5F7U A;  2ZHN A;  2BTV C;  4Y1U A;  1V6J A;  3OGR A;  5SV8 A;  1L3J A;  2ORZ A;  3KQR A;  5LEJ A;  1V9U 3;  2J1E A;  2ZOE B;  1QOT A;  3HAG A;  1AX1 A;  5L7O C;  3RJ2 X;  1E5I A;  4NRQ A;  1OC1 A;  1WMF A;  4LE3 A;  5IT6 A;  4ZZ8 A;  2O14 A;  2X09 A;  3BOP A;  4JKL A;  1J3R A;  2CAU A;  4K21 A;  1DQ0 A;  4KWK A;  4D69 A;  5HI0 A;  3WD5 A;  1FXZ A;  1CX4 A;  4Q4V 1;  2JE8 A;  2W46 A;  1OVS A;  4G4F A;  4KGQ A;  3AMQ A;  3E5Q A;  5JZG C;  2DCZ A;  3OPZ A;  4GWJ A;  5CFC B;  3ZSK A;  1WW6 A;  4RQP A;  1JS9 A;  2VNO A;  5FK8 A;  3B00 A;  4Z92 B;  3ZSJ A;  4OI4 A;  3E5X A;  4ITC A;  2GZW A;  2LRO A;  3WDY A;  5ISL A;  3EO6 A;  3JD7 2;  3N7K A;  3OUH A;  4YRD A;  4AQS A;  3MIE A;  4CCL A;  5FOB B;  4WM7 B;  1GKB A;  1HB2 A;  4BQ2 A;  3O1U A;  4MET A;  1JZ5 A;  1PGL 1;  2UYA A;  3KGZ A;  3H8U A;  3LGR A;  4GMP 1;  2WBK A;  2VMG A;  3WHT A;  2VUJ A;  1T6G C;  3O1T A;  4HSL A;  4ERO A;  1N1Y A;  1RUE 2;  3ALQ A;  3ILN A;  4AED B;  5FMD A;  1RUD 2;  2WUH A;  3B02 A;  1W2U A;  5A3L A;  4JDO A;  2B42 B;  3M1H A;  3U1X A;  2X05 A;  2ZGP A;  4RGA A;  1OA3 A;  2VR4 A;  5JPN B;  4FXK B;  3FHA A;  1AUY A;  3M3I A;  4MGZ E;  4Y1Z A;  5FRA A;  1S1A A;  5BNP A;  1A6C A;  1OA4 A;  2JIJ A;  3W59 A;  4MHR A;  3NAP A;  3PUA A;  2VNG A;  3ACL A;  5LB6 A;  3WT3 A;  1AL2 2;  2W0X A;  1PIV 1;  5FZ4 A;  3LEM A;  1UZW A;  2R1D A;  4P14 A;  4OI0 A;  3H1M A;  1ND3 A;  4GA9 A;  4RHV 2;  3OPW A;  1CIY A;  4P9J A;  5EFU A;  1O3Q A;  1UYY A;  1EPW A;  5IK4 A;  2X29 A;  4BQX A;  1CX1 A;  1M4W A;  2HWD 1;  2P37 A;  4IV3 A;  3UNP A;  3ES1 A;  5FYU A;  4L8Q A;  1FMD 3;  4GKY A;  1SFP A;  1UZV A;  3PNA A;  4LIU A;  4P9Y A;  4CVU A;  2E9Q A;  5CBL A;  4BQY A;  1B09 A;  1WCS A;  3BU0 A;  3ILF A;  2JX9 A;  1YEW A;  2PHT A;  3GBG A;  3WW1 A;  2YFZ A;  4JV4 A;  5FZO B;  1WCK A;  2ZGL A;  2IXI A;  3N9P A;  3WVJ A;  1HV1 A;  5JUV A;  2WYS A;  2ZAC A;  1OBN A;  3INA A;  3CU7 A;  1W6Q A;  3JD7 1;  5CG8 A;  1UX7 A;  1BQP A;  2WFF 2;  1ENR A;  1IS4 A;  1FI2 A;  1E5S A;  4COV A;  1PO1 3;  1SZB A;  3I2J A;  2WZE A;  1FPN 2;  1RUE 1;  3WNO A;  4E4Z A;  1FAT A;  2VZU A;  1RUD 1;  3KT7 A;  1LEN A;  5I0T A;  2E31 A;  1RGS A;  4UW5 A;  2JDU A;  1DGW X;  2O0O A;  3PVN A;  5F3G A;  3LOB A;  2ET1 A;  5GLU A;  4R4Z A;  1NCR C;  4D7S A;  4Q8L A;  3TEW A;  2FCV A;  4LO5 B;  4TN7 A;  1FYU A;  2IXJ A;  2WT1 A;  3AJZ A;  2WNU C;  1PO2 3;  3CIH A;  2R06 2;  1K5M A;  2XON A;  1DP0 A;  1HW5 A;  2DVB A;  3B5L B;  3SH5 A;  3WG1 A;  4XPV A;  4AGG A;  1BJQ A;  1H8T C;  4NRP A;  3CEW A;  4F7Z A;  3KSC A;  4HKO A;  3ZOI A;  4I30 A;  3H0O A;  4PHZ A;  1W0N A;  1W06 A;  5C8C B;  1D4M 2;  1NLQ A;  5FBJ A;  3TRS B;  4RHV 1;  4H14 A;  1U0A A;  4AZZ A;  1ALY A;  5CIR A;  3ZKY A;  2CSG A;  3BPS A;  5G05 L;  3URF A;  2W87 A;  5C3P A;  2JDM A;  4JRL A;  4L9B A;  4NHM A;  1BEV 3;  4D3W A;  1KS5 A;  4R4X A;  4TXW A;  5FZE A;  2WLQ A;  1WME A;  1PMI A;  3H1Y A;  2PN5 A;  4BJ0 A;  4NPM A;  2JG8 C;  2ZCW A;  5FXX A;  4A45 A;  1QQP 2;  3LZZ A;  1SLL A;  3OCP A; 
#chains in the Genus database with same CATH homology
 5FY9 A;  5FZ3 A;  2YU1 A;  2OX0 A;  4GD4 A;  4NUB A;  5FY1 A;  5K4L A;  5FZO A;  4D6Q A;  5FP8 A;  4UF0 B;  5FZG A;  5FP7 A;  3RVH A;  2GP5 A;  4AI9 A;  5CEH A;  3PUS A;  5LY1 A;  3N9N A;  5IVJ A;  2YBP A;  2P5B A;  4URA A;  5FZ7 A;  5ANQ A;  4QX8 A;  3U78 A;  5FPA A;  5F5C A;  5FPV A;  3DXT A;  2YPD A;  3DXU A;  5FXV A;  5FZB A;  4EZ4 A;  4BU2 A;  5FPL A;  5KR7 A;  5FZ8 A;  4BIS A;  3PUR A;  5FZC A;  3KV6 A;  3U4S A;  5FY0 A;  4C8D A;  4CCN A;  5IVC A;  3LDB A;  3PUA A;  5FYB A;  4QXB A;  5FWE A;  4QXH A;  4XDO A;  5FYC A;  3LD8 A;  4AAP A;  5FZ4 A;  2VD7 A;  5FYY A;  2XDV A;  5F5I A;  4CSW A;  4IGO A;  1VRB A;  3N9Q A;  3OPW A;  5FYT A;  4QXC A;  5IVE A;  2GP3 A;  5IVY A;  5FZA A;  5F37 A;  2OQ7 A;  2OS2 A;  4Y33 A;  3K3N A;  5FYZ A;  5A3N A;  5FJH A;  2XXZ A;  5FUN A;  5F2W A;  5FZ6 A;  5FV3 A;  5FYU A;  3KV4 A;  3PTR B;  3PUQ A;  5F39 A;  4V2V A;  3ZLI A;  5F3C A;  4LIU A;  4QWN A;  4GJY A;  5FZM A;  5A7P A;  5LWB A;  3PDQ A;  2XUE A;  4LIV A;  5FZH A;  5FP3 A;  5A1L A;  4E4H A;  4CCK A;  5F32 A;  4ASK A;  5FXZ A;  2Q8C A;  5FY4 A;  3AL6 A;  4CUG A;  5FZO B;  3N9P A;  5FYI A;  5A80 A;  5FP9 A;  5FZ9 A;  4CCO A;  5A3T A;  3KVB A;  5A7S A;  4IGP A;  3AL5 A;  3ZPO A;  5A7Q A;  4D6S A;  4V2W A;  5IW0 A;  5A7W A;  2WWJ A;  5FZI A;  4UF0 A;  3N9L A;  4HOO A;  5A7N A;  4D6R A;  2YBS A;  5FUP A;  3KVA A;  3KV5 A;  3PU3 A;  5F3G A;  2OT7 A;  5FZD A;  5FWJ A;  4TN7 A;  4Y4R A;  5FYH A;  5A1F A;  4EYU A;  5A3P A;  2WWU A;  4CCM A;  3AVR A;  3K2O A;  2YU2 A;  5FY5 A;  5FZL A;  4CCJ A;  2PXJ A;  5A7W B;  5LY2 A;  3K3O A;  3UYJ A;  5IVF A;  2Q8E A;  4BXF A;  4XDP A;  3AVS A;  3N9M A;  5FYS A;  5FZF A;  4DO0 A;  3NJY A;  2Q8D A;  5LW9 A;  4Y3O A;  5E6H A;  5F2S A;  5FZ1 A;  3N9O A;  4EZH A;  5IVV A;  5FZ0 A;  2XML A;  4GAZ A;  4HON A;  5FBJ A;  5FY7 A;  5A3W A;  2W2I A;  3OPT A;  5FPB A;  5FPU A;  5FJK A;  5F3I A;  2OQ6 A;  4LIT A;  5F5A A;  5A7O A;  5FP4 A;  4LXL A;  4GJZ A;  3KV9 A;  2YBK A;  5FZE A;  5FYM A;  5IVB A;  5FYV A;  5ISL A;  5IWF A;  4DIQ A;  4QU1 A;  4CCL A;  5FXX A;  4IGQ A;  5F3E A;  4QX7 A;  5FZK A;  3PU8 A;  5FY8 A;  5FXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...