5FR6A

The structure of polycomb uld complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
83
Chain Sequence
DDEIISLSIEFFKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization
pubmed doi rcsb
molecule keywords POLYCOMB COMPLEX PROTEIN BMI-1
molecule tags Transcription
source organism Homo sapiens
total genus 21
structure length 83
sequence length 105
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5fr6A00
4IUMB 2KX0A 2NR2A 3H7PB 1V5OA 3PPAA 4BKSA 1LXDA 2K8HA 3QARA 2JVCA 3VVWB 1C1YB 4MGKE 5KHQA 4WAAA 2KVRA 2FIFA 2L05A 1VCBA 4PYZA 3V60A 1WGRA 2Z59B 3RUIB 1YQBA 2A4ZA 2DYMA 3NHEB 3VUYA 3Q3FA 2KTRB 3DOWA 5KHOA 1KLVA 2CS4A 3DVGY 3SDLC 4RM9A 3ZRCA 2BWFA 4DDGD 2JZZA 1RFAA 2N9EB 2PJHA 5G2NA 2KJHB 3X23A 5TR5A 3UQAA 2D2QA 2KXJA 2KJ6A 2KX3A 3DVGX 3X0WA 4AUQC 1YJ1A 2RD0A 1R4NI 5DPRA 4ZRKA 4HWIB 5D94A 4B6WA 1XT9B 5JZEB 4CO7A 1FXTB 3A1QA 4ZRJA 2DAFA 3CSFA 3N30A 5D7GA 1E7VA 2LASA 1G6JA 1WYWB 4KIKA 4LDTD 1WMHB 2LI5A 1E8ZA 1EF1A 2ASQA 4IW0A 4XC2A 3RD2A 3V61A 4MJSA 4F8CB 4A3PA 3QWZB 4KZCA 1EO6A 1WRDB 2L8JA 3CMMB 4W9FA 5G55A 4ANVA 3PT2B 1S1QB 3R66C 4HPMB 2RPQA 3ZKJC 4FHKA 3L13A 3NZUA 1WXMA 3H6NA 3SHQA 1F9JA 2JT4B 2I1KA 1GJZA 2K6DB 3LDZE 3P2BA 2DX5B 4GDLA 5JH5C 5IAAC 3CSTA 1I42A 1ISNA 4LDTB 4FJZA 1WGYA 2MBQA 3R7QA 2FCSA 2N7DA 4NJ7A 3VUXA 3ZRFA 2J0MA 1L7YA 2C5LC 4GN1A 4RMAA 1L2NA 2KD0A 2C9WB 1GC6A 1V81A 1ZKHA 3VXWA 2R2QA 3OJ3A 4FADA 3VUWA 4MEMA 3AI5A 1TBEA 2AL3A 3HK0A 2Z0EB 3ZNID 3VTVA 3ZNZB 3PRPB 2REXA 2WWZA 4HJKA 2IO2B 3BY4B 2WX1A 1GC7A 2FCNA 2L76A 4HLEA 1WX9A 2QHOA 3NZSA 2BWES 2KO3A 2L3ZA 3UIPB 3V6CB 3VH3B 1A5RA 2UYZB 3JW0X 2BGFA 4JIOU 3RT3B 2JPHA 2NBUA 2HJ8A 4EKUA 2NS5A 3JSVB 2JRIB 2M4NA 1RLFA 1I35A 2FCQA 3A9KA 3PGEA 1H8CA 3W1SA 3U30A 4FA6A 5BO4B 2C7HA 1WFYA 4MSQB 2MBBB 2KDFB 1UD7A 3GZNI 2ZNVB 2AL6A 4DBGA 2GBJA 2KZRA 4BKGA 2MBHA 2LVPA 4EUTA 2D10A 3ML8A 3SU8X 2LXAA 3KYCD 1KM7A 2L00B 3IG3A 2NBVB 2LVOA 3ECIA 1XD3B 3AU4A 3DBLI 2KJRA 2MP2A 3R7RA 3KW5B 4NAWA 2GOWA 1KJTA 4BBNC 2LVQA 3R3MA 3O65B 3VH4B 4GB9A 4WWNA 3VQIA 2LD9A 2C7NB 3ONSA 4W9HA 3D32A 2DENB 2G45B 3AXCA 3KUCB 3A9JA 2KQ7A 2OOBB 1WJUA 3QX1A 2DZKA 1V86A 3PLUA 2KWVB 2MX2A 5EDSA 4CYEA 1S3SG 4G3XB 2V4LA 1J8CA 4G11A 5AEKB 3H7PA 1AARA 1J19A 3I3TB 2K1FA 3RCZA 5DPTA 2MRPA 4K7WA 4B95A 1C3TA 3ZW3A 1OQYA 3PHWB 4I6PA 1WM2A 3PVLA 2LRUA 2WDTB 4G0NB 2AEHA 4KV2A 2I1JA 5AZHA 1SGHA 2BF8B 2KTRA 2IO3B 4PS3A 4WJOA 1WIAA 2KMAA 5CX3A 5GMVA 3ZDTA 4URKA 4GXBA 2FNJB 5E6OA 2DAJA 4BBNF 1E8XA 2C7MB 4DHZE 4FBJB 3IFWB 4GSWA 4BKTA 4ANUA 3L16A 1IP9A 1UZXB 4GMVA 2LUEA 2XK5B 4EFOA 3KUZA 5E6PA 4BVUC 3LJ3A 4GOCA 4EZKA 3PLVA 1KOTA 1P98A 2CHZA 1WMHA 3T9LA 1GUAB 3ZDMC 2IO1B 1YD8U 4IC7B 4YL8A 2MBEA 1EF5A 5LLIA 2GBKA 2YLMA 3PRZA 3IBEA 2KC2A 4JL9A 3L10B 1P3QU 2N9PC 4E3CA 3KYDD 5IA7A 2BKRB 2BYFA 4OVVA 3ENEA 5DPWA 2MQJA 3QC8B 3DVNV 4M8MA 3ZLZA 5D2MB 2AWTA 4HCNB 3L17A 4ICVA 3H7SA 5JHBA 3HM6X 1WI0A 4NNJB 3ALBA 1Q1OA 3U8ZA 3EECA 4AP4C 4ICUA 2LRWA 3W1SC 1GNUA 4BFRA 2L0TA 3EHVA 4JQWC 3KVFB 4ASWC 3IVFA 3TJPA 3NS8A 4HDOA 2GBMA 4K7SA 4AOFA 2CKHB 4FLHA 3PS6A 1SIFA 2C60A 1TGZB 2ZEQA 1OGWA 3HIZA 3C0RB 3L0WB 3UGBB 1T0YA 3OLMD 4W9JA 2KFJA 5FR6A 5C23A 5LXIB 4NJ6A 3JSVA 1WXVA 2N1VA 4KVGB 1WX8A 3IHPC 2MCNB 3BINA 3T8MA 5J2RA 2D07B 2IY0B 2WX0A 3VFKA 2RGFA 4I6LB 1H4RA 3APDA 2VRRB 3WA0A 3Q3JA 2MSED 2LZ6A 2BPSA 4ANXA 2NPTA 4TV3A 1X1MA 4FHJA 3WIMA 4IWOA 2MBOA 4F7ZA 4X57B 1NBFC 4LCDE 2K39A 4XZ4A 2ZJDA 3PSEB 1IPGA 2K8BA 2KDIA 3MJWA 2CHWA 2KQSA 2KFKB 2IYDB 1V49A 2N9XA 2DYBA 2PE6B 3MTNB 3HHMA 2LGXA 1E90A 4MGYE 2KWCA 2PPHA 3N32A 5LXHA 2GMIC 2CU1A 4HDQA 4NQLB 3M3JA 3CF6E 1EUVB 4PS8A 3QQ8B 2KTFA 2KMCA 4TUUA 1SE9A 2KDEB 1V80A 4PYUA 2KDBA 3TCAA 2L0FA 4XX5A 2MLBA 4II3B 1GG3A 1E8YA 2K8CA 2CR5A 2FCMA 3DCGA 1RRBA 1WM3A 4MM3A 3V62A 3QK0A 2V3SA 3JYUA 4IWPA 1OEYJ 3B1LX 4KSLC 3APCA 1VD2A 5JHAA 1WF9A 3VTUA 3ZIMA 1OEYA 3A33B 1E5WA 2D3GA 2UWQA 4LJPB 2EMTA 2FUHB 2K25A 4B9KA 3ZUNA 1TTNA 4I6NB 3DDCB 2IBIB 3S2AA 1UELA 2KC1A 4MSMB 4ZDVA 1LQBA 1IYFA 1WZ3A 2XK5A 2KK8A 3DBRI 3QJZA 1CMXB 2DZJA 4MH0E 4E71A 2PEAA 4P7IA 1WR1A 4PS7A 2ZPYA 5L95C 2LXCA 4W9KA 4IWQA 2O6VD 2NVUI 4KDIC 1TZ1A 1YX6B 1WZ0A 2JXXA 2O2VB 4GIVA 4HK2A 4M0WB 2MA9B 3NOBA 3WAOA 2R2OA 2YVCA 3UIOB 2JF5A 4NY0A 2N7EA 1XQQA 2MWSB 2KOXA 3ZVVA 3A9JB 3DPDA 1NI2A 3TL5A 2KANA 2JUOA 3PREA 2ZPNA 4BOSC 4KDLB 4N9F4 1P0RA 2O6VB 3KH0A 5CTRC 5C1ZA 3SD5A 4A3OA 2GBRA 4BKSD 4EZJA 3DQVA 1Q5WB 3PV1A 3WANA 1NDDA 2IY1B 1YX5B 3WAPA 4AWJA 3TIXA 1Q0WB 2ZNVC 4GDKB 2FAZA 4W9CA 4WJPA 2IZVB 2CHXA 1V5TA 4ZRIA 4HCPB 3APFA 3L08A 3B0AA 3V6EB 2B3AA 1Z5SB 2XEWA 4OVUA 4A20A 4WQOB 5AZFA 3JVZX 3UF8A 4DHJD 2DZIA 2IO0B 2KLCA 1OTRB 4CHKA 1UBQA 1Z2MA 5E6NA 2DZMA 4DWFA 4LJOB 3A4SC 2J7QB 4ANWA 4IM3A 1WH3A 1WY8A 2ZZPB 3B08A 4WWOA 3W1YA 1WE7A 1WJ6A 4ZYNA 1V9JA 4WJNA 2D11A 2JWZA 2M1MA 4DHJB 1WJ4A 4FJYA 4IM2A 4EZLA 1WE6A 2M8SA 4MDKE 3VAWA 3PRMB 2KN5A 3K9PB 3WALA 1WJNA 3A1QB 3MHSD 1UGMA 1PQSA 2WYQA 4KIKB 4W9LA 3ZNGC 2EKEC 1J0GA 4GU2A 3EC8A 4MJSB 3VHTC 2KFKA 3H1UA 1D3ZA 1LFDA 1P9DU 2A5UA 2XBBC 3GOEA 1QZEA 5CHWA 5DPSA 2N4FA 2HD5B 2KLGA 3RZWC 1BT0A 3DVNU 3ZTDA 1Y8RC 1JRUA 2DHZA 4W9DA 2M17A 5J18A 2N1WA 1WGDA 1K8RB 1UBIA 4GDLB 1E7UA 1WR6E 3M63B 4MGZE 4IG7B 1P1AA 4JLCA 4DDID 1UH6A 4KSKC 5D6JB 2BYVE 1LM8B 1M94A 1MG8A 1R4MI 4FULA 5J17A 2V1YA 5HKHA 2GBNA 4K81A 2LGDA 2RSUA 4AJWA 3ZTCA 3EFUA 3NY5A 3VDZA 3H9DA 1ZGUB 3DBHI 2G3QB 2KNBA 4E74A 3PZDA 5AZGA 1V2YA 2M0XA 5DCNA 4JGHB 3TMPB 3PTFC 2K6QA 3AU5A 1U4AA 4NPNA 4G50A 3OAWA 4WWPA 2JZ3B 2LGYA 2NCNA 2Z0DB 3A4RA 3UINB 2G4DB 3DBSA 3RYTA 2LJ5A 3K9OB 2J0JA 2G4SA 3ML9A 1WX7A 2W9NA 3N3KB 3QAQA 1E8WA 2HE7A 2RR9A 4TQ1A 3PHXB 3TBLD 2ZCBA 4NQKE 4TKNA 4W9EA 2NPTB 3A9KB 3M95A 4EEWA 4HVBA 1WXSA 3RULA 3ZNHB 1WGHA 2Y5BB 2NBWB 1WGGA 2JY6A 2EMSA 4KZ0A 3HM3A 2FIDA 4WJQA 3WAMA 2O2VA 4BOZB 3UQBA 4II2B 4K1RB 4TQ0A 3OJ4B 3QA8A 3KUDB 2MW5A 2BYEA 2DYOA 4J6IA 1ZW7A 1WXAA 3RZFA 3QIJA 2LWPA 1V6EA 4IM0A 2JRHA 4DK5A 4GGQA 4HPLB 2ZVOA 2MP2B 2OJRA 4W9IA 2O6VA 2PE9A 4FJVB 1YIWA 4F1SA 4NAWB 3ZO5B 4K7UA 4DHZB 3M62B 2ZVNA 3L54A 3QCAA 5CHFA 3U7DA 3QHTA 4MELA 5CHVC 2KHWB 4MGIE 2HTHA 4FN2A 5L83A 3AULA 2KWUB 2BKFA 2AYOB 4DXAB 4GDKA 1HE8A 4HXDA 2KKCA 4EOYA 2J0KA 2L7RA 4W9GA 3VTWA 1RAXA 4AJYB 4RM8A 2ZCCA 4M8NA
chains in the Genus database with same CATH superfamily
2KX0A 4OZBA 3I9V1 2JVCA 3VVWB 4MGKE 4RF0A 2FIFA 2L05A 1VCBA 1YN3A 1YQBA 3AMZA 3DVGY 2QDFA 4DDGD 2JZZA 1RFAA 2WXJA 4USAA 5G2NA 3UQAA 5HI1A 2KJ6A 1PGAA 3KLSX 3IT4B 2RD0A 1R4NI 5IOIA 4US9A 5D94A 1E7PB 1FXTB 2DAFA 3N30A 1WXQA 1EF1A 4C7ZA 2WXKA 4F8CB 3QWZB 1EO6A 1QOFA 1YN5A 4D2KA 4ANVA 1WWTA 2KN4A 3H6NA 1F9JA 2I1KA 3KWVA 1I42A 3P2BA 2DX5B 4WAFA 1ISNA 4FJZA 2N7DA 4NJ7A 3ZRFA 4P16A 2C9WB 1V81A 3VXWA 1OQQA 1GPXA 4PK1A 2PKOA 1F0ZA 4OZCA 3ZNID 3ZNZB 4BAXA 3Q8EA 3DWMA 1GC7A 2FCNA 2L76A 1WX9A 3NZSA 1PGXA 2L3ZA 1A5RA 3JW0X 3RT3B 2NBUA 3LYYA 1I35A 2JRIB 1RLFA 2FCQA 3NVWA 1FXIA 4MSQB 2Y3AA 4ZRPA 4BKGA 3U4EG 1KFYB 2LVPA 5FK9C 3ML8A 1WYGA 1VZ6A 2L00B 3IG3A 3MC9A 1KLUD 4MH8A 1XD3B 4P1BC 2M0AA 3Q2AC 4NAWA 5C2TB 4BBNC 3IAS1 1FNUA 1T0QC 4JX1C 4W9HA 4JWUC 2G45B 3AXCA 1JROA 3AE2B 4XWTA 1DOYA 2YEPB 2M19A 4K3BA 2V4LA 1FCCC 2K1FA 3AEBB 1JMLA 1C3TA 5EE1A 4XGAB 3HUIA 2LRUA 1XLOA 1KF6B 1UF0A 4KV2A 3RFZB 2IO3B 5CX3A 5GMVA 2ONQA 4URKA 2JZPA 2FNJB 1VRAB 2DAJA 2GLSA 1E8XA 4DHZE 3BIID 3IFWB 4ANUA 1QOBA 3KUZA 4GOCA 4S17A 2WXPA 1V8CA 1P98A 2IGGA 1GUAB 1GB4A 4IC7B 2GBKA 3GZNB 3PRZA 2KC2A 4JL9A 2RDGA 3BVZA 3NZ3A 5IA7A 2BYFA 4OVVA 3GE3C 3DVNV 1J7BA 3ETRA 5D2MB 2AWTA 1CQVA 5JHBA 1KH0A 1WI0A 1FIQA 2H89B 2LRWA 3W1SC 4XDDA 4ASWC 1AN8A 3TJPA 3NRZA 1HQRD 2GBMA 2LJIA 5I4DA 1SIFA 1TGZB 1OGWA 2XN9C 3C0RB 1T0YA 2WXGA 1WX8A 3Q69A 3SFEB 2WX0A 5HG2A 3Q3JA 5TSSA 4TV3A 2V9HA 4IWOA 2MBOA 4F7ZA 1NBFC 2FUG1 2ZJDA 2KDIA 3MJWA 2CHWA 1F2RI 2KFKB 4MT5A 1WGKA 3MTNB 3HHMA 1ZXIA 5D3IB 2PPHA 2K5PA 1FM0D 4NQLB 1IBXB 1EUVB 4PS8A 1D4BA 4TUUA 3PZ7A 4II3B 2XNAC 2WS3B 1HZ6A 1RRBA 4MM3A 3V62A 3BWUD 4KSLC 4WH4A 1JCKB 5BMHA 1FNVA 3A33B 2D3GA 2UWQA 4EE2A 1SIJA 2FUHB 1HTOA 4MSMB 4C56C 1LQBA 1YOVB 4C80A 3DBRI 2DLBA 4KGTA 1BUIC 1CMXB 3AE5B 1ET9A 2OHFA 3BVMA 2PEAA 4HPPA 2QILA 3TSSA 5JXVA 1TZ1A 1YX6B 1WZ0A 4KKJA 1DOXA 2YVCA 1C78A 2UU7A 3UIOB 2JF5A 4NY0A 1C77A 1XQQA 4C4VA 3ZVVA 4BOSC 1MG4A 1P0RA 4KGRA 5CTRC 2BB5A 4IKGA 4BKSD 3PV1A 3R2TA 1NDDA 3N1YC 2PTLA 3BYTB 1QT9A 4AWJA 2I38A 2ZNVC 3P42A 2WDVB 4W9CA 4WJPA 1MFWA 2K9XA 3MC8A 3B0AA 3RNFC 2B3AA 2LFIA 2Z8LA 4LNFA 3JVZX 2KAJA 4DHJD 3OG5A 1XLQA 2MJEA 5E6NA 1TKGA 4DWFA 2JYTA 2QIEB 2J7QB 3W1YA 1WJ6A 1IGDA 2JWZA 1TZOA 1C4AA 4FJYA 4IM2A 2N0SB 3PRMB 2KN5A 1L4DB 1NEKB 1WJNA 1PQSA 2WYQA 2EKEC 1J0GA 3HVZA 1LFDA 1P9DU 5DPSA 3P63A 2FBWB 3ZTDA 4W9DA 4MACA 1E7UA 1WR6E 2VZKB 2WXFA 2W55A 4JLCA 1PFDA 5IKCM 5D6JB 1MG8A 4FULA 1XLPA 2ZW0A 4AJWA 3H9DA 2K3UA 4YWGG 3PTFC 1NYRA 3AU5A 1Y56A 2W3SA 4NPNA 2N9KA 4G50A 3OAWA 2Z0DB 3A4RA 3UINB 2QC8A 4H2AA 3DBSA 4LNKA 2J0JA 1QOAA 3ML9A 2BS2B 5BYSA 3N3KB 4TQ1A 3MFGA 1AWDA 2AQ3B 2ZCBA 1R4NB 4W9EA 2MEKA 2Y5BB 4KGSA 2EMSA 3HM3A 4WJQA 2WXMA 1LGRA 4B0EA 3KUDB 2DWQA 3QIJA 1V6EA 1EU4A 4HPLB 3L4PA 1YIWA 4NAWB 1HXYD 3AH7A 5CHFA 4OW0A 3QHTA 4MGIE 2HTHA 2QMTA 2BKFA 5E6JA 4HXDA 2KKCA 4EOYA 2L7RA 1VR9A 1C76A 1RAXA 1ZUD2 2ZCCA 4M8NA 5MPOA 4BKSA 1C1YB 5KHQA 5LNK1 4DXGA 3RN9C 1STEA 1N61A 2Z59B 3NHEB 2JXTA 4Q2JA 3Q3FA 5KHOA 1KLVA 3SDLC 4RM9A 2KT7A 2PJHA 3X23A 2KJHB 2D2QA 2ZW1A 2KXJA 3AE1B 3X0WA 2BS4B 1YJ1A 4ZRKA 5DPRA 4B6WA 1L0VB 3CSFA 2AQ1B 5D7GA 1ZPSA 1G6JA 1WYWB 2TSSA 3ABVB 2ASQA 4XC2A 3E56A 2Y5CA 2L8JA 4RF1A 3R66C 2RPQA 1CK1A 3L13A 4FHKA 1WXMA 1VZ8A 2INCC 1GJZA 1TY0A 3CSTA 1WGYA 1ZDXA 5D3DA 3TEXA 2FCSA 2J0MA 1L7YA 3E9SA 4RMAA 2KD0A 1ZKHA 2R2QA 3OJ3A 4FADA 1VDVA 3AI5A 1TBEA 1MJDA 3VTVA 1UUPA 2IO2B 5IN7A 1L4ZB 2BWES 3V6CB 1YJIA 2UYZB 2INDC 4LNNA 2JPHA 1NENB 3W1SA 1F2RC 1LO5D 1WFYA 2QSDA 4N58A 3AEAB 1TS4A 2MHJA 4DBGA 2AX5A 2GBJA 4M02A 4EUTA 3SU8X 2LXAA 3CIRB 1KM7A 1PUTA 2LVOA 3ECIA 3AU4A 2KJRA 2MP2A 4WIPA 3RNEC 2X38A 3O65B 4GB9A 3RI7C 3D32A 2DENB 3KQ4A 1T0RC 3EA6A 1PGBA 3QX1A 4GLSC 2DZKA 3PLUA 1L0XB 3AE3B 4G3XB 1J8CA 4G11A 1J19A 4WURA 3RCZA 5DPTA 3ZW3A 1P7EA 4I6PA 1WM2A 3PVLA 4G0NB 4WWMA 2AEHA 1JWUD 5AZHA 1SGHA 2BF8B 2KTRA 1ENFA 1DYQA 1EWYC 1WIAA 2KMAA 3W5UB 1ZXHA 3U7ZA 1IUEA 3L16A 5BYRA 4EZKA 5E6PA 4BVUC 2L1AA 2K22A 3PLVA 2WGSA 3UI3A 1TY2A 1WMHA 3ZDMC 4KKIA 1TS3A 1JALA 2MBEA 5FR3A 2QEJC 2YLMA 1MHHE 2J53A 1P3QU 2N9PC 3KYDD 4C4VB 3ENEA 4S0RA 5DPWA 2E6XA 1B1ZA 4M8MA 3ZJTA 1T5XD 1SF0A 3ALBA 1Q1OA 3EECA 2WQYB 1L0YB 4ICUA 2BBCA 3RNGC 3KVFB 1TS5A 4RGNA 1EM7A 2WXQA 2CKHB 3OWEB 2WDQB 3AEDB 3HIZA 3OLMD 2GRIA 3IAM1 2VH2A 2JSVX 3AE8B 3JSVA 3AE6B 1B9RA 3IHPC 2MCNB 3BINA 3AV8A 3U2SC 2IGDA 4B0MA 2RGFA 4KX6B 1H4RA 3APDA 3WA0A 3GS2A 3WIMA 4YTMB 3LXFA 4X57B 2IYDB 2DYBA 2PE6B 1XCTL 3VR8B 1E90A 3N32A 1TYGB 2CU1A 3M3JA 1J7AA 2WU2B 1XXGA 2KTFA 2KMCA 2KDEB 5BMGA 2MJ3A 1E8YA 4TSSA 1D5ZC 3VTUA 3R8BA 2K25A 1I4GA 3DDCB 2KC1A 4ZDVA 3ZXVA 2KK8A 3QJZA 1JWAD 2DZJA 2LXCA 2WU5B 4RGOS 3NOBA 2N7EA 5AUIA 3A9JB 2JUOA 4RGMA 4N6EB 4N9F4 3U52E 1EWCA 2HTME 2SAKA 1SBBB 1FRRA 1D6EC 1BXTA 2LEKA 3WAPA 3AE4B 4ZRIA 1Z5SB 1ROEA 2XEWA 4A20A 2NTSA 3UF8A 2DZIA 2H88B 3ZJUA 2BTEA 3T3NA 1N62A 3I5JC 3IT6B 2DZMA 4LJOB 1TKYA 4IM3A 1WH3A 4WQMA 1WY8A 4J3OD 4ZYNA 4DHJB 4EZLA 4C7YA 3ZYYX 3K9PB 1D3ZA 2A5UA 2XBBC 3GOEA 4M00A 5CHWA 1YJJA 1BT0A 4IOIE 1Y8RC 3P4PB 2BQQA 2N1WA 1WGDA 3B2GA 1UBIA 4MGZE 2KVZA 5GXGB 4DDID 2YEPF 1TKEA 1R4MI 2PIAA 5J17A 2IPKD 4ARCA 3ZTCA 3VDZA 4HJGE 1ZGUB 1XCQL 4RFBA 4E74A 1E6EB 3TMPB 2K6QA 1JRPA 2IDYA 2NCNA 3PZ8A 4O1NA 2W3RA 2LJ5A 4A90A 2G4SA 1XEEA 2W9NA 2RR9A 4EEWA 2NPTB 5BYQA 3ZNHB 1WGHA 2NBWB 1WGGA 4KZ0A 2FIDA 3UQBA 2O2VA 4BOZB 3TEYA 1SJHD 1SE2A 3QA8A 4J6IA 4RH6A 2BYEA 1ZW7A 4OVZA 1I4XA 2M56B 1WXAA 3RZFA 3ZQ4A 2JRHA 1SE3A 4GGQA 2ZVOA 2MP2B 4FJVB 4F1SA 3Q3OC 3ZO5B 4K7UA 3QCAA 3BYYB 1SE4A 4HKZE 2KWUB 4YSZB 2EKIA 4DXAB 3C8YA 4GDKA 2RMMA 1HE8A 4OZAA 1PYWD 3VTWA 4AJYB 4RM8A 1VZ7A 4BFRA 4AUQC 3TUOA 1V5OA 3DHGC 1LXDA 3QARA 2KVRA 1L5PA 4PYZA 3RPFC 3RUIB 1SJED 3DBHB 3NVYA 2RDHA 2KTRB 3T3OA 3ZRCA 3VRAB 2LUMA 2N9EB 3GB1A 2I2YA 4HWIB 2HJ1A 4CO7A 4ZRJA 3Q8AA 3ZGZA 1XLNA 4LDTD 1WMHB 2LI5A 2DNFA 1K51A 5T8IA 1WRDB 5G55A 2WNMA 3DHIC 2EELA 4HPMB 2MH7A 3NZUA 2JT4B 2K6DB 4GDLA 4AS1A 5IAAC 2JYEA 2MBQA 3AE9B 1L2NA 2R61A 1GC6A 1A70A 3B9JA 3VUWA 4JWSC 3HK0A 2Z0EB 3PRPB 3ZXRA 4M01A 3BY4B 4LLGM 2WX1A 4AQ7A 1SEBD 3NUHB 4BZAA 1QQRA 4EKUA 4HRSA 1V1OA 3IXSA 3GP7A 3JSVB 2M4NA 3A9KA 4YTNB 3PGEA 1H8CA 1RWSA 3U30A 4FA6A 2MBBB 3GZNI 2ZNVB 2BYTA 2B76B 3MJ5A 1QF6A 2LHDA 1IGCA 3DBLI 3P4RB 4HEA1 3KW5B 3WCQA 2GOWA 1DOIA 1KJTA 1ESFA 2LVQA 3VH4B 1HA5A 3KUCB 3N1XC 3A9JA 4L2YA 1QOGA 2KQ7A 4N59A 2OOBB 1V86A 2MX2A 4CYEA 2WDRB 1JWBD 3C19A 1MHXA 3H7PA 1AARA 3I3TB 4K7WA 4B95A 2BT6A 2IGHA 2I1JA 1EU3A 2ACZB 4C00A 3AE7B 2N7JA 4PS3A 3ZDTA 4GXBA 2WXHA 2C7MB 4NJCA 3Q14C 4BKTA 1IP9A 1UZXB 4GMVA 2LUEA 3EUB2 3LJ3A 2BS3B 1KOTA 3T9LA 1L6UA 2IO1B 1YD8U 3Q8CA 4YL8A 1EF5A 3IBEA 2WP9B 3L10B 2PW9A 3ZLZA 2L83A 1K53A 3L17A 3P4SB 4ICVA 2Q5WD 1I4PA 3HM6X 1E0ZA 4CQNA 4FXCA 1GNUA 3VR9B 1ET6A 3EHVA 4NAMA 4RGTA 4JQWC 4UDUC 3IVFA 5BMIA 3NS8A 3AECB 2LMCA 4AOFA 3PS6A 2BB6A 2PLPA 3RNAC 5FR6A 5C23A 4TMAB 4NJ6A 5HFYA 2N1VA 1ACCA 4KVGB 5J2RA 3RNCC 2WXNA 2WXOA 3LB8C 3ZJVA 2VRRB 4YSYB 2BPSA 3TEWA 3EGRA 2NPTA 4LCDE 3PSEB 2K8BA 4XWWA 3O13A 2N9XA 5H92C 4MGYE 2KWCA 2GMIC 1NI3A 1D5XC 3PO0A 1M4VA 4RCOA 2PVOD 4YXDB 3QQ8B 1SE9A 2HDEA 3TCAA 3FKYA 2MLBA 4XX5A 1GG3A 1KLGD 3DCGA 5EE9A 4A8XC 3Q6BA 3QK0A 1OEYJ 3APCA 2RPVA 3KWLA 3ZIMA 1E5WA 1SSNA 2EMTA 4B9KA 3FILA 4I6NB 3I63C 1UELA 1IYFA 2XK5A 1TJEA 4MH0E 5L95C 4P7IA 1WR1A 2ZPYA 2ICIA 2O6VD 4R3DA 2NVUI 4KDIC 3W5VB 1FFVA 4GIVA 2O2VB 2WXLA 4HK2A 3MP9A 4ZHPA 1C9FA 4K3CA 2MWSB 2KOXA 1NI2A 2GB1A 3KH0A 1YQ4B 2KACA 5C1ZA 3SD5A 1I7HA 2GBRA 3Q8FA 5FKAC 1HZ5A 3NS1A 1UWMA 1D5MC 3CWIA 2X8XX 1R4MB 1MPEA 3TIXA 1Q0WB 1T6BX 4GDKB 2FAZA 4DQOC 1V5TA 1BMLC 5IO9A 4HCPB 3L08A 3H8HA 3MC0B 2FE8A 1QLBB 3R2IA 4OVUA 5AZFA 1FO4A 1C79A 1T0SC 2KLCA 1TS2A 4CHKA 1N5XA 2KWDA 2SEBD 2V0GA 3A4SC 1P7FA 3HVDA 2ZZPB 4PT5A 1V9JA 2KYWA 2M1MA 4WJNA 1WE6A 4MDKE 1DGJA 3DBRB 1SB3C 3MHSD 3AEFB 1UGMA 2JQRB 3ZNGC 4GU2A 3VHTC 2W54A 3H1UA 2KLGA 1VJKA 3RZWC 3DVNU 1JRUA 2DHZA 1K8RB 4GDLB 1Q10A 2AQ2B 2D3BA 2CJNA 1P1AA 2OJWA 1UH6A 2BYVE 1I4QA 1MI0A 3RMKC 1KTKA 3Q8BA 5HKHA 3NY5A 2G3QB 2W82A 5AZGA 2OEDA 2M0XA 5DCNA 1GB1A 2G1EA 4WWPA 2JZ3B 2LGYA 2G4DB 4DXFA 3RYTA 3K9OB 1FPYA 1QILA 2JU6X 1WX7A 1E8WA 2HE7A 3PHXB 3TBLD 1WSPA 4HVBA 3M95A 3A9KB 2L52A 1WXSA 2RDBC 4A55A 2JY6A 4M0WA 4K1RB 4TQ0A 3OJ4B 2MW5A 2WHIA 3N20C 2LWPA 4DK5A 2K0PA 2PVGC 1RFKA 2O6VA 4DHZB 1E10A 3L54A 2D3AA 4ACFA 1F77A 5L83A 2AYOB 4W9GA 1RM6C 3V61A 4IUMB 2NR2A 3PPAA 3H7PB 3W2DA 2K8HA 4ZYSA 1J7CA 3N9YC 1FCLA 4WAAA 2NMQA 3V60A 1WGRA 2A4ZA 2DYMA 3VUYA 3DOWA 2CS4A 4XYCA 2BWFA 5TR5A 1T3QA 2KX3A 3DVGX 1V1PA 1XT9B 3GE8C 5JZEB 3A1QA 1E7VA 2LASA 3DBLB 1F1HA 4IW0A 4KIKA 1E8ZA 3RD2A 4MJSA 4A3PA 4KZCA 1I4RA 3CMMB 4W9FA 3PT2B 1S1QB 3ZKJC 3SHQA 1FD6A 2QCZA 3LDZE 5JH5C 4LDTB 3R7QA 3VUXA 2C5LC 4GN1A 3HRDD 4MEMA 2AL3A 4XE0A 2REXA 2WWZA 1RYJA 4HJKA 4US8A 4HLEA 1K52A 2QHOA 2KO3A 3UIPB 2CJOA 3VH3B 1GOZA 2BGFA 2J4XA 4YT0B 2QJLA 2WLBA 4JIOU 2HJ8A 4ZRQA 2NS5A 4QAYA 4L23A 4ARIA 1VLBA 4L1BA 5BO4B 2C7HA 1YQ3B 2PMVA 2KDFB 4ZOHC 1UD7A 1HTQA 2AL6A 2KZRA 2MBHA 2D10A 5EE3A 1R7SA 3KYCD 2MJDA 2NBVB 3FC4A 3R7RA 3VRBB 1AYFA 3DWGC 2NTTA 3R3MA 2JX5A 4WWNA 3VQIA 3N1ZC 2LD9A 2C7NB 3ONSA 2ON8A 1WJUA 3W9CB 2KWVB 3URYA 5EDSA 1FMAD 1S3SG 1MVKA 1GAQB 5AEKB 3MHZA 2MRPA 4A6QA 1ZOYB 1OQYA 3NG0A 1YN4A 3PHWB 3V05A 2WDTB 2KDMA 3B2FA 4ITKA 3NJTA 4LNIA 3Q3NC 4WJOA 3Q3MC 5E6OA 4BBNF 2N9LA 4P6VF 3FILB 4FBJB 1KRHA 1YNTE 4GSWA 5H8YE 2XK5B 4EFOA 1ZP0B 5HHDG 2CHZA 3TEZA 1OQRA 5LLIA 3I57A 1FEHA 4E3CA 4YTPB 2BKRB 2LGSA 1F52A 2MQJA 1QKZA 2WXRA 3QC8B 3V3XA 1TIFA 4HCNB 3H7SA 1UWXA 4IDIA 4NNJB 3U8ZA 4AP4C 1N63A 2L0TA 1CZPA 2INPE 4HDOA 4K7SA 3SR6A 4FLHA 1XF5L 2C60A 2ZEQA 4HROA 3L0WB 3UGBB 3J9CA 4W9JA 2KFJA 2Y5PA 5LXIB 2KMMA 4LTUA 1WXVA 3T8MA 2D07B 2IJ0A 3AB5A 2IY0B 2L32A 3VFKA 2V3PA 4I6LB 3BVGA 1NYQA 2MSED 2LZ6A 4ANXA 3AM9A 1X1MA 4FHJA 1JWMD 4JPSA 4REZA 4YSXB 2K39A 4XZ4A 1IPGA 3AN1A 2KQSA 1V49A 3BZDB 2LGXA 2V4IB 5LXHA 2BVCA 4HDQA 3CF6E 1FXAA 2J42A 1N5WA 1SXTA 1V80A 4PYUA 2KDBA 1E9MA 2L0FA 2K8CA 2CR5A 2FCMA 1WM3A 1ZDVA 2V3SA 3BK1A 3JYUA 4IWPA 3B1LX 1VD2A 5JHAA 1WF9A 1OEYA 3DHHC 1NVID 1PDXA 4LJPB 3ZUNA 1TTNA 2IBIB 3S2AA 2LHEA 1WZ3A 5EE0A 4HKQA 4ZHOA 2D5GA 3P4QB 4E71A 1AW7A 4PS7A 4W9KA 4IWQA 2JXXA 1JQ4A 1CJEA 4M0WB 2MA9B 3WAOA 2R2OA 2KQ4X 2V3NA 2VH1A 2BW2A 3NVVA 1WRIA 3DPDA 3TL5A 1C4CA 2KANA 5G5HA 3PREA 2ZPNA 4KDLB 1FFUA 2O6VB 4NZLB 4A3OA 4EZJA 3NVZA 3DQVA 1Q5WB 3WANA 2IY1B 1YX5B 1UGJA 1ZE3D 2JWUA 2IZVB 2WXIA 1FRDA 2CHXA 4RNAA 2DBYA 3SFDB 3APFA 1OFFA 3V6EB 1N6ZA 4WQOB 3AEGB 2IO0B 1OTRB 1UBQA 1Z2MA 4JE3B 2E3TA 4ANWA 1JWSD 3B08A 4WWOA 1WE7A 2D11A 1HEZE 1WJ4A 1V1PB 1C4PA 1UNSA 2M8SA 3VAWA 2INNE 2D3CA 3WALA 3A1QB 5AUKA 2VZKD 4KIKB 4W9LA 5G5GA 3EC8A 4MJSB 4LK0M 4XDCA 1TT5B 2KFKA 1QZEA 2N4FA 2HD5B 1IBXA 2M17A 5J18A 3M63B 4IG7B 1K50A 3RNBC 4KSKC 1LM8B 1M94A 2V1YA 2GBNA 4K81A 2LGDA 3SEBA 1V97A 2RSUA 2CU3A 3EFUA 4LNOA 3DBHI 3P1MA 2KNBA 4OHJA 3PZDA 1V2YA 3BK2A 4JGHB 1U4AA 1I4HA 1N60A 2J52A 3EFCA 1JW9D 3FAHA 3QAQA 1YMHE 4P1CC 4TKNA 4NQKE 3RULA 1XO3A 3WAMA 5IP4D 4A9AA 4II2B 2DYOA 1FNWA 3AEEB 4IM0A 2LGIA 1L6VA 2G9HD 2OJRA 4W9IA 2PE9A 3M62B 2ZVNA 2GI9A 3U7DA 4MELA 5CHVC 2KHWB 4FN2A 3AULA 5C3JB 4MM3B 2J0KA
chains in the Genus database with same CATH topology
4IUMB 2KX0A 2NR2A 3H7PB 1V5OA 3PPAA 4BKSA 1LXDA 2K8HA 3QARA 2JVCA 3VVWB 1C1YB 4MGKE 5KHQA 4WAAA 2KVRA 2FIFA 2L05A 1VCBA 4PYZA 3V60A 1WGRA 2Z59B 3RUIB 1YQBA 2A4ZA 2DYMA 3NHEB 3VUYA 3Q3FA 2KTRB 3DOWA 5KHOA 1KLVA 2CS4A 3DVGY 3SDLC 4RM9A 3ZRCA 2BWFA 4DDGD 2JZZA 1RFAA 2N9EB 2PJHA 5G2NA 2KJHB 3X23A 5TR5A 3UQAA 2D2QA 2KXJA 2KJ6A 2KX3A 3DVGX 3X0WA 4AUQC 1YJ1A 2RD0A 1R4NI 5DPRA 4ZRKA 4HWIB 5D94A 4B6WA 1XT9B 5JZEB 4CO7A 1FXTB 3A1QA 4ZRJA 2DAFA 3CSFA 3N30A 5D7GA 1E7VA 2LASA 1G6JA 1WYWB 4KIKA 4LDTD 1WMHB 2LI5A 1E8ZA 1EF1A 2ASQA 4IW0A 4XC2A 3RD2A 3V61A 4MJSA 4F8CB 4A3PA 3QWZB 4KZCA 1EO6A 1WRDB 2L8JA 3CMMB 4W9FA 5G55A 4ANVA 3PT2B 1S1QB 3R66C 4HPMB 2RPQA 3ZKJC 4FHKA 3L13A 3NZUA 1WXMA 3H6NA 3SHQA 1F9JA 2JT4B 2I1KA 1GJZA 2K6DB 3LDZE 3P2BA 2DX5B 4GDLA 5JH5C 5IAAC 3CSTA 1I42A 1ISNA 4LDTB 4FJZA 1WGYA 2MBQA 3R7QA 2FCSA 2N7DA 4NJ7A 3VUXA 3ZRFA 2J0MA 1L7YA 2C5LC 4GN1A 4RMAA 1L2NA 2KD0A 2C9WB 1GC6A 1V81A 1ZKHA 3VXWA 2R2QA 3OJ3A 4FADA 3VUWA 4MEMA 3AI5A 1TBEA 2AL3A 3HK0A 2Z0EB 3ZNID 3VTVA 3ZNZB 3PRPB 2REXA 2WWZA 4HJKA 2IO2B 3BY4B 2WX1A 1GC7A 2FCNA 2L76A 4HLEA 1WX9A 2QHOA 3NZSA 2BWES 2KO3A 2L3ZA 3UIPB 3V6CB 3VH3B 1A5RA 2UYZB 3JW0X 2BGFA 4JIOU 3RT3B 2JPHA 2NBUA 2HJ8A 4EKUA 2NS5A 3JSVB 2JRIB 2M4NA 1RLFA 1I35A 2FCQA 3A9KA 3PGEA 1H8CA 3W1SA 3U30A 4FA6A 5BO4B 2C7HA 1WFYA 4MSQB 2MBBB 2KDFB 1UD7A 3GZNI 2ZNVB 2AL6A 4DBGA 2GBJA 2KZRA 4BKGA 2MBHA 2LVPA 4EUTA 2D10A 3ML8A 3SU8X 2LXAA 3KYCD 1KM7A 2L00B 3IG3A 2NBVB 2LVOA 3ECIA 1XD3B 3AU4A 3DBLI 2KJRA 2MP2A 3R7RA 3KW5B 4NAWA 2GOWA 1KJTA 4BBNC 2LVQA 3R3MA 3O65B 3VH4B 4GB9A 4WWNA 3VQIA 2LD9A 2C7NB 3ONSA 4W9HA 3D32A 2DENB 2G45B 3AXCA 3KUCB 3A9JA 2KQ7A 2OOBB 1WJUA 3QX1A 2DZKA 1V86A 3PLUA 2KWVB 2MX2A 5EDSA 4CYEA 1S3SG 4G3XB 2V4LA 1J8CA 4G11A 5AEKB 3H7PA 1AARA 1J19A 3I3TB 2K1FA 3RCZA 5DPTA 2MRPA 4K7WA 4B95A 1C3TA 3ZW3A 1OQYA 3PHWB 4I6PA 1WM2A 3PVLA 2LRUA 2WDTB 4G0NB 2AEHA 4KV2A 2I1JA 5AZHA 1SGHA 2BF8B 2KTRA 2IO3B 4PS3A 4WJOA 1WIAA 2KMAA 5CX3A 5GMVA 3ZDTA 4URKA 4GXBA 2FNJB 5E6OA 2DAJA 4BBNF 1E8XA 2C7MB 4DHZE 4FBJB 3IFWB 4GSWA 4BKTA 4ANUA 3L16A 1IP9A 1UZXB 4GMVA 2LUEA 2XK5B 4EFOA 3KUZA 5E6PA 4BVUC 3LJ3A 4GOCA 4EZKA 3PLVA 1KOTA 1P98A 2CHZA 1WMHA 3T9LA 1GUAB 3ZDMC 2IO1B 1YD8U 4IC7B 4YL8A 2MBEA 1EF5A 5LLIA 2GBKA 2YLMA 3PRZA 3IBEA 2KC2A 4JL9A 3L10B 1P3QU 2N9PC 4E3CA 3KYDD 5IA7A 2BKRB 2BYFA 4OVVA 3ENEA 5DPWA 2MQJA 3QC8B 3DVNV 4M8MA 3ZLZA 5D2MB 2AWTA 4HCNB 3L17A 4ICVA 3H7SA 5JHBA 3HM6X 1WI0A 4NNJB 3ALBA 1Q1OA 3U8ZA 3EECA 4AP4C 4ICUA 2LRWA 3W1SC 1GNUA 4BFRA 2L0TA 3EHVA 4JQWC 3KVFB 4ASWC 3IVFA 3TJPA 3NS8A 4HDOA 2GBMA 4K7SA 4AOFA 2CKHB 4FLHA 3PS6A 1SIFA 2C60A 1TGZB 2ZEQA 1OGWA 3HIZA 3C0RB 3L0WB 3UGBB 1T0YA 3OLMD 4W9JA 2KFJA 5FR6A 5C23A 5LXIB 4NJ6A 3JSVA 1WXVA 2N1VA 4KVGB 1WX8A 3IHPC 2MCNB 3BINA 3T8MA 5J2RA 2D07B 2IY0B 2WX0A 3VFKA 2RGFA 4I6LB 1H4RA 3APDA 2VRRB 3WA0A 3Q3JA 2MSED 2LZ6A 2BPSA 4ANXA 2NPTA 4TV3A 1X1MA 4FHJA 3WIMA 4IWOA 2MBOA 4F7ZA 4X57B 1NBFC 4LCDE 2K39A 4XZ4A 2ZJDA 3PSEB 1IPGA 2K8BA 2KDIA 3MJWA 2CHWA 2KQSA 2KFKB 2IYDB 1V49A 2N9XA 2DYBA 2PE6B 3MTNB 3HHMA 2LGXA 1E90A 4MGYE 2KWCA 2PPHA 3N32A 5LXHA 2GMIC 2CU1A 4HDQA 4NQLB 3M3JA 3CF6E 1EUVB 4PS8A 3QQ8B 2KTFA 2KMCA 4TUUA 1SE9A 2KDEB 1V80A 4PYUA 2KDBA 3TCAA 2L0FA 4XX5A 2MLBA 4II3B 1GG3A 1E8YA 2K8CA 2CR5A 2FCMA 3DCGA 1RRBA 1WM3A 4MM3A 3V62A 3QK0A 2V3SA 3JYUA 4IWPA 1OEYJ 3B1LX 4KSLC 3APCA 1VD2A 5JHAA 1WF9A 3VTUA 3ZIMA 1OEYA 3A33B 1E5WA 2D3GA 2UWQA 4LJPB 2EMTA 2FUHB 2K25A 4B9KA 3ZUNA 1TTNA 4I6NB 3DDCB 2IBIB 3S2AA 1UELA 2KC1A 4MSMB 4ZDVA 1LQBA 1IYFA 1WZ3A 2XK5A 2KK8A 3DBRI 3QJZA 1CMXB 2DZJA 4MH0E 4E71A 2PEAA 4P7IA 1WR1A 4PS7A 2ZPYA 5L95C 2LXCA 4W9KA 4IWQA 2O6VD 2NVUI 4KDIC 1TZ1A 1YX6B 1WZ0A 2JXXA 2O2VB 4GIVA 4HK2A 4M0WB 2MA9B 3NOBA 3WAOA 2R2OA 2YVCA 3UIOB 2JF5A 4NY0A 2N7EA 1XQQA 2MWSB 2KOXA 3ZVVA 3A9JB 3DPDA 1NI2A 3TL5A 2KANA 2JUOA 3PREA 2ZPNA 4BOSC 4KDLB 4N9F4 1P0RA 2O6VB 3KH0A 5CTRC 5C1ZA 3SD5A 4A3OA 2GBRA 4BKSD 4EZJA 3DQVA 1Q5WB 3PV1A 3WANA 1NDDA 2IY1B 1YX5B 3WAPA 4AWJA 3TIXA 1Q0WB 2ZNVC 4GDKB 2FAZA 4W9CA 4WJPA 2IZVB 2CHXA 1V5TA 4ZRIA 4HCPB 3APFA 3L08A 3B0AA 3V6EB 2B3AA 1Z5SB 2XEWA 4OVUA 4A20A 4WQOB 5AZFA 3JVZX 3UF8A 4DHJD 2DZIA 2IO0B 2KLCA 1OTRB 4CHKA 1UBQA 1Z2MA 5E6NA 2DZMA 4DWFA 4LJOB 3A4SC 2J7QB 4ANWA 4IM3A 1WH3A 1WY8A 2ZZPB 3B08A 4WWOA 3W1YA 1WE7A 1WJ6A 4ZYNA 1V9JA 4WJNA 2D11A 2JWZA 2M1MA 4DHJB 1WJ4A 4FJYA 4IM2A 4EZLA 1WE6A 2M8SA 4MDKE 3VAWA 3PRMB 2KN5A 3K9PB 3WALA 1WJNA 3A1QB 3MHSD 1UGMA 1PQSA 2WYQA 4KIKB 4W9LA 3ZNGC 2EKEC 1J0GA 4GU2A 3EC8A 4MJSB 3VHTC 2KFKA 3H1UA 1D3ZA 1LFDA 1P9DU 2A5UA 2XBBC 3GOEA 1QZEA 5CHWA 5DPSA 2N4FA 2HD5B 2KLGA 3RZWC 1BT0A 3DVNU 3ZTDA 1Y8RC 1JRUA 2DHZA 4W9DA 2M17A 5J18A 2N1WA 1WGDA 1K8RB 1UBIA 4GDLB 1E7UA 1WR6E 3M63B 4MGZE 4IG7B 1P1AA 4JLCA 4DDID 1UH6A 4KSKC 5D6JB 2BYVE 1LM8B 1M94A 1MG8A 1R4MI 4FULA 5J17A 2V1YA 5HKHA 2GBNA 4K81A 2LGDA 2RSUA 4AJWA 3ZTCA 3EFUA 3NY5A 3VDZA 3H9DA 1ZGUB 3DBHI 2G3QB 2KNBA 4E74A 3PZDA 5AZGA 1V2YA 2M0XA 5DCNA 4JGHB 3TMPB 3PTFC 2K6QA 3AU5A 1U4AA 4NPNA 4G50A 3OAWA 4WWPA 2JZ3B 2LGYA 2NCNA 2Z0DB 3A4RA 3UINB 2G4DB 3DBSA 3RYTA 2LJ5A 3K9OB 2J0JA 2G4SA 3ML9A 1WX7A 2W9NA 3N3KB 3QAQA 1E8WA 2HE7A 2RR9A 4TQ1A 3PHXB 3TBLD 2ZCBA 4NQKE 4TKNA 4W9EA 2NPTB 3A9KB 3M95A 4EEWA 4HVBA 1WXSA 3RULA 3ZNHB 1WGHA 2Y5BB 2NBWB 1WGGA 2JY6A 2EMSA 4KZ0A 3HM3A 2FIDA 4WJQA 3WAMA 2O2VA 4BOZB 3UQBA 4II2B 4K1RB 4TQ0A 3OJ4B 3QA8A 3KUDB 2MW5A 2BYEA 2DYOA 4J6IA 1ZW7A 1WXAA 3RZFA 3QIJA 2LWPA 1V6EA 4IM0A 2JRHA 4DK5A 4GGQA 4HPLB 2ZVOA 2MP2B 2OJRA 4W9IA 2O6VA 2PE9A 4FJVB 1YIWA 4F1SA 4NAWB 3ZO5B 4K7UA 4DHZB 3M62B 2ZVNA 3L54A 3QCAA 5CHFA 3U7DA 3QHTA 4MELA 5CHVC 2KHWB 4MGIE 2HTHA 4FN2A 5L83A 3AULA 2KWUB 2BKFA 2AYOB 4DXAB 4GDKA 1HE8A 4HXDA 2KKCA 4EOYA 2J0KA 2L7RA 4W9GA 3VTWA 1RAXA 4AJYB 4RM8A 2ZCCA 4M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM B;  2KX0 A;  2NR2 A;  3H7P B;  1V5O A;  3PPA A;  4BKS A;  1LXD A;  2K8H A;  3QAR A;  2JVC A;  3VVW B;  1C1Y B;  4MGK E;  5KHQ A;  4WAA A;  2KVR A;  2FIF A;  2L05 A;  1VCB A;  4PYZ A;  3V60 A;  1WGR A;  2Z59 B;  3RUI B;  1YQB A;  2A4Z A;  2DYM A;  3NHE B;  3VUY A;  3Q3F A;  2KTR B;  3DOW A;  5KHO A;  1KLV A;  2CS4 A;  3DVG Y;  3SDL C;  4RM9 A;  3ZRC A;  2BWF A;  4DDG D;  2JZZ A;  1RFA A;  2N9E B;  2PJH A;  5G2N A;  2KJH B;  3X23 A;  5TR5 A;  3UQA A;  2D2Q A;  2KXJ A;  2KJ6 A;  2KX3 A;  3DVG X;  3X0W A;  4AUQ C;  1YJ1 A;  2RD0 A;  1R4N I;  5DPR A;  4ZRK A;  4HWI B;  5D94 A;  4B6W A;  1XT9 B;  5JZE B;  4CO7 A;  1FXT B;  3A1Q A;  4ZRJ A;  2DAF A;  3CSF A;  3N30 A;  5D7G A;  1E7V A;  2LAS A;  1G6J A;  1WYW B;  4KIK A;  4LDT D;  1WMH B;  2LI5 A;  1E8Z A;  1EF1 A;  2ASQ A;  4IW0 A;  4XC2 A;  3RD2 A;  3V61 A;  4MJS A;  4F8C B;  4A3P A;  3QWZ B;  4KZC A;  1EO6 A;  1WRD B;  2L8J A;  3CMM B;  4W9F A;  5G55 A;  4ANV A;  3PT2 B;  1S1Q B;  3R66 C;  4HPM B;  2RPQ A;  3ZKJ C;  4FHK A;  3L13 A;  3NZU A;  1WXM A;  3H6N A;  3SHQ A;  1F9J A;  2JT4 B;  2I1K A;  1GJZ A;  2K6D B;  3LDZ E;  3P2B A;  2DX5 B;  4GDL A;  5JH5 C;  5IAA C;  3CST A;  1I42 A;  1ISN A;  4LDT B;  4FJZ A;  1WGY A;  2MBQ A;  3R7Q A;  2FCS A;  2N7D A;  4NJ7 A;  3VUX A;  3ZRF A;  2J0M A;  1L7Y A;  2C5L C;  4GN1 A;  4RMA A;  1L2N A;  2KD0 A;  2C9W B;  1GC6 A;  1V81 A;  1ZKH A;  3VXW A;  2R2Q A;  3OJ3 A;  4FAD A;  3VUW A;  4MEM A;  3AI5 A;  1TBE A;  2AL3 A;  3HK0 A;  2Z0E B;  3ZNI D;  3VTV A;  3ZNZ B;  3PRP B;  2REX A;  2WWZ A;  4HJK A;  2IO2 B;  3BY4 B;  2WX1 A;  1GC7 A;  2FCN A;  2L76 A;  4HLE A;  1WX9 A;  2QHO A;  3NZS A;  2BWE S;  2KO3 A;  2L3Z A;  3UIP B;  3V6C B;  3VH3 B;  1A5R A;  2UYZ B;  3JW0 X;  2BGF A;  4JIO U;  3RT3 B;  2JPH A;  2NBU A;  2HJ8 A;  4EKU A;  2NS5 A;  3JSV B;  2JRI B;  2M4N A;  1RLF A;  1I35 A;  2FCQ A;  3A9K A;  3PGE A;  1H8C A;  3W1S A;  3U30 A;  4FA6 A;  5BO4 B;  2C7H A;  1WFY A;  4MSQ B;  2MBB B;  2KDF B;  1UD7 A;  3GZN I;  2ZNV B;  2AL6 A;  4DBG A;  2GBJ A;  2KZR A;  4BKG A;  2MBH A;  2LVP A;  4EUT A;  2D10 A;  3ML8 A;  3SU8 X;  2LXA A;  3KYC D;  1KM7 A;  2L00 B;  3IG3 A;  2NBV B;  2LVO A;  3ECI A;  1XD3 B;  3AU4 A;  3DBL I;  2KJR A;  2MP2 A;  3R7R A;  3KW5 B;  4NAW A;  2GOW A;  1KJT A;  4BBN C;  2LVQ A;  3R3M A;  3O65 B;  3VH4 B;  4GB9 A;  4WWN A;  3VQI A;  2LD9 A;  2C7N B;  3ONS A;  4W9H A;  3D32 A;  2DEN B;  2G45 B;  3AXC A;  3KUC B;  3A9J A;  2KQ7 A;  2OOB B;  1WJU A;  3QX1 A;  2DZK A;  1V86 A;  3PLU A;  2KWV B;  2MX2 A;  5EDS A;  4CYE A;  1S3S G;  4G3X B;  2V4L A;  1J8C A;  4G11 A;  5AEK B;  3H7P A;  1AAR A;  1J19 A;  3I3T B;  2K1F A;  3RCZ A;  5DPT A;  2MRP A;  4K7W A;  4B95 A;  1C3T A;  3ZW3 A;  1OQY A;  3PHW B;  4I6P A;  1WM2 A;  3PVL A;  2LRU A;  2WDT B;  4G0N B;  2AEH A;  4KV2 A;  2I1J A;  5AZH A;  1SGH A;  2BF8 B;  2KTR A;  2IO3 B;  4PS3 A;  4WJO A;  1WIA A;  2KMA A;  5CX3 A;  5GMV A;  3ZDT A;  4URK A;  4GXB A;  2FNJ B;  5E6O A;  2DAJ A;  4BBN F;  1E8X A;  2C7M B;  4DHZ E;  4FBJ B;  3IFW B;  4GSW A;  4BKT A;  4ANU A;  3L16 A;  1IP9 A;  1UZX B;  4GMV A;  2LUE A;  2XK5 B;  4EFO A;  3KUZ A;  5E6P A;  4BVU C;  3LJ3 A;  4GOC A;  4EZK A;  3PLV A;  1KOT A;  1P98 A;  2CHZ A;  1WMH A;  3T9L A;  1GUA B;  3ZDM C;  2IO1 B;  1YD8 U;  4IC7 B;  4YL8 A;  2MBE A;  1EF5 A;  5LLI A;  2GBK A;  2YLM A;  3PRZ A;  3IBE A;  2KC2 A;  4JL9 A;  3L10 B;  1P3Q U;  2N9P C;  4E3C A;  3KYD D;  5IA7 A;  2BKR B;  2BYF A;  4OVV A;  3ENE A;  5DPW A;  2MQJ A;  3QC8 B;  3DVN V;  4M8M A;  3ZLZ A;  5D2M B;  2AWT A;  4HCN B;  3L17 A;  4ICV A;  3H7S A;  5JHB A;  3HM6 X;  1WI0 A;  4NNJ B;  3ALB A;  1Q1O A;  3U8Z A;  3EEC A;  4AP4 C;  4ICU A;  2LRW A;  3W1S C;  1GNU A;  4BFR A;  2L0T A;  3EHV A;  4JQW C;  3KVF B;  4ASW C;  3IVF A;  3TJP A;  3NS8 A;  4HDO A;  2GBM A;  4K7S A;  4AOF A;  2CKH B;  4FLH A;  3PS6 A;  1SIF A;  2C60 A;  1TGZ B;  2ZEQ A;  1OGW A;  3HIZ A;  3C0R B;  3L0W B;  3UGB B;  1T0Y A;  3OLM D;  4W9J A;  2KFJ A;  5FR6 A;  5C23 A;  5LXI B;  4NJ6 A;  3JSV A;  1WXV A;  2N1V A;  4KVG B;  1WX8 A;  3IHP C;  2MCN B;  3BIN A;  3T8M A;  5J2R A;  2D07 B;  2IY0 B;  2WX0 A;  3VFK A;  2RGF A;  4I6L B;  1H4R A;  3APD A;  2VRR B;  3WA0 A;  3Q3J A;  2MSE D;  2LZ6 A;  2BPS A;  4ANX A;  2NPT A;  4TV3 A;  1X1M A;  4FHJ A;  3WIM A;  4IWO A;  2MBO A;  4F7Z A;  4X57 B;  1NBF C;  4LCD E;  2K39 A;  4XZ4 A;  2ZJD A;  3PSE B;  1IPG A;  2K8B A;  2KDI A;  3MJW A;  2CHW A;  2KQS A;  2KFK B;  2IYD B;  1V49 A;  2N9X A;  2DYB A;  2PE6 B;  3MTN B;  3HHM A;  2LGX A;  1E90 A;  4MGY E;  2KWC A;  2PPH A;  3N32 A;  5LXH A;  2GMI C;  2CU1 A;  4HDQ A;  4NQL B;  3M3J A;  3CF6 E;  1EUV B;  4PS8 A;  3QQ8 B;  2KTF A;  2KMC A;  4TUU A;  1SE9 A;  2KDE B;  1V80 A;  4PYU A;  2KDB A;  3TCA A;  2L0F A;  4XX5 A;  2MLB A;  4II3 B;  1GG3 A;  1E8Y A;  2K8C A;  2CR5 A;  2FCM A;  3DCG A;  1RRB A;  1WM3 A;  4MM3 A;  3V62 A;  3QK0 A;  2V3S A;  3JYU A;  4IWP A;  1OEY J;  3B1L X;  4KSL C;  3APC A;  1VD2 A;  5JHA A;  1WF9 A;  3VTU A;  3ZIM A;  1OEY A;  3A33 B;  1E5W A;  2D3G A;  2UWQ A;  4LJP B;  2EMT A;  2FUH B;  2K25 A;  4B9K A;  3ZUN A;  1TTN A;  4I6N B;  3DDC B;  2IBI B;  3S2A A;  1UEL A;  2KC1 A;  4MSM B;  4ZDV A;  1LQB A;  1IYF A;  1WZ3 A;  2XK5 A;  2KK8 A;  3DBR I;  3QJZ A;  1CMX B;  2DZJ A;  4MH0 E;  4E71 A;  2PEA A;  4P7I A;  1WR1 A;  4PS7 A;  2ZPY A;  5L95 C;  2LXC A;  4W9K A;  4IWQ A;  2O6V D;  2NVU I;  4KDI C;  1TZ1 A;  1YX6 B;  1WZ0 A;  2JXX A;  2O2V B;  4GIV A;  4HK2 A;  4M0W B;  2MA9 B;  3NOB A;  3WAO A;  2R2O A;  2YVC A;  3UIO B;  2JF5 A;  4NY0 A;  2N7E A;  1XQQ A;  2MWS B;  2KOX A;  3ZVV A;  3A9J B;  3DPD A;  1NI2 A;  3TL5 A;  2KAN A;  2JUO A;  3PRE A;  2ZPN A;  4BOS C;  4KDL B;  4N9F 4;  1P0R A;  2O6V B;  3KH0 A;  5CTR C;  5C1Z A;  3SD5 A;  4A3O A;  2GBR A;  4BKS D;  4EZJ A;  3DQV A;  1Q5W B;  3PV1 A;  3WAN A;  1NDD A;  2IY1 B;  1YX5 B;  3WAP A;  4AWJ A;  3TIX A;  1Q0W B;  2ZNV C;  4GDK B;  2FAZ A;  4W9C A;  4WJP A;  2IZV B;  2CHX A;  1V5T A;  4ZRI A;  4HCP B;  3APF A;  3L08 A;  3B0A A;  3V6E B;  2B3A A;  1Z5S B;  2XEW A;  4OVU A;  4A20 A;  4WQO B;  5AZF A;  3JVZ X;  3UF8 A;  4DHJ D;  2DZI A;  2IO0 B;  2KLC A;  1OTR B;  4CHK A;  1UBQ A;  1Z2M A;  5E6N A;  2DZM A;  4DWF A;  4LJO B;  3A4S C;  2J7Q B;  4ANW A;  4IM3 A;  1WH3 A;  1WY8 A;  2ZZP B;  3B08 A;  4WWO A;  3W1Y A;  1WE7 A;  1WJ6 A;  4ZYN A;  1V9J A;  4WJN A;  2D11 A;  2JWZ A;  2M1M A;  4DHJ B;  1WJ4 A;  4FJY A;  4IM2 A;  4EZL A;  1WE6 A;  2M8S A;  4MDK E;  3VAW A;  3PRM B;  2KN5 A;  3K9P B;  3WAL A;  1WJN A;  3A1Q B;  3MHS D;  1UGM A;  1PQS A;  2WYQ A;  4KIK B;  4W9L A;  3ZNG C;  2EKE C;  1J0G A;  4GU2 A;  3EC8 A;  4MJS B;  3VHT C;  2KFK A;  3H1U A;  1D3Z A;  1LFD A;  1P9D U;  2A5U A;  2XBB C;  3GOE A;  1QZE A;  5CHW A;  5DPS A;  2N4F A;  2HD5 B;  2KLG A;  3RZW C;  1BT0 A;  3DVN U;  3ZTD A;  1Y8R C;  1JRU A;  2DHZ A;  4W9D A;  2M17 A;  5J18 A;  2N1W A;  1WGD A;  1K8R B;  1UBI A;  4GDL B;  1E7U A;  1WR6 E;  3M63 B;  4MGZ E;  4IG7 B;  1P1A A;  4JLC A;  4DDI D;  1UH6 A;  4KSK C;  5D6J B;  2BYV E;  1LM8 B;  1M94 A;  1MG8 A;  1R4M I;  4FUL A;  5J17 A;  2V1Y A;  5HKH A;  2GBN A;  4K81 A;  2LGD A;  2RSU A;  4AJW A;  3ZTC A;  3EFU A;  3NY5 A;  3VDZ A;  3H9D A;  1ZGU B;  3DBH I;  2G3Q B;  2KNB A;  4E74 A;  3PZD A;  5AZG A;  1V2Y A;  2M0X A;  5DCN A;  4JGH B;  3TMP B;  3PTF C;  2K6Q A;  3AU5 A;  1U4A A;  4NPN A;  4G50 A;  3OAW A;  4WWP A;  2JZ3 B;  2LGY A;  2NCN A;  2Z0D B;  3A4R A;  3UIN B;  2G4D B;  3DBS A;  3RYT A;  2LJ5 A;  3K9O B;  2J0J A;  2G4S A;  3ML9 A;  1WX7 A;  2W9N A;  3N3K B;  3QAQ A;  1E8W A;  2HE7 A;  2RR9 A;  4TQ1 A;  3PHX B;  3TBL D;  2ZCB A;  4NQK E;  4TKN A;  4W9E A;  2NPT B;  3A9K B;  3M95 A;  4EEW A;  4HVB A;  1WXS A;  3RUL A;  3ZNH B;  1WGH A;  2Y5B B;  2NBW B;  1WGG A;  2JY6 A;  2EMS A;  4KZ0 A;  3HM3 A;  2FID A;  4WJQ A;  3WAM A;  2O2V A;  4BOZ B;  3UQB A;  4II2 B;  4K1R B;  4TQ0 A;  3OJ4 B;  3QA8 A;  3KUD B;  2MW5 A;  2BYE A;  2DYO A;  4J6I A;  1ZW7 A;  1WXA A;  3RZF A;  3QIJ A;  2LWP A;  1V6E A;  4IM0 A;  2JRH A;  4DK5 A;  4GGQ A;  4HPL B;  2ZVO A;  2MP2 B;  2OJR A;  4W9I A;  2O6V A;  2PE9 A;  4FJV B;  1YIW A;  4F1S A;  4NAW B;  3ZO5 B;  4K7U A;  4DHZ B;  3M62 B;  2ZVN A;  3L54 A;  3QCA A;  5CHF A;  3U7D A;  3QHT A;  4MEL A;  5CHV C;  2KHW B;  4MGI E;  2HTH A;  4FN2 A;  5L83 A;  3AUL A;  2KWU B;  2BKF A;  2AYO B;  4DXA B;  4GDK A;  1HE8 A;  4HXD A;  2KKC A;  4EOY A;  2J0K A;  2L7R A;  4W9G A;  3VTW A;  1RAX A;  4AJY B;  4RM8 A;  2ZCC A;  4M8N A; 
#chains in the Genus database with same CATH topology
 2KX0 A;  4OZB A;  3I9V 1;  2JVC A;  3VVW B;  4MGK E;  4RF0 A;  2FIF A;  2L05 A;  1VCB A;  1YN3 A;  1YQB A;  3AMZ A;  3DVG Y;  2QDF A;  4DDG D;  2JZZ A;  1RFA A;  2WXJ A;  4USA A;  5G2N A;  3UQA A;  5HI1 A;  2KJ6 A;  1PGA A;  3KLS X;  3IT4 B;  2RD0 A;  1R4N I;  5IOI A;  4US9 A;  5D94 A;  1E7P B;  1FXT B;  2DAF A;  3N30 A;  1WXQ A;  1EF1 A;  4C7Z A;  2WXK A;  4F8C B;  3QWZ B;  1EO6 A;  1QOF A;  1YN5 A;  4D2K A;  4ANV A;  1WWT A;  2KN4 A;  3H6N A;  1F9J A;  2I1K A;  3KWV A;  1I42 A;  3P2B A;  2DX5 B;  4WAF A;  1ISN A;  4FJZ A;  2N7D A;  4NJ7 A;  3ZRF A;  4P16 A;  2C9W B;  1V81 A;  3VXW A;  1OQQ A;  1GPX A;  4PK1 A;  2PKO A;  1F0Z A;  4OZC A;  3ZNI D;  3ZNZ B;  4BAX A;  3Q8E A;  3DWM A;  1GC7 A;  2FCN A;  2L76 A;  1WX9 A;  3NZS A;  1PGX A;  2L3Z A;  1A5R A;  3JW0 X;  3RT3 B;  2NBU A;  3LYY A;  1I35 A;  2JRI B;  1RLF A;  2FCQ A;  3NVW A;  1FXI A;  4MSQ B;  2Y3A A;  4ZRP A;  4BKG A;  3U4E G;  1KFY B;  2LVP A;  5FK9 C;  3ML8 A;  1WYG A;  1VZ6 A;  2L00 B;  3IG3 A;  3MC9 A;  1KLU D;  4MH8 A;  1XD3 B;  4P1B C;  2M0A A;  3Q2A C;  4NAW A;  5C2T B;  4BBN C;  3IAS 1;  1FNU A;  1T0Q C;  4JX1 C;  4W9H A;  4JWU C;  2G45 B;  3AXC A;  1JRO A;  3AE2 B;  4XWT A;  1DOY A;  2YEP B;  2M19 A;  4K3B A;  2V4L A;  1FCC C;  2K1F A;  3AEB B;  1JML A;  1C3T A;  5EE1 A;  4XGA B;  3HUI A;  2LRU A;  1XLO A;  1KF6 B;  1UF0 A;  4KV2 A;  3RFZ B;  2IO3 B;  5CX3 A;  5GMV A;  2ONQ A;  4URK A;  2JZP A;  2FNJ B;  1VRA B;  2DAJ A;  2GLS A;  1E8X A;  4DHZ E;  3BII D;  3IFW B;  4ANU A;  1QOB A;  3KUZ A;  4GOC A;  4S17 A;  2WXP A;  1V8C A;  1P98 A;  2IGG A;  1GUA B;  1GB4 A;  4IC7 B;  2GBK A;  3GZN B;  3PRZ A;  2KC2 A;  4JL9 A;  2RDG A;  3BVZ A;  3NZ3 A;  5IA7 A;  2BYF A;  4OVV A;  3GE3 C;  3DVN V;  1J7B A;  3ETR A;  5D2M B;  2AWT A;  1CQV A;  5JHB A;  1KH0 A;  1WI0 A;  1FIQ A;  2H89 B;  2LRW A;  3W1S C;  4XDD A;  4ASW C;  1AN8 A;  3TJP A;  3NRZ A;  1HQR D;  2GBM A;  2LJI A;  5I4D A;  1SIF A;  1TGZ B;  1OGW A;  2XN9 C;  3C0R B;  1T0Y A;  2WXG A;  1WX8 A;  3Q69 A;  3SFE B;  2WX0 A;  5HG2 A;  3Q3J A;  5TSS A;  4TV3 A;  2V9H A;  4IWO A;  2MBO A;  4F7Z A;  1NBF C;  2FUG 1;  2ZJD A;  2KDI A;  3MJW A;  2CHW A;  1F2R I;  2KFK B;  4MT5 A;  1WGK A;  3MTN B;  3HHM A;  1ZXI A;  5D3I B;  2PPH A;  2K5P A;  1FM0 D;  4NQL B;  1IBX B;  1EUV B;  4PS8 A;  1D4B A;  4TUU A;  3PZ7 A;  4II3 B;  2XNA C;  2WS3 B;  1HZ6 A;  1RRB A;  4MM3 A;  3V62 A;  3BWU D;  4KSL C;  4WH4 A;  1JCK B;  5BMH A;  1FNV A;  3A33 B;  2D3G A;  2UWQ A;  4EE2 A;  1SIJ A;  2FUH B;  1HTO A;  4MSM B;  4C56 C;  1LQB A;  1YOV B;  4C80 A;  3DBR I;  2DLB A;  4KGT A;  1BUI C;  1CMX B;  3AE5 B;  1ET9 A;  2OHF A;  3BVM A;  2PEA A;  4HPP A;  2QIL A;  3TSS A;  5JXV A;  1TZ1 A;  1YX6 B;  1WZ0 A;  4KKJ A;  1DOX A;  2YVC A;  1C78 A;  2UU7 A;  3UIO B;  2JF5 A;  4NY0 A;  1C77 A;  1XQQ A;  4C4V A;  3ZVV A;  4BOS C;  1MG4 A;  1P0R A;  4KGR A;  5CTR C;  2BB5 A;  4IKG A;  4BKS D;  3PV1 A;  3R2T A;  1NDD A;  3N1Y C;  2PTL A;  3BYT B;  1QT9 A;  4AWJ A;  2I38 A;  2ZNV C;  3P42 A;  2WDV B;  4W9C A;  4WJP A;  1MFW A;  2K9X A;  3MC8 A;  3B0A A;  3RNF C;  2B3A A;  2LFI A;  2Z8L A;  4LNF A;  3JVZ X;  2KAJ A;  4DHJ D;  3OG5 A;  1XLQ A;  2MJE A;  5E6N A;  1TKG A;  4DWF A;  2JYT A;  2QIE B;  2J7Q B;  3W1Y A;  1WJ6 A;  1IGD A;  2JWZ A;  1TZO A;  1C4A A;  4FJY A;  4IM2 A;  2N0S B;  3PRM B;  2KN5 A;  1L4D B;  1NEK B;  1WJN A;  1PQS A;  2WYQ A;  2EKE C;  1J0G A;  3HVZ A;  1LFD A;  1P9D U;  5DPS A;  3P63 A;  2FBW B;  3ZTD A;  4W9D A;  4MAC A;  1E7U A;  1WR6 E;  2VZK B;  2WXF A;  2W55 A;  4JLC A;  1PFD A;  5IKC M;  5D6J B;  1MG8 A;  4FUL A;  1XLP A;  2ZW0 A;  4AJW A;  3H9D A;  2K3U A;  4YWG G;  3PTF C;  1NYR A;  3AU5 A;  1Y56 A;  2W3S A;  4NPN A;  2N9K A;  4G50 A;  3OAW A;  2Z0D B;  3A4R A;  3UIN B;  2QC8 A;  4H2A A;  3DBS A;  4LNK A;  2J0J A;  1QOA A;  3ML9 A;  2BS2 B;  5BYS A;  3N3K B;  4TQ1 A;  3MFG A;  1AWD A;  2AQ3 B;  2ZCB A;  1R4N B;  4W9E A;  2MEK A;  2Y5B B;  4KGS A;  2EMS A;  3HM3 A;  4WJQ A;  2WXM A;  1LGR A;  4B0E A;  3KUD B;  2DWQ A;  3QIJ A;  1V6E A;  1EU4 A;  4HPL B;  3L4P A;  1YIW A;  4NAW B;  1HXY D;  3AH7 A;  5CHF A;  4OW0 A;  3QHT A;  4MGI E;  2HTH A;  2QMT A;  2BKF A;  5E6J A;  4HXD A;  2KKC A;  4EOY A;  2L7R A;  1VR9 A;  1C76 A;  1RAX A;  1ZUD 2;  2ZCC A;  4M8N A;  5MPO A;  4BKS A;  1C1Y B;  5KHQ A;  5LNK 1;  4DXG A;  3RN9 C;  1STE A;  1N61 A;  2Z59 B;  3NHE B;  2JXT A;  4Q2J A;  3Q3F A;  5KHO A;  1KLV A;  3SDL C;  4RM9 A;  2KT7 A;  2PJH A;  3X23 A;  2KJH B;  2D2Q A;  2ZW1 A;  2KXJ A;  3AE1 B;  3X0W A;  2BS4 B;  1YJ1 A;  4ZRK A;  5DPR A;  4B6W A;  1L0V B;  3CSF A;  2AQ1 B;  5D7G A;  1ZPS A;  1G6J A;  1WYW B;  2TSS A;  3ABV B;  2ASQ A;  4XC2 A;  3E56 A;  2Y5C A;  2L8J A;  4RF1 A;  3R66 C;  2RPQ A;  1CK1 A;  3L13 A;  4FHK A;  1WXM A;  1VZ8 A;  2INC C;  1GJZ A;  1TY0 A;  3CST A;  1WGY A;  1ZDX A;  5D3D A;  3TEX A;  2FCS A;  2J0M A;  1L7Y A;  3E9S A;  4RMA A;  2KD0 A;  1ZKH A;  2R2Q A;  3OJ3 A;  4FAD A;  1VDV A;  3AI5 A;  1TBE A;  1MJD A;  3VTV A;  1UUP A;  2IO2 B;  5IN7 A;  1L4Z B;  2BWE S;  3V6C B;  1YJI A;  2UYZ B;  2IND C;  4LNN A;  2JPH A;  1NEN B;  3W1S A;  1F2R C;  1LO5 D;  1WFY A;  2QSD A;  4N58 A;  3AEA B;  1TS4 A;  2MHJ A;  4DBG A;  2AX5 A;  2GBJ A;  4M02 A;  4EUT A;  3SU8 X;  2LXA A;  3CIR B;  1KM7 A;  1PUT A;  2LVO A;  3ECI A;  3AU4 A;  2KJR A;  2MP2 A;  4WIP A;  3RNE C;  2X38 A;  3O65 B;  4GB9 A;  3RI7 C;  3D32 A;  2DEN B;  3KQ4 A;  1T0R C;  3EA6 A;  1PGB A;  3QX1 A;  4GLS C;  2DZK A;  3PLU A;  1L0X B;  3AE3 B;  4G3X B;  1J8C A;  4G11 A;  1J19 A;  4WUR A;  3RCZ A;  5DPT A;  3ZW3 A;  1P7E A;  4I6P A;  1WM2 A;  3PVL A;  4G0N B;  4WWM A;  2AEH A;  1JWU D;  5AZH A;  1SGH A;  2BF8 B;  2KTR A;  1ENF A;  1DYQ A;  1EWY C;  1WIA A;  2KMA A;  3W5U B;  1ZXH A;  3U7Z A;  1IUE A;  3L16 A;  5BYR A;  4EZK A;  5E6P A;  4BVU C;  2L1A A;  2K22 A;  3PLV A;  2WGS A;  3UI3 A;  1TY2 A;  1WMH A;  3ZDM C;  4KKI A;  1TS3 A;  1JAL A;  2MBE A;  5FR3 A;  2QEJ C;  2YLM A;  1MHH E;  2J53 A;  1P3Q U;  2N9P C;  3KYD D;  4C4V B;  3ENE A;  4S0R A;  5DPW A;  2E6X A;  1B1Z A;  4M8M A;  3ZJT A;  1T5X D;  1SF0 A;  3ALB A;  1Q1O A;  3EEC A;  2WQY B;  1L0Y B;  4ICU A;  2BBC A;  3RNG C;  3KVF B;  1TS5 A;  4RGN A;  1EM7 A;  2WXQ A;  2CKH B;  3OWE B;  2WDQ B;  3AED B;  3HIZ A;  3OLM D;  2GRI A;  3IAM 1;  2VH2 A;  2JSV X;  3AE8 B;  3JSV A;  3AE6 B;  1B9R A;  3IHP C;  2MCN B;  3BIN A;  3AV8 A;  3U2S C;  2IGD A;  4B0M A;  2RGF A;  4KX6 B;  1H4R A;  3APD A;  3WA0 A;  3GS2 A;  3WIM A;  4YTM B;  3LXF A;  4X57 B;  2IYD B;  2DYB A;  2PE6 B;  1XCT L;  3VR8 B;  1E90 A;  3N32 A;  1TYG B;  2CU1 A;  3M3J A;  1J7A A;  2WU2 B;  1XXG A;  2KTF A;  2KMC A;  2KDE B;  5BMG A;  2MJ3 A;  1E8Y A;  4TSS A;  1D5Z C;  3VTU A;  3R8B A;  2K25 A;  1I4G A;  3DDC B;  2KC1 A;  4ZDV A;  3ZXV A;  2KK8 A;  3QJZ A;  1JWA D;  2DZJ A;  2LXC A;  2WU5 B;  4RGO S;  3NOB A;  2N7E A;  5AUI A;  3A9J B;  2JUO A;  4RGM A;  4N6E B;  4N9F 4;  3U52 E;  1EWC A;  2HTM E;  2SAK A;  1SBB B;  1FRR A;  1D6E C;  1BXT A;  2LEK A;  3WAP A;  3AE4 B;  4ZRI A;  1Z5S B;  1ROE A;  2XEW A;  4A20 A;  2NTS A;  3UF8 A;  2DZI A;  2H88 B;  3ZJU A;  2BTE A;  3T3N A;  1N62 A;  3I5J C;  3IT6 B;  2DZM A;  4LJO B;  1TKY A;  4IM3 A;  1WH3 A;  4WQM A;  1WY8 A;  4J3O D;  4ZYN A;  4DHJ B;  4EZL A;  4C7Y A;  3ZYY X;  3K9P B;  1D3Z A;  2A5U A;  2XBB C;  3GOE A;  4M00 A;  5CHW A;  1YJJ A;  1BT0 A;  4IOI E;  1Y8R C;  3P4P B;  2BQQ A;  2N1W A;  1WGD A;  3B2G A;  1UBI A;  4MGZ E;  2KVZ A;  5GXG B;  4DDI D;  2YEP F;  1TKE A;  1R4M I;  2PIA A;  5J17 A;  2IPK D;  4ARC A;  3ZTC A;  3VDZ A;  4HJG E;  1ZGU B;  1XCQ L;  4RFB A;  4E74 A;  1E6E B;  3TMP B;  2K6Q A;  1JRP A;  2IDY A;  2NCN A;  3PZ8 A;  4O1N A;  2W3R A;  2LJ5 A;  4A90 A;  2G4S A;  1XEE A;  2W9N A;  2RR9 A;  4EEW A;  2NPT B;  5BYQ A;  3ZNH B;  1WGH A;  2NBW B;  1WGG A;  4KZ0 A;  2FID A;  3UQB A;  2O2V A;  4BOZ B;  3TEY A;  1SJH D;  1SE2 A;  3QA8 A;  4J6I A;  4RH6 A;  2BYE A;  1ZW7 A;  4OVZ A;  1I4X A;  2M56 B;  1WXA A;  3RZF A;  3ZQ4 A;  2JRH A;  1SE3 A;  4GGQ A;  2ZVO A;  2MP2 B;  4FJV B;  4F1S A;  3Q3O C;  3ZO5 B;  4K7U A;  3QCA A;  3BYY B;  1SE4 A;  4HKZ E;  2KWU B;  4YSZ B;  2EKI A;  4DXA B;  3C8Y A;  4GDK A;  2RMM A;  1HE8 A;  4OZA A;  1PYW D;  3VTW A;  4AJY B;  4RM8 A;  1VZ7 A;  4BFR A;  4AUQ C;  3TUO A;  1V5O A;  3DHG C;  1LXD A;  3QAR A;  2KVR A;  1L5P A;  4PYZ A;  3RPF C;  3RUI B;  1SJE D;  3DBH B;  3NVY A;  2RDH A;  2KTR B;  3T3O A;  3ZRC A;  3VRA B;  2LUM A;  2N9E B;  3GB1 A;  2I2Y A;  4HWI B;  2HJ1 A;  4CO7 A;  4ZRJ A;  3Q8A A;  3ZGZ A;  1XLN A;  4LDT D;  1WMH B;  2LI5 A;  2DNF A;  1K51 A;  5T8I A;  1WRD B;  5G55 A;  2WNM A;  3DHI C;  2EEL A;  4HPM B;  2MH7 A;  3NZU A;  2JT4 B;  2K6D B;  4GDL A;  4AS1 A;  5IAA C;  2JYE A;  2MBQ A;  3AE9 B;  1L2N A;  2R61 A;  1GC6 A;  1A70 A;  3B9J A;  3VUW A;  4JWS C;  3HK0 A;  2Z0E B;  3PRP B;  3ZXR A;  4M01 A;  3BY4 B;  4LLG M;  2WX1 A;  4AQ7 A;  1SEB D;  3NUH B;  4BZA A;  1QQR A;  4EKU A;  4HRS A;  1V1O A;  3IXS A;  3GP7 A;  3JSV B;  2M4N A;  3A9K A;  4YTN B;  3PGE A;  1H8C A;  1RWS A;  3U30 A;  4FA6 A;  2MBB B;  3GZN I;  2ZNV B;  2BYT A;  2B76 B;  3MJ5 A;  1QF6 A;  2LHD A;  1IGC A;  3DBL I;  3P4R B;  4HEA 1;  3KW5 B;  3WCQ A;  2GOW A;  1DOI A;  1KJT A;  1ESF A;  2LVQ A;  3VH4 B;  1HA5 A;  3KUC B;  3N1X C;  3A9J A;  4L2Y A;  1QOG A;  2KQ7 A;  4N59 A;  2OOB B;  1V86 A;  2MX2 A;  4CYE A;  2WDR B;  1JWB D;  3C19 A;  1MHX A;  3H7P A;  1AAR A;  3I3T B;  4K7W A;  4B95 A;  2BT6 A;  2IGH A;  2I1J A;  1EU3 A;  2ACZ B;  4C00 A;  3AE7 B;  2N7J A;  4PS3 A;  3ZDT A;  4GXB A;  2WXH A;  2C7M B;  4NJC A;  3Q14 C;  4BKT A;  1IP9 A;  1UZX B;  4GMV A;  2LUE A;  3EUB 2;  3LJ3 A;  2BS3 B;  1KOT A;  3T9L A;  1L6U A;  2IO1 B;  1YD8 U;  3Q8C A;  4YL8 A;  1EF5 A;  3IBE A;  2WP9 B;  3L10 B;  2PW9 A;  3ZLZ A;  2L83 A;  1K53 A;  3L17 A;  3P4S B;  4ICV A;  2Q5W D;  1I4P A;  3HM6 X;  1E0Z A;  4CQN A;  4FXC A;  1GNU A;  3VR9 B;  1ET6 A;  3EHV A;  4NAM A;  4RGT A;  4JQW C;  4UDU C;  3IVF A;  5BMI A;  3NS8 A;  3AEC B;  2LMC A;  4AOF A;  3PS6 A;  2BB6 A;  2PLP A;  3RNA C;  5FR6 A;  5C23 A;  4TMA B;  4NJ6 A;  5HFY A;  2N1V A;  1ACC A;  4KVG B;  5J2R A;  3RNC C;  2WXN A;  2WXO A;  3LB8 C;  3ZJV A;  2VRR B;  4YSY B;  2BPS A;  3TEW A;  3EGR A;  2NPT A;  4LCD E;  3PSE B;  2K8B A;  4XWW A;  3O13 A;  2N9X A;  5H92 C;  4MGY E;  2KWC A;  2GMI C;  1NI3 A;  1D5X C;  3PO0 A;  1M4V A;  4RCO A;  2PVO D;  4YXD B;  3QQ8 B;  1SE9 A;  2HDE A;  3TCA A;  3FKY A;  2MLB A;  4XX5 A;  1GG3 A;  1KLG D;  3DCG A;  5EE9 A;  4A8X C;  3Q6B A;  3QK0 A;  1OEY J;  3APC A;  2RPV A;  3KWL A;  3ZIM A;  1E5W A;  1SSN A;  2EMT A;  4B9K A;  3FIL A;  4I6N B;  3I63 C;  1UEL A;  1IYF A;  2XK5 A;  1TJE A;  4MH0 E;  5L95 C;  4P7I A;  1WR1 A;  2ZPY A;  2ICI A;  2O6V D;  4R3D A;  2NVU I;  4KDI C;  3W5V B;  1FFV A;  4GIV A;  2O2V B;  2WXL A;  4HK2 A;  3MP9 A;  4ZHP A;  1C9F A;  4K3C A;  2MWS B;  2KOX A;  1NI2 A;  2GB1 A;  3KH0 A;  1YQ4 B;  2KAC A;  5C1Z A;  3SD5 A;  1I7H A;  2GBR A;  3Q8F A;  5FKA C;  1HZ5 A;  3NS1 A;  1UWM A;  1D5M C;  3CWI A;  2X8X X;  1R4M B;  1MPE A;  3TIX A;  1Q0W B;  1T6B X;  4GDK B;  2FAZ A;  4DQO C;  1V5T A;  1BML C;  5IO9 A;  4HCP B;  3L08 A;  3H8H A;  3MC0 B;  2FE8 A;  1QLB B;  3R2I A;  4OVU A;  5AZF A;  1FO4 A;  1C79 A;  1T0S C;  2KLC A;  1TS2 A;  4CHK A;  1N5X A;  2KWD A;  2SEB D;  2V0G A;  3A4S C;  1P7F A;  3HVD A;  2ZZP B;  4PT5 A;  1V9J A;  2KYW A;  2M1M A;  4WJN A;  1WE6 A;  4MDK E;  1DGJ A;  3DBR B;  1SB3 C;  3MHS D;  3AEF B;  1UGM A;  2JQR B;  3ZNG C;  4GU2 A;  3VHT C;  2W54 A;  3H1U A;  2KLG A;  1VJK A;  3RZW C;  3DVN U;  1JRU A;  2DHZ A;  1K8R B;  4GDL B;  1Q10 A;  2AQ2 B;  2D3B A;  2CJN A;  1P1A A;  2OJW A;  1UH6 A;  2BYV E;  1I4Q A;  1MI0 A;  3RMK C;  1KTK A;  3Q8B A;  5HKH A;  3NY5 A;  2G3Q B;  2W82 A;  5AZG A;  2OED A;  2M0X A;  5DCN A;  1GB1 A;  2G1E A;  4WWP A;  2JZ3 B;  2LGY A;  2G4D B;  4DXF A;  3RYT A;  3K9O B;  1FPY A;  1QIL A;  2JU6 X;  1WX7 A;  1E8W A;  2HE7 A;  3PHX B;  3TBL D;  1WSP A;  4HVB A;  3M95 A;  3A9K B;  2L52 A;  1WXS A;  2RDB C;  4A55 A;  2JY6 A;  4M0W A;  4K1R B;  4TQ0 A;  3OJ4 B;  2MW5 A;  2WHI A;  3N20 C;  2LWP A;  4DK5 A;  2K0P A;  2PVG C;  1RFK A;  2O6V A;  4DHZ B;  1E10 A;  3L54 A;  2D3A A;  4ACF A;  1F77 A;  5L83 A;  2AYO B;  4W9G A;  1RM6 C;  3V61 A;  4IUM B;  2NR2 A;  3PPA A;  3H7P B;  3W2D A;  2K8H A;  4ZYS A;  1J7C A;  3N9Y C;  1FCL A;  4WAA A;  2NMQ A;  3V60 A;  1WGR A;  2A4Z A;  2DYM A;  3VUY A;  3DOW A;  2CS4 A;  4XYC A;  2BWF A;  5TR5 A;  1T3Q A;  2KX3 A;  3DVG X;  1V1P A;  1XT9 B;  3GE8 C;  5JZE B;  3A1Q A;  1E7V A;  2LAS A;  3DBL B;  1F1H A;  4IW0 A;  4KIK A;  1E8Z A;  3RD2 A;  4MJS A;  4A3P A;  4KZC A;  1I4R A;  3CMM B;  4W9F A;  3PT2 B;  1S1Q B;  3ZKJ C;  3SHQ A;  1FD6 A;  2QCZ A;  3LDZ E;  5JH5 C;  4LDT B;  3R7Q A;  3VUX A;  2C5L C;  4GN1 A;  3HRD D;  4MEM A;  2AL3 A;  4XE0 A;  2REX A;  2WWZ A;  1RYJ A;  4HJK A;  4US8 A;  4HLE A;  1K52 A;  2QHO A;  2KO3 A;  3UIP B;  2CJO A;  3VH3 B;  1GOZ A;  2BGF A;  2J4X A;  4YT0 B;  2QJL A;  2WLB A;  4JIO U;  2HJ8 A;  4ZRQ A;  2NS5 A;  4QAY A;  4L23 A;  4ARI A;  1VLB A;  4L1B A;  5BO4 B;  2C7H A;  1YQ3 B;  2PMV A;  2KDF B;  4ZOH C;  1UD7 A;  1HTQ A;  2AL6 A;  2KZR A;  2MBH A;  2D10 A;  5EE3 A;  1R7S A;  3KYC D;  2MJD A;  2NBV B;  3FC4 A;  3R7R A;  3VRB B;  1AYF A;  3DWG C;  2NTT A;  3R3M A;  2JX5 A;  4WWN A;  3VQI A;  3N1Z C;  2LD9 A;  2C7N B;  3ONS A;  2ON8 A;  1WJU A;  3W9C B;  2KWV B;  3URY A;  5EDS A;  1FMA D;  1S3S G;  1MVK A;  1GAQ B;  5AEK B;  3MHZ A;  2MRP A;  4A6Q A;  1ZOY B;  1OQY A;  3NG0 A;  1YN4 A;  3PHW B;  3V05 A;  2WDT B;  2KDM A;  3B2F A;  4ITK A;  3NJT A;  4LNI A;  3Q3N C;  4WJO A;  3Q3M C;  5E6O A;  4BBN F;  2N9L A;  4P6V F;  3FIL B;  4FBJ B;  1KRH A;  1YNT E;  4GSW A;  5H8Y E;  2XK5 B;  4EFO A;  1ZP0 B;  5HHD G;  2CHZ A;  3TEZ A;  1OQR A;  5LLI A;  3I57 A;  1FEH A;  4E3C A;  4YTP B;  2BKR B;  2LGS A;  1F52 A;  2MQJ A;  1QKZ A;  2WXR A;  3QC8 B;  3V3X A;  1TIF A;  4HCN B;  3H7S A;  1UWX A;  4IDI A;  4NNJ B;  3U8Z A;  4AP4 C;  1N63 A;  2L0T A;  1CZP A;  2INP E;  4HDO A;  4K7S A;  3SR6 A;  4FLH A;  1XF5 L;  2C60 A;  2ZEQ A;  4HRO A;  3L0W B;  3UGB B;  3J9C A;  4W9J A;  2KFJ A;  2Y5P A;  5LXI B;  2KMM A;  4LTU A;  1WXV A;  3T8M A;  2D07 B;  2IJ0 A;  3AB5 A;  2IY0 B;  2L32 A;  3VFK A;  2V3P A;  4I6L B;  3BVG A;  1NYQ A;  2MSE D;  2LZ6 A;  4ANX A;  3AM9 A;  1X1M A;  4FHJ A;  1JWM D;  4JPS A;  4REZ A;  4YSX B;  2K39 A;  4XZ4 A;  1IPG A;  3AN1 A;  2KQS A;  1V49 A;  3BZD B;  2LGX A;  2V4I B;  5LXH A;  2BVC A;  4HDQ A;  3CF6 E;  1FXA A;  2J42 A;  1N5W A;  1SXT A;  1V80 A;  4PYU A;  2KDB A;  1E9M A;  2L0F A;  2K8C A;  2CR5 A;  2FCM A;  1WM3 A;  1ZDV A;  2V3S A;  3BK1 A;  3JYU A;  4IWP A;  3B1L X;  1VD2 A;  5JHA A;  1WF9 A;  1OEY A;  3DHH C;  1NVI D;  1PDX A;  4LJP B;  3ZUN A;  1TTN A;  2IBI B;  3S2A A;  2LHE A;  1WZ3 A;  5EE0 A;  4HKQ A;  4ZHO A;  2D5G A;  3P4Q B;  4E71 A;  1AW7 A;  4PS7 A;  4W9K A;  4IWQ A;  2JXX A;  1JQ4 A;  1CJE A;  4M0W B;  2MA9 B;  3WAO A;  2R2O A;  2KQ4 X;  2V3N A;  2VH1 A;  2BW2 A;  3NVV A;  1WRI A;  3DPD A;  3TL5 A;  1C4C A;  2KAN A;  5G5H A;  3PRE A;  2ZPN A;  4KDL B;  1FFU A;  2O6V B;  4NZL B;  4A3O A;  4EZJ A;  3NVZ A;  3DQV A;  1Q5W B;  3WAN A;  2IY1 B;  1YX5 B;  1UGJ A;  1ZE3 D;  2JWU A;  2IZV B;  2WXI A;  1FRD A;  2CHX A;  4RNA A;  2DBY A;  3SFD B;  3APF A;  1OFF A;  3V6E B;  1N6Z A;  4WQO B;  3AEG B;  2IO0 B;  1OTR B;  1UBQ A;  1Z2M A;  4JE3 B;  2E3T A;  4ANW A;  1JWS D;  3B08 A;  4WWO A;  1WE7 A;  2D11 A;  1HEZ E;  1WJ4 A;  1V1P B;  1C4P A;  1UNS A;  2M8S A;  3VAW A;  2INN E;  2D3C A;  3WAL A;  3A1Q B;  5AUK A;  2VZK D;  4KIK B;  4W9L A;  5G5G A;  3EC8 A;  4MJS B;  4LK0 M;  4XDC A;  1TT5 B;  2KFK A;  1QZE A;  2N4F A;  2HD5 B;  1IBX A;  2M17 A;  5J18 A;  3M63 B;  4IG7 B;  1K50 A;  3RNB C;  4KSK C;  1LM8 B;  1M94 A;  2V1Y A;  2GBN A;  4K81 A;  2LGD A;  3SEB A;  1V97 A;  2RSU A;  2CU3 A;  3EFU A;  4LNO A;  3DBH I;  3P1M A;  2KNB A;  4OHJ A;  3PZD A;  1V2Y A;  3BK2 A;  4JGH B;  1U4A A;  1I4H A;  1N60 A;  2J52 A;  3EFC A;  1JW9 D;  3FAH A;  3QAQ A;  1YMH E;  4P1C C;  4TKN A;  4NQK E;  3RUL A;  1XO3 A;  3WAM A;  5IP4 D;  4A9A A;  4II2 B;  2DYO A;  1FNW A;  3AEE B;  4IM0 A;  2LGI A;  1L6V A;  2G9H D;  2OJR A;  4W9I A;  2PE9 A;  3M62 B;  2ZVN A;  2GI9 A;  3U7D A;  4MEL A;  5CHV C;  2KHW B;  4FN2 A;  3AUL A;  5C3J B;  4MM3 B;  2J0K A; 
#chains in the Genus database with same CATH homology
 4IUM B;  2KX0 A;  2NR2 A;  3H7P B;  1V5O A;  3PPA A;  4BKS A;  1LXD A;  2K8H A;  3QAR A;  2JVC A;  3VVW B;  1C1Y B;  4MGK E;  5KHQ A;  4WAA A;  2KVR A;  2FIF A;  2L05 A;  1VCB A;  4PYZ A;  3V60 A;  1WGR A;  2Z59 B;  3RUI B;  1YQB A;  2A4Z A;  2DYM A;  3NHE B;  3VUY A;  3Q3F A;  2KTR B;  3DOW A;  5KHO A;  1KLV A;  2CS4 A;  3DVG Y;  3SDL C;  4RM9 A;  3ZRC A;  2BWF A;  4DDG D;  2JZZ A;  1RFA A;  2N9E B;  2PJH A;  5G2N A;  2KJH B;  3X23 A;  5TR5 A;  3UQA A;  2D2Q A;  2KXJ A;  2KJ6 A;  2KX3 A;  3DVG X;  3X0W A;  4AUQ C;  1YJ1 A;  2RD0 A;  1R4N I;  5DPR A;  4ZRK A;  4HWI B;  5D94 A;  4B6W A;  1XT9 B;  5JZE B;  4CO7 A;  1FXT B;  3A1Q A;  4ZRJ A;  2DAF A;  3CSF A;  3N30 A;  5D7G A;  1E7V A;  2LAS A;  1G6J A;  1WYW B;  4KIK A;  4LDT D;  1WMH B;  2LI5 A;  1E8Z A;  1EF1 A;  2ASQ A;  4IW0 A;  4XC2 A;  3RD2 A;  3V61 A;  4MJS A;  4F8C B;  4A3P A;  3QWZ B;  4KZC A;  1EO6 A;  1WRD B;  2L8J A;  3CMM B;  4W9F A;  5G55 A;  4ANV A;  3PT2 B;  1S1Q B;  3R66 C;  4HPM B;  2RPQ A;  3ZKJ C;  4FHK A;  3L13 A;  3NZU A;  1WXM A;  3H6N A;  3SHQ A;  1F9J A;  2JT4 B;  2I1K A;  1GJZ A;  2K6D B;  3LDZ E;  3P2B A;  2DX5 B;  4GDL A;  5JH5 C;  5IAA C;  3CST A;  1I42 A;  1ISN A;  4LDT B;  4FJZ A;  1WGY A;  2MBQ A;  3R7Q A;  2FCS A;  2N7D A;  4NJ7 A;  3VUX A;  3ZRF A;  2J0M A;  1L7Y A;  2C5L C;  4GN1 A;  4RMA A;  1L2N A;  2KD0 A;  2C9W B;  1GC6 A;  1V81 A;  1ZKH A;  3VXW A;  2R2Q A;  3OJ3 A;  4FAD A;  3VUW A;  4MEM A;  3AI5 A;  1TBE A;  2AL3 A;  3HK0 A;  2Z0E B;  3ZNI D;  3VTV A;  3ZNZ B;  3PRP B;  2REX A;  2WWZ A;  4HJK A;  2IO2 B;  3BY4 B;  2WX1 A;  1GC7 A;  2FCN A;  2L76 A;  4HLE A;  1WX9 A;  2QHO A;  3NZS A;  2BWE S;  2KO3 A;  2L3Z A;  3UIP B;  3V6C B;  3VH3 B;  1A5R A;  2UYZ B;  3JW0 X;  2BGF A;  4JIO U;  3RT3 B;  2JPH A;  2NBU A;  2HJ8 A;  4EKU A;  2NS5 A;  3JSV B;  2JRI B;  2M4N A;  1RLF A;  1I35 A;  2FCQ A;  3A9K A;  3PGE A;  1H8C A;  3W1S A;  3U30 A;  4FA6 A;  5BO4 B;  2C7H A;  1WFY A;  4MSQ B;  2MBB B;  2KDF B;  1UD7 A;  3GZN I;  2ZNV B;  2AL6 A;  4DBG A;  2GBJ A;  2KZR A;  4BKG A;  2MBH A;  2LVP A;  4EUT A;  2D10 A;  3ML8 A;  3SU8 X;  2LXA A;  3KYC D;  1KM7 A;  2L00 B;  3IG3 A;  2NBV B;  2LVO A;  3ECI A;  1XD3 B;  3AU4 A;  3DBL I;  2KJR A;  2MP2 A;  3R7R A;  3KW5 B;  4NAW A;  2GOW A;  1KJT A;  4BBN C;  2LVQ A;  3R3M A;  3O65 B;  3VH4 B;  4GB9 A;  4WWN A;  3VQI A;  2LD9 A;  2C7N B;  3ONS A;  4W9H A;  3D32 A;  2DEN B;  2G45 B;  3AXC A;  3KUC B;  3A9J A;  2KQ7 A;  2OOB B;  1WJU A;  3QX1 A;  2DZK A;  1V86 A;  3PLU A;  2KWV B;  2MX2 A;  5EDS A;  4CYE A;  1S3S G;  4G3X B;  2V4L A;  1J8C A;  4G11 A;  5AEK B;  3H7P A;  1AAR A;  1J19 A;  3I3T B;  2K1F A;  3RCZ A;  5DPT A;  2MRP A;  4K7W A;  4B95 A;  1C3T A;  3ZW3 A;  1OQY A;  3PHW B;  4I6P A;  1WM2 A;  3PVL A;  2LRU A;  2WDT B;  4G0N B;  2AEH A;  4KV2 A;  2I1J A;  5AZH A;  1SGH A;  2BF8 B;  2KTR A;  2IO3 B;  4PS3 A;  4WJO A;  1WIA A;  2KMA A;  5CX3 A;  5GMV A;  3ZDT A;  4URK A;  4GXB A;  2FNJ B;  5E6O A;  2DAJ A;  4BBN F;  1E8X A;  2C7M B;  4DHZ E;  4FBJ B;  3IFW B;  4GSW A;  4BKT A;  4ANU A;  3L16 A;  1IP9 A;  1UZX B;  4GMV A;  2LUE A;  2XK5 B;  4EFO A;  3KUZ A;  5E6P A;  4BVU C;  3LJ3 A;  4GOC A;  4EZK A;  3PLV A;  1KOT A;  1P98 A;  2CHZ A;  1WMH A;  3T9L A;  1GUA B;  3ZDM C;  2IO1 B;  1YD8 U;  4IC7 B;  4YL8 A;  2MBE A;  1EF5 A;  5LLI A;  2GBK A;  2YLM A;  3PRZ A;  3IBE A;  2KC2 A;  4JL9 A;  3L10 B;  1P3Q U;  2N9P C;  4E3C A;  3KYD D;  5IA7 A;  2BKR B;  2BYF A;  4OVV A;  3ENE A;  5DPW A;  2MQJ A;  3QC8 B;  3DVN V;  4M8M A;  3ZLZ A;  5D2M B;  2AWT A;  4HCN B;  3L17 A;  4ICV A;  3H7S A;  5JHB A;  3HM6 X;  1WI0 A;  4NNJ B;  3ALB A;  1Q1O A;  3U8Z A;  3EEC A;  4AP4 C;  4ICU A;  2LRW A;  3W1S C;  1GNU A;  4BFR A;  2L0T A;  3EHV A;  4JQW C;  3KVF B;  4ASW C;  3IVF A;  3TJP A;  3NS8 A;  4HDO A;  2GBM A;  4K7S A;  4AOF A;  2CKH B;  4FLH A;  3PS6 A;  1SIF A;  2C60 A;  1TGZ B;  2ZEQ A;  1OGW A;  3HIZ A;  3C0R B;  3L0W B;  3UGB B;  1T0Y A;  3OLM D;  4W9J A;  2KFJ A;  5FR6 A;  5C23 A;  5LXI B;  4NJ6 A;  3JSV A;  1WXV A;  2N1V A;  4KVG B;  1WX8 A;  3IHP C;  2MCN B;  3BIN A;  3T8M A;  5J2R A;  2D07 B;  2IY0 B;  2WX0 A;  3VFK A;  2RGF A;  4I6L B;  1H4R A;  3APD A;  2VRR B;  3WA0 A;  3Q3J A;  2MSE D;  2LZ6 A;  2BPS A;  4ANX A;  2NPT A;  4TV3 A;  1X1M A;  4FHJ A;  3WIM A;  4IWO A;  2MBO A;  4F7Z A;  4X57 B;  1NBF C;  4LCD E;  2K39 A;  4XZ4 A;  2ZJD A;  3PSE B;  1IPG A;  2K8B A;  2KDI A;  3MJW A;  2CHW A;  2KQS A;  2KFK B;  2IYD B;  1V49 A;  2N9X A;  2DYB A;  2PE6 B;  3MTN B;  3HHM A;  2LGX A;  1E90 A;  4MGY E;  2KWC A;  2PPH A;  3N32 A;  5LXH A;  2GMI C;  2CU1 A;  4HDQ A;  4NQL B;  3M3J A;  3CF6 E;  1EUV B;  4PS8 A;  3QQ8 B;  2KTF A;  2KMC A;  4TUU A;  1SE9 A;  2KDE B;  1V80 A;  4PYU A;  2KDB A;  3TCA A;  2L0F A;  4XX5 A;  2MLB A;  4II3 B;  1GG3 A;  1E8Y A;  2K8C A;  2CR5 A;  2FCM A;  3DCG A;  1RRB A;  1WM3 A;  4MM3 A;  3V62 A;  3QK0 A;  2V3S A;  3JYU A;  4IWP A;  1OEY J;  3B1L X;  4KSL C;  3APC A;  1VD2 A;  5JHA A;  1WF9 A;  3VTU A;  3ZIM A;  1OEY A;  3A33 B;  1E5W A;  2D3G A;  2UWQ A;  4LJP B;  2EMT A;  2FUH B;  2K25 A;  4B9K A;  3ZUN A;  1TTN A;  4I6N B;  3DDC B;  2IBI B;  3S2A A;  1UEL A;  2KC1 A;  4MSM B;  4ZDV A;  1LQB A;  1IYF A;  1WZ3 A;  2XK5 A;  2KK8 A;  3DBR I;  3QJZ A;  1CMX B;  2DZJ A;  4MH0 E;  4E71 A;  2PEA A;  4P7I A;  1WR1 A;  4PS7 A;  2ZPY A;  5L95 C;  2LXC A;  4W9K A;  4IWQ A;  2O6V D;  2NVU I;  4KDI C;  1TZ1 A;  1YX6 B;  1WZ0 A;  2JXX A;  2O2V B;  4GIV A;  4HK2 A;  4M0W B;  2MA9 B;  3NOB A;  3WAO A;  2R2O A;  2YVC A;  3UIO B;  2JF5 A;  4NY0 A;  2N7E A;  1XQQ A;  2MWS B;  2KOX A;  3ZVV A;  3A9J B;  3DPD A;  1NI2 A;  3TL5 A;  2KAN A;  2JUO A;  3PRE A;  2ZPN A;  4BOS C;  4KDL B;  4N9F 4;  1P0R A;  2O6V B;  3KH0 A;  5CTR C;  5C1Z A;  3SD5 A;  4A3O A;  2GBR A;  4BKS D;  4EZJ A;  3DQV A;  1Q5W B;  3PV1 A;  3WAN A;  1NDD A;  2IY1 B;  1YX5 B;  3WAP A;  4AWJ A;  3TIX A;  1Q0W B;  2ZNV C;  4GDK B;  2FAZ A;  4W9C A;  4WJP A;  2IZV B;  2CHX A;  1V5T A;  4ZRI A;  4HCP B;  3APF A;  3L08 A;  3B0A A;  3V6E B;  2B3A A;  1Z5S B;  2XEW A;  4OVU A;  4A20 A;  4WQO B;  5AZF A;  3JVZ X;  3UF8 A;  4DHJ D;  2DZI A;  2IO0 B;  2KLC A;  1OTR B;  4CHK A;  1UBQ A;  1Z2M A;  5E6N A;  2DZM A;  4DWF A;  4LJO B;  3A4S C;  2J7Q B;  4ANW A;  4IM3 A;  1WH3 A;  1WY8 A;  2ZZP B;  3B08 A;  4WWO A;  3W1Y A;  1WE7 A;  1WJ6 A;  4ZYN A;  1V9J A;  4WJN A;  2D11 A;  2JWZ A;  2M1M A;  4DHJ B;  1WJ4 A;  4FJY A;  4IM2 A;  4EZL A;  1WE6 A;  2M8S A;  4MDK E;  3VAW A;  3PRM B;  2KN5 A;  3K9P B;  3WAL A;  1WJN A;  3A1Q B;  3MHS D;  1UGM A;  1PQS A;  2WYQ A;  4KIK B;  4W9L A;  3ZNG C;  2EKE C;  1J0G A;  4GU2 A;  3EC8 A;  4MJS B;  3VHT C;  2KFK A;  3H1U A;  1D3Z A;  1LFD A;  1P9D U;  2A5U A;  2XBB C;  3GOE A;  1QZE A;  5CHW A;  5DPS A;  2N4F A;  2HD5 B;  2KLG A;  3RZW C;  1BT0 A;  3DVN U;  3ZTD A;  1Y8R C;  1JRU A;  2DHZ A;  4W9D A;  2M17 A;  5J18 A;  2N1W A;  1WGD A;  1K8R B;  1UBI A;  4GDL B;  1E7U A;  1WR6 E;  3M63 B;  4MGZ E;  4IG7 B;  1P1A A;  4JLC A;  4DDI D;  1UH6 A;  4KSK C;  5D6J B;  2BYV E;  1LM8 B;  1M94 A;  1MG8 A;  1R4M I;  4FUL A;  5J17 A;  2V1Y A;  5HKH A;  2GBN A;  4K81 A;  2LGD A;  2RSU A;  4AJW A;  3ZTC A;  3EFU A;  3NY5 A;  3VDZ A;  3H9D A;  1ZGU B;  3DBH I;  2G3Q B;  2KNB A;  4E74 A;  3PZD A;  5AZG A;  1V2Y A;  2M0X A;  5DCN A;  4JGH B;  3TMP B;  3PTF C;  2K6Q A;  3AU5 A;  1U4A A;  4NPN A;  4G50 A;  3OAW A;  4WWP A;  2JZ3 B;  2LGY A;  2NCN A;  2Z0D B;  3A4R A;  3UIN B;  2G4D B;  3DBS A;  3RYT A;  2LJ5 A;  3K9O B;  2J0J A;  2G4S A;  3ML9 A;  1WX7 A;  2W9N A;  3N3K B;  3QAQ A;  1E8W A;  2HE7 A;  2RR9 A;  4TQ1 A;  3PHX B;  3TBL D;  2ZCB A;  4NQK E;  4TKN A;  4W9E A;  2NPT B;  3A9K B;  3M95 A;  4EEW A;  4HVB A;  1WXS A;  3RUL A;  3ZNH B;  1WGH A;  2Y5B B;  2NBW B;  1WGG A;  2JY6 A;  2EMS A;  4KZ0 A;  3HM3 A;  2FID A;  4WJQ A;  3WAM A;  2O2V A;  4BOZ B;  3UQB A;  4II2 B;  4K1R B;  4TQ0 A;  3OJ4 B;  3QA8 A;  3KUD B;  2MW5 A;  2BYE A;  2DYO A;  4J6I A;  1ZW7 A;  1WXA A;  3RZF A;  3QIJ A;  2LWP A;  1V6E A;  4IM0 A;  2JRH A;  4DK5 A;  4GGQ A;  4HPL B;  2ZVO A;  2MP2 B;  2OJR A;  4W9I A;  2O6V A;  2PE9 A;  4FJV B;  1YIW A;  4F1S A;  4NAW B;  3ZO5 B;  4K7U A;  4DHZ B;  3M62 B;  2ZVN A;  3L54 A;  3QCA A;  5CHF A;  3U7D A;  3QHT A;  4MEL A;  5CHV C;  2KHW B;  4MGI E;  2HTH A;  4FN2 A;  5L83 A;  3AUL A;  2KWU B;  2BKF A;  2AYO B;  4DXA B;  4GDK A;  1HE8 A;  4HXD A;  2KKC A;  4EOY A;  2J0K A;  2L7R A;  4W9G A;  3VTW A;  1RAX A;  4AJY B;  4RM8 A;  2ZCC A;  4M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...