5FR6A

The structure of polycomb uld complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
83
Chain Sequence
DDEIISLSIEFFKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYCOMB COMPLEX PROTEIN BMI-1
publication title Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 83
sequence length 105
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5fr6A00
2O6VB 1E8WA 1RRBA 2KWUB 4K7SA 3DVNV 2LUEA 3AU5A 2G4SA 4EUTA 1GUAB 4A3OA 4RM9A 2JUOA 3H7SA 2DYBA 2IO2B 3A1QA 4CO7A 5LXIB 2GBNA 4IM3A 2C7MB 3APFA 2K39A 2NR2A 2ZJDA 3R7RA 4WJOA 3DVNU 1WFYA 3DVGX 3ZTCA 4IM2A 4NJ6A 4EFOA 2CKHB 1SE9A 2KFKB 3A9JB 2NPTA 2J0KA 2KMCA 4MGKE 4HXDA 4FA6A 1YQBA 2MCNB 2HE7A 3PGEA 4WWOA 3WAOA 4DWFA 5EDSA 5JHBA 4DK5A 4IUMB 2LXCA 4ANUA 3N30A 1E5WA 1FXTB 4GDLA 4URKA 1L7YA 2KC2A 3KYDD 2KQSA 3L0WB 2BF8B 3PLVA 1WE7A 4B9KA 1V6EA 3AXCA 3SHQA 1H4RA 1EO6A 3JVZX 2ZEQA 3ZRCA 2BYFA 4IM0A 3ZLZA 1QZEA 2M17A 1YX5B 4GGQA 2IY1B 2JT4B 4XX5A 1ZKHA 3ZW3A 3DVGY 2HJ8A 3ENEA 4KDIC 3MJWA 3UINB 3RULA 4BBNC 2KN5A 4MGIE 4AOFA 4B95A 1JRUA 2KVRA 4BBNF 4DDGD 1V49A 4JL9A 4W9IA 1SGHA 2BKRB 2LI5A 3PV1A 1WF9A 1M94A 3V62A 2M0XA 2M1MA 3PSEB 2IZVB 1C3TA 3MTNB 3V6EB 3ML8A 3KVFB 2LGXA 2L0FA 5G55A 4CHKA 2PJHA 3ECIA 3BINA 3QA8A 1RAXA 4LJPB 2IBIB 2M4NA 4JQWC 4MJSB 4EZKA 5IA7A 3ZVVA 2GBKA 2JZZA 2NBVB 4KV2A 2JPHA 3DOWA 3A9JA 2KZRA 1OGWA 1P1AA 4GN1A 2O2VA 3D32A 2MBOA 2FIFA 4IWOA 3P2BA 1G6JA 3T9LA 2V1YA 2BWFA 3OJ3A 3UIPB 1NBFC 1OQYA 5D94A 3UGBB 4G0NB 3A4RA 2K25A 3EFUA 2NVUI 2NBWB 2Z0EB 4NAWA 1P9DU 1WGGA 2XEWA 4M8NA 4JGHB 1NDDA 2DAFA 2BGFA 4MGZE 1OEYJ 2N1VA 4DXAB 1E8ZA 3OAWA 4GOCA 3QK0A 4AJWA 4GDLB 1WM3A 2Y5BB 2MW5A 5E6PA 2KMAA 4II2B 2MQJA 3DBRI 4WAAA 4PYUA 1WGHA 2LJ5A 5CHVC 3L54A 1LM8B 2KWCA 2ZNVC 1TZ1A 3CMMB 4I6LB 3V60A 3X0WA 3UF8A 2FCMA 1WX8A 1KLVA 1Z5SB 4K7UA 1P3QU 1WH3A 2ZVOA 3NS8A 2KDEB 3APCA 4IG7B 2Z59B 3CSFA 1WXAA 3A9KA 3I3TB 2L3ZA 4JLCA 4W9KA 4X57B 3V61A 2DYMA 3TBLD 2CHWA 2Z0DB 3K9PB 1UZXB 3AU4A 2WYQA 4I6NB 4II3B 2M8SA 2KX0A 4GMVA 3ZIMA 3H6NA 1CMXB 1WYWB 3GZNI 4MJSA 3AULA 3IG3A 3ALBA 2KANA 2MBHA 2MLBA 2DZIA 1WXVA 2GMIC 2K6DB 2FCSA 1V80A 2KX3A 2MP2B 1UELA 4KDLB 3N3KB 3ZDMC 4ANVA 1YJ1A 4HDQA 2PPHA 1WGRA 2LRWA 4GDKA 2DYOA 4RM8A 5DPTA 4HPLB 4EKUA 2GOWA 2LGYA 4W9EA 4DHZE 3WALA 2J7QB 1ZW7A 5JHAA 4DHZB 5D6JB 1S3SG 4LCDE 3PRPB 2DZKA 2O2VB 2J0JA 4A3PA 1GG3A 1IYFA 3VUXA 3EHVA 2N4FA 2FCQA 1PQSA 3QJZA 1WI0A 4ZRKA 5CHFA 2KO3A 4LDTD 2REXA 1EUVB 3SU8X 3S2AA 1WZ3A 4BOSC 4NAWB 1WJUA 5G2NA 1IP9A 3BY4B 1Z2MA 4LDTB 2N7EA 4ZRJA 3K9OB 2KJ6A 3PS6A 1GC7A 3IVFA 4YL8A 1TGZB 4NQKE 5DPSA 1UBIA 2CHZA 2CHXA 3WA0A 4BVUC 1S1QB 5E6OA 2LVQA 2KD0A 3U7DA 4MDKE 1RLFA 3VTVA 4HCPB 3L08A 1E7VA 4E74A 3ZKJC 1GNUA 1BT0A 3O65B 4WWNA 2GBRA 2JZ3B 2L76A 2YVCA 2XK5B 3QCAA 1YD8U 1WGYA 2KTRA 1Q0WB 5LXHA 1WXSA 3U8ZA 4ZDVA 3ML9A 4HPMB 2L00B 3VXWA 3JSVB 1WXMA 4GU2A 2KNBA 4MSQB 4DDID 1J19A 5GMVA 1VCBA 1V9JA 3KUDB 1OEYA 2UWQA 2RD0A 3A9KB 5C23A 3KYCD 3RZFA 2K8CA 3TJPA 4A20A 4EEWA 2IYDB 3R3MA 4G11A 3DCGA 2DZMA 3OJ4B 2MP2A 3B08A 4FBJB 3DDCB 3GOEA 2IY0B 2L0TA 3AI5A 4N9F4 2ZZPB 1U4AA 3NOBA 4PYZA 3B0AA 3RD2A 2FIDA 4W9DA 4ZRIA 3ZUNA 4DBGA 1NI2A 2CR5A 3Q3FA 1R4NI 2JRHA 2OJRA 2WWZA 4HVBA 2KXJA 2MSED 4NNJB 2LWPA 4KVGB 4W9LA 3TL5A 2N9PC 4G50A 4FN2A 4GDKB 1J0GA 5TR5A 1TTNA 3IBEA 3PHWB 4F7ZA 3LJ3A 5CTRC 4WJPA 3WAMA 1D3ZA 2EKEC 2KLGA 1OTRB 2LZ6A 1H8CA 2LD9A 3TMPB 5J17A 3VQIA 2V4LA 4AP4C 5JZEB 1L2NA 4F1SA 3KUCB 2D07B 3WANA 3CF6E 3L17A 4FLHA 2RR9A 3ZNID 1WR6E 1WJ4A 2KKCA 3PT2B 4RMAA 3A33B 2KWVB 2XK5A 4MEMA 1V81A 4MM3A 2N9EB 1KOTA 2L7RA 3IHPC 4WWPA 3VHTC 2C9WB 2KQ7A 1GJZA 4IWPA 3C0RB 1UBQA 4PS8A 2QHOA 2GBJA 3W1SC 3JSVA 3PRZA 4BKSA 2K6QA 1K8RB 2MA9B 2ZPNA 2L05A 4TKNA 2NCNA 1WM2A 1WJNA 2KK8A 4FJYA 3QAQA 3NY5A 3V6CB 1LFDA 2K1FA 2JY6A 2KTRB 4FHKA 4DHJD 2MWSB 4FADA 3KW5B 4EZJA 3W1YA 2KJHB 2G45B 1KM7A 3H9DA 2W9NA 4DHJB 1I35A 2FNJB 5J2RA 2WDTB 4IW0A 1IPGA 1WRDB 4PS3A 4W9CA 4OVVA 3NZSA 2ASQA 1WZ0A 1XT9B 2B3AA 2OOBB 2C7NB 2MRPA 2JRIB 3VTUA 3ZO5B 5C1ZA 1WMHB 2V3SA 3QARA 4E3CA 1WJ6A 2D2QA 2KJRA 4W9JA 4FJVB 3ZRFA 5IAAC 3HM6X 4ANXA 4WJQA 4E71A 5DPWA 2KLCA 3NHEB 2DHZA 3H7PA 4M0WB 2KC1A 3PLUA 4MSMB 1E8YA 2EMTA 2D10A 4IC7B 4MGYE 3M3JA 2AL6A 3VFKA 2RPQA 4ICUA 5D7GA 2WX1A 3M62B 5AZGA 4W9FA 4MH0E 5DCNA 1GC6A 2JXXA 2KOXA 3R7QA 2LVOA 2A4ZA 4TUUA 4WJNA 2HTHA 2I1KA 1WX7A 5J18A 4TV3A 2R2QA 3UQAA 4NJ7A 4KZ0A 1XD3B 2JVCA 2C5LC 2FUHB 2KHWB 2KTFA 3PVLA 3PTFC 5AZHA 2KDIA 4IWQA 5KHOA 4W9HA 2N9XA 3L16A 3SDLC 3PPAA 4K81A 3SD5A 3DBSA 5JH5C 2G4DB 3PRMB 3KH0A 2KDBA 2ZCBA 4HWIB 3PREA 3QIJA 5BO4B 5L95C 2JF5A 3ZDTA 5L83A 1T0YA 2EMSA 1YX6B 4BKSD 5AZFA 4HLEA 3DPDA 4P7IA 3VUYA 2CU1A 3A4SC 4CYEA 5DPRA 2PE9A 2DENB 4KIKA 1ISNA 3IFWB 3WAPA 4HK2A 3EECA 1ZGUB 3DBLI 2K8BA 2BYVE 2LXAA 3RYTA 2ZNVB 3U30A 5KHQA 1WE6A 2DAJA 2GBMA 3JW0X 3RUIB 3HIZA 1E8XA 2KDFB 3VDZA 4XZ4A 2FAZA 2NS5A 1P0RA 1AARA 4K7WA 2MX2A 2WX0A 3VTWA 2JWZA 1P98A 1WMHA 3CSTA 1UGMA 4EZLA 3NZUA 1V5TA 3HK0A 3R66C 3TCAA 2PEAA 2RSUA 3VH4B 2K8HA 1Y8RC 2LVPA 2LRUA 1VD2A 2O6VA 2XBBC 3L13A 4HCNB 2G3QB 4NQLB 3VUWA 2D3GA 2KFJA 3QWZB 1V86A 3ZNZB 1MG8A 2J0MA 2N7DA 1UH6A 3DBHI 3KUZA 4KSKC 3N32A 3ZNHB 4G3XB 3Q3JA 4GSWA 2AWTA 1Q1OA 1X1MA 2N1WA 3ZNGC 4BOZB 2BYEA 3H7PB 1E7UA 4WQOB 2NBUA 4BKGA 3RT3B 1R4MI 1V5OA 3OLMD 1WR1A 3B1LX 3TIXA 4BKTA 2VRRB 2BPSA 1HE8A 3ZTDA 2I1JA 4NY0A 2ZCCA 1YIWA 2HD5B 4ANWA 2KFKA 3ONSA 2UYZB 3QC8B 4TQ0A 2R2OA 4NPNA 4GB9A 3A1QB 5FR6A 2AYOB 2PE6B 3JYUA 1EF1A 4AUQC 3APDA 1RFAA 4ASWC 2YLMA 2A5UA 2IO3B 2MBBB 3WIMA 5AEKB 4KSLC 5E6NA 1KJTA 1J8CA 4MELA 1UD7A 3EC8A 4KZCA 2AL3A 4AWJA 1A5RA 2NPTB 1TBEA 3RZWC 5CX3A 1LXDA 2RGFA 3PHXB 1F9JA 2IO1B 2LGDA 3RCZA 3T8MA 1WIAA 4FJZA 4LJOB 2MBEA 4I6PA 2L8JA 4ICVA 4M8MA 3X23A 3HHMA 3M95A 2FCNA 3W1SA 2LASA 4K1RB 4HJKA 4KIKB 3HM3A 5LLIA 3H1UA 3UIOB 1WGDA 2DZJA 2MBQA 1WY8A 3QX1A 4B6WA 3UQBA 4FHJA 4BFRA 3DQVA 3PZDA 1E90A 4PS7A 1LQBA 5D2MB 4HDOA 2BWES 4W9GA 3L10B 1V2YA 3QQ8B 4GIVA 4XC2A 3QHTA 4TQ1A 3VH3B 1C1YB 3LDZE 4OVUA 3VAWA 4FULA 4GXBA 1EF5A 5HKHA 1SIFA 4JIOU 4J6IA 2BKFA 2DX5B 2C60A 2ZPYA 3MHSD 2ZVNA 5CHWA 2D11A 4AJYB 4ZYNA 2O6VD 3VVWB 2CS4A 1XQQA 2C7HA 2AEHA 3M63B 4F8CB 1I42A 4EOYA 2IO0B 1Q5WB 1WX9A
chains in the Genus database with same CATH superfamily
1ESFA 1RRBA 4MT5A 2LUEA 2HJ1A 2G4SA 1BUIC 2OEDA 1JCKB 2JUOA 3H7SA 4ZHOA 3NJTA 5LXIB 3DBRB 3MP9A 5FR3A 3APFA 4WJOA 4M00A 4L23A 4IM2A 2KFKB 2KMCA 2MCNB 1RWSA 4LNIA 5EDSA 4DK5A 4IUMB 4GDLA 2KQSA 4WWMA 1V8CA 1WE7A 4B9KA 2LJIA 3BVZA 1FRRA 3Q69A 3B2GA 1ET9A 2IY1B 2ON8A 2M56B 3MJWA 4AOFA 1JRUA 2KVRA 4BBNF 4ITKA 1SGHA 2L1AA 4C80A 3V62A 2M0XA 3GE8C 3RI7C 3PSEB 3OWEB 3V6EB 4RCOA 2LGXA 4P6VF 2CJNA 4CHKA 2HDEA 2M4NA 1J7BA 4C7ZA 2NBVB 3MFGA 1MFWA 1JW9D 1OGWA 1P1AA 3D32A 2MBOA 3BVMA 2BWFA 3OJ3A 2WDRB 2K25A 2WXIA 2NBWB 4NAWA 1P9DU 3BYTB 3R2IA 2DAFA 2BGFA 2D3AA 4MGZE 1OEYJ 2N1VA 2WXRA 4YTNB 3QK0A 4AJWA 1YN4A 2Y5BB 1JWUD 2X38A 5TSSA 3ZJTA 2BVCA 1WSPA 5CHVC 1LM8B 1TJEA 1TZ1A 4I6LB 1WX8A 1WXQA 1HXYD 1Z5SB 5I4DA 4S0RA 2KDEB 3APCA 3CSFA 3A9KA 4ZOHC 3I3TB 5EE0A 3Q8CA 1QOAA 3K9PB 4II3B 1UZXB 4I6NB 1MI0A 4NAMA 2M8SA 1HTQA 4GMVA 3ZIMA 1CMXB 3GZNI 1ET6A 3IG3A 1C79A 2Y5PA 2PVOD 2K6DB 2KX3A 3AB5A 4US8A 1YJ1A 3B2FA 2WNMA 2LRWA 2DYOA 4RM8A 4HPLB 4CQNA 2JZPA 1PGAA 1KRHA 5D6JB 1HTOA 1S3SG 2DZKA 4A3PA 3VUXA 2N4FA 1RYJA 1T0QC 1CQVA 2BS3B 1I4XA 5G2NA 1QOBA 3BY4B 4LDTB 4KGTA 3K9OB 2HTME 1UBIA 2CHXA 5BYQA 3WA0A 1R7SA 1N5WA 5IOIA 3O65B 2YVCA 1WGYA 1WXSA 2QIEB 2BS4B 2WXHA 3AE6B 2J53A 4GU2A 4MSQB 4DDID 1GB4A 2UWQA 1BMLC 3AEDB 2IPKD 3DCGA 2DZMA 3HVZA 3AI5A 3NVWA 2KYWA 1VZ6A 4ACFA 2INCC 2CR5A 1FIQA 2JRHA 4HVBA 1TKYA 2MSED 4KVGB 2N9PC 1UWXA 5TR5A 5HHDG 3PHWB 4WIPA 1C76A 4US9A 3AEAB 5CTRC 4WJPA 3IAM1 2EKEC 5JZEB 3ZYYX 5HI1A 2D07B 3CF6E 2QC8A 2WXFA 1OQQA 1K50A 2KWVB 2XK5A 3KWVA 4MM3A 1KOTA 4WWPA 2C9WB 1DGJA 2J4XA 1GJZA 3C0RB 2BQQA 1MG4A 1IBXA 2L05A 3ETRA 3GE3C 1WJNA 2KK8A 2ZW1A 4FJYA 1L6VA 1XLOA 4ZYSA 4FHKA 4DHJD 5EE1A 2YEPF 4EZJA 2KJHB 2AQ2B 5J2RA 4IW0A 1JRPA 1WRDB 4PS3A 3MC0B 1VZ7A 1WZ0A 3U52E 1SE3A 4XDDA 2MRPA 2BTEA 1WMHB 1WJ6A 2D2QA 4FJVB 1FFVA 4E71A 5DPWA 2DHZA 2WXPA 4MSMB 2EMTA 4XYCA 2WX1A 5AZGA 4XGAB 4B0MA 2KOXA 4WJNA 1C4CA 3UQAA 4NJ7A 2KHWB 5AZHA 3PTFC 3L16A 1I4PA 3PPAA 4K81A 3SD5A 5JH5C 3KH0A 5BO4B 2EMSA 4BKSD 1L4ZB 3VUYA 1I7HA 2IGDA 2QMTA 1OFFA 1PUTA 1TT5B 3DBLI 5IO9A 1JWMD 3RYTA 1WE6A 2DAJA 2GBMA 3Q8FA 2KDFB 2FAZA 2WHIA 2MX2A 3VTWA 3HVDA 4EZLA 4ZRPA 3I9V1 1QKZA 3KWLA 2PEAA 4TSSA 1Y8RC 2ICIA 3L13A 2JU6X 2PLPA 2J0MA 1UH6A 1BXTA 1PYWD 4KKIA 1X1MA 1PGBA 2BYEA 4KGSA 1R4MI 3HUIA 2KFKA 3LB8C 4YSXB 2UYZB 1SJHD 3N20C 3JYUA 3RNCC 2DLBA 3WIMA 2I38A 5AEKB 5D3IB 4MELA 1ROEA 3OG5A 2NPTB 1I4RA 2QILA 3PHXB 3RCZA 3T8MA 4M8MA 3W9CB 3VRAB 1B9RA 4K1RB 1E10A 2N0SB 4HJGE 3HM3A 3ABVB 4B6WA 3UIOB 2DZJA 4BFRA 2LHEA 1TIFA 3PZDA 1R4NB 1V2YA 2K0PA 4PK1A 2QEJC 3BK2A 5H92C 4YTPB 1HEZE 5HKHA 1SIFA 1D5XC 2DX5B 2C60A 1N61A 2H89B 1I4QA 2V4IB 4EOYA 1WX9A 1UWMA 4K7SA 3DVNV 4LTUA 1FFUA 1ZE3D 2IO2B 4IM3A 1CZPA 2K39A 1MJDA 2E6XA 3R7RA 3ZTCA 3AEEB 1UUPA 4NJ6A 4HKZE 4EFOA 2CKHB 3A9JB 3P42A 2J0KA 4RGMA 3PZ8A 4REZA 4WWOA 2L32A 1FXTB 1CJEA 1L7YA 4YWGG 3L0WB 1V6EA 3AXCA 1HZ5A 1KH0A 2RMMA 1EO6A 2V3PA 2BYFA 3BZDB 4GGQA 2JT4B 4XX5A 3P63A 1L6UA 1F0ZA 1K51A 3Q8BA 4KDIC 3UINB 2YEPB 3RULA 4BBNC 4B95A 4MGIE 3U4EG 1TY0A 4RGTA 5BMHA 2QDFA 1WF9A 4DXFA 4RF0A 4RF1A 3CWIA 5G55A 3ECIA 1XXGA 4JQWC 4MJSB 3UI3A 3J9CA 4EZKA 4YSYB 1KLGD 2WLBA 4A9AA 1AW7A 4KV2A 3DOWA 2D3CA 2KZRA 1G6JA 4N58A 1NBFC 5D94A 3UGBB 2NVUI 2Z0EB 1F77A 2Z8LA 1WM3A 2MW5A 5E6PA 2KMAA 4JE3B 3DBRI 4WAAA 1T6BX 4PYUA 2LJ5A 1ZDVA 2BS2B 3SFDB 1XCQL 2WGSA 5HFYA 2FCMA 3WCQA 1VDVA 4K7UA 2W3RA 4LNNA 3BIID 3DBHB 2DYMA 2CHWA 3AU4A 4EE2A 3AH7A 2AQ1B 3NZ3A 3H6NA 4XWTA 1N60A 2KANA 3I5JC 2MLBA 5G5HA 1WXVA 2GMIC 3AEGB 1V80A 2MP2B 3C19A 2KAJA 2PPHA 3P1MA 1WGRA 1YN5A 2GOWA 1WGKA 4HKQA 2LGYA 2J7QB 2AX5A 4RGNA 3IT4B 2RDHA 2O2VB 1JQ4A 1GG3A 2JYEA 1IYFA 1SB3C 2FCQA 3C8YA 1IGCA 5CHFA 4TMAB 1EUVB 1WZ3A 2W55A 4H2AA 2INDC 2KJ6A 3PS6A 3IVFA 1S1QB 5E6OA 2KD0A 4MDKE 1RLFA 3L08A 3ZKJC 1GNUA 1XF5L 3Q6BA 2GBRA 2L76A 2MHJA 3QCAA 3ML9A 1YNTE 1AYFA 1RM6C 2KNBA 1J19A 1VCBA 2KACA 1OEYA 2RD0A 3I57A 3MJ5A 1WWTA 2K8CA 1NI3A 3R3MA 4N6EB 5E6JA 4FBJB 3B0AA 3RD2A 1DOYA 2FIDA 3ZUNA 2GRIA 1JROA 1PFDA 2OJRA 2LWPA 2NTTA 3DHIC 3TL5A 1KTKA 4JX1C 4G50A 1J0GA 3IBEA 4F7ZA 3LJ3A 1QF6A 5IP4D 1XLQA 2LD9A 4LNOA 2W54A 3VQIA 4P1CC 5J17A 2V4LA 3TEZA 1P7FA 3L17A 3TEWA 1K53A 3PT2B 4RMAA 2DBYA 1V81A 2N9EB 3IHPC 1OQRA 1DYQA 3JSVA 3LYYA 2LEKA 2K6QA 1K8RB 2PW9A 4OHJA 3NY5A 2K1FA 2WDVB 2BW2A 2KTRB 1FPYA 1QILA 2MWSB 2G45B 1KM7A 3H9DA 4DHJB 1I35A 2WDTB 1P7EA 1IPGA 4W9CA 4OVVA 1XT9B 2OOBB 3RNGC 4E3CA 2KJRA 3RNEC 3ZRFA 5IAAC 4J3OD 3HM6X 3AN1A 2J42A 3NHEB 3L4PA 4KKJA 4YT0B 3PLUA 2D10A 4IC7B 4MGYE 2JQRB 2AL6A 5AUKA 4ICUA 3M62B 4W9FA 4MH0E 5DCNA 1GC6A 3BWUD 3R7QA 4TUUA 4KGRA 4TV3A 2ONQA 2JVCA 1FCCC 4IWQA 3Q3OC 3SDLC 1UGJA 1QOFA 3PRMB 3NVZA 3PREA 3QIJA 2SEBD 5L95C 3ZDTA 5L83A 3NUHB 3O13A 4P7IA 2PTLA 4CYEA 5IN7A 1FRDA 3WAPA 4HK2A 3ZXVA 3DWGC 1ZGUB 1TS5A 2N9KA 3DHGC 3JW0X 1P0RA 1AARA 4K7WA 4RGOS 2JWZA 1L5PA 3P4PB 3HK0A 2JWUA 2W3SA 2Y3AA 3Q3MC 2K8HA 2LRUA 3VUWA 4YSZB 2VH1A 3ZNZB 1Y56A 3MHZA 1QQRA 1N6ZA 4G3XB 4GSWA 1NYRA 2N1WA 2K9XA 3H7PB 1E7UA 2PKOA 2LUMA 4BKTA 1L0XB 1HE8A 2I1JA 4NY0A 4GB9A 1N5XA 2AYOB 3APDA 4ASWC 1VJKA 1J8CA 1UD7A 2W82A 1FD6A 1TBEA 3RZWC 2RGFA 4WURA 1HZ6A 2IO1B 1WIAA 4LJOB 2MBEA 3X23A 3HHMA 2WU2B 2FCNA 3KLSX 4A90A 3AE9B 4KIKB 1WY8A 4FHJA 3DQVA 4PS7A 1LQBA 2MJ3A 4W9GA 5T8IA 3L10B 2FBWB 1XLPA 3QQ8B 3Q3NC 1YOVB 2V3NA 4TQ1A 4WH4A 3VH3B 3LDZE 3VAWA 4FULA 4J6IA 5CHWA 4BZAA 2FUG1 2D11A 4AJYB 2O6VD 3NVVA 5MPOA 1WYGA 4C56C 2IO0B 1E7VA 2H88B 1Q5WB 3VRBB 1EM7A 2EELA 3TSSA 2WXQA 3AU5A 2DNFA 1GUAB 2DYBA 3A1QA 1XO3A 1B1ZA 4AQ7A 1WFYA 2N9LA 1C77A 4A8XC 3RPFC 1SE9A 2PIAA 3Q8EA 4HXDA 1ZXIA 2HE7A 3PGEA 3WAOA 3N9YC 4DWFA 5JHBA 4ZHPA 4ANUA 1ZDXA 3N30A 1ACCA 4WQMA 2KC2A 2VZKD 1FXIA 3BVGA 3SHQA 3ZLZA 1QZEA 2BB6A 2M17A 1M4VA 4NJCA 3ZW3A 3DVGY 2HJ8A 3ENEA 2XNAC 1T0SC 3AE7B 1V49A 2D5GA 4W9IA 2BKRB 3PV1A 1M94A 1D4BA 3Q8AA 2DWQA 2KWDA 2PJHA 3BINA 4RH6A 2NMQA 3QA8A 1HA5A 1WRIA 4A55A 1RAXA 1XLNA 1DOIA 3DWMA 5IA7A 2INPE 2JZZA 2K22A 2WS3B 2IGHA 2O2VA 3GS2A 2FIFA 4IWOA 2V1YA 1YQ3B 3H8HA 1OQYA 2CJOA 3EFUA 3NVYA 4JGHB 4L1BA 3DBLB 4DXAB 1E8ZA 4XDCA 2MQJA 5FK9C 3L54A 2TSSA 1IUEA 2KWCA 1TKGA 3CMMB 3X0WA 1UF0A 1KLVA 1P3QU 1WH3A 1F52A 1SE2A 2Z59B 4MACA 1WXAA 4JLCA 3V05A 4W9KA 4X57B 4DXGA 2E3TA 3N1YC 2UU7A 1YN3A 1GOZA 4USAA 1R4MB 2K5PA 3AULA 3ALBA 2MBHA 1V1OA 4M01A 2DZIA 1TS3A 1UELA 3ZDMC 4ANVA 1MHHE 4HDQA 2JSVX 4BAXA 5DPTA 4EKUA 1DOXA 2GB1A 3E56A 1ZW7A 3R2TA 1Q10A 4DHZB 2GLSA 3PRPB 3EHVA 1PQSA 3QJZA 4YTMB 4ZRKA 2B76B 2KO3A 3W5UB 2REXA 2L52A 3S2AA 3SU8X 1WJUA 2N7JA 1Z2MA 2VH2A 3AE4B 2N7EA 4ZRJA 1C4PA 3FC4A 1GC7A 4YL8A 3AM9A 4HCPB 4S17A 5BYSA 4E74A 1YJIA 1BT0A 4WWNA 2JXTA 2JZ3B 2XK5B 1D5MC 3Q14C 2KTRA 5LXHA 3U8ZA 4ZDVA 3EUB2 2L00B 1CK1A 3VXWA 1WXMA 3GB1A 5GMVA 1V9JA 3KUDB 5C23A 3RZFA 4EEWA 3RN9C 4G11A 1JWBD 3B08A 3DDCB 3GOEA 5H8YE 2L0TA 4N9F4 2ZZPB 4LNFA 1U4AA 3NOBA 3N1XC 1T5XD 4ZRIA 4DBGA 3URYA 2RDGA 1HQRD 2OJWA 1TY2A 4FN2A 4GDKB 1TTNA 1L0VB 4Q2JA 3WAMA 1OTRB 2LZ6A 1H8CA 4HPPA 5LNK1 2WP9B 2BBCA 4F1SA 3KUCB 4OZBA 2Y5CA 3WANA 3ZNID 2RDBC 2KKCA 3EA6A 3GP7A 4D2KA 2ZW0A 2KQ7A 4IWPA 3U2SC 4PS8A 2QHOA 2GBJA 3I63C 4OVZA 4BKSA 1VRAB 1QT9A 4TKNA 2NCNA 3V6CB 1LFDA 2JY6A 1XCTL 2WXOA 4FADA 3RNFC 3KW5B 1FXAA 1TKEA 2W9NA 2K3UA 2ASQA 2B3AA 2C7NB 5EE9A 5C1ZA 2WXNA 2BYTA 1ZPSA 4W9JA 1SEBD 4NZLB 4ANXA 2KLCA 4M0WB 3H7PA 2KC1A 1E8YA 2G1EA 2LGIA 2FE8A 2JXXA 1L4DB 2A4ZA 2LVOA 4HRSA 3ZQ4A 2I1KA 4C4VB 1WX7A 4KZ0A 1XD3B 1V97A 2C5LC 3PVLA 4W9HA 3AEBB 3DBSA 1TZOA 1V1PB 3TEXA 2KDBA 2NTSA 2JF5A 1YX6B 4HLEA 2CU1A 2XN9C 3A4SC 2PE9A 4FXCA 2DENB 1NEKB 4KIKA 3RNBC 3AE3B 5BYRA 3EECA 3VR9B 1LGRA 5HG2A 2SAKA 2BYVE 2ZNVB 1SJED 1F2RC 3RUIB 1GAQB 3VDZA 4XZ4A 2WX0A 1WMHA 1FO4A 1UGMA 3NZUA 4KX6B 3R66C 4IDIA 2RSUA 2LVPA 1VD2A 2XBBC 4HCNB 2G3QB 2D3GA 2KFJA 3QWZB 1V86A 1KF6B 4JWSC 3KUZA 3N32A 3ZNHB 3KQ4A 3Q3JA 1VLBA 2KT7A 1E9MA 3MC9A 5C2TB 1Q1OA 4BOZB 2NBUA 1V5OA 1WR1A 3ZTDA 3W2DA 2HD5B 4ANWA 3ONSA 1PGXA 3QC8B 2R2OA 1C78A 4AUQC 2IO3B 1KJTA 3EC8A 4KZCA 3IAS1 2AL3A 1A5RA 5CX3A 1LXDA 4XWWA 3RNAC 2QSDA 4FJZA 4I6PA 2L8JA 1VR9A 4GLSC 2LASA 5C3JB 1K52A 3P4QB 4HJKA 5LLIA 3UQBA 3QX1A 1ZP0B 2AQ3B 4XC2A 3QHTA 3AE1B 1C1YB 1EU3A 4OVUA 4B0EA 1FEHA 4ZYNA 1XQQA 2C7HA 2AEHA 4OW0A 4F8CB 2O6VB 1E8WA 2KWUB 5JXVA 2EKIA 4LK0M 2LHDA 1C9FA 4EUTA 4A3OA 4RM9A 2MEKA 3BK1A 4CO7A 2BT6A 2GBNA 2C7MB 1PDXA 2NR2A 2ZJDA 3DVNU 3DVGX 4R3DA 2CU3A 3NG0A 1I4GA 4QAYA 2NPTA 4MGKE 4ZRQA 4FA6A 1YQBA 4OZAA 4OZCA 2LXCA 4HEA1 2Q5WD 4A6QA 1E5WA 2L83A 4URKA 4K3BA 3AECB 3KYDD 2GI9A 2BF8B 3PLVA 1NVID 5FKAC 3FILB 3GZNB 2VZKB 1H4RA 3JVZX 2ZEQA 3ZRCA 4IM0A 1YX5B 1ZKHA 3CIRB 2KN5A 3ZGZA 4DDGD 4ARIA 4JL9A 3MC8A 1FNUA 2LI5A 2MH7A 1L0YB 1EU4A 2M1MA 2IZVB 1C3TA 1EWCA 3MTNB 3ML8A 3KVFB 4M02A 2L0FA 1RFKA 3AMZA 1N63A 4LJPB 3TEYA 2IBIB 3AE8B 1YMHE 4LNKA 5AUIA 4UDUC 1N62A 3ZVVA 2GBKA 2KN4A 2JPHA 3A9JA 4GN1A 1D6EC 3P2BA 2KMMA 3T9LA 3LXFA 4XE0A 3UIPB 1JWAD 4G0NB 3A4RA 3AEFB 1J7AA 1WGGA 4MH8A 2XEWA 1KLUD 4M8NA 2JYTA 1NDDA 1ZUD2 2RPVA 3OAWA 3IT6B 4GOCA 1FCLA 4GDLB 4II2B 2WXJA 3B9JA 1WGHA 5G5GA 2ZNVC 5D3DA 3V60A 3UF8A 2M0AA 2ZVOA 3E9SA 2KVZA 2ACZB 3NS8A 4IG7B 2WU5B 2L3ZA 5BMGA 3V61A 3AV8A 3TBLD 1SXTA 2Z0DB 1J7CA 2WYQA 2KX0A 1FMAD 1WYWB 3T3NA 1A70A 4MJSA 2WXMA 2FCSA 5GXGB 4KDLB 2M19A 3N3KB 4RNAA 1SBBB 4GDKA 1VZ8A 4C7YA 4W9EA 4DHZE 3WALA 5JHAA 4DQOC 4LCDE 2J0JA 3ZXRA 2KQ4X 1WI0A 3NS1A 4LDTD 5EE3A 4BOSC 2PMVA 4NAWB 1IP9A 3N1ZC 3R8BA 3TUOA 4BVUC 1STEA 1TGZB 4NQKE 5DPSA 2CHZA 3BYYB 2LVQA 4P16A 4AS1A 3U7DA 1JALA 3VTVA 3SEBA 2INNE 1YD8U 1Q0WB 1E7PB 3IXSA 1T3QA 2V9HA 4HPMB 1ZXHA 1UNSA 2X8XX 3JSVB 1QLBB 1JWSD 4WAFA 3A9KB 4A20A 3KYCD 3ZJVA 3TJPA 2IYDB 2LGSA 1MHXA 3P4SB 1KFYB 3OJ4B 2MP2A 2IY0B 4PYZA 2WQYB 3DHHC 4O1NA 4W9DA 1NI2A 1I4HA 3Q2AC 3Q3FA 1R4NI 4M0WA 2WDQB 2WWZA 2KXJA 4NNJB 1NYQA 4W9LA 2BB5A 5BMIA 1F2RI 2MJDA 4C4VA 1D3ZA 2KLGA 5IKCM 1NENB 2KDMA 3TMPB 2V0GA 1QOGA 1T0RC 4AP4C 1TS4A 3ZJUA 1L2NA 4FLHA 4L2YA 1V1PA 2RR9A 1WR6E 1WJ4A 3SFEB 3A33B 4MEMA 1LO5D 2QJLA 2L7RA 3VHTC 1UBQA 2I2YA 2IDYA 3W1SC 3PRZA 2IJ0A 1XEEA 2MA9B 2D3BA 2ZPNA 1WM2A 1YJJA 4JPSA 3QAQA 1AWDA 1GB1A 3W1YA 2PVGC 3FAHA 2FNJB 1FNWA 4C00A 4LLGM 3NZSA 1F1HA 2LMCA 2JRIB 3VTUA 3ZO5B 2V3SA 3QARA 3RFZB 4N59A 3HRDD 4WJQA 1FNVA 1JMLA 2OHFA 1SSNA 1MVKA 3M3JA 3VFKA 2RPQA 1AN8A 5D7GA 3VR8B 1C4AA 2HTHA 5J18A 3PZ7A 2R2QA 2G9HD 3EGRA 2FUHB 5KHOA 2KTFA 2KDIA 2N9XA 2G4DB 2MJEA 4K3CA 3EFCA 3FKYA 2ZCBA 4HWIB 4MM3B 1FM0D 1E0ZA 1T0YA 4IKGA 5AZFA 3DPDA 4HROA 5DPRA 1ISNA 1IBXB 3IFWB 1EWYC 3W5VB 2K8BA 2LXAA 3U30A 5KHQA 3T3OA 4P1BC 3HIZA 1E8XA 2LFIA 2NS5A 2R61A 3CSTA 1P98A 2WXGA 1V5TA 3TCAA 1D5ZC 3U7ZA 3VH4B 2O6VA 4NQLB 2IGGA 1SE4A 1MG8A 2N7DA 3DBHI 4KSKC 4PT5A 1GPXA 2AWTA 3ZNGC 3NRZA 2J52A 4BKGA 4WQOB 3RT3B 2WXKA 3OLMD 3B1LX 3TIXA 4JWUC 2VRRB 2BPSA 4RFBA 3SR6A 2ZCCA 1YIWA 4ARCA 4TQ0A 4NPNA 3A1QB 5FR6A 2PE6B 1EF1A 1TS2A 2QCZA 1RFAA 1SIJA 2YLMA 2A5UA 1SF0A 2MBBB 4KSLC 5E6NA 3AE2B 4AWJA 1TYGB 3FILA 1F9JA 2LGDA 4ICVA 3M95A 3W1SA 3P4RB 3V3XA 2JX5A 3H1UA 1IGDA 1WGDA 2MBQA 4YXDB 1ZOYB 1E90A 5D2MB 4HDOA 2BWES 1E6EB 1YQ4B 3PO0A 4GIVA 1MPEA 3RMKC 1ENFA 4GXBA 1EF5A 4JIOU 2BKFA 2ZPYA 3MHSD 2ZVNA 3VVWB 2CS4A 4IOIE 2WXLA 3M63B 1I42A 3AE5B
chains in the Genus database with same CATH topology
2O6VB 1E8WA 1RRBA 2KWUB 4K7SA 3DVNV 2LUEA 3AU5A 2G4SA 4EUTA 1GUAB 4A3OA 4RM9A 2JUOA 3H7SA 2DYBA 2IO2B 3A1QA 4CO7A 5LXIB 2GBNA 4IM3A 2C7MB 3APFA 2K39A 2NR2A 2ZJDA 3R7RA 4WJOA 3DVNU 1WFYA 3DVGX 3ZTCA 4IM2A 4NJ6A 4EFOA 2CKHB 1SE9A 2KFKB 3A9JB 2NPTA 2J0KA 2KMCA 4MGKE 4HXDA 4FA6A 1YQBA 2MCNB 2HE7A 3PGEA 4WWOA 3WAOA 4DWFA 5EDSA 5JHBA 4DK5A 4IUMB 2LXCA 4ANUA 3N30A 1E5WA 1FXTB 4GDLA 4URKA 1L7YA 2KC2A 3KYDD 2KQSA 3L0WB 2BF8B 3PLVA 1WE7A 4B9KA 1V6EA 3AXCA 3SHQA 1H4RA 1EO6A 3JVZX 2ZEQA 3ZRCA 2BYFA 4IM0A 3ZLZA 1QZEA 2M17A 1YX5B 4GGQA 2IY1B 2JT4B 4XX5A 1ZKHA 3ZW3A 3DVGY 2HJ8A 3ENEA 4KDIC 3MJWA 3UINB 3RULA 4BBNC 2KN5A 4MGIE 4AOFA 4B95A 1JRUA 2KVRA 4BBNF 4DDGD 1V49A 4JL9A 4W9IA 1SGHA 2BKRB 2LI5A 3PV1A 1WF9A 1M94A 3V62A 2M0XA 2M1MA 3PSEB 2IZVB 1C3TA 3MTNB 3V6EB 3ML8A 3KVFB 2LGXA 2L0FA 5G55A 4CHKA 2PJHA 3ECIA 3BINA 3QA8A 1RAXA 4LJPB 2IBIB 2M4NA 4JQWC 4MJSB 4EZKA 5IA7A 3ZVVA 2GBKA 2JZZA 2NBVB 4KV2A 2JPHA 3DOWA 3A9JA 2KZRA 1OGWA 1P1AA 4GN1A 2O2VA 3D32A 2MBOA 2FIFA 4IWOA 3P2BA 1G6JA 3T9LA 2V1YA 2BWFA 3OJ3A 3UIPB 1NBFC 1OQYA 5D94A 3UGBB 4G0NB 3A4RA 2K25A 3EFUA 2NVUI 2NBWB 2Z0EB 4NAWA 1P9DU 1WGGA 2XEWA 4M8NA 4JGHB 1NDDA 2DAFA 2BGFA 4MGZE 1OEYJ 2N1VA 4DXAB 1E8ZA 3OAWA 4GOCA 3QK0A 4AJWA 4GDLB 1WM3A 2Y5BB 2MW5A 5E6PA 2KMAA 4II2B 2MQJA 3DBRI 4WAAA 4PYUA 1WGHA 2LJ5A 5CHVC 3L54A 1LM8B 2KWCA 2ZNVC 1TZ1A 3CMMB 4I6LB 3V60A 3X0WA 3UF8A 2FCMA 1WX8A 1KLVA 1Z5SB 4K7UA 1P3QU 1WH3A 2ZVOA 3NS8A 2KDEB 3APCA 4IG7B 2Z59B 3CSFA 1WXAA 3A9KA 3I3TB 2L3ZA 4JLCA 4W9KA 4X57B 3V61A 2DYMA 3TBLD 2CHWA 2Z0DB 3K9PB 1UZXB 3AU4A 2WYQA 4I6NB 4II3B 2M8SA 2KX0A 4GMVA 3ZIMA 3H6NA 1CMXB 1WYWB 3GZNI 4MJSA 3AULA 3IG3A 3ALBA 2KANA 2MBHA 2MLBA 2DZIA 1WXVA 2GMIC 2K6DB 2FCSA 1V80A 2KX3A 2MP2B 1UELA 4KDLB 3N3KB 3ZDMC 4ANVA 1YJ1A 4HDQA 2PPHA 1WGRA 2LRWA 4GDKA 2DYOA 4RM8A 5DPTA 4HPLB 4EKUA 2GOWA 2LGYA 4W9EA 4DHZE 3WALA 2J7QB 1ZW7A 5JHAA 4DHZB 5D6JB 1S3SG 4LCDE 3PRPB 2DZKA 2O2VB 2J0JA 4A3PA 1GG3A 1IYFA 3VUXA 3EHVA 2N4FA 2FCQA 1PQSA 3QJZA 1WI0A 4ZRKA 5CHFA 2KO3A 4LDTD 2REXA 1EUVB 3SU8X 3S2AA 1WZ3A 4BOSC 4NAWB 1WJUA 5G2NA 1IP9A 3BY4B 1Z2MA 4LDTB 2N7EA 4ZRJA 3K9OB 2KJ6A 3PS6A 1GC7A 3IVFA 4YL8A 1TGZB 4NQKE 5DPSA 1UBIA 2CHZA 2CHXA 3WA0A 4BVUC 1S1QB 5E6OA 2LVQA 2KD0A 3U7DA 4MDKE 1RLFA 3VTVA 4HCPB 3L08A 1E7VA 4E74A 3ZKJC 1GNUA 1BT0A 3O65B 4WWNA 2GBRA 2JZ3B 2L76A 2YVCA 2XK5B 3QCAA 1YD8U 1WGYA 2KTRA 1Q0WB 5LXHA 1WXSA 3U8ZA 4ZDVA 3ML9A 4HPMB 2L00B 3VXWA 3JSVB 1WXMA 4GU2A 2KNBA 4MSQB 4DDID 1J19A 5GMVA 1VCBA 1V9JA 3KUDB 1OEYA 2UWQA 2RD0A 3A9KB 5C23A 3KYCD 3RZFA 2K8CA 3TJPA 4A20A 4EEWA 2IYDB 3R3MA 4G11A 3DCGA 2DZMA 3OJ4B 2MP2A 3B08A 4FBJB 3DDCB 3GOEA 2IY0B 2L0TA 3AI5A 4N9F4 2ZZPB 1U4AA 3NOBA 4PYZA 3B0AA 3RD2A 2FIDA 4W9DA 4ZRIA 3ZUNA 4DBGA 1NI2A 2CR5A 3Q3FA 1R4NI 2JRHA 2OJRA 2WWZA 4HVBA 2KXJA 2MSED 4NNJB 2LWPA 4KVGB 4W9LA 3TL5A 2N9PC 4G50A 4FN2A 4GDKB 1J0GA 5TR5A 1TTNA 3IBEA 3PHWB 4F7ZA 3LJ3A 5CTRC 4WJPA 3WAMA 1D3ZA 2EKEC 2KLGA 1OTRB 2LZ6A 1H8CA 2LD9A 3TMPB 5J17A 3VQIA 2V4LA 4AP4C 5JZEB 1L2NA 4F1SA 3KUCB 2D07B 3WANA 3CF6E 3L17A 4FLHA 2RR9A 3ZNID 1WR6E 1WJ4A 2KKCA 3PT2B 4RMAA 3A33B 2KWVB 2XK5A 4MEMA 1V81A 4MM3A 2N9EB 1KOTA 2L7RA 3IHPC 4WWPA 3VHTC 2C9WB 2KQ7A 1GJZA 4IWPA 3C0RB 1UBQA 4PS8A 2QHOA 2GBJA 3W1SC 3JSVA 3PRZA 4BKSA 2K6QA 1K8RB 2MA9B 2ZPNA 2L05A 4TKNA 2NCNA 1WM2A 1WJNA 2KK8A 4FJYA 3QAQA 3NY5A 3V6CB 1LFDA 2K1FA 2JY6A 2KTRB 4FHKA 4DHJD 2MWSB 4FADA 3KW5B 4EZJA 3W1YA 2KJHB 2G45B 1KM7A 3H9DA 2W9NA 4DHJB 1I35A 2FNJB 5J2RA 2WDTB 4IW0A 1IPGA 1WRDB 4PS3A 4W9CA 4OVVA 3NZSA 2ASQA 1WZ0A 1XT9B 2B3AA 2OOBB 2C7NB 2MRPA 2JRIB 3VTUA 3ZO5B 5C1ZA 1WMHB 2V3SA 3QARA 4E3CA 1WJ6A 2D2QA 2KJRA 4W9JA 4FJVB 3ZRFA 5IAAC 3HM6X 4ANXA 4WJQA 4E71A 5DPWA 2KLCA 3NHEB 2DHZA 3H7PA 4M0WB 2KC1A 3PLUA 4MSMB 1E8YA 2EMTA 2D10A 4IC7B 4MGYE 3M3JA 2AL6A 3VFKA 2RPQA 4ICUA 5D7GA 2WX1A 3M62B 5AZGA 4W9FA 4MH0E 5DCNA 1GC6A 2JXXA 2KOXA 3R7QA 2LVOA 2A4ZA 4TUUA 4WJNA 2HTHA 2I1KA 1WX7A 5J18A 4TV3A 2R2QA 3UQAA 4NJ7A 4KZ0A 1XD3B 2JVCA 2C5LC 2FUHB 2KHWB 2KTFA 3PVLA 3PTFC 5AZHA 2KDIA 4IWQA 5KHOA 4W9HA 2N9XA 3L16A 3SDLC 3PPAA 4K81A 3SD5A 3DBSA 5JH5C 2G4DB 3PRMB 3KH0A 2KDBA 2ZCBA 4HWIB 3PREA 3QIJA 5BO4B 5L95C 2JF5A 3ZDTA 5L83A 1T0YA 2EMSA 1YX6B 4BKSD 5AZFA 4HLEA 3DPDA 4P7IA 3VUYA 2CU1A 3A4SC 4CYEA 5DPRA 2PE9A 2DENB 4KIKA 1ISNA 3IFWB 3WAPA 4HK2A 3EECA 1ZGUB 3DBLI 2K8BA 2BYVE 2LXAA 3RYTA 2ZNVB 3U30A 5KHQA 1WE6A 2DAJA 2GBMA 3JW0X 3RUIB 3HIZA 1E8XA 2KDFB 3VDZA 4XZ4A 2FAZA 2NS5A 1P0RA 1AARA 4K7WA 2MX2A 2WX0A 3VTWA 2JWZA 1P98A 1WMHA 3CSTA 1UGMA 4EZLA 3NZUA 1V5TA 3HK0A 3R66C 3TCAA 2PEAA 2RSUA 3VH4B 2K8HA 1Y8RC 2LVPA 2LRUA 1VD2A 2O6VA 2XBBC 3L13A 4HCNB 2G3QB 4NQLB 3VUWA 2D3GA 2KFJA 3QWZB 1V86A 3ZNZB 1MG8A 2J0MA 2N7DA 1UH6A 3DBHI 3KUZA 4KSKC 3N32A 3ZNHB 4G3XB 3Q3JA 4GSWA 2AWTA 1Q1OA 1X1MA 2N1WA 3ZNGC 4BOZB 2BYEA 3H7PB 1E7UA 4WQOB 2NBUA 4BKGA 3RT3B 1R4MI 1V5OA 3OLMD 1WR1A 3B1LX 3TIXA 4BKTA 2VRRB 2BPSA 1HE8A 3ZTDA 2I1JA 4NY0A 2ZCCA 1YIWA 2HD5B 4ANWA 2KFKA 3ONSA 2UYZB 3QC8B 4TQ0A 2R2OA 4NPNA 4GB9A 3A1QB 5FR6A 2AYOB 2PE6B 3JYUA 1EF1A 4AUQC 3APDA 1RFAA 4ASWC 2YLMA 2A5UA 2IO3B 2MBBB 3WIMA 5AEKB 4KSLC 5E6NA 1KJTA 1J8CA 4MELA 1UD7A 3EC8A 4KZCA 2AL3A 4AWJA 1A5RA 2NPTB 1TBEA 3RZWC 5CX3A 1LXDA 2RGFA 3PHXB 1F9JA 2IO1B 2LGDA 3RCZA 3T8MA 1WIAA 4FJZA 4LJOB 2MBEA 4I6PA 2L8JA 4ICVA 4M8MA 3X23A 3HHMA 3M95A 2FCNA 3W1SA 2LASA 4K1RB 4HJKA 4KIKB 3HM3A 5LLIA 3H1UA 3UIOB 1WGDA 2DZJA 2MBQA 1WY8A 3QX1A 4B6WA 3UQBA 4FHJA 4BFRA 3DQVA 3PZDA 1E90A 4PS7A 1LQBA 5D2MB 4HDOA 2BWES 4W9GA 3L10B 1V2YA 3QQ8B 4GIVA 4XC2A 3QHTA 4TQ1A 3VH3B 1C1YB 3LDZE 4OVUA 3VAWA 4FULA 4GXBA 1EF5A 5HKHA 1SIFA 4JIOU 4J6IA 2BKFA 2DX5B 2C60A 2ZPYA 3MHSD 2ZVNA 5CHWA 2D11A 4AJYB 4ZYNA 2O6VD 3VVWB 2CS4A 1XQQA 2C7HA 2AEHA 3M63B 4F8CB 1I42A 4EOYA 2IO0B 1Q5WB 1WX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V B;  1E8W A;  1RRB A;  2KWU B;  4K7S A;  3DVN V;  2LUE A;  3AU5 A;  2G4S A;  4EUT A;  1GUA B;  4A3O A;  4RM9 A;  2JUO A;  3H7S A;  2DYB A;  2IO2 B;  3A1Q A;  4CO7 A;  5LXI B;  2GBN A;  4IM3 A;  2C7M B;  3APF A;  2K39 A;  2NR2 A;  2ZJD A;  3R7R A;  4WJO A;  3DVN U;  1WFY A;  3DVG X;  3ZTC A;  4IM2 A;  4NJ6 A;  4EFO A;  2CKH B;  1SE9 A;  2KFK B;  3A9J B;  2NPT A;  2J0K A;  2KMC A;  4MGK E;  4HXD A;  4FA6 A;  1YQB A;  2MCN B;  2HE7 A;  3PGE A;  4WWO A;  3WAO A;  4DWF A;  5EDS A;  5JHB A;  4DK5 A;  4IUM B;  2LXC A;  4ANU A;  3N30 A;  1E5W A;  1FXT B;  4GDL A;  4URK A;  1L7Y A;  2KC2 A;  3KYD D;  2KQS A;  3L0W B;  2BF8 B;  3PLV A;  1WE7 A;  4B9K A;  1V6E A;  3AXC A;  3SHQ A;  1H4R A;  1EO6 A;  3JVZ X;  2ZEQ A;  3ZRC A;  2BYF A;  4IM0 A;  3ZLZ A;  1QZE A;  2M17 A;  1YX5 B;  4GGQ A;  2IY1 B;  2JT4 B;  4XX5 A;  1ZKH A;  3ZW3 A;  3DVG Y;  2HJ8 A;  3ENE A;  4KDI C;  3MJW A;  3UIN B;  3RUL A;  4BBN C;  2KN5 A;  4MGI E;  4AOF A;  4B95 A;  1JRU A;  2KVR A;  4BBN F;  4DDG D;  1V49 A;  4JL9 A;  4W9I A;  1SGH A;  2BKR B;  2LI5 A;  3PV1 A;  1WF9 A;  1M94 A;  3V62 A;  2M0X A;  2M1M A;  3PSE B;  2IZV B;  1C3T A;  3MTN B;  3V6E B;  3ML8 A;  3KVF B;  2LGX A;  2L0F A;  5G55 A;  4CHK A;  2PJH A;  3ECI A;  3BIN A;  3QA8 A;  1RAX A;  4LJP B;  2IBI B;  2M4N A;  4JQW C;  4MJS B;  4EZK A;  5IA7 A;  3ZVV A;  2GBK A;  2JZZ A;  2NBV B;  4KV2 A;  2JPH A;  3DOW A;  3A9J A;  2KZR A;  1OGW A;  1P1A A;  4GN1 A;  2O2V A;  3D32 A;  2MBO A;  2FIF A;  4IWO A;  3P2B A;  1G6J A;  3T9L A;  2V1Y A;  2BWF A;  3OJ3 A;  3UIP B;  1NBF C;  1OQY A;  5D94 A;  3UGB B;  4G0N B;  3A4R A;  2K25 A;  3EFU A;  2NVU I;  2NBW B;  2Z0E B;  4NAW A;  1P9D U;  1WGG A;  2XEW A;  4M8N A;  4JGH B;  1NDD A;  2DAF A;  2BGF A;  4MGZ E;  1OEY J;  2N1V A;  4DXA B;  1E8Z A;  3OAW A;  4GOC A;  3QK0 A;  4AJW A;  4GDL B;  1WM3 A;  2Y5B B;  2MW5 A;  5E6P A;  2KMA A;  4II2 B;  2MQJ A;  3DBR I;  4WAA A;  4PYU A;  1WGH A;  2LJ5 A;  5CHV C;  3L54 A;  1LM8 B;  2KWC A;  2ZNV C;  1TZ1 A;  3CMM B;  4I6L B;  3V60 A;  3X0W A;  3UF8 A;  2FCM A;  1WX8 A;  1KLV A;  1Z5S B;  4K7U A;  1P3Q U;  1WH3 A;  2ZVO A;  3NS8 A;  2KDE B;  3APC A;  4IG7 B;  2Z59 B;  3CSF A;  1WXA A;  3A9K A;  3I3T B;  2L3Z A;  4JLC A;  4W9K A;  4X57 B;  3V61 A;  2DYM A;  3TBL D;  2CHW A;  2Z0D B;  3K9P B;  1UZX B;  3AU4 A;  2WYQ A;  4I6N B;  4II3 B;  2M8S A;  2KX0 A;  4GMV A;  3ZIM A;  3H6N A;  1CMX B;  1WYW B;  3GZN I;  4MJS A;  3AUL A;  3IG3 A;  3ALB A;  2KAN A;  2MBH A;  2MLB A;  2DZI A;  1WXV A;  2GMI C;  2K6D B;  2FCS A;  1V80 A;  2KX3 A;  2MP2 B;  1UEL A;  4KDL B;  3N3K B;  3ZDM C;  4ANV A;  1YJ1 A;  4HDQ A;  2PPH A;  1WGR A;  2LRW A;  4GDK A;  2DYO A;  4RM8 A;  5DPT A;  4HPL B;  4EKU A;  2GOW A;  2LGY A;  4W9E A;  4DHZ E;  3WAL A;  2J7Q B;  1ZW7 A;  5JHA A;  4DHZ B;  5D6J B;  1S3S G;  4LCD E;  3PRP B;  2DZK A;  2O2V B;  2J0J A;  4A3P A;  1GG3 A;  1IYF A;  3VUX A;  3EHV A;  2N4F A;  2FCQ A;  1PQS A;  3QJZ A;  1WI0 A;  4ZRK A;  5CHF A;  2KO3 A;  4LDT D;  2REX A;  1EUV B;  3SU8 X;  3S2A A;  1WZ3 A;  4BOS C;  4NAW B;  1WJU A;  5G2N A;  1IP9 A;  3BY4 B;  1Z2M A;  4LDT B;  2N7E A;  4ZRJ A;  3K9O B;  2KJ6 A;  3PS6 A;  1GC7 A;  3IVF A;  4YL8 A;  1TGZ B;  4NQK E;  5DPS A;  1UBI A;  2CHZ A;  2CHX A;  3WA0 A;  4BVU C;  1S1Q B;  5E6O A;  2LVQ A;  2KD0 A;  3U7D A;  4MDK E;  1RLF A;  3VTV A;  4HCP B;  3L08 A;  1E7V A;  4E74 A;  3ZKJ C;  1GNU A;  1BT0 A;  3O65 B;  4WWN A;  2GBR A;  2JZ3 B;  2L76 A;  2YVC A;  2XK5 B;  3QCA A;  1YD8 U;  1WGY A;  2KTR A;  1Q0W B;  5LXH A;  1WXS A;  3U8Z A;  4ZDV A;  3ML9 A;  4HPM B;  2L00 B;  3VXW A;  3JSV B;  1WXM A;  4GU2 A;  2KNB A;  4MSQ B;  4DDI D;  1J19 A;  5GMV A;  1VCB A;  1V9J A;  3KUD B;  1OEY A;  2UWQ A;  2RD0 A;  3A9K B;  5C23 A;  3KYC D;  3RZF A;  2K8C A;  3TJP A;  4A20 A;  4EEW A;  2IYD B;  3R3M A;  4G11 A;  3DCG A;  2DZM A;  3OJ4 B;  2MP2 A;  3B08 A;  4FBJ B;  3DDC B;  3GOE A;  2IY0 B;  2L0T A;  3AI5 A;  4N9F 4;  2ZZP B;  1U4A A;  3NOB A;  4PYZ A;  3B0A A;  3RD2 A;  2FID A;  4W9D A;  4ZRI A;  3ZUN A;  4DBG A;  1NI2 A;  2CR5 A;  3Q3F A;  1R4N I;  2JRH A;  2OJR A;  2WWZ A;  4HVB A;  2KXJ A;  2MSE D;  4NNJ B;  2LWP A;  4KVG B;  4W9L A;  3TL5 A;  2N9P C;  4G50 A;  4FN2 A;  4GDK B;  1J0G A;  5TR5 A;  1TTN A;  3IBE A;  3PHW B;  4F7Z A;  3LJ3 A;  5CTR C;  4WJP A;  3WAM A;  1D3Z A;  2EKE C;  2KLG A;  1OTR B;  2LZ6 A;  1H8C A;  2LD9 A;  3TMP B;  5J17 A;  3VQI A;  2V4L A;  4AP4 C;  5JZE B;  1L2N A;  4F1S A;  3KUC B;  2D07 B;  3WAN A;  3CF6 E;  3L17 A;  4FLH A;  2RR9 A;  3ZNI D;  1WR6 E;  1WJ4 A;  2KKC A;  3PT2 B;  4RMA A;  3A33 B;  2KWV B;  2XK5 A;  4MEM A;  1V81 A;  4MM3 A;  2N9E B;  1KOT A;  2L7R A;  3IHP C;  4WWP A;  3VHT C;  2C9W B;  2KQ7 A;  1GJZ A;  4IWP A;  3C0R B;  1UBQ A;  4PS8 A;  2QHO A;  2GBJ A;  3W1S C;  3JSV A;  3PRZ A;  4BKS A;  2K6Q A;  1K8R B;  2MA9 B;  2ZPN A;  2L05 A;  4TKN A;  2NCN A;  1WM2 A;  1WJN A;  2KK8 A;  4FJY A;  3QAQ A;  3NY5 A;  3V6C B;  1LFD A;  2K1F A;  2JY6 A;  2KTR B;  4FHK A;  4DHJ D;  2MWS B;  4FAD A;  3KW5 B;  4EZJ A;  3W1Y A;  2KJH B;  2G45 B;  1KM7 A;  3H9D A;  2W9N A;  4DHJ B;  1I35 A;  2FNJ B;  5J2R A;  2WDT B;  4IW0 A;  1IPG A;  1WRD B;  4PS3 A;  4W9C A;  4OVV A;  3NZS A;  2ASQ A;  1WZ0 A;  1XT9 B;  2B3A A;  2OOB B;  2C7N B;  2MRP A;  2JRI B;  3VTU A;  3ZO5 B;  5C1Z A;  1WMH B;  2V3S A;  3QAR A;  4E3C A;  1WJ6 A;  2D2Q A;  2KJR A;  4W9J A;  4FJV B;  3ZRF A;  5IAA C;  3HM6 X;  4ANX A;  4WJQ A;  4E71 A;  5DPW A;  2KLC A;  3NHE B;  2DHZ A;  3H7P A;  4M0W B;  2KC1 A;  3PLU A;  4MSM B;  1E8Y A;  2EMT A;  2D10 A;  4IC7 B;  4MGY E;  3M3J A;  2AL6 A;  3VFK A;  2RPQ A;  4ICU A;  5D7G A;  2WX1 A;  3M62 B;  5AZG A;  4W9F A;  4MH0 E;  5DCN A;  1GC6 A;  2JXX A;  2KOX A;  3R7Q A;  2LVO A;  2A4Z A;  4TUU A;  4WJN A;  2HTH A;  2I1K A;  1WX7 A;  5J18 A;  4TV3 A;  2R2Q A;  3UQA A;  4NJ7 A;  4KZ0 A;  1XD3 B;  2JVC A;  2C5L C;  2FUH B;  2KHW B;  2KTF A;  3PVL A;  3PTF C;  5AZH A;  2KDI A;  4IWQ A;  5KHO A;  4W9H A;  2N9X A;  3L16 A;  3SDL C;  3PPA A;  4K81 A;  3SD5 A;  3DBS A;  5JH5 C;  2G4D B;  3PRM B;  3KH0 A;  2KDB A;  2ZCB A;  4HWI B;  3PRE A;  3QIJ A;  5BO4 B;  5L95 C;  2JF5 A;  3ZDT A;  5L83 A;  1T0Y A;  2EMS A;  1YX6 B;  4BKS D;  5AZF A;  4HLE A;  3DPD A;  4P7I A;  3VUY A;  2CU1 A;  3A4S C;  4CYE A;  5DPR A;  2PE9 A;  2DEN B;  4KIK A;  1ISN A;  3IFW B;  3WAP A;  4HK2 A;  3EEC A;  1ZGU B;  3DBL I;  2K8B A;  2BYV E;  2LXA A;  3RYT A;  2ZNV B;  3U30 A;  5KHQ A;  1WE6 A;  2DAJ A;  2GBM A;  3JW0 X;  3RUI B;  3HIZ A;  1E8X A;  2KDF B;  3VDZ A;  4XZ4 A;  2FAZ A;  2NS5 A;  1P0R A;  1AAR A;  4K7W A;  2MX2 A;  2WX0 A;  3VTW A;  2JWZ A;  1P98 A;  1WMH A;  3CST A;  1UGM A;  4EZL A;  3NZU A;  1V5T A;  3HK0 A;  3R66 C;  3TCA A;  2PEA A;  2RSU A;  3VH4 B;  2K8H A;  1Y8R C;  2LVP A;  2LRU A;  1VD2 A;  2O6V A;  2XBB C;  3L13 A;  4HCN B;  2G3Q B;  4NQL B;  3VUW A;  2D3G A;  2KFJ A;  3QWZ B;  1V86 A;  3ZNZ B;  1MG8 A;  2J0M A;  2N7D A;  1UH6 A;  3DBH I;  3KUZ A;  4KSK C;  3N32 A;  3ZNH B;  4G3X B;  3Q3J A;  4GSW A;  2AWT A;  1Q1O A;  1X1M A;  2N1W A;  3ZNG C;  4BOZ B;  2BYE A;  3H7P B;  1E7U A;  4WQO B;  2NBU A;  4BKG A;  3RT3 B;  1R4M I;  1V5O A;  3OLM D;  1WR1 A;  3B1L X;  3TIX A;  4BKT A;  2VRR B;  2BPS A;  1HE8 A;  3ZTD A;  2I1J A;  4NY0 A;  2ZCC A;  1YIW A;  2HD5 B;  4ANW A;  2KFK A;  3ONS A;  2UYZ B;  3QC8 B;  4TQ0 A;  2R2O A;  4NPN A;  4GB9 A;  3A1Q B;  5FR6 A;  2AYO B;  2PE6 B;  3JYU A;  1EF1 A;  4AUQ C;  3APD A;  1RFA A;  4ASW C;  2YLM A;  2A5U A;  2IO3 B;  2MBB B;  3WIM A;  5AEK B;  4KSL C;  5E6N A;  1KJT A;  1J8C A;  4MEL A;  1UD7 A;  3EC8 A;  4KZC A;  2AL3 A;  4AWJ A;  1A5R A;  2NPT B;  1TBE A;  3RZW C;  5CX3 A;  1LXD A;  2RGF A;  3PHX B;  1F9J A;  2IO1 B;  2LGD A;  3RCZ A;  3T8M A;  1WIA A;  4FJZ A;  4LJO B;  2MBE A;  4I6P A;  2L8J A;  4ICV A;  4M8M A;  3X23 A;  3HHM A;  3M95 A;  2FCN A;  3W1S A;  2LAS A;  4K1R B;  4HJK A;  4KIK B;  3HM3 A;  5LLI A;  3H1U A;  3UIO B;  1WGD A;  2DZJ A;  2MBQ A;  1WY8 A;  3QX1 A;  4B6W A;  3UQB A;  4FHJ A;  4BFR A;  3DQV A;  3PZD A;  1E90 A;  4PS7 A;  1LQB A;  5D2M B;  4HDO A;  2BWE S;  4W9G A;  3L10 B;  1V2Y A;  3QQ8 B;  4GIV A;  4XC2 A;  3QHT A;  4TQ1 A;  3VH3 B;  1C1Y B;  3LDZ E;  4OVU A;  3VAW A;  4FUL A;  4GXB A;  1EF5 A;  5HKH A;  1SIF A;  4JIO U;  4J6I A;  2BKF A;  2DX5 B;  2C60 A;  2ZPY A;  3MHS D;  2ZVN A;  5CHW A;  2D11 A;  4AJY B;  4ZYN A;  2O6V D;  3VVW B;  2CS4 A;  1XQQ A;  2C7H A;  2AEH A;  3M63 B;  4F8C B;  1I42 A;  4EOY A;  2IO0 B;  1Q5W B;  1WX9 A; 
#chains in the Genus database with same CATH topology
 1ESF A;  1RRB A;  4MT5 A;  2LUE A;  2HJ1 A;  2G4S A;  1BUI C;  2OED A;  1JCK B;  2JUO A;  3H7S A;  4ZHO A;  3NJT A;  5LXI B;  3DBR B;  3MP9 A;  5FR3 A;  3APF A;  4WJO A;  4M00 A;  4L23 A;  4IM2 A;  2KFK B;  2KMC A;  2MCN B;  1RWS A;  4LNI A;  5EDS A;  4DK5 A;  4IUM B;  4GDL A;  2KQS A;  4WWM A;  1V8C A;  1WE7 A;  4B9K A;  2LJI A;  3BVZ A;  1FRR A;  3Q69 A;  3B2G A;  1ET9 A;  2IY1 B;  2ON8 A;  2M56 B;  3MJW A;  4AOF A;  1JRU A;  2KVR A;  4BBN F;  4ITK A;  1SGH A;  2L1A A;  4C80 A;  3V62 A;  2M0X A;  3GE8 C;  3RI7 C;  3PSE B;  3OWE B;  3V6E B;  4RCO A;  2LGX A;  4P6V F;  2CJN A;  4CHK A;  2HDE A;  2M4N A;  1J7B A;  4C7Z A;  2NBV B;  3MFG A;  1MFW A;  1JW9 D;  1OGW A;  1P1A A;  3D32 A;  2MBO A;  3BVM A;  2BWF A;  3OJ3 A;  2WDR B;  2K25 A;  2WXI A;  2NBW B;  4NAW A;  1P9D U;  3BYT B;  3R2I A;  2DAF A;  2BGF A;  2D3A A;  4MGZ E;  1OEY J;  2N1V A;  2WXR A;  4YTN B;  3QK0 A;  4AJW A;  1YN4 A;  2Y5B B;  1JWU D;  2X38 A;  5TSS A;  3ZJT A;  2BVC A;  1WSP A;  5CHV C;  1LM8 B;  1TJE A;  1TZ1 A;  4I6L B;  1WX8 A;  1WXQ A;  1HXY D;  1Z5S B;  5I4D A;  4S0R A;  2KDE B;  3APC A;  3CSF A;  3A9K A;  4ZOH C;  3I3T B;  5EE0 A;  3Q8C A;  1QOA A;  3K9P B;  4II3 B;  1UZX B;  4I6N B;  1MI0 A;  4NAM A;  2M8S A;  1HTQ A;  4GMV A;  3ZIM A;  1CMX B;  3GZN I;  1ET6 A;  3IG3 A;  1C79 A;  2Y5P A;  2PVO D;  2K6D B;  2KX3 A;  3AB5 A;  4US8 A;  1YJ1 A;  3B2F A;  2WNM A;  2LRW A;  2DYO A;  4RM8 A;  4HPL B;  4CQN A;  2JZP A;  1PGA A;  1KRH A;  5D6J B;  1HTO A;  1S3S G;  2DZK A;  4A3P A;  3VUX A;  2N4F A;  1RYJ A;  1T0Q C;  1CQV A;  2BS3 B;  1I4X A;  5G2N A;  1QOB A;  3BY4 B;  4LDT B;  4KGT A;  3K9O B;  2HTM E;  1UBI A;  2CHX A;  5BYQ A;  3WA0 A;  1R7S A;  1N5W A;  5IOI A;  3O65 B;  2YVC A;  1WGY A;  1WXS A;  2QIE B;  2BS4 B;  2WXH A;  3AE6 B;  2J53 A;  4GU2 A;  4MSQ B;  4DDI D;  1GB4 A;  2UWQ A;  1BML C;  3AED B;  2IPK D;  3DCG A;  2DZM A;  3HVZ A;  3AI5 A;  3NVW A;  2KYW A;  1VZ6 A;  4ACF A;  2INC C;  2CR5 A;  1FIQ A;  2JRH A;  4HVB A;  1TKY A;  2MSE D;  4KVG B;  2N9P C;  1UWX A;  5TR5 A;  5HHD G;  3PHW B;  4WIP A;  1C76 A;  4US9 A;  3AEA B;  5CTR C;  4WJP A;  3IAM 1;  2EKE C;  5JZE B;  3ZYY X;  5HI1 A;  2D07 B;  3CF6 E;  2QC8 A;  2WXF A;  1OQQ A;  1K50 A;  2KWV B;  2XK5 A;  3KWV A;  4MM3 A;  1KOT A;  4WWP A;  2C9W B;  1DGJ A;  2J4X A;  1GJZ A;  3C0R B;  2BQQ A;  1MG4 A;  1IBX A;  2L05 A;  3ETR A;  3GE3 C;  1WJN A;  2KK8 A;  2ZW1 A;  4FJY A;  1L6V A;  1XLO A;  4ZYS A;  4FHK A;  4DHJ D;  5EE1 A;  2YEP F;  4EZJ A;  2KJH B;  2AQ2 B;  5J2R A;  4IW0 A;  1JRP A;  1WRD B;  4PS3 A;  3MC0 B;  1VZ7 A;  1WZ0 A;  3U52 E;  1SE3 A;  4XDD A;  2MRP A;  2BTE A;  1WMH B;  1WJ6 A;  2D2Q A;  4FJV B;  1FFV A;  4E71 A;  5DPW A;  2DHZ A;  2WXP A;  4MSM B;  2EMT A;  4XYC A;  2WX1 A;  5AZG A;  4XGA B;  4B0M A;  2KOX A;  4WJN A;  1C4C A;  3UQA A;  4NJ7 A;  2KHW B;  5AZH A;  3PTF C;  3L16 A;  1I4P A;  3PPA A;  4K81 A;  3SD5 A;  5JH5 C;  3KH0 A;  5BO4 B;  2EMS A;  4BKS D;  1L4Z B;  3VUY A;  1I7H A;  2IGD A;  2QMT A;  1OFF A;  1PUT A;  1TT5 B;  3DBL I;  5IO9 A;  1JWM D;  3RYT A;  1WE6 A;  2DAJ A;  2GBM A;  3Q8F A;  2KDF B;  2FAZ A;  2WHI A;  2MX2 A;  3VTW A;  3HVD A;  4EZL A;  4ZRP A;  3I9V 1;  1QKZ A;  3KWL A;  2PEA A;  4TSS A;  1Y8R C;  2ICI A;  3L13 A;  2JU6 X;  2PLP A;  2J0M A;  1UH6 A;  1BXT A;  1PYW D;  4KKI A;  1X1M A;  1PGB A;  2BYE A;  4KGS A;  1R4M I;  3HUI A;  2KFK A;  3LB8 C;  4YSX B;  2UYZ B;  1SJH D;  3N20 C;  3JYU A;  3RNC C;  2DLB A;  3WIM A;  2I38 A;  5AEK B;  5D3I B;  4MEL A;  1ROE A;  3OG5 A;  2NPT B;  1I4R A;  2QIL A;  3PHX B;  3RCZ A;  3T8M A;  4M8M A;  3W9C B;  3VRA B;  1B9R A;  4K1R B;  1E10 A;  2N0S B;  4HJG E;  3HM3 A;  3ABV B;  4B6W A;  3UIO B;  2DZJ A;  4BFR A;  2LHE A;  1TIF A;  3PZD A;  1R4N B;  1V2Y A;  2K0P A;  4PK1 A;  2QEJ C;  3BK2 A;  5H92 C;  4YTP B;  1HEZ E;  5HKH A;  1SIF A;  1D5X C;  2DX5 B;  2C60 A;  1N61 A;  2H89 B;  1I4Q A;  2V4I B;  4EOY A;  1WX9 A;  1UWM A;  4K7S A;  3DVN V;  4LTU A;  1FFU A;  1ZE3 D;  2IO2 B;  4IM3 A;  1CZP A;  2K39 A;  1MJD A;  2E6X A;  3R7R A;  3ZTC A;  3AEE B;  1UUP A;  4NJ6 A;  4HKZ E;  4EFO A;  2CKH B;  3A9J B;  3P42 A;  2J0K A;  4RGM A;  3PZ8 A;  4REZ A;  4WWO A;  2L32 A;  1FXT B;  1CJE A;  1L7Y A;  4YWG G;  3L0W B;  1V6E A;  3AXC A;  1HZ5 A;  1KH0 A;  2RMM A;  1EO6 A;  2V3P A;  2BYF A;  3BZD B;  4GGQ A;  2JT4 B;  4XX5 A;  3P63 A;  1L6U A;  1F0Z A;  1K51 A;  3Q8B A;  4KDI C;  3UIN B;  2YEP B;  3RUL A;  4BBN C;  4B95 A;  4MGI E;  3U4E G;  1TY0 A;  4RGT A;  5BMH A;  2QDF A;  1WF9 A;  4DXF A;  4RF0 A;  4RF1 A;  3CWI A;  5G55 A;  3ECI A;  1XXG A;  4JQW C;  4MJS B;  3UI3 A;  3J9C A;  4EZK A;  4YSY B;  1KLG D;  2WLB A;  4A9A A;  1AW7 A;  4KV2 A;  3DOW A;  2D3C A;  2KZR A;  1G6J A;  4N58 A;  1NBF C;  5D94 A;  3UGB B;  2NVU I;  2Z0E B;  1F77 A;  2Z8L A;  1WM3 A;  2MW5 A;  5E6P A;  2KMA A;  4JE3 B;  3DBR I;  4WAA A;  1T6B X;  4PYU A;  2LJ5 A;  1ZDV A;  2BS2 B;  3SFD B;  1XCQ L;  2WGS A;  5HFY A;  2FCM A;  3WCQ A;  1VDV A;  4K7U A;  2W3R A;  4LNN A;  3BII D;  3DBH B;  2DYM A;  2CHW A;  3AU4 A;  4EE2 A;  3AH7 A;  2AQ1 B;  3NZ3 A;  3H6N A;  4XWT A;  1N60 A;  2KAN A;  3I5J C;  2MLB A;  5G5H A;  1WXV A;  2GMI C;  3AEG B;  1V80 A;  2MP2 B;  3C19 A;  2KAJ A;  2PPH A;  3P1M A;  1WGR A;  1YN5 A;  2GOW A;  1WGK A;  4HKQ A;  2LGY A;  2J7Q B;  2AX5 A;  4RGN A;  3IT4 B;  2RDH A;  2O2V B;  1JQ4 A;  1GG3 A;  2JYE A;  1IYF A;  1SB3 C;  2FCQ A;  3C8Y A;  1IGC A;  5CHF A;  4TMA B;  1EUV B;  1WZ3 A;  2W55 A;  4H2A A;  2IND C;  2KJ6 A;  3PS6 A;  3IVF A;  1S1Q B;  5E6O A;  2KD0 A;  4MDK E;  1RLF A;  3L08 A;  3ZKJ C;  1GNU A;  1XF5 L;  3Q6B A;  2GBR A;  2L76 A;  2MHJ A;  3QCA A;  3ML9 A;  1YNT E;  1AYF A;  1RM6 C;  2KNB A;  1J19 A;  1VCB A;  2KAC A;  1OEY A;  2RD0 A;  3I57 A;  3MJ5 A;  1WWT A;  2K8C A;  1NI3 A;  3R3M A;  4N6E B;  5E6J A;  4FBJ B;  3B0A A;  3RD2 A;  1DOY A;  2FID A;  3ZUN A;  2GRI A;  1JRO A;  1PFD A;  2OJR A;  2LWP A;  2NTT A;  3DHI C;  3TL5 A;  1KTK A;  4JX1 C;  4G50 A;  1J0G A;  3IBE A;  4F7Z A;  3LJ3 A;  1QF6 A;  5IP4 D;  1XLQ A;  2LD9 A;  4LNO A;  2W54 A;  3VQI A;  4P1C C;  5J17 A;  2V4L A;  3TEZ A;  1P7F A;  3L17 A;  3TEW A;  1K53 A;  3PT2 B;  4RMA A;  2DBY A;  1V81 A;  2N9E B;  3IHP C;  1OQR A;  1DYQ A;  3JSV A;  3LYY A;  2LEK A;  2K6Q A;  1K8R B;  2PW9 A;  4OHJ A;  3NY5 A;  2K1F A;  2WDV B;  2BW2 A;  2KTR B;  1FPY A;  1QIL A;  2MWS B;  2G45 B;  1KM7 A;  3H9D A;  4DHJ B;  1I35 A;  2WDT B;  1P7E A;  1IPG A;  4W9C A;  4OVV A;  1XT9 B;  2OOB B;  3RNG C;  4E3C A;  2KJR A;  3RNE C;  3ZRF A;  5IAA C;  4J3O D;  3HM6 X;  3AN1 A;  2J42 A;  3NHE B;  3L4P A;  4KKJ A;  4YT0 B;  3PLU A;  2D10 A;  4IC7 B;  4MGY E;  2JQR B;  2AL6 A;  5AUK A;  4ICU A;  3M62 B;  4W9F A;  4MH0 E;  5DCN A;  1GC6 A;  3BWU D;  3R7Q A;  4TUU A;  4KGR A;  4TV3 A;  2ONQ A;  2JVC A;  1FCC C;  4IWQ A;  3Q3O C;  3SDL C;  1UGJ A;  1QOF A;  3PRM B;  3NVZ A;  3PRE A;  3QIJ A;  2SEB D;  5L95 C;  3ZDT A;  5L83 A;  3NUH B;  3O13 A;  4P7I A;  2PTL A;  4CYE A;  5IN7 A;  1FRD A;  3WAP A;  4HK2 A;  3ZXV A;  3DWG C;  1ZGU B;  1TS5 A;  2N9K A;  3DHG C;  3JW0 X;  1P0R A;  1AAR A;  4K7W A;  4RGO S;  2JWZ A;  1L5P A;  3P4P B;  3HK0 A;  2JWU A;  2W3S A;  2Y3A A;  3Q3M C;  2K8H A;  2LRU A;  3VUW A;  4YSZ B;  2VH1 A;  3ZNZ B;  1Y56 A;  3MHZ A;  1QQR A;  1N6Z A;  4G3X B;  4GSW A;  1NYR A;  2N1W A;  2K9X A;  3H7P B;  1E7U A;  2PKO A;  2LUM A;  4BKT A;  1L0X B;  1HE8 A;  2I1J A;  4NY0 A;  4GB9 A;  1N5X A;  2AYO B;  3APD A;  4ASW C;  1VJK A;  1J8C A;  1UD7 A;  2W82 A;  1FD6 A;  1TBE A;  3RZW C;  2RGF A;  4WUR A;  1HZ6 A;  2IO1 B;  1WIA A;  4LJO B;  2MBE A;  3X23 A;  3HHM A;  2WU2 B;  2FCN A;  3KLS X;  4A90 A;  3AE9 B;  4KIK B;  1WY8 A;  4FHJ A;  3DQV A;  4PS7 A;  1LQB A;  2MJ3 A;  4W9G A;  5T8I A;  3L10 B;  2FBW B;  1XLP A;  3QQ8 B;  3Q3N C;  1YOV B;  2V3N A;  4TQ1 A;  4WH4 A;  3VH3 B;  3LDZ E;  3VAW A;  4FUL A;  4J6I A;  5CHW A;  4BZA A;  2FUG 1;  2D11 A;  4AJY B;  2O6V D;  3NVV A;  5MPO A;  1WYG A;  4C56 C;  2IO0 B;  1E7V A;  2H88 B;  1Q5W B;  3VRB B;  1EM7 A;  2EEL A;  3TSS A;  2WXQ A;  3AU5 A;  2DNF A;  1GUA B;  2DYB A;  3A1Q A;  1XO3 A;  1B1Z A;  4AQ7 A;  1WFY A;  2N9L A;  1C77 A;  4A8X C;  3RPF C;  1SE9 A;  2PIA A;  3Q8E A;  4HXD A;  1ZXI A;  2HE7 A;  3PGE A;  3WAO A;  3N9Y C;  4DWF A;  5JHB A;  4ZHP A;  4ANU A;  1ZDX A;  3N30 A;  1ACC A;  4WQM A;  2KC2 A;  2VZK D;  1FXI A;  3BVG A;  3SHQ A;  3ZLZ A;  1QZE A;  2BB6 A;  2M17 A;  1M4V A;  4NJC A;  3ZW3 A;  3DVG Y;  2HJ8 A;  3ENE A;  2XNA C;  1T0S C;  3AE7 B;  1V49 A;  2D5G A;  4W9I A;  2BKR B;  3PV1 A;  1M94 A;  1D4B A;  3Q8A A;  2DWQ A;  2KWD A;  2PJH A;  3BIN A;  4RH6 A;  2NMQ A;  3QA8 A;  1HA5 A;  1WRI A;  4A55 A;  1RAX A;  1XLN A;  1DOI A;  3DWM A;  5IA7 A;  2INP E;  2JZZ A;  2K22 A;  2WS3 B;  2IGH A;  2O2V A;  3GS2 A;  2FIF A;  4IWO A;  2V1Y A;  1YQ3 B;  3H8H A;  1OQY A;  2CJO A;  3EFU A;  3NVY A;  4JGH B;  4L1B A;  3DBL B;  4DXA B;  1E8Z A;  4XDC A;  2MQJ A;  5FK9 C;  3L54 A;  2TSS A;  1IUE A;  2KWC A;  1TKG A;  3CMM B;  3X0W A;  1UF0 A;  1KLV A;  1P3Q U;  1WH3 A;  1F52 A;  1SE2 A;  2Z59 B;  4MAC A;  1WXA A;  4JLC A;  3V05 A;  4W9K A;  4X57 B;  4DXG A;  2E3T A;  3N1Y C;  2UU7 A;  1YN3 A;  1GOZ A;  4USA A;  1R4M B;  2K5P A;  3AUL A;  3ALB A;  2MBH A;  1V1O A;  4M01 A;  2DZI A;  1TS3 A;  1UEL A;  3ZDM C;  4ANV A;  1MHH E;  4HDQ A;  2JSV X;  4BAX A;  5DPT A;  4EKU A;  1DOX A;  2GB1 A;  3E56 A;  1ZW7 A;  3R2T A;  1Q10 A;  4DHZ B;  2GLS A;  3PRP B;  3EHV A;  1PQS A;  3QJZ A;  4YTM B;  4ZRK A;  2B76 B;  2KO3 A;  3W5U B;  2REX A;  2L52 A;  3S2A A;  3SU8 X;  1WJU A;  2N7J A;  1Z2M A;  2VH2 A;  3AE4 B;  2N7E A;  4ZRJ A;  1C4P A;  3FC4 A;  1GC7 A;  4YL8 A;  3AM9 A;  4HCP B;  4S17 A;  5BYS A;  4E74 A;  1YJI A;  1BT0 A;  4WWN A;  2JXT A;  2JZ3 B;  2XK5 B;  1D5M C;  3Q14 C;  2KTR A;  5LXH A;  3U8Z A;  4ZDV A;  3EUB 2;  2L00 B;  1CK1 A;  3VXW A;  1WXM A;  3GB1 A;  5GMV A;  1V9J A;  3KUD B;  5C23 A;  3RZF A;  4EEW A;  3RN9 C;  4G11 A;  1JWB D;  3B08 A;  3DDC B;  3GOE A;  5H8Y E;  2L0T A;  4N9F 4;  2ZZP B;  4LNF A;  1U4A A;  3NOB A;  3N1X C;  1T5X D;  4ZRI A;  4DBG A;  3URY A;  2RDG A;  1HQR D;  2OJW A;  1TY2 A;  4FN2 A;  4GDK B;  1TTN A;  1L0V B;  4Q2J A;  3WAM A;  1OTR B;  2LZ6 A;  1H8C A;  4HPP A;  5LNK 1;  2WP9 B;  2BBC A;  4F1S A;  3KUC B;  4OZB A;  2Y5C A;  3WAN A;  3ZNI D;  2RDB C;  2KKC A;  3EA6 A;  3GP7 A;  4D2K A;  2ZW0 A;  2KQ7 A;  4IWP A;  3U2S C;  4PS8 A;  2QHO A;  2GBJ A;  3I63 C;  4OVZ A;  4BKS A;  1VRA B;  1QT9 A;  4TKN A;  2NCN A;  3V6C B;  1LFD A;  2JY6 A;  1XCT L;  2WXO A;  4FAD A;  3RNF C;  3KW5 B;  1FXA A;  1TKE A;  2W9N A;  2K3U A;  2ASQ A;  2B3A A;  2C7N B;  5EE9 A;  5C1Z A;  2WXN A;  2BYT A;  1ZPS A;  4W9J A;  1SEB D;  4NZL B;  4ANX A;  2KLC A;  4M0W B;  3H7P A;  2KC1 A;  1E8Y A;  2G1E A;  2LGI A;  2FE8 A;  2JXX A;  1L4D B;  2A4Z A;  2LVO A;  4HRS A;  3ZQ4 A;  2I1K A;  4C4V B;  1WX7 A;  4KZ0 A;  1XD3 B;  1V97 A;  2C5L C;  3PVL A;  4W9H A;  3AEB B;  3DBS A;  1TZO A;  1V1P B;  3TEX A;  2KDB A;  2NTS A;  2JF5 A;  1YX6 B;  4HLE A;  2CU1 A;  2XN9 C;  3A4S C;  2PE9 A;  4FXC A;  2DEN B;  1NEK B;  4KIK A;  3RNB C;  3AE3 B;  5BYR A;  3EEC A;  3VR9 B;  1LGR A;  5HG2 A;  2SAK A;  2BYV E;  2ZNV B;  1SJE D;  1F2R C;  3RUI B;  1GAQ B;  3VDZ A;  4XZ4 A;  2WX0 A;  1WMH A;  1FO4 A;  1UGM A;  3NZU A;  4KX6 B;  3R66 C;  4IDI A;  2RSU A;  2LVP A;  1VD2 A;  2XBB C;  4HCN B;  2G3Q B;  2D3G A;  2KFJ A;  3QWZ B;  1V86 A;  1KF6 B;  4JWS C;  3KUZ A;  3N32 A;  3ZNH B;  3KQ4 A;  3Q3J A;  1VLB A;  2KT7 A;  1E9M A;  3MC9 A;  5C2T B;  1Q1O A;  4BOZ B;  2NBU A;  1V5O A;  1WR1 A;  3ZTD A;  3W2D A;  2HD5 B;  4ANW A;  3ONS A;  1PGX A;  3QC8 B;  2R2O A;  1C78 A;  4AUQ C;  2IO3 B;  1KJT A;  3EC8 A;  4KZC A;  3IAS 1;  2AL3 A;  1A5R A;  5CX3 A;  1LXD A;  4XWW A;  3RNA C;  2QSD A;  4FJZ A;  4I6P A;  2L8J A;  1VR9 A;  4GLS C;  2LAS A;  5C3J B;  1K52 A;  3P4Q B;  4HJK A;  5LLI A;  3UQB A;  3QX1 A;  1ZP0 B;  2AQ3 B;  4XC2 A;  3QHT A;  3AE1 B;  1C1Y B;  1EU3 A;  4OVU A;  4B0E A;  1FEH A;  4ZYN A;  1XQQ A;  2C7H A;  2AEH A;  4OW0 A;  4F8C B;  2O6V B;  1E8W A;  2KWU B;  5JXV A;  2EKI A;  4LK0 M;  2LHD A;  1C9F A;  4EUT A;  4A3O A;  4RM9 A;  2MEK A;  3BK1 A;  4CO7 A;  2BT6 A;  2GBN A;  2C7M B;  1PDX A;  2NR2 A;  2ZJD A;  3DVN U;  3DVG X;  4R3D A;  2CU3 A;  3NG0 A;  1I4G A;  4QAY A;  2NPT A;  4MGK E;  4ZRQ A;  4FA6 A;  1YQB A;  4OZA A;  4OZC A;  2LXC A;  4HEA 1;  2Q5W D;  4A6Q A;  1E5W A;  2L83 A;  4URK A;  4K3B A;  3AEC B;  3KYD D;  2GI9 A;  2BF8 B;  3PLV A;  1NVI D;  5FKA C;  3FIL B;  3GZN B;  2VZK B;  1H4R A;  3JVZ X;  2ZEQ A;  3ZRC A;  4IM0 A;  1YX5 B;  1ZKH A;  3CIR B;  2KN5 A;  3ZGZ A;  4DDG D;  4ARI A;  4JL9 A;  3MC8 A;  1FNU A;  2LI5 A;  2MH7 A;  1L0Y B;  1EU4 A;  2M1M A;  2IZV B;  1C3T A;  1EWC A;  3MTN B;  3ML8 A;  3KVF B;  4M02 A;  2L0F A;  1RFK A;  3AMZ A;  1N63 A;  4LJP B;  3TEY A;  2IBI B;  3AE8 B;  1YMH E;  4LNK A;  5AUI A;  4UDU C;  1N62 A;  3ZVV A;  2GBK A;  2KN4 A;  2JPH A;  3A9J A;  4GN1 A;  1D6E C;  3P2B A;  2KMM A;  3T9L A;  3LXF A;  4XE0 A;  3UIP B;  1JWA D;  4G0N B;  3A4R A;  3AEF B;  1J7A A;  1WGG A;  4MH8 A;  2XEW A;  1KLU D;  4M8N A;  2JYT A;  1NDD A;  1ZUD 2;  2RPV A;  3OAW A;  3IT6 B;  4GOC A;  1FCL A;  4GDL B;  4II2 B;  2WXJ A;  3B9J A;  1WGH A;  5G5G A;  2ZNV C;  5D3D A;  3V60 A;  3UF8 A;  2M0A A;  2ZVO A;  3E9S A;  2KVZ A;  2ACZ B;  3NS8 A;  4IG7 B;  2WU5 B;  2L3Z A;  5BMG A;  3V61 A;  3AV8 A;  3TBL D;  1SXT A;  2Z0D B;  1J7C A;  2WYQ A;  2KX0 A;  1FMA D;  1WYW B;  3T3N A;  1A70 A;  4MJS A;  2WXM A;  2FCS A;  5GXG B;  4KDL B;  2M19 A;  3N3K B;  4RNA A;  1SBB B;  4GDK A;  1VZ8 A;  4C7Y A;  4W9E A;  4DHZ E;  3WAL A;  5JHA A;  4DQO C;  4LCD E;  2J0J A;  3ZXR A;  2KQ4 X;  1WI0 A;  3NS1 A;  4LDT D;  5EE3 A;  4BOS C;  2PMV A;  4NAW B;  1IP9 A;  3N1Z C;  3R8B A;  3TUO A;  4BVU C;  1STE A;  1TGZ B;  4NQK E;  5DPS A;  2CHZ A;  3BYY B;  2LVQ A;  4P16 A;  4AS1 A;  3U7D A;  1JAL A;  3VTV A;  3SEB A;  2INN E;  1YD8 U;  1Q0W B;  1E7P B;  3IXS A;  1T3Q A;  2V9H A;  4HPM B;  1ZXH A;  1UNS A;  2X8X X;  3JSV B;  1QLB B;  1JWS D;  4WAF A;  3A9K B;  4A20 A;  3KYC D;  3ZJV A;  3TJP A;  2IYD B;  2LGS A;  1MHX A;  3P4S B;  1KFY B;  3OJ4 B;  2MP2 A;  2IY0 B;  4PYZ A;  2WQY B;  3DHH C;  4O1N A;  4W9D A;  1NI2 A;  1I4H A;  3Q2A C;  3Q3F A;  1R4N I;  4M0W A;  2WDQ B;  2WWZ A;  2KXJ A;  4NNJ B;  1NYQ A;  4W9L A;  2BB5 A;  5BMI A;  1F2R I;  2MJD A;  4C4V A;  1D3Z A;  2KLG A;  5IKC M;  1NEN B;  2KDM A;  3TMP B;  2V0G A;  1QOG A;  1T0R C;  4AP4 C;  1TS4 A;  3ZJU A;  1L2N A;  4FLH A;  4L2Y A;  1V1P A;  2RR9 A;  1WR6 E;  1WJ4 A;  3SFE B;  3A33 B;  4MEM A;  1LO5 D;  2QJL A;  2L7R A;  3VHT C;  1UBQ A;  2I2Y A;  2IDY A;  3W1S C;  3PRZ A;  2IJ0 A;  1XEE A;  2MA9 B;  2D3B A;  2ZPN A;  1WM2 A;  1YJJ A;  4JPS A;  3QAQ A;  1AWD A;  1GB1 A;  3W1Y A;  2PVG C;  3FAH A;  2FNJ B;  1FNW A;  4C00 A;  4LLG M;  3NZS A;  1F1H A;  2LMC A;  2JRI B;  3VTU A;  3ZO5 B;  2V3S A;  3QAR A;  3RFZ B;  4N59 A;  3HRD D;  4WJQ A;  1FNV A;  1JML A;  2OHF A;  1SSN A;  1MVK A;  3M3J A;  3VFK A;  2RPQ A;  1AN8 A;  5D7G A;  3VR8 B;  1C4A A;  2HTH A;  5J18 A;  3PZ7 A;  2R2Q A;  2G9H D;  3EGR A;  2FUH B;  5KHO A;  2KTF A;  2KDI A;  2N9X A;  2G4D B;  2MJE A;  4K3C A;  3EFC A;  3FKY A;  2ZCB A;  4HWI B;  4MM3 B;  1FM0 D;  1E0Z A;  1T0Y A;  4IKG A;  5AZF A;  3DPD A;  4HRO A;  5DPR A;  1ISN A;  1IBX B;  3IFW B;  1EWY C;  3W5V B;  2K8B A;  2LXA A;  3U30 A;  5KHQ A;  3T3O A;  4P1B C;  3HIZ A;  1E8X A;  2LFI A;  2NS5 A;  2R61 A;  3CST A;  1P98 A;  2WXG A;  1V5T A;  3TCA A;  1D5Z C;  3U7Z A;  3VH4 B;  2O6V A;  4NQL B;  2IGG A;  1SE4 A;  1MG8 A;  2N7D A;  3DBH I;  4KSK C;  4PT5 A;  1GPX A;  2AWT A;  3ZNG C;  3NRZ A;  2J52 A;  4BKG A;  4WQO B;  3RT3 B;  2WXK A;  3OLM D;  3B1L X;  3TIX A;  4JWU C;  2VRR B;  2BPS A;  4RFB A;  3SR6 A;  2ZCC A;  1YIW A;  4ARC A;  4TQ0 A;  4NPN A;  3A1Q B;  5FR6 A;  2PE6 B;  1EF1 A;  1TS2 A;  2QCZ A;  1RFA A;  1SIJ A;  2YLM A;  2A5U A;  1SF0 A;  2MBB B;  4KSL C;  5E6N A;  3AE2 B;  4AWJ A;  1TYG B;  3FIL A;  1F9J A;  2LGD A;  4ICV A;  3M95 A;  3W1S A;  3P4R B;  3V3X A;  2JX5 A;  3H1U A;  1IGD A;  1WGD A;  2MBQ A;  4YXD B;  1ZOY B;  1E90 A;  5D2M B;  4HDO A;  2BWE S;  1E6E B;  1YQ4 B;  3PO0 A;  4GIV A;  1MPE A;  3RMK C;  1ENF A;  4GXB A;  1EF5 A;  4JIO U;  2BKF A;  2ZPY A;  3MHS D;  2ZVN A;  3VVW B;  2CS4 A;  4IOI E;  2WXL A;  3M63 B;  1I42 A;  3AE5 B; 
#chains in the Genus database with same CATH homology
 2O6V B;  1E8W A;  1RRB A;  2KWU B;  4K7S A;  3DVN V;  2LUE A;  3AU5 A;  2G4S A;  4EUT A;  1GUA B;  4A3O A;  4RM9 A;  2JUO A;  3H7S A;  2DYB A;  2IO2 B;  3A1Q A;  4CO7 A;  5LXI B;  2GBN A;  4IM3 A;  2C7M B;  3APF A;  2K39 A;  2NR2 A;  2ZJD A;  3R7R A;  4WJO A;  3DVN U;  1WFY A;  3DVG X;  3ZTC A;  4IM2 A;  4NJ6 A;  4EFO A;  2CKH B;  1SE9 A;  2KFK B;  3A9J B;  2NPT A;  2J0K A;  2KMC A;  4MGK E;  4HXD A;  4FA6 A;  1YQB A;  2MCN B;  2HE7 A;  3PGE A;  4WWO A;  3WAO A;  4DWF A;  5EDS A;  5JHB A;  4DK5 A;  4IUM B;  2LXC A;  4ANU A;  3N30 A;  1E5W A;  1FXT B;  4GDL A;  4URK A;  1L7Y A;  2KC2 A;  3KYD D;  2KQS A;  3L0W B;  2BF8 B;  3PLV A;  1WE7 A;  4B9K A;  1V6E A;  3AXC A;  3SHQ A;  1H4R A;  1EO6 A;  3JVZ X;  2ZEQ A;  3ZRC A;  2BYF A;  4IM0 A;  3ZLZ A;  1QZE A;  2M17 A;  1YX5 B;  4GGQ A;  2IY1 B;  2JT4 B;  4XX5 A;  1ZKH A;  3ZW3 A;  3DVG Y;  2HJ8 A;  3ENE A;  4KDI C;  3MJW A;  3UIN B;  3RUL A;  4BBN C;  2KN5 A;  4MGI E;  4AOF A;  4B95 A;  1JRU A;  2KVR A;  4BBN F;  4DDG D;  1V49 A;  4JL9 A;  4W9I A;  1SGH A;  2BKR B;  2LI5 A;  3PV1 A;  1WF9 A;  1M94 A;  3V62 A;  2M0X A;  2M1M A;  3PSE B;  2IZV B;  1C3T A;  3MTN B;  3V6E B;  3ML8 A;  3KVF B;  2LGX A;  2L0F A;  5G55 A;  4CHK A;  2PJH A;  3ECI A;  3BIN A;  3QA8 A;  1RAX A;  4LJP B;  2IBI B;  2M4N A;  4JQW C;  4MJS B;  4EZK A;  5IA7 A;  3ZVV A;  2GBK A;  2JZZ A;  2NBV B;  4KV2 A;  2JPH A;  3DOW A;  3A9J A;  2KZR A;  1OGW A;  1P1A A;  4GN1 A;  2O2V A;  3D32 A;  2MBO A;  2FIF A;  4IWO A;  3P2B A;  1G6J A;  3T9L A;  2V1Y A;  2BWF A;  3OJ3 A;  3UIP B;  1NBF C;  1OQY A;  5D94 A;  3UGB B;  4G0N B;  3A4R A;  2K25 A;  3EFU A;  2NVU I;  2NBW B;  2Z0E B;  4NAW A;  1P9D U;  1WGG A;  2XEW A;  4M8N A;  4JGH B;  1NDD A;  2DAF A;  2BGF A;  4MGZ E;  1OEY J;  2N1V A;  4DXA B;  1E8Z A;  3OAW A;  4GOC A;  3QK0 A;  4AJW A;  4GDL B;  1WM3 A;  2Y5B B;  2MW5 A;  5E6P A;  2KMA A;  4II2 B;  2MQJ A;  3DBR I;  4WAA A;  4PYU A;  1WGH A;  2LJ5 A;  5CHV C;  3L54 A;  1LM8 B;  2KWC A;  2ZNV C;  1TZ1 A;  3CMM B;  4I6L B;  3V60 A;  3X0W A;  3UF8 A;  2FCM A;  1WX8 A;  1KLV A;  1Z5S B;  4K7U A;  1P3Q U;  1WH3 A;  2ZVO A;  3NS8 A;  2KDE B;  3APC A;  4IG7 B;  2Z59 B;  3CSF A;  1WXA A;  3A9K A;  3I3T B;  2L3Z A;  4JLC A;  4W9K A;  4X57 B;  3V61 A;  2DYM A;  3TBL D;  2CHW A;  2Z0D B;  3K9P B;  1UZX B;  3AU4 A;  2WYQ A;  4I6N B;  4II3 B;  2M8S A;  2KX0 A;  4GMV A;  3ZIM A;  3H6N A;  1CMX B;  1WYW B;  3GZN I;  4MJS A;  3AUL A;  3IG3 A;  3ALB A;  2KAN A;  2MBH A;  2MLB A;  2DZI A;  1WXV A;  2GMI C;  2K6D B;  2FCS A;  1V80 A;  2KX3 A;  2MP2 B;  1UEL A;  4KDL B;  3N3K B;  3ZDM C;  4ANV A;  1YJ1 A;  4HDQ A;  2PPH A;  1WGR A;  2LRW A;  4GDK A;  2DYO A;  4RM8 A;  5DPT A;  4HPL B;  4EKU A;  2GOW A;  2LGY A;  4W9E A;  4DHZ E;  3WAL A;  2J7Q B;  1ZW7 A;  5JHA A;  4DHZ B;  5D6J B;  1S3S G;  4LCD E;  3PRP B;  2DZK A;  2O2V B;  2J0J A;  4A3P A;  1GG3 A;  1IYF A;  3VUX A;  3EHV A;  2N4F A;  2FCQ A;  1PQS A;  3QJZ A;  1WI0 A;  4ZRK A;  5CHF A;  2KO3 A;  4LDT D;  2REX A;  1EUV B;  3SU8 X;  3S2A A;  1WZ3 A;  4BOS C;  4NAW B;  1WJU A;  5G2N A;  1IP9 A;  3BY4 B;  1Z2M A;  4LDT B;  2N7E A;  4ZRJ A;  3K9O B;  2KJ6 A;  3PS6 A;  1GC7 A;  3IVF A;  4YL8 A;  1TGZ B;  4NQK E;  5DPS A;  1UBI A;  2CHZ A;  2CHX A;  3WA0 A;  4BVU C;  1S1Q B;  5E6O A;  2LVQ A;  2KD0 A;  3U7D A;  4MDK E;  1RLF A;  3VTV A;  4HCP B;  3L08 A;  1E7V A;  4E74 A;  3ZKJ C;  1GNU A;  1BT0 A;  3O65 B;  4WWN A;  2GBR A;  2JZ3 B;  2L76 A;  2YVC A;  2XK5 B;  3QCA A;  1YD8 U;  1WGY A;  2KTR A;  1Q0W B;  5LXH A;  1WXS A;  3U8Z A;  4ZDV A;  3ML9 A;  4HPM B;  2L00 B;  3VXW A;  3JSV B;  1WXM A;  4GU2 A;  2KNB A;  4MSQ B;  4DDI D;  1J19 A;  5GMV A;  1VCB A;  1V9J A;  3KUD B;  1OEY A;  2UWQ A;  2RD0 A;  3A9K B;  5C23 A;  3KYC D;  3RZF A;  2K8C A;  3TJP A;  4A20 A;  4EEW A;  2IYD B;  3R3M A;  4G11 A;  3DCG A;  2DZM A;  3OJ4 B;  2MP2 A;  3B08 A;  4FBJ B;  3DDC B;  3GOE A;  2IY0 B;  2L0T A;  3AI5 A;  4N9F 4;  2ZZP B;  1U4A A;  3NOB A;  4PYZ A;  3B0A A;  3RD2 A;  2FID A;  4W9D A;  4ZRI A;  3ZUN A;  4DBG A;  1NI2 A;  2CR5 A;  3Q3F A;  1R4N I;  2JRH A;  2OJR A;  2WWZ A;  4HVB A;  2KXJ A;  2MSE D;  4NNJ B;  2LWP A;  4KVG B;  4W9L A;  3TL5 A;  2N9P C;  4G50 A;  4FN2 A;  4GDK B;  1J0G A;  5TR5 A;  1TTN A;  3IBE A;  3PHW B;  4F7Z A;  3LJ3 A;  5CTR C;  4WJP A;  3WAM A;  1D3Z A;  2EKE C;  2KLG A;  1OTR B;  2LZ6 A;  1H8C A;  2LD9 A;  3TMP B;  5J17 A;  3VQI A;  2V4L A;  4AP4 C;  5JZE B;  1L2N A;  4F1S A;  3KUC B;  2D07 B;  3WAN A;  3CF6 E;  3L17 A;  4FLH A;  2RR9 A;  3ZNI D;  1WR6 E;  1WJ4 A;  2KKC A;  3PT2 B;  4RMA A;  3A33 B;  2KWV B;  2XK5 A;  4MEM A;  1V81 A;  4MM3 A;  2N9E B;  1KOT A;  2L7R A;  3IHP C;  4WWP A;  3VHT C;  2C9W B;  2KQ7 A;  1GJZ A;  4IWP A;  3C0R B;  1UBQ A;  4PS8 A;  2QHO A;  2GBJ A;  3W1S C;  3JSV A;  3PRZ A;  4BKS A;  2K6Q A;  1K8R B;  2MA9 B;  2ZPN A;  2L05 A;  4TKN A;  2NCN A;  1WM2 A;  1WJN A;  2KK8 A;  4FJY A;  3QAQ A;  3NY5 A;  3V6C B;  1LFD A;  2K1F A;  2JY6 A;  2KTR B;  4FHK A;  4DHJ D;  2MWS B;  4FAD A;  3KW5 B;  4EZJ A;  3W1Y A;  2KJH B;  2G45 B;  1KM7 A;  3H9D A;  2W9N A;  4DHJ B;  1I35 A;  2FNJ B;  5J2R A;  2WDT B;  4IW0 A;  1IPG A;  1WRD B;  4PS3 A;  4W9C A;  4OVV A;  3NZS A;  2ASQ A;  1WZ0 A;  1XT9 B;  2B3A A;  2OOB B;  2C7N B;  2MRP A;  2JRI B;  3VTU A;  3ZO5 B;  5C1Z A;  1WMH B;  2V3S A;  3QAR A;  4E3C A;  1WJ6 A;  2D2Q A;  2KJR A;  4W9J A;  4FJV B;  3ZRF A;  5IAA C;  3HM6 X;  4ANX A;  4WJQ A;  4E71 A;  5DPW A;  2KLC A;  3NHE B;  2DHZ A;  3H7P A;  4M0W B;  2KC1 A;  3PLU A;  4MSM B;  1E8Y A;  2EMT A;  2D10 A;  4IC7 B;  4MGY E;  3M3J A;  2AL6 A;  3VFK A;  2RPQ A;  4ICU A;  5D7G A;  2WX1 A;  3M62 B;  5AZG A;  4W9F A;  4MH0 E;  5DCN A;  1GC6 A;  2JXX A;  2KOX A;  3R7Q A;  2LVO A;  2A4Z A;  4TUU A;  4WJN A;  2HTH A;  2I1K A;  1WX7 A;  5J18 A;  4TV3 A;  2R2Q A;  3UQA A;  4NJ7 A;  4KZ0 A;  1XD3 B;  2JVC A;  2C5L C;  2FUH B;  2KHW B;  2KTF A;  3PVL A;  3PTF C;  5AZH A;  2KDI A;  4IWQ A;  5KHO A;  4W9H A;  2N9X A;  3L16 A;  3SDL C;  3PPA A;  4K81 A;  3SD5 A;  3DBS A;  5JH5 C;  2G4D B;  3PRM B;  3KH0 A;  2KDB A;  2ZCB A;  4HWI B;  3PRE A;  3QIJ A;  5BO4 B;  5L95 C;  2JF5 A;  3ZDT A;  5L83 A;  1T0Y A;  2EMS A;  1YX6 B;  4BKS D;  5AZF A;  4HLE A;  3DPD A;  4P7I A;  3VUY A;  2CU1 A;  3A4S C;  4CYE A;  5DPR A;  2PE9 A;  2DEN B;  4KIK A;  1ISN A;  3IFW B;  3WAP A;  4HK2 A;  3EEC A;  1ZGU B;  3DBL I;  2K8B A;  2BYV E;  2LXA A;  3RYT A;  2ZNV B;  3U30 A;  5KHQ A;  1WE6 A;  2DAJ A;  2GBM A;  3JW0 X;  3RUI B;  3HIZ A;  1E8X A;  2KDF B;  3VDZ A;  4XZ4 A;  2FAZ A;  2NS5 A;  1P0R A;  1AAR A;  4K7W A;  2MX2 A;  2WX0 A;  3VTW A;  2JWZ A;  1P98 A;  1WMH A;  3CST A;  1UGM A;  4EZL A;  3NZU A;  1V5T A;  3HK0 A;  3R66 C;  3TCA A;  2PEA A;  2RSU A;  3VH4 B;  2K8H A;  1Y8R C;  2LVP A;  2LRU A;  1VD2 A;  2O6V A;  2XBB C;  3L13 A;  4HCN B;  2G3Q B;  4NQL B;  3VUW A;  2D3G A;  2KFJ A;  3QWZ B;  1V86 A;  3ZNZ B;  1MG8 A;  2J0M A;  2N7D A;  1UH6 A;  3DBH I;  3KUZ A;  4KSK C;  3N32 A;  3ZNH B;  4G3X B;  3Q3J A;  4GSW A;  2AWT A;  1Q1O A;  1X1M A;  2N1W A;  3ZNG C;  4BOZ B;  2BYE A;  3H7P B;  1E7U A;  4WQO B;  2NBU A;  4BKG A;  3RT3 B;  1R4M I;  1V5O A;  3OLM D;  1WR1 A;  3B1L X;  3TIX A;  4BKT A;  2VRR B;  2BPS A;  1HE8 A;  3ZTD A;  2I1J A;  4NY0 A;  2ZCC A;  1YIW A;  2HD5 B;  4ANW A;  2KFK A;  3ONS A;  2UYZ B;  3QC8 B;  4TQ0 A;  2R2O A;  4NPN A;  4GB9 A;  3A1Q B;  5FR6 A;  2AYO B;  2PE6 B;  3JYU A;  1EF1 A;  4AUQ C;  3APD A;  1RFA A;  4ASW C;  2YLM A;  2A5U A;  2IO3 B;  2MBB B;  3WIM A;  5AEK B;  4KSL C;  5E6N A;  1KJT A;  1J8C A;  4MEL A;  1UD7 A;  3EC8 A;  4KZC A;  2AL3 A;  4AWJ A;  1A5R A;  2NPT B;  1TBE A;  3RZW C;  5CX3 A;  1LXD A;  2RGF A;  3PHX B;  1F9J A;  2IO1 B;  2LGD A;  3RCZ A;  3T8M A;  1WIA A;  4FJZ A;  4LJO B;  2MBE A;  4I6P A;  2L8J A;  4ICV A;  4M8M A;  3X23 A;  3HHM A;  3M95 A;  2FCN A;  3W1S A;  2LAS A;  4K1R B;  4HJK A;  4KIK B;  3HM3 A;  5LLI A;  3H1U A;  3UIO B;  1WGD A;  2DZJ A;  2MBQ A;  1WY8 A;  3QX1 A;  4B6W A;  3UQB A;  4FHJ A;  4BFR A;  3DQV A;  3PZD A;  1E90 A;  4PS7 A;  1LQB A;  5D2M B;  4HDO A;  2BWE S;  4W9G A;  3L10 B;  1V2Y A;  3QQ8 B;  4GIV A;  4XC2 A;  3QHT A;  4TQ1 A;  3VH3 B;  1C1Y B;  3LDZ E;  4OVU A;  3VAW A;  4FUL A;  4GXB A;  1EF5 A;  5HKH A;  1SIF A;  4JIO U;  4J6I A;  2BKF A;  2DX5 B;  2C60 A;  2ZPY A;  3MHS D;  2ZVN A;  5CHW A;  2D11 A;  4AJY B;  4ZYN A;  2O6V D;  3VVW B;  2CS4 A;  1XQQ A;  2C7H A;  2AEH A;  3M63 B;  4F8C B;  1I42 A;  4EOY A;  2IO0 B;  1Q5W B;  1WX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...