5FR6A

The structure of polycomb uld complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
83
Chain Sequence
b'DDEIISLSIEFFKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYCOMB COMPLEX PROTEIN BMI-1
publication title Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 83
sequence length 105
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5fr6A00
2DYBA 4WWOA 2M17A 2LGYA 2HJ8A 2PE6B 4MGIE 4FBJB 1UELA 2FNJB 2LXAA 5JH5C 2NCNA 3L54A 4HCNB 2ZNVC 1TGZB 3TL5A 1R4NI 2GBNA 2LGXA 3LJ3A 3PGEA 3L13A 3TIXA 3PSEB 5CHFA 3V6CB 4FJZA 4XZ4A 2NS5A 2RPQA 1UGMA 2MLBA 2C7NB 3UQAA 2CU1A 3T8MA 1WJ4A 1NDDA 1WE6A 2KJ6A 5DPWA 2MSED 1SE9A 2O2VA 1OGWA 1P1AA 2CS4A 3ZNZB 3A9JB 1YX6B 3AXCA 3IG3A 3IFWB 5LXIB 4AWJA 1WZ3A 4TKNA 2ZCBA 2G4SA 3PLUA 3QJZA 4RMAA 1S3SG 2KQ7A 4KV2A 2RSUA 4E74A 4DDID 3ONSA 2LGDA 3PVLA 5AZGA 4NJ6A 4IM0A 1OEYA 4BVUC 5GMVA 1WXVA 5AZHA 4IM2A 5AEKB 2Y5BB 1E8WA 1WMHA 3BY4B 4II2B 4NQLB 1H4RA 3ML8A 4BKSA 1Q1OA 2NPTA 2L05A 3DBLI 3HK0A 3L10B 2N9PC 1UH6A 2N7DA 4WWNA 2J0MA 2QHOA 4DXAB 4MSMB 4BBNF 2O2VB 2FIFA 3GZNI 2MW5A 2IY0B 3A9KB 3N3KB 4DBGA 3DOWA 2K6DB 2MX2A 2ZZPB 2DHZA 1GJZA 2M4NA 3QAQA 4LJOB 4EFOA 4A20A 3MJWA 3CF6E 4HDQA 3TMPB 4ICVA 1WF9A 2CHZA 4HK2A 1XQQA 2WYQA 3L17A 1CMXB 2D2QA 2L3ZA 5DCNA 4K7WA 2DZMA 2HTHA 4ZRJA 1LM8B 5E6NA 3Q3JA 3ZUNA 4GU2A 1E8YA 1WMHB 1MG8A 3ECIA 3JYUA 3U30A 3ZDTA 2JUOA 3WAOA 2NPTB 2K1FA 4GDKA 3AI5A 2EKEC 1WRDB 2GBJA 4FADA 1Q5WB 4RM8A 2KHWB 1WXSA 2RD0A 3SU8X 2C7HA 2DAFA 1YX5B 2MP2A 3H9DA 3A33B 2DZIA 3DBSA 3Q3FA 1WJNA 4NAWA 3T9LA 1WH3A 3I3TB 3V62A 4EUTA 3OLMD 2KFKA 5KHOA 4DHJB 3VVWB 4I6NB 5EDSA 2C7MB 4N9F4 1TTNA 3AU4A 4W9KA 4DHZE 2LVOA 1NBFC 2IY1B 2K25A 2RGFA 3DVNU 3HM3A 3QK0A 2PJHA 4EZJA 2DZKA 4F8CB 1ZGUB 4HCPB 5DPTA 1P0RA 3ZNGC 2EMSA 4A3PA 1C3TA 2AYOB 5D7GA 3ZW3A 2A4ZA 4ANVA 4GDKB 2GMIC 2KX0A 3L0WB 2BKRB 2FCQA 2J0JA 5D94A 3ZO5B 4BKSD 2N1VA 2AL6A 4FN2A 3WANA 3B1LX 2L76A 2DENB 3APDA 3PV1A 4NAWB 2BWES 1UBQA 2IO2B 4GDLA 4WJOA 1WGYA 2YVCA 2NBVB 1U4AA 2O6VB 4JQWC 3K9OB 3WAMA 4LCDE 2LVPA 4DHJD 5CHWA 2MRPA 2AEHA 2KZRA 3DBRI 3HIZA 2K6QA 4KDLB 4TUUA 1KLVA 2AWTA 4MDKE 3NZSA 1K8RB 3R3MA 3VTVA 1E8ZA 2C9WB 2D3GA 3R7QA 1D3ZA 4DHZB 3DBHI 2ASQA 2KDIA 2DAJA 2Z0EB 3WA0A 2I1KA 2JVCA 3ZRFA 1C1YB 4MM3A 3V60A 1WJUA 1Y8RC 4E3CA 3UQBA 4HPLB 4TV3A 4F1SA 4GDLB 2LRUA 4URKA 3NY5A 3A9JA 3VUWA 4KZCA 3P2BA 2FCNA 4GOCA 3CSTA 3BINA 2V4LA 2MWSB 3HHMA 2C60A 3W1SA 3UGBB 3A1QA 2MBHA 4KDIC 3R7RA 5JZEB 5IA7A 3DQVA 3M63B 3PREA 2M1MA 2MBOA 3DVGX 3QARA 3TJPA 3N32A 2PPHA 1SGHA 2KDBA 5C1ZA 4K7SA 3U7DA 3IVFA 1UBIA 2ZCCA 1V2YA 2ZPNA 2DYMA 2JY6A 2LXCA 2JZ3B 2IO0B 4FHJA 4NQKE 2ZJDA 1VD2A 2FCSA 4MELA 1V6EA 2D07B 1V5OA 4PS7A 1WYWB 1J8CA 2G45B 3B0AA 1L7YA 3A9KA 4ZRIA 2K8HA 4EZKA 4HVBA 2KMCA 2VRRB 3VTWA 1M94A 2GBKA 3A1QB 3PHXB 4HLEA 2KQSA 1YD8U 4EZLA 3GOEA 2KK8A 1V80A 1YJ1A 3KVFB 5KHQA 3DVNV 4GMVA 1XT9B 5J2RA 3PPAA 1S1QB 2N9EB 3A4RA 3ZTCA 4LJPB 2KC1A 4K81A 1I35A 4PYZA 1WIAA 2Z0DB 4E71A 2UYZB 3H7PA 1E7UA 2HE7A 1JRUA 2L8JA 2YLMA 4GXBA 2WX0A 1OTRB 5JHAA 4K7UA 4GSWA 2MCNB 3QQ8B 2FAZA 3N30A 1Z5SB 4MH0E 3U8ZA 2KO3A 5D2MB 2XK5A 5TR5A 3ZVVA 3M3JA 4KSKC 3DVGY 5J17A 3K9PB 1KJTA 2BYVE 4JL9A 3OAWA 3QCAA 1Z2MA 2GOWA 3ZIMA 4EOYA 3IBEA 1OQYA 2PEAA 2KDFB 2JT4B 4XX5A 1LXDA 2MQJA 2UWQA 1G6JA 2L7RA 3RZWC 1J0GA 4K1RB 1V5TA 3HM6X 4JGHB 3H7PB 4M0WB 2KKCA 3QA8A 2L0TA 4MGYE 1NI2A 2KLGA 3VUYA 3JVZX 4HJKA 4I6PA 4NNJB 2KX3A 2DX5B 2LWPA 3PT2B 4BBNC 2IO3B 2AL3A 2FCMA 2LRWA 5CX3A 3SDLC 3WAPA 1WGDA 3ZKJC 1IPGA 4EEWA 5J18A 2XK5B 4I6LB 2Z59B 1RLFA 1WI0A 2G3QB 3UIPB 4GGQA 3X23A 2O6VA 3B08A 1WR1A 2OOBB 1WM2A 2W9NA 3PRZA 4IWPA 5FR6A 2ZNVB 3JSVB 4KVGB 1J19A 4BKTA 4A3OA 4FULA 2N9XA 5DPRA 1YQBA 1GC6A 4XC2A 3UF8A 3PS6A 2BYFA 4DDGD 1P9DU 2CHXA 2J0KA 5DPSA 3ZNID 2JZZA 4J6IA 4GIVA 2BGFA 1LQBA 2DYOA 4F7ZA 1V49A 1X1MA 3ALBA 4ZDVA 3EECA 2ZPYA 3VTUA 5L95C 2OJRA 2DZJA 3PLVA 4ANXA 4CHKA 4BOZB 3RULA 1WM3A 2IYDB 5CTRC 2WWZA 2D10A 4JLCA 1WGRA 3AU5A 2LVQA 3L08A 1EUVB 2JPHA 2KJRA 2XBBC 4G11A 1P98A 2LJ5A 3ZNHB 4BKGA 4AJYB 1GG3A 4ZRKA 2KMAA 1YIWA 1WX8A 3UIOB 4KSLC 2IZVB 1KM7A 5C23A 4MGZE 4BFRA 2KTFA 3EFUA 3RZFA 3O65B 1SIFA 4FJVB 4PS8A 2M8SA 3LDZE 4HWIB 4MEMA 3MTNB 3VUXA 1T0YA 3EHVA 2KC2A 2BPSA 3ENEA 3CMMB 3APFA 3ZRCA 4KIKA 2BWFA 4GN1A 4WWPA 4ASWC 5LXHA 2O6VD 4DWFA 2NVUI 2WDTB 2BKFA 3DCGA 2K8BA 2MBBB 3MHSD 4W9EA 2CKHB 4W9JA 3NHEB 3RD2A 5L83A 1V9JA 1WY8A 2GBMA 3PRPB 3KUCB 4NY0A 5BO4B 1KOTA 1E90A 3R66C 3KYCD 2L0FA 1EF1A 3C0RB 2KNBA 3UINB 1BT0A 3OJ4B 2KXJA 2LZ6A 3PZDA 4W9FA 4FA6A 1L2NA 4PYUA 3QWZB 1FXTB 3PTFC 2KN5A 3RT3B 1PQSA 2FIDA 2I1JA 2PE9A 1WE7A 4KIKB 4ANUA 4IM3A 3ZDMC 2HD5B 3CSFA 1TBEA 4TQ1A 3S2AA 1E5WA 1WJ6A 2KTRA 2KVRA 3JW0X 1WFYA 4X57B 1WX9A 5LLIA 3X0WA 4OVVA 4IG7B 2NBWB 5D6JB 2JRIB 3RCZA 4CYEA 4ICUA 3M95A 5HKHA 3VFKA 4FLHA 4WJPA 4W9LA 3VAWA 3QX1A 4W9IA 4DK5A 2BYEA 4BOSC 2ZEQA 4WQOB 3D32A 4AOFA 2NR2A 2KANA 4LDTB 4B6WA 3VH4B 3VDZA 1IP9A 3H1UA 3WALA 2FUHB 1R4MI 3NS8A 1WR6E 1A5RA 1Q0WB 2KOXA 4AP4C 1E8XA 1ZKHA 2KTRB 2GBRA 4HDOA 2KLCA 4WJQA 4ZYNA 3WIMA 3ML9A 3JSVA 3W1YA 2CR5A 4HPMB 4YL8A 4AJWA 2B3AA 1WGGA 4ANWA 3NZUA 4IW0A 1P3QU 2BF8B 4PS3A 4HXDA 4OVUA 2JXXA 2G4DB 4NJ7A 3V61A 3TCAA 3DDCB 2LD9A 1QZEA 4LDTD 3NOBA 2R2OA 1WX7A 1RFAA 2REXA 4IWOA 4W9HA 4IC7B 4IUMB 4EKUA 2WX1A 1EF5A 5G55A 2JF5A 4B9KA 3KH0A 1XD3B 3RUIB 1WGHA 2MA9B 4FHKA 2EMTA 3PRMB 2C5LC 1E7VA 3A4SC 2CHWA 3VXWA 1H8CA 4FJYA 5AZFA 2LI5A 3VH3B 2KFJA 2MBQA 2J7QB 2R2QA 3KW5B 2XEWA 3L16A 4G3XB 3TBLD 3DPDA 4M8MA 3SD5A 3W1SC 4W9DA 1TZ1A 1ISNA 3OJ3A 1AARA 2JRHA 4MJSA 3VQIA 1VCBA 2N1WA 4G0NB 4B95A 2KWUB 2K8CA 5JHBA 3APCA 3KYDD 1V86A 2IO1B 3VHTC 2IBIB 1WXMA 3M62B 5E6PA 1OEYJ 2RR9A 2ZVNA 2KWVB 4G50A 2V3SA 3PHWB 1UZXB 2MBEA 3QHTA 2N4FA 2K39A 2NBUA 5E6OA 2L00B 2MP2B 4W9CA 4AUQC 1IYFA 1ZW7A 2M0XA 4MGKE 3IHPC 3RYTA 2KFKB 3H7SA 4GB9A 2N7EA 4P7IA 2JWZA 4CO7A 4RM9A 2LASA 4M8NA 4JIOU 1I42A 4MJSB 1EO6A 1WZ0A 3ZLZA 1GUAB 3AULA 4WJNA 4NPNA 3KUDB 3KUZA 4IWQA 4WAAA 3V6EB 4W9GA 3ZTDA 1UD7A 3SHQA 1RRBA 3H6NA 1F9JA 2D11A 1GNUA 2KJHB 3EC8A 3QC8B 1HE8A 4KZ0A 1WXAA 2LUEA 2KDEB 4MSQB 3QIJA 1V81A 2KD0A 2KWCA 2V1YA 1RAXA 4II3B 5CHVC 5IAAC 1LFDA 1GC7A 2A5UA 4TQ0A 5G2NA 2ZVOA
chains in the Genus database with same CATH superfamily
2M17A 3Q8FA 1UELA 1M4VA 2LXAA 2NCNA 1I4HA 3R2IA 2ZNVC 2NTTA 2GBNA 2LGXA 3ABVB 3PGEA 3Q6BA 1XCTL 2GB1A 1TKYA 1YMHE 1UGMA 3GS2A 2MLBA 3UQAA 3KLSX 3T8MA 1WE6A 2DLBA 5FKAC 2WXQA 1P1AA 3IG3A 4AWJA 4TKNA 2ZCBA 3PLUA 2RSUA 5HHDG 5AZGA 4ZHPA 1E6EB 1EWYC 1DOYA 1OEYA 2K5PA 5GMVA 4BVUC 2Y5BB 3NVZA 3DBLI 3L10B 2YEPB 4P16A 2N7DA 4CQNA 2QHOA 4MSMB 2O2VB 2L1AA 2SAKA 1GJZA 5JXVA 4HDQA 2ZW0A 2CHZA 4HK2A 1CMXB 5DCNA 4K7WA 2D5GA 1C76A 3ZUNA 1J7BA 1MG8A 3B9JA 2J52A 3JYUA 1DYQA 4GDKA 3C19A 4FADA 2RD0A 1L0YB 5MPOA 2C7HA 2MP2A 4ARCA 4NAWA 3DBSA 1WJNA 5G5HA 1WH3A 3Q3NC 1KTKA 1QOAA 1AW7A 1L4ZB 1TTNA 3AU4A 4DHZE 4XDCA 2PJHA 1SJED 5DPTA 5LNK1 2D3BA 3ZGZA 2EMSA 2YEPF 2X8XX 4ANVA 3ZW3A 2BKRB 3ZO5B 2CU3A 2N1VA 1UNSA 3WANA 2DENB 1RM6C 4WJOA 2O6VB 4JQWC 3K9OB 4DHJD 5CHWA 2PW9A 3AE3B 2K6QA 3HIZA 4KDLB 4LNFA 3NZSA 3R7QA 2XNAC 3DBHI 2L52A 2KDIA 2WDQB 3V60A 1WJUA 3O13A 4URKA 2LRUA 2M0AA 3A9JA 3P2BA 3BINA 1P7FA 3UGBB 4KDIC 2MBHA 5IA7A 3PREA 2MBOA 3N32A 2PPHA 1TJEA 1SGHA 2DYMA 1LO5D 4LNNA 1RFKA 2IO0B 4D2KA 2PLPA 2FCSA 3N1XC 2KT7A 3AE8B 2D07B 1SJHD 1V5OA 2N9LA 4MM3B 2G45B 3N9YC 1ZOYB 3B0AA 4KGSA 3PZ7A 3A9KA 1TS4A 4HROA 4B0MA 2KN4A 3A1QB 2UU7A 2V3NA 1FNUA 1AWDA 1MVKA 1V80A 1YJ1A 1S1QB 4LJPB 1I35A 4E71A 1WYGA 3RNAC 4HRSA 2FAZA 3N30A 2BVCA 2M19A 4MH0E 2KO3A 5D2MB 2XK5A 3IT6B 3K9PB 1KJTA 3OAWA 2PEAA 1C79A 4XX5A 2MQJA 1K53A 1V5TA 2KKCA 3QA8A 2L0TA 1NI2A 4PT5A 3LYYA 4HJKA 2KX3A 2DX5B 3PT2B 4BBNC 1JRPA 5CX3A 2AL3A 3ZKJC 3WAPA 2VH2A 1DGJA 2WP9B 4MT5A 1WR1A 2W9NA 4KVGB 1J19A 2W82A 4FULA 1GC6A 2BW2A 3PS6A 3Q8CA 4DDGD 1PGBA 1I4XA 2JZZA 1LQBA 2DYOA 1UUPA 1X1MA 4ZDVA 5L95C 5EE9A 1L4DB 4ANXA 2JZPA 3RULA 2KVZA 2PVGC 3B2GA 2WWZA 2D10A 2JXTA 4B0EA 2JPHA 2LJ5A 4AJYB 1GG3A 5C23A 3P4SB 4BFRA 1HQRD 4HKQA 3RZFA 1WWTA 4HWIB 3PO0A 3MTNB 3EHVA 3U2SC 2BWFA 4WWPA 2BQQA 3RNBC 2O6VD 2NVUI 3DCGA 1MG4A 4W9JA 1WY8A 3ZYYX 3R66C 2L0FA 3WCQA 2KNBA 3P4RB 2KXJA 1OQRA 2HDEA 2Y5CA 1TY2A 1FMAD 2DWQA 1L5PA 3PTFC 3RT3B 1HTQA 4ANUA 4WIPA 3ZDMC 2HD5B 5D3IB 5H8YE 3OWEB 1E5WA 2BYTA 2KTRA 2KVRA 1WX9A 1XXGA 2NBWB 2JRIB 1YQ4B 1JROA 3VFKA 3TEXA 4C4VA 4YSXB 2L83A 1Q10A 3VAWA 1N63A 2ZEQA 1EU4A 3D32A 4WURA 3NVYA 2WQYB 3H1UA 1HA5A 3NS8A 1E8XA 1XEEA 4M02A 2ZW1A 2KLCA 3WIMA 1N62A 3W1YA 2Z8LA 1ET6A 2CR5A 4YL8A 2WDVB 3HUIA 4OZBA 4ANWA 2BF8B 1SSNA 3AEBB 4HXDA 3I57A 4LDTD 3FILB 4RNAA 1WX7A 4IC7B 2WU2B 4C80A 2WX1A 1EF5A 2JF5A 4LLGM 3SFDB 2RMMA 1WGHA 1AN8A 1GPXA 4N58A 5AZFA 3VH3B 5IO9A 1TIFA 1FCLA 1MJDA 1N5WA 1ISNA 2WU5B 3OJ3A 1AARA 1F2RI 1UF0A 4MJSA 1J7CA 4G0NB 4B95A 4H2AA 4MH8A 3APCA 2QCZA 4KX6B 1K51A 2RR9A 4ZRQA 2I2YA 1FNWA 2K39A 5E6OA 4AUQC 2MP2B 4W9CA 1WSPA 1XCQL 2M0XA 4US9A 2WXOA 4CO7A 1FO4A 1N5XA 1T6BX 3ZLZA 4YWGG 3P42A 3KUZA 2LMCA 2CJNA 2D11A 1HE8A 1GAQB 2PIAA 2KDEB 3I5JC 4UDUC 1TS3A 3IT4B 4YSYB 2BB5A 1C4AA 2HJ8A 2LGYA 4MGIE 2V4IB 1E10A 3W2DA 4HCNB 1NYQA 1R4NI 2JWUA 2K9XA 3V6CB 1VLBA 1FIQA 2NS5A 4WAFA 2RPQA 1JCKB 4Q2JA 1NDDA 4WH4A 4P1BC 3ZNZB 3A9JB 3IFWB 1FRRA 2INPE 1WZ3A 1GOZA 1TYGB 3QJZA 4E74A 2BT6A 3Q3OC 3ONSA 2LGDA 3DBLB 3PVLA 3SFEB 4NJ6A 5AEKB 3P4QB 5HI1A 1WMHA 2INNE 4NQLB 1H4RA 1Q1OA 4ARIA 3HK0A 2N9PC 4P6VF 1UH6A 4WWNA 2J0MA 2FIFA 3A9KB 3B2FA 3EUB2 4DBGA 1ZE3D 2LHEA 2DHZA 2M4NA 3MJWA 4R3DA 1LGRA 2WXFA 1GB4A 1XQQA 1ZP0B 2L3ZA 2WXRA 1V1PB 1LM8B 1E8YA 3ECIA 1ESFA 1JWUD 2NPTB 4RH6A 3AI5A 4A8XC 1PFDA 2GBJA 2DAFA 2WGSA 4DHJB 4I6NB 1FXAA 2LVOA 2N0SB 2RGFA 3QK0A 4F8CB 4HCPB 1MHHE 3ZNGC 2AYOB 1VJKA 5D7GA 2A4ZA 3AM9A 3L0WB 2FCQA 5D94A 5IP4D 2L76A 3PV1A 2YVCA 2NBVB 2J4XA 1WGKA 3DBHB 4TUUA 4P1CC 4MDKE 1ZUD2 2WXIA 4ZRPA 3AMZA 3WA0A 1C1YB 4HPLB 4TV3A 4GDLB 3CSTA 3HHMA 2C60A 3DVGX 3TJPA 1D5XC 4WQMA 3AEFB 1F1HA 1YN5A 1ACCA 5C1ZA 3U7DA 3RNEC 1RWSA 1V2YA 2ZPNA 2JY6A 2JZ3B 2WXLA 1VD2A 3GB1A 2X38A 1XLOA 4PS7A 4ZRIA 2K8HA 4EZKA 3HVDA 3VTWA 1M94A 4PK1A 1XLNA 1YD8U 4YTNB 3N20C 3PPAA 2LGIA 3A4RA 4K81A 1R4MB 3H7PA 2L8JA 2YLMA 3IAS1 1OTRB 5JHAA 4ITKA 4RGMA 4JPSA 2MCNB 4ZHOA 2OEDA 5TR5A 4XGAB 2WXKA 3IBEA 5BMIA 4YT0B 2UWQA 1G6JA 4DXGA 3RZWC 2BS4B 4M0WB 4MGYE 2KLGA 4NNJB 3BK1A 4OHJA 3RNGC 4I6LB 2L32A 2G3QB 4TMAB 3TEYA 4C56C 2AQ1B 2AX5A 4IWPA 2BBCA 2ZNVB 2W3RA 1FRDA 4BKTA 2JX5A 2QEJC 3UF8A 1B1ZA 2BYFA 4MACA 2J0KA 3P1MA 3ZNID 5T8IA 3IXSA 1QOFA 4YTMB 5BYQA 3VTUA 1T0SC 1KLGD 4CHKA 4BOZB 1WM3A 2N7JA 3V3XA 1WGRA 3L08A 2LVQA 3HRDD 1EUVB 2XBBC 2IDYA 4G11A 3ZNHB 2AQ2B 4ZRKA 1WX8A 3UIOB 1IBXB 1JALA 1NI3A 2FE8A 1FNVA 1KM7A 2KTFA 2MJDA 3EFUA 4MEMA 3J9CA 2DNFA 2BPSA 1OQQA 3Q8AA 3ZRCA 4C7YA 3RFZB 1PUTA 1NVID 1T0RC 4K3BA 1PGXA 1I4GA 2LFIA 3C0RB 1BT0A 3OJ4B 3PZDA 4FA6A 4K3CA 3QWZB 2KN5A 1HZ6A 1FD6A 2FIDA 2I1JA 1N6ZA 1WE7A 4KIKB 4IM3A 3CSFA 1TBEA 3MC9A 3S2AA 3RI7C 2K0PA 1I4PA 4IKGA 1WFYA 2VH1A 5D6JB 3RCZA 4LTUA 3NS1A 4WJPA 4A6QA 4HJGE 2BS2B 4WQOB 4LDTB 3BWUD 2WXMA 3AE7B 2D3AA 3VDZA 1R4MI 4ZOHC 1QF6A 1A5RA 1Q0WB 4A90A 1ZKHA 4KKIA 3U52E 2GBRA 3JSVA 4HPMB 4AJWA 1K52A 4PS3A 2G4DB 3TCAA 2LD9A 3NOBA 2R2OA 4IWOA 2ACZB 4IUMB 4BZAA 1Y56A 2J53A 4B9KA 3N1ZC 3KH0A 1XD3B 4FHKA 2EMTA 3R8BA 2QIEB 1VZ7A 3PRMB 5IN7A 2C5LC 1E7VA 3A4SC 2KFJA 2WXJA 3KW5B 1YN4A 3SD5A 3Q8EA 2MEKA 4W9DA 4OZCA 1SXTA 2JRHA 1SE4A 2MH7A 2KYWA 4JX1C 3E56A 1R7SA 3ZQ4A 3VHTC 2IBIB 2H89B 3M62B 1STEA 2V3SA 1SIJA 3BYYB 1UZXB 3OG5A 2NBUA 1ZW7A 3RYTA 3H7SA 2VZKD 2BS3B 4P7IA 1QLBB 4C7ZA 1F0ZA 4RM9A 1YJIA 2LASA 2KDMA 1CK1A 1I42A 1EO6A 3IAM1 1GUAB 3AULA 4WAAA 3V6EB 2LJIA 4W9GA 3ZTDA 3SHQA 2KJHB 1QQRA 4WWMA 4XYCA 1V8CA 4MSQB 2KWCA 5IAAC 1R4NB 3TUOA 5TSSA 2KWDA 4DQOC 1WXQA 4XWWA 2PE6B 4FBJB 2K3UA 1E9MA 3W5UB 3L54A 1TGZB 5AUKA 3L13A 3PSEB 3DWGC 1HEZE 1CQVA 2CU1A 1SB3C 1WJ4A 2QJLA 2G1EA 1SE9A 2O2VA 1OGWA 3AXCA 2M56B 5LXIB 2G4SA 4RMAA 2KQ7A 4DDID 1ENFA 1VDVA 4M01A 4IM0A 1KLUD 2V3PA 2KMMA 4YSZB 1WXVA 5AZHA 4IM2A 3RMKC 1SEBD 1D6EC 3NJTA 3ML8A 4BKSA 2L05A 1MFWA 2WS3B 2WDRB 4BBNF 1I4RA 3GZNI 3N3KB 1QKZA 2MX2A 4EFOA 4A20A 3CF6E 3TMPB 4ICVA 1PDXA 5GXGB 1EM7A 2WYQA 3L17A 4JWUC 2DZMA 5E6NA 5FR3A 4GU2A 3ZDTA 2B76B 3U30A 3R2TA 3T3OA 2JUOA 1VR9A 3WAOA 3RNCC 2K1FA 2EKEC 2J42A 1Q5WB 1HXYD 3H9DA 3A33B 2DZIA 4KGRA 3T9LA 3I3TB 4LNOA 2FUG1 3AN1A 3VVWB 5EDSA 2C7MB 1NBFC 4DXFA 2IY1B 3DVNU 2KAJA 4OW0A 1JWAD 2DZKA 1ZGUB 1L0XB 1P0RA 4A3PA 1ROEA 2HJ1A 4GDKB 2GMIC 2KX0A 2J0JA 3TEZA 2WLBA 3DHHC 5C2TB 2KQ4X 3B1LX 2WXGA 3T3NA 1TS2A 4NAWB 2IO2B 1WGYA 1U4AA 1F52A 2W54A 4JE3B 2MRPA 2AEHA 2KZRA 3DBRI 2WXNA 2AWTA 3VTVA 1E8ZA 4M00A 1JWMD 2ASQA 2Z0EB 1ZPSA 2JVCA 4QAYA 4MM3A 2RDHA 3MP9A 4F1SA 3Q69A 4KZCA 4GOCA 2FCNA 2JYTA 2V4LA 3W1SA 3A1QA 3AE6B 3M63B 4REZA 2M1MA 3QARA 2N9KA 2KDBA 4K7SA 4XE0A 1UBIA 2ZCCA 1VRAB 4FHJA 1WYWB 1FCCC 1L7YA 1N61A 2GBKA 2KQSA 4IOIE 3MC0B 3L4PA 3DVNV 1XT9B 4AS1A 3ZTCA 2KC1A 4PYZA 1WIAA 2Z0DB 2UYZB 1E7UA 2WX0A 1BMLC 1T0QC 3U8ZA 3W9CB 3VRBB 4KSKC 1IUEA 4RGNA 3DVGY 5J17A 1YQ3B 3FKYA 3EFCA 3QCAA 1Z2MA 3AECB 4EOYA 3CWIA 1OQYA 2JT4B 4LK0M 2E6XA 2L7RA 1J0GA 2QMTA 4K1RB 1CZPA 2FBWB 3Q14C 3JVZX 3AEDB 2LWPA 4KKJA 2AQ3B 2IO3B 2FCMA 5AUIA 1T3QA 4J3OD 2XK5B 1I4QA 1RLFA 1WI0A 3U4EG 4GGQA 3B08A 3W5VB 2RDBC 4OVZA 1MPEA 1WM2A 2OOBB 3JSVB 1YQBA 1DOXA 1P9DU 5DPSA 4FXCA 4J6IA 2JYEA 2G9HD 3AV8A 4HKZE 1QILA 2BGFA 3TSSA 3VRAB 4F7ZA 1V49A 2ZPYA 2OJRA 2DZJA 2IYDB 5CTRC 3AU5A 1E7PB 2KJRA 1P98A 3LB8C 3AE2B 2KMAA 1YIWA 3Q3MC 4MGZE 1KRHA 3O65B 1SIFA 4FJVB 2M8SA 3VUXA 4LNIA 3LXFA 3NRZA 2KC2A 3I63C 4EE2A 3MFGA 4ASWC 5D3DA 5LXHA 4DWFA 3GE3C 2BKFA 3ZXRA 2K8BA 1FXIA 3NHEB 3ZJVA 1V9JA 2WHIA 1KOTA 4NY0A 3KUCB 5BO4B 1E90A 3KYCD 1ZDXA 3UINB 2LZ6A 1GB1A 1L2NA 3DHGC 4PYUA 1FXTB 1PQSA 2IGHA 2OHFA 4TQ1A 3KWLA 3FAHA 4X57B 3N1YC 3X0WA 4OVVA 4IG7B 4CYEA 1MI0A 5HKHA 2MHJA 4W9LA 4W9IA 4DK5A 1VZ8A 4BOSC 2KANA 4B6WA 2GLSA 1UGJA 2NTSA 3FILA 1IP9A 3ZXVA 2KOXA 4AP4C 1V1OA 4IDIA 2KTRB 1VZ6A 1IGCA 4ZYNA 1SE3A 3KQ4A 2B3AA 4C4VB 1NYRA 1P3QU 1I7HA 1YJJA 3V05A 3EA6A 4OVUA 1C4PA 5HG2A 4AQ7A 4NJ7A 3V61A 3E9SA 1QZEA 1TKEA 1E0ZA 2QSDA 1L0VB 2REXA 4EKUA 2PVOD 4L2YA 2W3SA 3AE1B 4RGOS 5H92C 2IGGA 3VXWA 1H8CA 4FJYA 2LI5A 2V0GA 2J7QB 2R2QA 3L16A 4G3XB 4JWSC 2ICIA 1OFFA 3DPDA 2VZKB 3W1SC 2IJ0A 2D3CA 1XO3A 5EE3A 1QT9A 2KWUB 2K8CA 3I9V1 2IO1B 1TS5A 1UWXA 1WXMA 5E6PA 4G50A 3P63A 3PHWB 1BUIC 1JW9D 3BIID 3QHTA 2WXPA 5BYRA 5EE0A 4GB9A 3U7ZA 2N7EA 1TT5B 4M8NA 1XLPA 4MJSB 1WZ0A 1L6VA 3KUDB 1RRBA 1SBBB 3EC8A 1GNUA 4C00A 4NZLB 1D5MC 1JMLA 4KZ0A 4ACFA 2LUEA 1DOIA 3VQIA 2KD0A 5BYSA 5CHVC 1RAXA 1TZOA 1GC7A 3H8HA 5G2NA 2JQRB 2ZVOA 2DYBA 4GLSC 3HVZA 3Q8BA 4WWOA 1IGDA 2FNJB 5JH5C 2INDC 2MJEA 3TL5A 3MHZA 3LJ3A 3TIXA 5IKCM 5CHFA 2W55A 4FJZA 4XZ4A 1F2RC 2C7NB 5DPWA 3MJ5A 2KJ6A 4S0RA 1C9FA 2V9HA 2MSED 1EU3A 2QDFA 2QILA 2CS4A 1YX6B 3ETRA 1XLQA 1S3SG 4KV2A 3ZJUA 2INCC 1B9RA 1V1PA 3NG0A 3GZNB 1SF0A 1E8WA 4L23A 3BY4B 4II2B 2NPTA 5FK9C 1AYFA 3BVMA 2Y3AA 4DXAB 2MW5A 2IY0B 1RYJA 3DOWA 1C78A 1P7EA 2K6DB 2CJOA 2ZZPB 3QAQA 4LJOB 1FPYA 1WF9A 2D2QA 1T5XD 2HTHA 3BYTB 4ZRJA 3Q3JA 3P4PB 1WMHB 3BVGA 4YTPB 5G5GA 1WRDB 4RM8A 2KHWB 1WXSA 3SU8X 2RDGA 1KH0A 1YX5B 1ZXIA 5IOIA 3Q3FA 3V62A 4EUTA 2LEKA 3OLMD 2Y5PA 2KFKA 5KHOA 4N9F4 4W9KA 1HTOA 2K25A 3HM3A 3BK2A 4EZJA 1K50A 2I38A 1C3TA 2EKIA 4BKSD 4N59A 3TEWA 3AEGB 2AL6A 4FN2A 4RF0A 4YXDB 4S17A 3APDA 3DBRB 2BWES 1UBQA 4GDLA 3UI3A 5EE1A 4RFBA 3WAMA 1NENB 4LCDE 2LVPA 4ZYSA 1ZXHA 1FEHA 1D4BA 1KLVA 3SEBA 1K8RB 3R3MA 4KGTA 2C9WB 2D3GA 4A9AA 1FM0D 4DHZB 1D3ZA 2JSVX 1HZ5A 1KF6B 2DAJA 2I1KA 3ZRFA 4O1NA 1Y8RC 1ET9A 4E3CA 3UQBA 3NY5A 3VUWA 2MWSB 5HFYA 3R7RA 5JZEB 3DQVA 1A70A 3IVFA 2IPKD 2LXCA 3BZDB 4NQKE 1YNTE 2ZJDA 3RPFC 3CIRB 4MELA 1V6EA 1J8CA 3AB5A 4HVBA 2KMCA 2VRRB 3PHXB 4HLEA 3RNFC 4EZLA 3GOEA 2KK8A 3KVFB 5KHQA 4GMVA 3NVWA 5J2RA 2N9EB 1WRIA 4M0WA 2GRIA 2HE7A 1JRUA 3EGRA 4GXBA 3AEAB 4K7UA 4GSWA 3QQ8B 4NAMA 5C3JB 1Z5SB 1QOBA 3ZVVA 3M3JA 1F77A 2BYVE 4XDDA 4JL9A 2GOWA 1D5ZC 4TSSA 3ZIMA 3RN9C 3MC8A 2KDFB 3ZJTA 1LXDA 1EWCA 1QOGA 3HM6X 4JGHB 3H7PB 3VUYA 4I6PA 2ONQA 2DBYA 2LRWA 3SDLC 4EEWA 1WGDA 1IPGA 5J18A 1JWSD 2Z59B 1FFVA 3UIPB 4XWTA 3X23A 2O6VA 1YN3A 3PRZA 5FR6A 2BB6A 4A3OA 2N9XA 5DPRA 4XC2A 1IBXA 2CHXA 4N6EB 4OZAA 3KWVA 4GIVA 2ON8A 2XN9C 4RGTA 3ALBA 4RCOA 3EECA 2K22A 2E3TA 3PLVA 1JQ4A 3AEEB 2BTEA 4JLCA 4BAXA 4BKGA 3BVZA 5BMHA 4KSLC 3NZ3A 3SR6A 2IZVB 3C8YA 2GI9A 1J7AA 3AE9B 4PS8A 3LDZE 1FFUA 1T0YA 1MHXA 2IGDA 4HPPA 5BMGA 3ENEA 3CMMB 3APFA 4KIKA 4GN1A 3VR9B 1SE2A 2WDTB 2MBBB 3GE8C 3MHSD 4W9EA 2CKHB 3RD2A 5L83A 2GBMA 3PRPB 2R61A 1NEKB 2RPVA 1EF1A 1N60A 4LNKA 2WNMA 4W9FA 1V97A 3AH7A 2PE9A 3FC4A 1WJ6A 2WXHA 1UWMA 3JW0X 5LLIA 4ICUA 3M95A 4FLHA 2HTME 3QX1A 2BYEA 2QC8A 4AOFA 2NR2A 2OJWA 2LHDA 3VH4B 3WALA 2FUHB 1WR6E 1YOVB 3AE4B 3NUHB 4HDOA 4WJQA 2PKOA 3ML9A 2MJ3A 1WGGA 1KFYB 3NZUA 4IW0A 2JXXA 3Q2AC 3DDCB 1RFAA 2JU6X 1TY0A 4W9HA 4L1BA 5G55A 3RUIB 2MA9B 2CHWA 4NJCA 3AE5B 4US8A 2MBQA 2LGSA 1C4CA 2XEWA 1BXTA 3TBLD 2NMQA 4M8MA 1TKGA 1XF5L 1TZ1A 2LUMA 3PZ8A 1JWBD 2H88B 4A55A 2TSSA 2KACA 2EELA 1VCBA 3GP7A 3URYA 2N1WA 4USAA 5JHBA 3KYDD 1V86A 2Q5WD 1OEYJ 2ZVNA 2KWVB 2MBEA 2N4FA 2L00B 5I4DA 1IYFA 3NVVA 4MGKE 3IHPC 3DWMA 2KFKB 2PMVA 3VR8B 2JWZA 4HEA1 4JIOU 4WJNA 4NPNA 4IWQA 2SEBD 3DHIC 1L6UA 1UD7A 3H6NA 2PTLA 1F9JA 3QC8B 1ZDVA 1CJEA 1C77A 1PGAA 1PYWD 1WXAA 4RF1A 3QIJA 1V81A 2V1YA 5E6JA 4II3B 1LFDA 2A5UA 4TQ0A
chains in the Genus database with same CATH topology
2DYBA 4WWOA 2M17A 2LGYA 2HJ8A 2PE6B 4MGIE 4FBJB 1UELA 2FNJB 2LXAA 5JH5C 2NCNA 3L54A 4HCNB 2ZNVC 1TGZB 3TL5A 1R4NI 2GBNA 2LGXA 3LJ3A 3PGEA 3L13A 3TIXA 3PSEB 5CHFA 3V6CB 4FJZA 4XZ4A 2NS5A 2RPQA 1UGMA 2MLBA 2C7NB 3UQAA 2CU1A 3T8MA 1WJ4A 1NDDA 1WE6A 2KJ6A 5DPWA 2MSED 1SE9A 2O2VA 1OGWA 1P1AA 2CS4A 3ZNZB 3A9JB 1YX6B 3AXCA 3IG3A 3IFWB 5LXIB 4AWJA 1WZ3A 4TKNA 2ZCBA 2G4SA 3PLUA 3QJZA 4RMAA 1S3SG 2KQ7A 4KV2A 2RSUA 4E74A 4DDID 3ONSA 2LGDA 3PVLA 5AZGA 4NJ6A 4IM0A 1OEYA 4BVUC 5GMVA 1WXVA 5AZHA 4IM2A 5AEKB 2Y5BB 1E8WA 1WMHA 3BY4B 4II2B 4NQLB 1H4RA 3ML8A 4BKSA 1Q1OA 2NPTA 2L05A 3DBLI 3HK0A 3L10B 2N9PC 1UH6A 2N7DA 4WWNA 2J0MA 2QHOA 4DXAB 4MSMB 4BBNF 2O2VB 2FIFA 3GZNI 2MW5A 2IY0B 3A9KB 3N3KB 4DBGA 3DOWA 2K6DB 2MX2A 2ZZPB 2DHZA 1GJZA 2M4NA 3QAQA 4LJOB 4EFOA 4A20A 3MJWA 3CF6E 4HDQA 3TMPB 4ICVA 1WF9A 2CHZA 4HK2A 1XQQA 2WYQA 3L17A 1CMXB 2D2QA 2L3ZA 5DCNA 4K7WA 2DZMA 2HTHA 4ZRJA 1LM8B 5E6NA 3Q3JA 3ZUNA 4GU2A 1E8YA 1WMHB 1MG8A 3ECIA 3JYUA 3U30A 3ZDTA 2JUOA 3WAOA 2NPTB 2K1FA 4GDKA 3AI5A 2EKEC 1WRDB 2GBJA 4FADA 1Q5WB 4RM8A 2KHWB 1WXSA 2RD0A 3SU8X 2C7HA 2DAFA 1YX5B 2MP2A 3H9DA 3A33B 2DZIA 3DBSA 3Q3FA 1WJNA 4NAWA 3T9LA 1WH3A 3I3TB 3V62A 4EUTA 3OLMD 2KFKA 5KHOA 4DHJB 3VVWB 4I6NB 5EDSA 2C7MB 4N9F4 1TTNA 3AU4A 4W9KA 4DHZE 2LVOA 1NBFC 2IY1B 2K25A 2RGFA 3DVNU 3HM3A 3QK0A 2PJHA 4EZJA 2DZKA 4F8CB 1ZGUB 4HCPB 5DPTA 1P0RA 3ZNGC 2EMSA 4A3PA 1C3TA 2AYOB 5D7GA 3ZW3A 2A4ZA 4ANVA 4GDKB 2GMIC 2KX0A 3L0WB 2BKRB 2FCQA 2J0JA 5D94A 3ZO5B 4BKSD 2N1VA 2AL6A 4FN2A 3WANA 3B1LX 2L76A 2DENB 3APDA 3PV1A 4NAWB 2BWES 1UBQA 2IO2B 4GDLA 4WJOA 1WGYA 2YVCA 2NBVB 1U4AA 2O6VB 4JQWC 3K9OB 3WAMA 4LCDE 2LVPA 4DHJD 5CHWA 2MRPA 2AEHA 2KZRA 3DBRI 3HIZA 2K6QA 4KDLB 4TUUA 1KLVA 2AWTA 4MDKE 3NZSA 1K8RB 3R3MA 3VTVA 1E8ZA 2C9WB 2D3GA 3R7QA 1D3ZA 4DHZB 3DBHI 2ASQA 2KDIA 2DAJA 2Z0EB 3WA0A 2I1KA 2JVCA 3ZRFA 1C1YB 4MM3A 3V60A 1WJUA 1Y8RC 4E3CA 3UQBA 4HPLB 4TV3A 4F1SA 4GDLB 2LRUA 4URKA 3NY5A 3A9JA 3VUWA 4KZCA 3P2BA 2FCNA 4GOCA 3CSTA 3BINA 2V4LA 2MWSB 3HHMA 2C60A 3W1SA 3UGBB 3A1QA 2MBHA 4KDIC 3R7RA 5JZEB 5IA7A 3DQVA 3M63B 3PREA 2M1MA 2MBOA 3DVGX 3QARA 3TJPA 3N32A 2PPHA 1SGHA 2KDBA 5C1ZA 4K7SA 3U7DA 3IVFA 1UBIA 2ZCCA 1V2YA 2ZPNA 2DYMA 2JY6A 2LXCA 2JZ3B 2IO0B 4FHJA 4NQKE 2ZJDA 1VD2A 2FCSA 4MELA 1V6EA 2D07B 1V5OA 4PS7A 1WYWB 1J8CA 2G45B 3B0AA 1L7YA 3A9KA 4ZRIA 2K8HA 4EZKA 4HVBA 2KMCA 2VRRB 3VTWA 1M94A 2GBKA 3A1QB 3PHXB 4HLEA 2KQSA 1YD8U 4EZLA 3GOEA 2KK8A 1V80A 1YJ1A 3KVFB 5KHQA 3DVNV 4GMVA 1XT9B 5J2RA 3PPAA 1S1QB 2N9EB 3A4RA 3ZTCA 4LJPB 2KC1A 4K81A 1I35A 4PYZA 1WIAA 2Z0DB 4E71A 2UYZB 3H7PA 1E7UA 2HE7A 1JRUA 2L8JA 2YLMA 4GXBA 2WX0A 1OTRB 5JHAA 4K7UA 4GSWA 2MCNB 3QQ8B 2FAZA 3N30A 1Z5SB 4MH0E 3U8ZA 2KO3A 5D2MB 2XK5A 5TR5A 3ZVVA 3M3JA 4KSKC 3DVGY 5J17A 3K9PB 1KJTA 2BYVE 4JL9A 3OAWA 3QCAA 1Z2MA 2GOWA 3ZIMA 4EOYA 3IBEA 1OQYA 2PEAA 2KDFB 2JT4B 4XX5A 1LXDA 2MQJA 2UWQA 1G6JA 2L7RA 3RZWC 1J0GA 4K1RB 1V5TA 3HM6X 4JGHB 3H7PB 4M0WB 2KKCA 3QA8A 2L0TA 4MGYE 1NI2A 2KLGA 3VUYA 3JVZX 4HJKA 4I6PA 4NNJB 2KX3A 2DX5B 2LWPA 3PT2B 4BBNC 2IO3B 2AL3A 2FCMA 2LRWA 5CX3A 3SDLC 3WAPA 1WGDA 3ZKJC 1IPGA 4EEWA 5J18A 2XK5B 4I6LB 2Z59B 1RLFA 1WI0A 2G3QB 3UIPB 4GGQA 3X23A 2O6VA 3B08A 1WR1A 2OOBB 1WM2A 2W9NA 3PRZA 4IWPA 5FR6A 2ZNVB 3JSVB 4KVGB 1J19A 4BKTA 4A3OA 4FULA 2N9XA 5DPRA 1YQBA 1GC6A 4XC2A 3UF8A 3PS6A 2BYFA 4DDGD 1P9DU 2CHXA 2J0KA 5DPSA 3ZNID 2JZZA 4J6IA 4GIVA 2BGFA 1LQBA 2DYOA 4F7ZA 1V49A 1X1MA 3ALBA 4ZDVA 3EECA 2ZPYA 3VTUA 5L95C 2OJRA 2DZJA 3PLVA 4ANXA 4CHKA 4BOZB 3RULA 1WM3A 2IYDB 5CTRC 2WWZA 2D10A 4JLCA 1WGRA 3AU5A 2LVQA 3L08A 1EUVB 2JPHA 2KJRA 2XBBC 4G11A 1P98A 2LJ5A 3ZNHB 4BKGA 4AJYB 1GG3A 4ZRKA 2KMAA 1YIWA 1WX8A 3UIOB 4KSLC 2IZVB 1KM7A 5C23A 4MGZE 4BFRA 2KTFA 3EFUA 3RZFA 3O65B 1SIFA 4FJVB 4PS8A 2M8SA 3LDZE 4HWIB 4MEMA 3MTNB 3VUXA 1T0YA 3EHVA 2KC2A 2BPSA 3ENEA 3CMMB 3APFA 3ZRCA 4KIKA 2BWFA 4GN1A 4WWPA 4ASWC 5LXHA 2O6VD 4DWFA 2NVUI 2WDTB 2BKFA 3DCGA 2K8BA 2MBBB 3MHSD 4W9EA 2CKHB 4W9JA 3NHEB 3RD2A 5L83A 1V9JA 1WY8A 2GBMA 3PRPB 3KUCB 4NY0A 5BO4B 1KOTA 1E90A 3R66C 3KYCD 2L0FA 1EF1A 3C0RB 2KNBA 3UINB 1BT0A 3OJ4B 2KXJA 2LZ6A 3PZDA 4W9FA 4FA6A 1L2NA 4PYUA 3QWZB 1FXTB 3PTFC 2KN5A 3RT3B 1PQSA 2FIDA 2I1JA 2PE9A 1WE7A 4KIKB 4ANUA 4IM3A 3ZDMC 2HD5B 3CSFA 1TBEA 4TQ1A 3S2AA 1E5WA 1WJ6A 2KTRA 2KVRA 3JW0X 1WFYA 4X57B 1WX9A 5LLIA 3X0WA 4OVVA 4IG7B 2NBWB 5D6JB 2JRIB 3RCZA 4CYEA 4ICUA 3M95A 5HKHA 3VFKA 4FLHA 4WJPA 4W9LA 3VAWA 3QX1A 4W9IA 4DK5A 2BYEA 4BOSC 2ZEQA 4WQOB 3D32A 4AOFA 2NR2A 2KANA 4LDTB 4B6WA 3VH4B 3VDZA 1IP9A 3H1UA 3WALA 2FUHB 1R4MI 3NS8A 1WR6E 1A5RA 1Q0WB 2KOXA 4AP4C 1E8XA 1ZKHA 2KTRB 2GBRA 4HDOA 2KLCA 4WJQA 4ZYNA 3WIMA 3ML9A 3JSVA 3W1YA 2CR5A 4HPMB 4YL8A 4AJWA 2B3AA 1WGGA 4ANWA 3NZUA 4IW0A 1P3QU 2BF8B 4PS3A 4HXDA 4OVUA 2JXXA 2G4DB 4NJ7A 3V61A 3TCAA 3DDCB 2LD9A 1QZEA 4LDTD 3NOBA 2R2OA 1WX7A 1RFAA 2REXA 4IWOA 4W9HA 4IC7B 4IUMB 4EKUA 2WX1A 1EF5A 5G55A 2JF5A 4B9KA 3KH0A 1XD3B 3RUIB 1WGHA 2MA9B 4FHKA 2EMTA 3PRMB 2C5LC 1E7VA 3A4SC 2CHWA 3VXWA 1H8CA 4FJYA 5AZFA 2LI5A 3VH3B 2KFJA 2MBQA 2J7QB 2R2QA 3KW5B 2XEWA 3L16A 4G3XB 3TBLD 3DPDA 4M8MA 3SD5A 3W1SC 4W9DA 1TZ1A 1ISNA 3OJ3A 1AARA 2JRHA 4MJSA 3VQIA 1VCBA 2N1WA 4G0NB 4B95A 2KWUB 2K8CA 5JHBA 3APCA 3KYDD 1V86A 2IO1B 3VHTC 2IBIB 1WXMA 3M62B 5E6PA 1OEYJ 2RR9A 2ZVNA 2KWVB 4G50A 2V3SA 3PHWB 1UZXB 2MBEA 3QHTA 2N4FA 2K39A 2NBUA 5E6OA 2L00B 2MP2B 4W9CA 4AUQC 1IYFA 1ZW7A 2M0XA 4MGKE 3IHPC 3RYTA 2KFKB 3H7SA 4GB9A 2N7EA 4P7IA 2JWZA 4CO7A 4RM9A 2LASA 4M8NA 4JIOU 1I42A 4MJSB 1EO6A 1WZ0A 3ZLZA 1GUAB 3AULA 4WJNA 4NPNA 3KUDB 3KUZA 4IWQA 4WAAA 3V6EB 4W9GA 3ZTDA 1UD7A 3SHQA 1RRBA 3H6NA 1F9JA 2D11A 1GNUA 2KJHB 3EC8A 3QC8B 1HE8A 4KZ0A 1WXAA 2LUEA 2KDEB 4MSQB 3QIJA 1V81A 2KD0A 2KWCA 2V1YA 1RAXA 4II3B 5CHVC 5IAAC 1LFDA 1GC7A 2A5UA 4TQ0A 5G2NA 2ZVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  4WWO A;  2M17 A;  2LGY A;  2HJ8 A;  2PE6 B;  4MGI E;  4FBJ B;  1UEL A;  2FNJ B;  2LXA A;  5JH5 C;  2NCN A;  3L54 A;  4HCN B;  2ZNV C;  1TGZ B;  3TL5 A;  1R4N I;  2GBN A;  2LGX A;  3LJ3 A;  3PGE A;  3L13 A;  3TIX A;  3PSE B;  5CHF A;  3V6C B;  4FJZ A;  4XZ4 A;  2NS5 A;  2RPQ A;  1UGM A;  2MLB A;  2C7N B;  3UQA A;  2CU1 A;  3T8M A;  1WJ4 A;  1NDD A;  1WE6 A;  2KJ6 A;  5DPW A;  2MSE D;  1SE9 A;  2O2V A;  1OGW A;  1P1A A;  2CS4 A;  3ZNZ B;  3A9J B;  1YX6 B;  3AXC A;  3IG3 A;  3IFW B;  5LXI B;  4AWJ A;  1WZ3 A;  4TKN A;  2ZCB A;  2G4S A;  3PLU A;  3QJZ A;  4RMA A;  1S3S G;  2KQ7 A;  4KV2 A;  2RSU A;  4E74 A;  4DDI D;  3ONS A;  2LGD A;  3PVL A;  5AZG A;  4NJ6 A;  4IM0 A;  1OEY A;  4BVU C;  5GMV A;  1WXV A;  5AZH A;  4IM2 A;  5AEK B;  2Y5B B;  1E8W A;  1WMH A;  3BY4 B;  4II2 B;  4NQL B;  1H4R A;  3ML8 A;  4BKS A;  1Q1O A;  2NPT A;  2L05 A;  3DBL I;  3HK0 A;  3L10 B;  2N9P C;  1UH6 A;  2N7D A;  4WWN A;  2J0M A;  2QHO A;  4DXA B;  4MSM B;  4BBN F;  2O2V B;  2FIF A;  3GZN I;  2MW5 A;  2IY0 B;  3A9K B;  3N3K B;  4DBG A;  3DOW A;  2K6D B;  2MX2 A;  2ZZP B;  2DHZ A;  1GJZ A;  2M4N A;  3QAQ A;  4LJO B;  4EFO A;  4A20 A;  3MJW A;  3CF6 E;  4HDQ A;  3TMP B;  4ICV A;  1WF9 A;  2CHZ A;  4HK2 A;  1XQQ A;  2WYQ A;  3L17 A;  1CMX B;  2D2Q A;  2L3Z A;  5DCN A;  4K7W A;  2DZM A;  2HTH A;  4ZRJ A;  1LM8 B;  5E6N A;  3Q3J A;  3ZUN A;  4GU2 A;  1E8Y A;  1WMH B;  1MG8 A;  3ECI A;  3JYU A;  3U30 A;  3ZDT A;  2JUO A;  3WAO A;  2NPT B;  2K1F A;  4GDK A;  3AI5 A;  2EKE C;  1WRD B;  2GBJ A;  4FAD A;  1Q5W B;  4RM8 A;  2KHW B;  1WXS A;  2RD0 A;  3SU8 X;  2C7H A;  2DAF A;  1YX5 B;  2MP2 A;  3H9D A;  3A33 B;  2DZI A;  3DBS A;  3Q3F A;  1WJN A;  4NAW A;  3T9L A;  1WH3 A;  3I3T B;  3V62 A;  4EUT A;  3OLM D;  2KFK A;  5KHO A;  4DHJ B;  3VVW B;  4I6N B;  5EDS A;  2C7M B;  4N9F 4;  1TTN A;  3AU4 A;  4W9K A;  4DHZ E;  2LVO A;  1NBF C;  2IY1 B;  2K25 A;  2RGF A;  3DVN U;  3HM3 A;  3QK0 A;  2PJH A;  4EZJ A;  2DZK A;  4F8C B;  1ZGU B;  4HCP B;  5DPT A;  1P0R A;  3ZNG C;  2EMS A;  4A3P A;  1C3T A;  2AYO B;  5D7G A;  3ZW3 A;  2A4Z A;  4ANV A;  4GDK B;  2GMI C;  2KX0 A;  3L0W B;  2BKR B;  2FCQ A;  2J0J A;  5D94 A;  3ZO5 B;  4BKS D;  2N1V A;  2AL6 A;  4FN2 A;  3WAN A;  3B1L X;  2L76 A;  2DEN B;  3APD A;  3PV1 A;  4NAW B;  2BWE S;  1UBQ A;  2IO2 B;  4GDL A;  4WJO A;  1WGY A;  2YVC A;  2NBV B;  1U4A A;  2O6V B;  4JQW C;  3K9O B;  3WAM A;  4LCD E;  2LVP A;  4DHJ D;  5CHW A;  2MRP A;  2AEH A;  2KZR A;  3DBR I;  3HIZ A;  2K6Q A;  4KDL B;  4TUU A;  1KLV A;  2AWT A;  4MDK E;  3NZS A;  1K8R B;  3R3M A;  3VTV A;  1E8Z A;  2C9W B;  2D3G A;  3R7Q A;  1D3Z A;  4DHZ B;  3DBH I;  2ASQ A;  2KDI A;  2DAJ A;  2Z0E B;  3WA0 A;  2I1K A;  2JVC A;  3ZRF A;  1C1Y B;  4MM3 A;  3V60 A;  1WJU A;  1Y8R C;  4E3C A;  3UQB A;  4HPL B;  4TV3 A;  4F1S A;  4GDL B;  2LRU A;  4URK A;  3NY5 A;  3A9J A;  3VUW A;  4KZC A;  3P2B A;  2FCN A;  4GOC A;  3CST A;  3BIN A;  2V4L A;  2MWS B;  3HHM A;  2C60 A;  3W1S A;  3UGB B;  3A1Q A;  2MBH A;  4KDI C;  3R7R A;  5JZE B;  5IA7 A;  3DQV A;  3M63 B;  3PRE A;  2M1M A;  2MBO A;  3DVG X;  3QAR A;  3TJP A;  3N32 A;  2PPH A;  1SGH A;  2KDB A;  5C1Z A;  4K7S A;  3U7D A;  3IVF A;  1UBI A;  2ZCC A;  1V2Y A;  2ZPN A;  2DYM A;  2JY6 A;  2LXC A;  2JZ3 B;  2IO0 B;  4FHJ A;  4NQK E;  2ZJD A;  1VD2 A;  2FCS A;  4MEL A;  1V6E A;  2D07 B;  1V5O A;  4PS7 A;  1WYW B;  1J8C A;  2G45 B;  3B0A A;  1L7Y A;  3A9K A;  4ZRI A;  2K8H A;  4EZK A;  4HVB A;  2KMC A;  2VRR B;  3VTW A;  1M94 A;  2GBK A;  3A1Q B;  3PHX B;  4HLE A;  2KQS A;  1YD8 U;  4EZL A;  3GOE A;  2KK8 A;  1V80 A;  1YJ1 A;  3KVF B;  5KHQ A;  3DVN V;  4GMV A;  1XT9 B;  5J2R A;  3PPA A;  1S1Q B;  2N9E B;  3A4R A;  3ZTC A;  4LJP B;  2KC1 A;  4K81 A;  1I35 A;  4PYZ A;  1WIA A;  2Z0D B;  4E71 A;  2UYZ B;  3H7P A;  1E7U A;  2HE7 A;  1JRU A;  2L8J A;  2YLM A;  4GXB A;  2WX0 A;  1OTR B;  5JHA A;  4K7U A;  4GSW A;  2MCN B;  3QQ8 B;  2FAZ A;  3N30 A;  1Z5S B;  4MH0 E;  3U8Z A;  2KO3 A;  5D2M B;  2XK5 A;  5TR5 A;  3ZVV A;  3M3J A;  4KSK C;  3DVG Y;  5J17 A;  3K9P B;  1KJT A;  2BYV E;  4JL9 A;  3OAW A;  3QCA A;  1Z2M A;  2GOW A;  3ZIM A;  4EOY A;  3IBE A;  1OQY A;  2PEA A;  2KDF B;  2JT4 B;  4XX5 A;  1LXD A;  2MQJ A;  2UWQ A;  1G6J A;  2L7R A;  3RZW C;  1J0G A;  4K1R B;  1V5T A;  3HM6 X;  4JGH B;  3H7P B;  4M0W B;  2KKC A;  3QA8 A;  2L0T A;  4MGY E;  1NI2 A;  2KLG A;  3VUY A;  3JVZ X;  4HJK A;  4I6P A;  4NNJ B;  2KX3 A;  2DX5 B;  2LWP A;  3PT2 B;  4BBN C;  2IO3 B;  2AL3 A;  2FCM A;  2LRW A;  5CX3 A;  3SDL C;  3WAP A;  1WGD A;  3ZKJ C;  1IPG A;  4EEW A;  5J18 A;  2XK5 B;  4I6L B;  2Z59 B;  1RLF A;  1WI0 A;  2G3Q B;  3UIP B;  4GGQ A;  3X23 A;  2O6V A;  3B08 A;  1WR1 A;  2OOB B;  1WM2 A;  2W9N A;  3PRZ A;  4IWP A;  5FR6 A;  2ZNV B;  3JSV B;  4KVG B;  1J19 A;  4BKT A;  4A3O A;  4FUL A;  2N9X A;  5DPR A;  1YQB A;  1GC6 A;  4XC2 A;  3UF8 A;  3PS6 A;  2BYF A;  4DDG D;  1P9D U;  2CHX A;  2J0K A;  5DPS A;  3ZNI D;  2JZZ A;  4J6I A;  4GIV A;  2BGF A;  1LQB A;  2DYO A;  4F7Z A;  1V49 A;  1X1M A;  3ALB A;  4ZDV A;  3EEC A;  2ZPY A;  3VTU A;  5L95 C;  2OJR A;  2DZJ A;  3PLV A;  4ANX A;  4CHK A;  4BOZ B;  3RUL A;  1WM3 A;  2IYD B;  5CTR C;  2WWZ A;  2D10 A;  4JLC A;  1WGR A;  3AU5 A;  2LVQ A;  3L08 A;  1EUV B;  2JPH A;  2KJR A;  2XBB C;  4G11 A;  1P98 A;  2LJ5 A;  3ZNH B;  4BKG A;  4AJY B;  1GG3 A;  4ZRK A;  2KMA A;  1YIW A;  1WX8 A;  3UIO B;  4KSL C;  2IZV B;  1KM7 A;  5C23 A;  4MGZ E;  4BFR A;  2KTF A;  3EFU A;  3RZF A;  3O65 B;  1SIF A;  4FJV B;  4PS8 A;  2M8S A;  3LDZ E;  4HWI B;  4MEM A;  3MTN B;  3VUX A;  1T0Y A;  3EHV A;  2KC2 A;  2BPS A;  3ENE A;  3CMM B;  3APF A;  3ZRC A;  4KIK A;  2BWF A;  4GN1 A;  4WWP A;  4ASW C;  5LXH A;  2O6V D;  4DWF A;  2NVU I;  2WDT B;  2BKF A;  3DCG A;  2K8B A;  2MBB B;  3MHS D;  4W9E A;  2CKH B;  4W9J A;  3NHE B;  3RD2 A;  5L83 A;  1V9J A;  1WY8 A;  2GBM A;  3PRP B;  3KUC B;  4NY0 A;  5BO4 B;  1KOT A;  1E90 A;  3R66 C;  3KYC D;  2L0F A;  1EF1 A;  3C0R B;  2KNB A;  3UIN B;  1BT0 A;  3OJ4 B;  2KXJ A;  2LZ6 A;  3PZD A;  4W9F A;  4FA6 A;  1L2N A;  4PYU A;  3QWZ B;  1FXT B;  3PTF C;  2KN5 A;  3RT3 B;  1PQS A;  2FID A;  2I1J A;  2PE9 A;  1WE7 A;  4KIK B;  4ANU A;  4IM3 A;  3ZDM C;  2HD5 B;  3CSF A;  1TBE A;  4TQ1 A;  3S2A A;  1E5W A;  1WJ6 A;  2KTR A;  2KVR A;  3JW0 X;  1WFY A;  4X57 B;  1WX9 A;  5LLI A;  3X0W A;  4OVV A;  4IG7 B;  2NBW B;  5D6J B;  2JRI B;  3RCZ A;  4CYE A;  4ICU A;  3M95 A;  5HKH A;  3VFK A;  4FLH A;  4WJP A;  4W9L A;  3VAW A;  3QX1 A;  4W9I A;  4DK5 A;  2BYE A;  4BOS C;  2ZEQ A;  4WQO B;  3D32 A;  4AOF A;  2NR2 A;  2KAN A;  4LDT B;  4B6W A;  3VH4 B;  3VDZ A;  1IP9 A;  3H1U A;  3WAL A;  2FUH B;  1R4M I;  3NS8 A;  1WR6 E;  1A5R A;  1Q0W B;  2KOX A;  4AP4 C;  1E8X A;  1ZKH A;  2KTR B;  2GBR A;  4HDO A;  2KLC A;  4WJQ A;  4ZYN A;  3WIM A;  3ML9 A;  3JSV A;  3W1Y A;  2CR5 A;  4HPM B;  4YL8 A;  4AJW A;  2B3A A;  1WGG A;  4ANW A;  3NZU A;  4IW0 A;  1P3Q U;  2BF8 B;  4PS3 A;  4HXD A;  4OVU A;  2JXX A;  2G4D B;  4NJ7 A;  3V61 A;  3TCA A;  3DDC B;  2LD9 A;  1QZE A;  4LDT D;  3NOB A;  2R2O A;  1WX7 A;  1RFA A;  2REX A;  4IWO A;  4W9H A;  4IC7 B;  4IUM B;  4EKU A;  2WX1 A;  1EF5 A;  5G55 A;  2JF5 A;  4B9K A;  3KH0 A;  1XD3 B;  3RUI B;  1WGH A;  2MA9 B;  4FHK A;  2EMT A;  3PRM B;  2C5L C;  1E7V A;  3A4S C;  2CHW A;  3VXW A;  1H8C A;  4FJY A;  5AZF A;  2LI5 A;  3VH3 B;  2KFJ A;  2MBQ A;  2J7Q B;  2R2Q A;  3KW5 B;  2XEW A;  3L16 A;  4G3X B;  3TBL D;  3DPD A;  4M8M A;  3SD5 A;  3W1S C;  4W9D A;  1TZ1 A;  1ISN A;  3OJ3 A;  1AAR A;  2JRH A;  4MJS A;  3VQI A;  1VCB A;  2N1W A;  4G0N B;  4B95 A;  2KWU B;  2K8C A;  5JHB A;  3APC A;  3KYD D;  1V86 A;  2IO1 B;  3VHT C;  2IBI B;  1WXM A;  3M62 B;  5E6P A;  1OEY J;  2RR9 A;  2ZVN A;  2KWV B;  4G50 A;  2V3S A;  3PHW B;  1UZX B;  2MBE A;  3QHT A;  2N4F A;  2K39 A;  2NBU A;  5E6O A;  2L00 B;  2MP2 B;  4W9C A;  4AUQ C;  1IYF A;  1ZW7 A;  2M0X A;  4MGK E;  3IHP C;  3RYT A;  2KFK B;  3H7S A;  4GB9 A;  2N7E A;  4P7I A;  2JWZ A;  4CO7 A;  4RM9 A;  2LAS A;  4M8N A;  4JIO U;  1I42 A;  4MJS B;  1EO6 A;  1WZ0 A;  3ZLZ A;  1GUA B;  3AUL A;  4WJN A;  4NPN A;  3KUD B;  3KUZ A;  4IWQ A;  4WAA A;  3V6E B;  4W9G A;  3ZTD A;  1UD7 A;  3SHQ A;  1RRB A;  3H6N A;  1F9J A;  2D11 A;  1GNU A;  2KJH B;  3EC8 A;  3QC8 B;  1HE8 A;  4KZ0 A;  1WXA A;  2LUE A;  2KDE B;  4MSQ B;  3QIJ A;  1V81 A;  2KD0 A;  2KWC A;  2V1Y A;  1RAX A;  4II3 B;  5CHV C;  5IAA C;  1LFD A;  1GC7 A;  2A5U A;  4TQ0 A;  5G2N A;  2ZVO A; 
#chains in the Genus database with same CATH topology
 2M17 A;  3Q8F A;  1UEL A;  1M4V A;  2LXA A;  2NCN A;  1I4H A;  3R2I A;  2ZNV C;  2NTT A;  2GBN A;  2LGX A;  3ABV B;  3PGE A;  3Q6B A;  1XCT L;  2GB1 A;  1TKY A;  1YMH E;  1UGM A;  3GS2 A;  2MLB A;  3UQA A;  3KLS X;  3T8M A;  1WE6 A;  2DLB A;  5FKA C;  2WXQ A;  1P1A A;  3IG3 A;  4AWJ A;  4TKN A;  2ZCB A;  3PLU A;  2RSU A;  5HHD G;  5AZG A;  4ZHP A;  1E6E B;  1EWY C;  1DOY A;  1OEY A;  2K5P A;  5GMV A;  4BVU C;  2Y5B B;  3NVZ A;  3DBL I;  3L10 B;  2YEP B;  4P16 A;  2N7D A;  4CQN A;  2QHO A;  4MSM B;  2O2V B;  2L1A A;  2SAK A;  1GJZ A;  5JXV A;  4HDQ A;  2ZW0 A;  2CHZ A;  4HK2 A;  1CMX B;  5DCN A;  4K7W A;  2D5G A;  1C76 A;  3ZUN A;  1J7B A;  1MG8 A;  3B9J A;  2J52 A;  3JYU A;  1DYQ A;  4GDK A;  3C19 A;  4FAD A;  2RD0 A;  1L0Y B;  5MPO A;  2C7H A;  2MP2 A;  4ARC A;  4NAW A;  3DBS A;  1WJN A;  5G5H A;  1WH3 A;  3Q3N C;  1KTK A;  1QOA A;  1AW7 A;  1L4Z B;  1TTN A;  3AU4 A;  4DHZ E;  4XDC A;  2PJH A;  1SJE D;  5DPT A;  5LNK 1;  2D3B A;  3ZGZ A;  2EMS A;  2YEP F;  2X8X X;  4ANV A;  3ZW3 A;  2BKR B;  3ZO5 B;  2CU3 A;  2N1V A;  1UNS A;  3WAN A;  2DEN B;  1RM6 C;  4WJO A;  2O6V B;  4JQW C;  3K9O B;  4DHJ D;  5CHW A;  2PW9 A;  3AE3 B;  2K6Q A;  3HIZ A;  4KDL B;  4LNF A;  3NZS A;  3R7Q A;  2XNA C;  3DBH I;  2L52 A;  2KDI A;  2WDQ B;  3V60 A;  1WJU A;  3O13 A;  4URK A;  2LRU A;  2M0A A;  3A9J A;  3P2B A;  3BIN A;  1P7F A;  3UGB B;  4KDI C;  2MBH A;  5IA7 A;  3PRE A;  2MBO A;  3N32 A;  2PPH A;  1TJE A;  1SGH A;  2DYM A;  1LO5 D;  4LNN A;  1RFK A;  2IO0 B;  4D2K A;  2PLP A;  2FCS A;  3N1X C;  2KT7 A;  3AE8 B;  2D07 B;  1SJH D;  1V5O A;  2N9L A;  4MM3 B;  2G45 B;  3N9Y C;  1ZOY B;  3B0A A;  4KGS A;  3PZ7 A;  3A9K A;  1TS4 A;  4HRO A;  4B0M A;  2KN4 A;  3A1Q B;  2UU7 A;  2V3N A;  1FNU A;  1AWD A;  1MVK A;  1V80 A;  1YJ1 A;  1S1Q B;  4LJP B;  1I35 A;  4E71 A;  1WYG A;  3RNA C;  4HRS A;  2FAZ A;  3N30 A;  2BVC A;  2M19 A;  4MH0 E;  2KO3 A;  5D2M B;  2XK5 A;  3IT6 B;  3K9P B;  1KJT A;  3OAW A;  2PEA A;  1C79 A;  4XX5 A;  2MQJ A;  1K53 A;  1V5T A;  2KKC A;  3QA8 A;  2L0T A;  1NI2 A;  4PT5 A;  3LYY A;  4HJK A;  2KX3 A;  2DX5 B;  3PT2 B;  4BBN C;  1JRP A;  5CX3 A;  2AL3 A;  3ZKJ C;  3WAP A;  2VH2 A;  1DGJ A;  2WP9 B;  4MT5 A;  1WR1 A;  2W9N A;  4KVG B;  1J19 A;  2W82 A;  4FUL A;  1GC6 A;  2BW2 A;  3PS6 A;  3Q8C A;  4DDG D;  1PGB A;  1I4X A;  2JZZ A;  1LQB A;  2DYO A;  1UUP A;  1X1M A;  4ZDV A;  5L95 C;  5EE9 A;  1L4D B;  4ANX A;  2JZP A;  3RUL A;  2KVZ A;  2PVG C;  3B2G A;  2WWZ A;  2D10 A;  2JXT A;  4B0E A;  2JPH A;  2LJ5 A;  4AJY B;  1GG3 A;  5C23 A;  3P4S B;  4BFR A;  1HQR D;  4HKQ A;  3RZF A;  1WWT A;  4HWI B;  3PO0 A;  3MTN B;  3EHV A;  3U2S C;  2BWF A;  4WWP A;  2BQQ A;  3RNB C;  2O6V D;  2NVU I;  3DCG A;  1MG4 A;  4W9J A;  1WY8 A;  3ZYY X;  3R66 C;  2L0F A;  3WCQ A;  2KNB A;  3P4R B;  2KXJ A;  1OQR A;  2HDE A;  2Y5C A;  1TY2 A;  1FMA D;  2DWQ A;  1L5P A;  3PTF C;  3RT3 B;  1HTQ A;  4ANU A;  4WIP A;  3ZDM C;  2HD5 B;  5D3I B;  5H8Y E;  3OWE B;  1E5W A;  2BYT A;  2KTR A;  2KVR A;  1WX9 A;  1XXG A;  2NBW B;  2JRI B;  1YQ4 B;  1JRO A;  3VFK A;  3TEX A;  4C4V A;  4YSX B;  2L83 A;  1Q10 A;  3VAW A;  1N63 A;  2ZEQ A;  1EU4 A;  3D32 A;  4WUR A;  3NVY A;  2WQY B;  3H1U A;  1HA5 A;  3NS8 A;  1E8X A;  1XEE A;  4M02 A;  2ZW1 A;  2KLC A;  3WIM A;  1N62 A;  3W1Y A;  2Z8L A;  1ET6 A;  2CR5 A;  4YL8 A;  2WDV B;  3HUI A;  4OZB A;  4ANW A;  2BF8 B;  1SSN A;  3AEB B;  4HXD A;  3I57 A;  4LDT D;  3FIL B;  4RNA A;  1WX7 A;  4IC7 B;  2WU2 B;  4C80 A;  2WX1 A;  1EF5 A;  2JF5 A;  4LLG M;  3SFD B;  2RMM A;  1WGH A;  1AN8 A;  1GPX A;  4N58 A;  5AZF A;  3VH3 B;  5IO9 A;  1TIF A;  1FCL A;  1MJD A;  1N5W A;  1ISN A;  2WU5 B;  3OJ3 A;  1AAR A;  1F2R I;  1UF0 A;  4MJS A;  1J7C A;  4G0N B;  4B95 A;  4H2A A;  4MH8 A;  3APC A;  2QCZ A;  4KX6 B;  1K51 A;  2RR9 A;  4ZRQ A;  2I2Y A;  1FNW A;  2K39 A;  5E6O A;  4AUQ C;  2MP2 B;  4W9C A;  1WSP A;  1XCQ L;  2M0X A;  4US9 A;  2WXO A;  4CO7 A;  1FO4 A;  1N5X A;  1T6B X;  3ZLZ A;  4YWG G;  3P42 A;  3KUZ A;  2LMC A;  2CJN A;  2D11 A;  1HE8 A;  1GAQ B;  2PIA A;  2KDE B;  3I5J C;  4UDU C;  1TS3 A;  3IT4 B;  4YSY B;  2BB5 A;  1C4A A;  2HJ8 A;  2LGY A;  4MGI E;  2V4I B;  1E10 A;  3W2D A;  4HCN B;  1NYQ A;  1R4N I;  2JWU A;  2K9X A;  3V6C B;  1VLB A;  1FIQ A;  2NS5 A;  4WAF A;  2RPQ A;  1JCK B;  4Q2J A;  1NDD A;  4WH4 A;  4P1B C;  3ZNZ B;  3A9J B;  3IFW B;  1FRR A;  2INP E;  1WZ3 A;  1GOZ A;  1TYG B;  3QJZ A;  4E74 A;  2BT6 A;  3Q3O C;  3ONS A;  2LGD A;  3DBL B;  3PVL A;  3SFE B;  4NJ6 A;  5AEK B;  3P4Q B;  5HI1 A;  1WMH A;  2INN E;  4NQL B;  1H4R A;  1Q1O A;  4ARI A;  3HK0 A;  2N9P C;  4P6V F;  1UH6 A;  4WWN A;  2J0M A;  2FIF A;  3A9K B;  3B2F A;  3EUB 2;  4DBG A;  1ZE3 D;  2LHE A;  2DHZ A;  2M4N A;  3MJW A;  4R3D A;  1LGR A;  2WXF A;  1GB4 A;  1XQQ A;  1ZP0 B;  2L3Z A;  2WXR A;  1V1P B;  1LM8 B;  1E8Y A;  3ECI A;  1ESF A;  1JWU D;  2NPT B;  4RH6 A;  3AI5 A;  4A8X C;  1PFD A;  2GBJ A;  2DAF A;  2WGS A;  4DHJ B;  4I6N B;  1FXA A;  2LVO A;  2N0S B;  2RGF A;  3QK0 A;  4F8C B;  4HCP B;  1MHH E;  3ZNG C;  2AYO B;  1VJK A;  5D7G A;  2A4Z A;  3AM9 A;  3L0W B;  2FCQ A;  5D94 A;  5IP4 D;  2L76 A;  3PV1 A;  2YVC A;  2NBV B;  2J4X A;  1WGK A;  3DBH B;  4TUU A;  4P1C C;  4MDK E;  1ZUD 2;  2WXI A;  4ZRP A;  3AMZ A;  3WA0 A;  1C1Y B;  4HPL B;  4TV3 A;  4GDL B;  3CST A;  3HHM A;  2C60 A;  3DVG X;  3TJP A;  1D5X C;  4WQM A;  3AEF B;  1F1H A;  1YN5 A;  1ACC A;  5C1Z A;  3U7D A;  3RNE C;  1RWS A;  1V2Y A;  2ZPN A;  2JY6 A;  2JZ3 B;  2WXL A;  1VD2 A;  3GB1 A;  2X38 A;  1XLO A;  4PS7 A;  4ZRI A;  2K8H A;  4EZK A;  3HVD A;  3VTW A;  1M94 A;  4PK1 A;  1XLN A;  1YD8 U;  4YTN B;  3N20 C;  3PPA A;  2LGI A;  3A4R A;  4K81 A;  1R4M B;  3H7P A;  2L8J A;  2YLM A;  3IAS 1;  1OTR B;  5JHA A;  4ITK A;  4RGM A;  4JPS A;  2MCN B;  4ZHO A;  2OED A;  5TR5 A;  4XGA B;  2WXK A;  3IBE A;  5BMI A;  4YT0 B;  2UWQ A;  1G6J A;  4DXG A;  3RZW C;  2BS4 B;  4M0W B;  4MGY E;  2KLG A;  4NNJ B;  3BK1 A;  4OHJ A;  3RNG C;  4I6L B;  2L32 A;  2G3Q B;  4TMA B;  3TEY A;  4C56 C;  2AQ1 B;  2AX5 A;  4IWP A;  2BBC A;  2ZNV B;  2W3R A;  1FRD A;  4BKT A;  2JX5 A;  2QEJ C;  3UF8 A;  1B1Z A;  2BYF A;  4MAC A;  2J0K A;  3P1M A;  3ZNI D;  5T8I A;  3IXS A;  1QOF A;  4YTM B;  5BYQ A;  3VTU A;  1T0S C;  1KLG D;  4CHK A;  4BOZ B;  1WM3 A;  2N7J A;  3V3X A;  1WGR A;  3L08 A;  2LVQ A;  3HRD D;  1EUV B;  2XBB C;  2IDY A;  4G11 A;  3ZNH B;  2AQ2 B;  4ZRK A;  1WX8 A;  3UIO B;  1IBX B;  1JAL A;  1NI3 A;  2FE8 A;  1FNV A;  1KM7 A;  2KTF A;  2MJD A;  3EFU A;  4MEM A;  3J9C A;  2DNF A;  2BPS A;  1OQQ A;  3Q8A A;  3ZRC A;  4C7Y A;  3RFZ B;  1PUT A;  1NVI D;  1T0R C;  4K3B A;  1PGX A;  1I4G A;  2LFI A;  3C0R B;  1BT0 A;  3OJ4 B;  3PZD A;  4FA6 A;  4K3C A;  3QWZ B;  2KN5 A;  1HZ6 A;  1FD6 A;  2FID A;  2I1J A;  1N6Z A;  1WE7 A;  4KIK B;  4IM3 A;  3CSF A;  1TBE A;  3MC9 A;  3S2A A;  3RI7 C;  2K0P A;  1I4P A;  4IKG A;  1WFY A;  2VH1 A;  5D6J B;  3RCZ A;  4LTU A;  3NS1 A;  4WJP A;  4A6Q A;  4HJG E;  2BS2 B;  4WQO B;  4LDT B;  3BWU D;  2WXM A;  3AE7 B;  2D3A A;  3VDZ A;  1R4M I;  4ZOH C;  1QF6 A;  1A5R A;  1Q0W B;  4A90 A;  1ZKH A;  4KKI A;  3U52 E;  2GBR A;  3JSV A;  4HPM B;  4AJW A;  1K52 A;  4PS3 A;  2G4D B;  3TCA A;  2LD9 A;  3NOB A;  2R2O A;  4IWO A;  2ACZ B;  4IUM B;  4BZA A;  1Y56 A;  2J53 A;  4B9K A;  3N1Z C;  3KH0 A;  1XD3 B;  4FHK A;  2EMT A;  3R8B A;  2QIE B;  1VZ7 A;  3PRM B;  5IN7 A;  2C5L C;  1E7V A;  3A4S C;  2KFJ A;  2WXJ A;  3KW5 B;  1YN4 A;  3SD5 A;  3Q8E A;  2MEK A;  4W9D A;  4OZC A;  1SXT A;  2JRH A;  1SE4 A;  2MH7 A;  2KYW A;  4JX1 C;  3E56 A;  1R7S A;  3ZQ4 A;  3VHT C;  2IBI B;  2H89 B;  3M62 B;  1STE A;  2V3S A;  1SIJ A;  3BYY B;  1UZX B;  3OG5 A;  2NBU A;  1ZW7 A;  3RYT A;  3H7S A;  2VZK D;  2BS3 B;  4P7I A;  1QLB B;  4C7Z A;  1F0Z A;  4RM9 A;  1YJI A;  2LAS A;  2KDM A;  1CK1 A;  1I42 A;  1EO6 A;  3IAM 1;  1GUA B;  3AUL A;  4WAA A;  3V6E B;  2LJI A;  4W9G A;  3ZTD A;  3SHQ A;  2KJH B;  1QQR A;  4WWM A;  4XYC A;  1V8C A;  4MSQ B;  2KWC A;  5IAA C;  1R4N B;  3TUO A;  5TSS A;  2KWD A;  4DQO C;  1WXQ A;  4XWW A;  2PE6 B;  4FBJ B;  2K3U A;  1E9M A;  3W5U B;  3L54 A;  1TGZ B;  5AUK A;  3L13 A;  3PSE B;  3DWG C;  1HEZ E;  1CQV A;  2CU1 A;  1SB3 C;  1WJ4 A;  2QJL A;  2G1E A;  1SE9 A;  2O2V A;  1OGW A;  3AXC A;  2M56 B;  5LXI B;  2G4S A;  4RMA A;  2KQ7 A;  4DDI D;  1ENF A;  1VDV A;  4M01 A;  4IM0 A;  1KLU D;  2V3P A;  2KMM A;  4YSZ B;  1WXV A;  5AZH A;  4IM2 A;  3RMK C;  1SEB D;  1D6E C;  3NJT A;  3ML8 A;  4BKS A;  2L05 A;  1MFW A;  2WS3 B;  2WDR B;  4BBN F;  1I4R A;  3GZN I;  3N3K B;  1QKZ A;  2MX2 A;  4EFO A;  4A20 A;  3CF6 E;  3TMP B;  4ICV A;  1PDX A;  5GXG B;  1EM7 A;  2WYQ A;  3L17 A;  4JWU C;  2DZM A;  5E6N A;  5FR3 A;  4GU2 A;  3ZDT A;  2B76 B;  3U30 A;  3R2T A;  3T3O A;  2JUO A;  1VR9 A;  3WAO A;  3RNC C;  2K1F A;  2EKE C;  2J42 A;  1Q5W B;  1HXY D;  3H9D A;  3A33 B;  2DZI A;  4KGR A;  3T9L A;  3I3T B;  4LNO A;  2FUG 1;  3AN1 A;  3VVW B;  5EDS A;  2C7M B;  1NBF C;  4DXF A;  2IY1 B;  3DVN U;  2KAJ A;  4OW0 A;  1JWA D;  2DZK A;  1ZGU B;  1L0X B;  1P0R A;  4A3P A;  1ROE A;  2HJ1 A;  4GDK B;  2GMI C;  2KX0 A;  2J0J A;  3TEZ A;  2WLB A;  3DHH C;  5C2T B;  2KQ4 X;  3B1L X;  2WXG A;  3T3N A;  1TS2 A;  4NAW B;  2IO2 B;  1WGY A;  1U4A A;  1F52 A;  2W54 A;  4JE3 B;  2MRP A;  2AEH A;  2KZR A;  3DBR I;  2WXN A;  2AWT A;  3VTV A;  1E8Z A;  4M00 A;  1JWM D;  2ASQ A;  2Z0E B;  1ZPS A;  2JVC A;  4QAY A;  4MM3 A;  2RDH A;  3MP9 A;  4F1S A;  3Q69 A;  4KZC A;  4GOC A;  2FCN A;  2JYT A;  2V4L A;  3W1S A;  3A1Q A;  3AE6 B;  3M63 B;  4REZ A;  2M1M A;  3QAR A;  2N9K A;  2KDB A;  4K7S A;  4XE0 A;  1UBI A;  2ZCC A;  1VRA B;  4FHJ A;  1WYW B;  1FCC C;  1L7Y A;  1N61 A;  2GBK A;  2KQS A;  4IOI E;  3MC0 B;  3L4P A;  3DVN V;  1XT9 B;  4AS1 A;  3ZTC A;  2KC1 A;  4PYZ A;  1WIA A;  2Z0D B;  2UYZ B;  1E7U A;  2WX0 A;  1BML C;  1T0Q C;  3U8Z A;  3W9C B;  3VRB B;  4KSK C;  1IUE A;  4RGN A;  3DVG Y;  5J17 A;  1YQ3 B;  3FKY A;  3EFC A;  3QCA A;  1Z2M A;  3AEC B;  4EOY A;  3CWI A;  1OQY A;  2JT4 B;  4LK0 M;  2E6X A;  2L7R A;  1J0G A;  2QMT A;  4K1R B;  1CZP A;  2FBW B;  3Q14 C;  3JVZ X;  3AED B;  2LWP A;  4KKJ A;  2AQ3 B;  2IO3 B;  2FCM A;  5AUI A;  1T3Q A;  4J3O D;  2XK5 B;  1I4Q A;  1RLF A;  1WI0 A;  3U4E G;  4GGQ A;  3B08 A;  3W5V B;  2RDB C;  4OVZ A;  1MPE A;  1WM2 A;  2OOB B;  3JSV B;  1YQB A;  1DOX A;  1P9D U;  5DPS A;  4FXC A;  4J6I A;  2JYE A;  2G9H D;  3AV8 A;  4HKZ E;  1QIL A;  2BGF A;  3TSS A;  3VRA B;  4F7Z A;  1V49 A;  2ZPY A;  2OJR A;  2DZJ A;  2IYD B;  5CTR C;  3AU5 A;  1E7P B;  2KJR A;  1P98 A;  3LB8 C;  3AE2 B;  2KMA A;  1YIW A;  3Q3M C;  4MGZ E;  1KRH A;  3O65 B;  1SIF A;  4FJV B;  2M8S A;  3VUX A;  4LNI A;  3LXF A;  3NRZ A;  2KC2 A;  3I63 C;  4EE2 A;  3MFG A;  4ASW C;  5D3D A;  5LXH A;  4DWF A;  3GE3 C;  2BKF A;  3ZXR A;  2K8B A;  1FXI A;  3NHE B;  3ZJV A;  1V9J A;  2WHI A;  1KOT A;  4NY0 A;  3KUC B;  5BO4 B;  1E90 A;  3KYC D;  1ZDX A;  3UIN B;  2LZ6 A;  1GB1 A;  1L2N A;  3DHG C;  4PYU A;  1FXT B;  1PQS A;  2IGH A;  2OHF A;  4TQ1 A;  3KWL A;  3FAH A;  4X57 B;  3N1Y C;  3X0W A;  4OVV A;  4IG7 B;  4CYE A;  1MI0 A;  5HKH A;  2MHJ A;  4W9L A;  4W9I A;  4DK5 A;  1VZ8 A;  4BOS C;  2KAN A;  4B6W A;  2GLS A;  1UGJ A;  2NTS A;  3FIL A;  1IP9 A;  3ZXV A;  2KOX A;  4AP4 C;  1V1O A;  4IDI A;  2KTR B;  1VZ6 A;  1IGC A;  4ZYN A;  1SE3 A;  3KQ4 A;  2B3A A;  4C4V B;  1NYR A;  1P3Q U;  1I7H A;  1YJJ A;  3V05 A;  3EA6 A;  4OVU A;  1C4P A;  5HG2 A;  4AQ7 A;  4NJ7 A;  3V61 A;  3E9S A;  1QZE A;  1TKE A;  1E0Z A;  2QSD A;  1L0V B;  2REX A;  4EKU A;  2PVO D;  4L2Y A;  2W3S A;  3AE1 B;  4RGO S;  5H92 C;  2IGG A;  3VXW A;  1H8C A;  4FJY A;  2LI5 A;  2V0G A;  2J7Q B;  2R2Q A;  3L16 A;  4G3X B;  4JWS C;  2ICI A;  1OFF A;  3DPD A;  2VZK B;  3W1S C;  2IJ0 A;  2D3C A;  1XO3 A;  5EE3 A;  1QT9 A;  2KWU B;  2K8C A;  3I9V 1;  2IO1 B;  1TS5 A;  1UWX A;  1WXM A;  5E6P A;  4G50 A;  3P63 A;  3PHW B;  1BUI C;  1JW9 D;  3BII D;  3QHT A;  2WXP A;  5BYR A;  5EE0 A;  4GB9 A;  3U7Z A;  2N7E A;  1TT5 B;  4M8N A;  1XLP A;  4MJS B;  1WZ0 A;  1L6V A;  3KUD B;  1RRB A;  1SBB B;  3EC8 A;  1GNU A;  4C00 A;  4NZL B;  1D5M C;  1JML A;  4KZ0 A;  4ACF A;  2LUE A;  1DOI A;  3VQI A;  2KD0 A;  5BYS A;  5CHV C;  1RAX A;  1TZO A;  1GC7 A;  3H8H A;  5G2N A;  2JQR B;  2ZVO A;  2DYB A;  4GLS C;  3HVZ A;  3Q8B A;  4WWO A;  1IGD A;  2FNJ B;  5JH5 C;  2IND C;  2MJE A;  3TL5 A;  3MHZ A;  3LJ3 A;  3TIX A;  5IKC M;  5CHF A;  2W55 A;  4FJZ A;  4XZ4 A;  1F2R C;  2C7N B;  5DPW A;  3MJ5 A;  2KJ6 A;  4S0R A;  1C9F A;  2V9H A;  2MSE D;  1EU3 A;  2QDF A;  2QIL A;  2CS4 A;  1YX6 B;  3ETR A;  1XLQ A;  1S3S G;  4KV2 A;  3ZJU A;  2INC C;  1B9R A;  1V1P A;  3NG0 A;  3GZN B;  1SF0 A;  1E8W A;  4L23 A;  3BY4 B;  4II2 B;  2NPT A;  5FK9 C;  1AYF A;  3BVM A;  2Y3A A;  4DXA B;  2MW5 A;  2IY0 B;  1RYJ A;  3DOW A;  1C78 A;  1P7E A;  2K6D B;  2CJO A;  2ZZP B;  3QAQ A;  4LJO B;  1FPY A;  1WF9 A;  2D2Q A;  1T5X D;  2HTH A;  3BYT B;  4ZRJ A;  3Q3J A;  3P4P B;  1WMH B;  3BVG A;  4YTP B;  5G5G A;  1WRD B;  4RM8 A;  2KHW B;  1WXS A;  3SU8 X;  2RDG A;  1KH0 A;  1YX5 B;  1ZXI A;  5IOI A;  3Q3F A;  3V62 A;  4EUT A;  2LEK A;  3OLM D;  2Y5P A;  2KFK A;  5KHO A;  4N9F 4;  4W9K A;  1HTO A;  2K25 A;  3HM3 A;  3BK2 A;  4EZJ A;  1K50 A;  2I38 A;  1C3T A;  2EKI A;  4BKS D;  4N59 A;  3TEW A;  3AEG B;  2AL6 A;  4FN2 A;  4RF0 A;  4YXD B;  4S17 A;  3APD A;  3DBR B;  2BWE S;  1UBQ A;  4GDL A;  3UI3 A;  5EE1 A;  4RFB A;  3WAM A;  1NEN B;  4LCD E;  2LVP A;  4ZYS A;  1ZXH A;  1FEH A;  1D4B A;  1KLV A;  3SEB A;  1K8R B;  3R3M A;  4KGT A;  2C9W B;  2D3G A;  4A9A A;  1FM0 D;  4DHZ B;  1D3Z A;  2JSV X;  1HZ5 A;  1KF6 B;  2DAJ A;  2I1K A;  3ZRF A;  4O1N A;  1Y8R C;  1ET9 A;  4E3C A;  3UQB A;  3NY5 A;  3VUW A;  2MWS B;  5HFY A;  3R7R A;  5JZE B;  3DQV A;  1A70 A;  3IVF A;  2IPK D;  2LXC A;  3BZD B;  4NQK E;  1YNT E;  2ZJD A;  3RPF C;  3CIR B;  4MEL A;  1V6E A;  1J8C A;  3AB5 A;  4HVB A;  2KMC A;  2VRR B;  3PHX B;  4HLE A;  3RNF C;  4EZL A;  3GOE A;  2KK8 A;  3KVF B;  5KHQ A;  4GMV A;  3NVW A;  5J2R A;  2N9E B;  1WRI A;  4M0W A;  2GRI A;  2HE7 A;  1JRU A;  3EGR A;  4GXB A;  3AEA B;  4K7U A;  4GSW A;  3QQ8 B;  4NAM A;  5C3J B;  1Z5S B;  1QOB A;  3ZVV A;  3M3J A;  1F77 A;  2BYV E;  4XDD A;  4JL9 A;  2GOW A;  1D5Z C;  4TSS A;  3ZIM A;  3RN9 C;  3MC8 A;  2KDF B;  3ZJT A;  1LXD A;  1EWC A;  1QOG A;  3HM6 X;  4JGH B;  3H7P B;  3VUY A;  4I6P A;  2ONQ A;  2DBY A;  2LRW A;  3SDL C;  4EEW A;  1WGD A;  1IPG A;  5J18 A;  1JWS D;  2Z59 B;  1FFV A;  3UIP B;  4XWT A;  3X23 A;  2O6V A;  1YN3 A;  3PRZ A;  5FR6 A;  2BB6 A;  4A3O A;  2N9X A;  5DPR A;  4XC2 A;  1IBX A;  2CHX A;  4N6E B;  4OZA A;  3KWV A;  4GIV A;  2ON8 A;  2XN9 C;  4RGT A;  3ALB A;  4RCO A;  3EEC A;  2K22 A;  2E3T A;  3PLV A;  1JQ4 A;  3AEE B;  2BTE A;  4JLC A;  4BAX A;  4BKG A;  3BVZ A;  5BMH A;  4KSL C;  3NZ3 A;  3SR6 A;  2IZV B;  3C8Y A;  2GI9 A;  1J7A A;  3AE9 B;  4PS8 A;  3LDZ E;  1FFU A;  1T0Y A;  1MHX A;  2IGD A;  4HPP A;  5BMG A;  3ENE A;  3CMM B;  3APF A;  4KIK A;  4GN1 A;  3VR9 B;  1SE2 A;  2WDT B;  2MBB B;  3GE8 C;  3MHS D;  4W9E A;  2CKH B;  3RD2 A;  5L83 A;  2GBM A;  3PRP B;  2R61 A;  1NEK B;  2RPV A;  1EF1 A;  1N60 A;  4LNK A;  2WNM A;  4W9F A;  1V97 A;  3AH7 A;  2PE9 A;  3FC4 A;  1WJ6 A;  2WXH A;  1UWM A;  3JW0 X;  5LLI A;  4ICU A;  3M95 A;  4FLH A;  2HTM E;  3QX1 A;  2BYE A;  2QC8 A;  4AOF A;  2NR2 A;  2OJW A;  2LHD A;  3VH4 B;  3WAL A;  2FUH B;  1WR6 E;  1YOV B;  3AE4 B;  3NUH B;  4HDO A;  4WJQ A;  2PKO A;  3ML9 A;  2MJ3 A;  1WGG A;  1KFY B;  3NZU A;  4IW0 A;  2JXX A;  3Q2A C;  3DDC B;  1RFA A;  2JU6 X;  1TY0 A;  4W9H A;  4L1B A;  5G55 A;  3RUI B;  2MA9 B;  2CHW A;  4NJC A;  3AE5 B;  4US8 A;  2MBQ A;  2LGS A;  1C4C A;  2XEW A;  1BXT A;  3TBL D;  2NMQ A;  4M8M A;  1TKG A;  1XF5 L;  1TZ1 A;  2LUM A;  3PZ8 A;  1JWB D;  2H88 B;  4A55 A;  2TSS A;  2KAC A;  2EEL A;  1VCB A;  3GP7 A;  3URY A;  2N1W A;  4USA A;  5JHB A;  3KYD D;  1V86 A;  2Q5W D;  1OEY J;  2ZVN A;  2KWV B;  2MBE A;  2N4F A;  2L00 B;  5I4D A;  1IYF A;  3NVV A;  4MGK E;  3IHP C;  3DWM A;  2KFK B;  2PMV A;  3VR8 B;  2JWZ A;  4HEA 1;  4JIO U;  4WJN A;  4NPN A;  4IWQ A;  2SEB D;  3DHI C;  1L6U A;  1UD7 A;  3H6N A;  2PTL A;  1F9J A;  3QC8 B;  1ZDV A;  1CJE A;  1C77 A;  1PGA A;  1PYW D;  1WXA A;  4RF1 A;  3QIJ A;  1V81 A;  2V1Y A;  5E6J A;  4II3 B;  1LFD A;  2A5U A;  4TQ0 A; 
#chains in the Genus database with same CATH homology
 2DYB A;  4WWO A;  2M17 A;  2LGY A;  2HJ8 A;  2PE6 B;  4MGI E;  4FBJ B;  1UEL A;  2FNJ B;  2LXA A;  5JH5 C;  2NCN A;  3L54 A;  4HCN B;  2ZNV C;  1TGZ B;  3TL5 A;  1R4N I;  2GBN A;  2LGX A;  3LJ3 A;  3PGE A;  3L13 A;  3TIX A;  3PSE B;  5CHF A;  3V6C B;  4FJZ A;  4XZ4 A;  2NS5 A;  2RPQ A;  1UGM A;  2MLB A;  2C7N B;  3UQA A;  2CU1 A;  3T8M A;  1WJ4 A;  1NDD A;  1WE6 A;  2KJ6 A;  5DPW A;  2MSE D;  1SE9 A;  2O2V A;  1OGW A;  1P1A A;  2CS4 A;  3ZNZ B;  3A9J B;  1YX6 B;  3AXC A;  3IG3 A;  3IFW B;  5LXI B;  4AWJ A;  1WZ3 A;  4TKN A;  2ZCB A;  2G4S A;  3PLU A;  3QJZ A;  4RMA A;  1S3S G;  2KQ7 A;  4KV2 A;  2RSU A;  4E74 A;  4DDI D;  3ONS A;  2LGD A;  3PVL A;  5AZG A;  4NJ6 A;  4IM0 A;  1OEY A;  4BVU C;  5GMV A;  1WXV A;  5AZH A;  4IM2 A;  5AEK B;  2Y5B B;  1E8W A;  1WMH A;  3BY4 B;  4II2 B;  4NQL B;  1H4R A;  3ML8 A;  4BKS A;  1Q1O A;  2NPT A;  2L05 A;  3DBL I;  3HK0 A;  3L10 B;  2N9P C;  1UH6 A;  2N7D A;  4WWN A;  2J0M A;  2QHO A;  4DXA B;  4MSM B;  4BBN F;  2O2V B;  2FIF A;  3GZN I;  2MW5 A;  2IY0 B;  3A9K B;  3N3K B;  4DBG A;  3DOW A;  2K6D B;  2MX2 A;  2ZZP B;  2DHZ A;  1GJZ A;  2M4N A;  3QAQ A;  4LJO B;  4EFO A;  4A20 A;  3MJW A;  3CF6 E;  4HDQ A;  3TMP B;  4ICV A;  1WF9 A;  2CHZ A;  4HK2 A;  1XQQ A;  2WYQ A;  3L17 A;  1CMX B;  2D2Q A;  2L3Z A;  5DCN A;  4K7W A;  2DZM A;  2HTH A;  4ZRJ A;  1LM8 B;  5E6N A;  3Q3J A;  3ZUN A;  4GU2 A;  1E8Y A;  1WMH B;  1MG8 A;  3ECI A;  3JYU A;  3U30 A;  3ZDT A;  2JUO A;  3WAO A;  2NPT B;  2K1F A;  4GDK A;  3AI5 A;  2EKE C;  1WRD B;  2GBJ A;  4FAD A;  1Q5W B;  4RM8 A;  2KHW B;  1WXS A;  2RD0 A;  3SU8 X;  2C7H A;  2DAF A;  1YX5 B;  2MP2 A;  3H9D A;  3A33 B;  2DZI A;  3DBS A;  3Q3F A;  1WJN A;  4NAW A;  3T9L A;  1WH3 A;  3I3T B;  3V62 A;  4EUT A;  3OLM D;  2KFK A;  5KHO A;  4DHJ B;  3VVW B;  4I6N B;  5EDS A;  2C7M B;  4N9F 4;  1TTN A;  3AU4 A;  4W9K A;  4DHZ E;  2LVO A;  1NBF C;  2IY1 B;  2K25 A;  2RGF A;  3DVN U;  3HM3 A;  3QK0 A;  2PJH A;  4EZJ A;  2DZK A;  4F8C B;  1ZGU B;  4HCP B;  5DPT A;  1P0R A;  3ZNG C;  2EMS A;  4A3P A;  1C3T A;  2AYO B;  5D7G A;  3ZW3 A;  2A4Z A;  4ANV A;  4GDK B;  2GMI C;  2KX0 A;  3L0W B;  2BKR B;  2FCQ A;  2J0J A;  5D94 A;  3ZO5 B;  4BKS D;  2N1V A;  2AL6 A;  4FN2 A;  3WAN A;  3B1L X;  2L76 A;  2DEN B;  3APD A;  3PV1 A;  4NAW B;  2BWE S;  1UBQ A;  2IO2 B;  4GDL A;  4WJO A;  1WGY A;  2YVC A;  2NBV B;  1U4A A;  2O6V B;  4JQW C;  3K9O B;  3WAM A;  4LCD E;  2LVP A;  4DHJ D;  5CHW A;  2MRP A;  2AEH A;  2KZR A;  3DBR I;  3HIZ A;  2K6Q A;  4KDL B;  4TUU A;  1KLV A;  2AWT A;  4MDK E;  3NZS A;  1K8R B;  3R3M A;  3VTV A;  1E8Z A;  2C9W B;  2D3G A;  3R7Q A;  1D3Z A;  4DHZ B;  3DBH I;  2ASQ A;  2KDI A;  2DAJ A;  2Z0E B;  3WA0 A;  2I1K A;  2JVC A;  3ZRF A;  1C1Y B;  4MM3 A;  3V60 A;  1WJU A;  1Y8R C;  4E3C A;  3UQB A;  4HPL B;  4TV3 A;  4F1S A;  4GDL B;  2LRU A;  4URK A;  3NY5 A;  3A9J A;  3VUW A;  4KZC A;  3P2B A;  2FCN A;  4GOC A;  3CST A;  3BIN A;  2V4L A;  2MWS B;  3HHM A;  2C60 A;  3W1S A;  3UGB B;  3A1Q A;  2MBH A;  4KDI C;  3R7R A;  5JZE B;  5IA7 A;  3DQV A;  3M63 B;  3PRE A;  2M1M A;  2MBO A;  3DVG X;  3QAR A;  3TJP A;  3N32 A;  2PPH A;  1SGH A;  2KDB A;  5C1Z A;  4K7S A;  3U7D A;  3IVF A;  1UBI A;  2ZCC A;  1V2Y A;  2ZPN A;  2DYM A;  2JY6 A;  2LXC A;  2JZ3 B;  2IO0 B;  4FHJ A;  4NQK E;  2ZJD A;  1VD2 A;  2FCS A;  4MEL A;  1V6E A;  2D07 B;  1V5O A;  4PS7 A;  1WYW B;  1J8C A;  2G45 B;  3B0A A;  1L7Y A;  3A9K A;  4ZRI A;  2K8H A;  4EZK A;  4HVB A;  2KMC A;  2VRR B;  3VTW A;  1M94 A;  2GBK A;  3A1Q B;  3PHX B;  4HLE A;  2KQS A;  1YD8 U;  4EZL A;  3GOE A;  2KK8 A;  1V80 A;  1YJ1 A;  3KVF B;  5KHQ A;  3DVN V;  4GMV A;  1XT9 B;  5J2R A;  3PPA A;  1S1Q B;  2N9E B;  3A4R A;  3ZTC A;  4LJP B;  2KC1 A;  4K81 A;  1I35 A;  4PYZ A;  1WIA A;  2Z0D B;  4E71 A;  2UYZ B;  3H7P A;  1E7U A;  2HE7 A;  1JRU A;  2L8J A;  2YLM A;  4GXB A;  2WX0 A;  1OTR B;  5JHA A;  4K7U A;  4GSW A;  2MCN B;  3QQ8 B;  2FAZ A;  3N30 A;  1Z5S B;  4MH0 E;  3U8Z A;  2KO3 A;  5D2M B;  2XK5 A;  5TR5 A;  3ZVV A;  3M3J A;  4KSK C;  3DVG Y;  5J17 A;  3K9P B;  1KJT A;  2BYV E;  4JL9 A;  3OAW A;  3QCA A;  1Z2M A;  2GOW A;  3ZIM A;  4EOY A;  3IBE A;  1OQY A;  2PEA A;  2KDF B;  2JT4 B;  4XX5 A;  1LXD A;  2MQJ A;  2UWQ A;  1G6J A;  2L7R A;  3RZW C;  1J0G A;  4K1R B;  1V5T A;  3HM6 X;  4JGH B;  3H7P B;  4M0W B;  2KKC A;  3QA8 A;  2L0T A;  4MGY E;  1NI2 A;  2KLG A;  3VUY A;  3JVZ X;  4HJK A;  4I6P A;  4NNJ B;  2KX3 A;  2DX5 B;  2LWP A;  3PT2 B;  4BBN C;  2IO3 B;  2AL3 A;  2FCM A;  2LRW A;  5CX3 A;  3SDL C;  3WAP A;  1WGD A;  3ZKJ C;  1IPG A;  4EEW A;  5J18 A;  2XK5 B;  4I6L B;  2Z59 B;  1RLF A;  1WI0 A;  2G3Q B;  3UIP B;  4GGQ A;  3X23 A;  2O6V A;  3B08 A;  1WR1 A;  2OOB B;  1WM2 A;  2W9N A;  3PRZ A;  4IWP A;  5FR6 A;  2ZNV B;  3JSV B;  4KVG B;  1J19 A;  4BKT A;  4A3O A;  4FUL A;  2N9X A;  5DPR A;  1YQB A;  1GC6 A;  4XC2 A;  3UF8 A;  3PS6 A;  2BYF A;  4DDG D;  1P9D U;  2CHX A;  2J0K A;  5DPS A;  3ZNI D;  2JZZ A;  4J6I A;  4GIV A;  2BGF A;  1LQB A;  2DYO A;  4F7Z A;  1V49 A;  1X1M A;  3ALB A;  4ZDV A;  3EEC A;  2ZPY A;  3VTU A;  5L95 C;  2OJR A;  2DZJ A;  3PLV A;  4ANX A;  4CHK A;  4BOZ B;  3RUL A;  1WM3 A;  2IYD B;  5CTR C;  2WWZ A;  2D10 A;  4JLC A;  1WGR A;  3AU5 A;  2LVQ A;  3L08 A;  1EUV B;  2JPH A;  2KJR A;  2XBB C;  4G11 A;  1P98 A;  2LJ5 A;  3ZNH B;  4BKG A;  4AJY B;  1GG3 A;  4ZRK A;  2KMA A;  1YIW A;  1WX8 A;  3UIO B;  4KSL C;  2IZV B;  1KM7 A;  5C23 A;  4MGZ E;  4BFR A;  2KTF A;  3EFU A;  3RZF A;  3O65 B;  1SIF A;  4FJV B;  4PS8 A;  2M8S A;  3LDZ E;  4HWI B;  4MEM A;  3MTN B;  3VUX A;  1T0Y A;  3EHV A;  2KC2 A;  2BPS A;  3ENE A;  3CMM B;  3APF A;  3ZRC A;  4KIK A;  2BWF A;  4GN1 A;  4WWP A;  4ASW C;  5LXH A;  2O6V D;  4DWF A;  2NVU I;  2WDT B;  2BKF A;  3DCG A;  2K8B A;  2MBB B;  3MHS D;  4W9E A;  2CKH B;  4W9J A;  3NHE B;  3RD2 A;  5L83 A;  1V9J A;  1WY8 A;  2GBM A;  3PRP B;  3KUC B;  4NY0 A;  5BO4 B;  1KOT A;  1E90 A;  3R66 C;  3KYC D;  2L0F A;  1EF1 A;  3C0R B;  2KNB A;  3UIN B;  1BT0 A;  3OJ4 B;  2KXJ A;  2LZ6 A;  3PZD A;  4W9F A;  4FA6 A;  1L2N A;  4PYU A;  3QWZ B;  1FXT B;  3PTF C;  2KN5 A;  3RT3 B;  1PQS A;  2FID A;  2I1J A;  2PE9 A;  1WE7 A;  4KIK B;  4ANU A;  4IM3 A;  3ZDM C;  2HD5 B;  3CSF A;  1TBE A;  4TQ1 A;  3S2A A;  1E5W A;  1WJ6 A;  2KTR A;  2KVR A;  3JW0 X;  1WFY A;  4X57 B;  1WX9 A;  5LLI A;  3X0W A;  4OVV A;  4IG7 B;  2NBW B;  5D6J B;  2JRI B;  3RCZ A;  4CYE A;  4ICU A;  3M95 A;  5HKH A;  3VFK A;  4FLH A;  4WJP A;  4W9L A;  3VAW A;  3QX1 A;  4W9I A;  4DK5 A;  2BYE A;  4BOS C;  2ZEQ A;  4WQO B;  3D32 A;  4AOF A;  2NR2 A;  2KAN A;  4LDT B;  4B6W A;  3VH4 B;  3VDZ A;  1IP9 A;  3H1U A;  3WAL A;  2FUH B;  1R4M I;  3NS8 A;  1WR6 E;  1A5R A;  1Q0W B;  2KOX A;  4AP4 C;  1E8X A;  1ZKH A;  2KTR B;  2GBR A;  4HDO A;  2KLC A;  4WJQ A;  4ZYN A;  3WIM A;  3ML9 A;  3JSV A;  3W1Y A;  2CR5 A;  4HPM B;  4YL8 A;  4AJW A;  2B3A A;  1WGG A;  4ANW A;  3NZU A;  4IW0 A;  1P3Q U;  2BF8 B;  4PS3 A;  4HXD A;  4OVU A;  2JXX A;  2G4D B;  4NJ7 A;  3V61 A;  3TCA A;  3DDC B;  2LD9 A;  1QZE A;  4LDT D;  3NOB A;  2R2O A;  1WX7 A;  1RFA A;  2REX A;  4IWO A;  4W9H A;  4IC7 B;  4IUM B;  4EKU A;  2WX1 A;  1EF5 A;  5G55 A;  2JF5 A;  4B9K A;  3KH0 A;  1XD3 B;  3RUI B;  1WGH A;  2MA9 B;  4FHK A;  2EMT A;  3PRM B;  2C5L C;  1E7V A;  3A4S C;  2CHW A;  3VXW A;  1H8C A;  4FJY A;  5AZF A;  2LI5 A;  3VH3 B;  2KFJ A;  2MBQ A;  2J7Q B;  2R2Q A;  3KW5 B;  2XEW A;  3L16 A;  4G3X B;  3TBL D;  3DPD A;  4M8M A;  3SD5 A;  3W1S C;  4W9D A;  1TZ1 A;  1ISN A;  3OJ3 A;  1AAR A;  2JRH A;  4MJS A;  3VQI A;  1VCB A;  2N1W A;  4G0N B;  4B95 A;  2KWU B;  2K8C A;  5JHB A;  3APC A;  3KYD D;  1V86 A;  2IO1 B;  3VHT C;  2IBI B;  1WXM A;  3M62 B;  5E6P A;  1OEY J;  2RR9 A;  2ZVN A;  2KWV B;  4G50 A;  2V3S A;  3PHW B;  1UZX B;  2MBE A;  3QHT A;  2N4F A;  2K39 A;  2NBU A;  5E6O A;  2L00 B;  2MP2 B;  4W9C A;  4AUQ C;  1IYF A;  1ZW7 A;  2M0X A;  4MGK E;  3IHP C;  3RYT A;  2KFK B;  3H7S A;  4GB9 A;  2N7E A;  4P7I A;  2JWZ A;  4CO7 A;  4RM9 A;  2LAS A;  4M8N A;  4JIO U;  1I42 A;  4MJS B;  1EO6 A;  1WZ0 A;  3ZLZ A;  1GUA B;  3AUL A;  4WJN A;  4NPN A;  3KUD B;  3KUZ A;  4IWQ A;  4WAA A;  3V6E B;  4W9G A;  3ZTD A;  1UD7 A;  3SHQ A;  1RRB A;  3H6N A;  1F9J A;  2D11 A;  1GNU A;  2KJH B;  3EC8 A;  3QC8 B;  1HE8 A;  4KZ0 A;  1WXA A;  2LUE A;  2KDE B;  4MSQ B;  3QIJ A;  1V81 A;  2KD0 A;  2KWC A;  2V1Y A;  1RAX A;  4II3 B;  5CHV C;  5IAA C;  1LFD A;  1GC7 A;  2A5U A;  4TQ0 A;  5G2N A;  2ZVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...