5FR6A

The structure of polycomb uld complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
83
Chain Sequence
b'DDEIISLSIEFFKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYCOMB COMPLEX PROTEIN BMI-1
molecule tags Transcription
source organism Homo sapiens
publication title Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization
pubmed doi rcsb
total genus 21
structure length 83
sequence length 105
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5fr6A00
4MGKE 3TIXA 4RMAA 2GBNA 3T9LA 2JZZA 4ANXA 3VUYA 2ZCBA 4BOZB 2V3SA 1WFYA 4KSKC 2DYOA 4IWOA 2LGXA 2N7DA 2JUOA 2PPHA 4KSLC 4YL8A 1WGGA 4M8NA 2J0MA 3RYTA 5IAAC 2KDFB 1WRDB 4BOSC 3DBRI 4G3XB 2KJHB 2G4DB 3GZNI 4CHKA 3ZVVA 2BYFA 2K6DB 3ZRFA 3V61A 1YX5B 1WH3A 1UH6A 1KM7A 2O2VA 3N32A 2KTRA 1M94A 2IO1B 2FUHB 3QIJA 4W9GA 4NQLB 3VAWA 4KZ0A 4DDGD 4GN1A 2KJRA 4NAWB 2JPHA 2MBEA 1OQYA 2NVUI 3OJ4B 5LLIA 3RD2A 3QARA 4FJVB 3H7SA 5LXHA 2DAJA 3ENEA 1E90A 2C7HA 3PRPB 4TUUA 1KJTA 1UZXB 2I1KA 3A9KA 3U8ZA 4AWJA 1J8CA 5CHWA 2GBKA 2C5LC 1NDDA 1WXSA 3T8MA 1WF9A 5TR5A 3H7PB 2GOWA 4W9DA 3OLMD 3DBHI 3P2BA 4IM3A 4XZ4A 2JZ3B 1WZ3A 3QX1A 1P0RA 2KKCA 2OOBB 4E74A 1CMXB 4IWPA 3U30A 4WWOA 1WGYA 3EC8A 1GC7A 3W1YA 4FADA 3RCZA 2MWSB 2K1FA 3HIZA 3QA8A 4DWFA 4BFRA 3RULA 4EEWA 3SHQA 2MBBB 3H6NA 4BBNF 4OVVA 3ZIMA 4M0WB 2LZ6A 2WX0A 2FAZA 3APDA 1V6EA 1LM8B 2DZMA 3EECA 4DHJB 2AL6A 2ZNVB 3L10B 3VDZA 4BKSA 1UELA 2KMCA 3TCAA 1OGWA 2DX5B 1RLFA 1E8WA 3QC8B 1E7VA 4MJSA 1RRBA 2JF5A 3H1UA 4W9HA 1UBIA 4JIOU 2XK5A 2O6VD 2O6VB 2MRPA 1YD8U 1WI0A 4IM2A 1WJUA 2ZEQA 4P7IA 4XX5A 3ZLZA 2J0JA 2JXXA 3A4SC 3KUZA 3JVZX 3ZDMC 4DHZB 4II3B 1T0YA 4WWNA 2Y5BB 2IBIB 2YVCA 2REXA 2DZIA 1WJ4A 1X1MA 3KYDD 3QQ8B 1RFAA 1KLVA 3W1SA 2KX3A 3L13A 4K81A 2GBMA 2Z59B 3K9PB 3Q3JA 2BKFA 3QJZA 4DK5A 1L7YA 2BYVE 3ZTCA 3D32A 4NY0A 2N9XA 4BKGA 3PHWB 3IFWB 1GJZA 1I42A 1LFDA 3B08A 3UQBA 1V2YA 1YIWA 2NPTB 1Q5WB 3CSFA 3AXCA 3CMMB 2FCNA 4ZYNA 4DDID 4FN2A 1A5RA 1OTRB 2IZVB 2V4LA 4TKNA 5FR6A 3GOEA 2MX2A 1SE9A 2GMIC 2KLCA 4JQWC 1V86A 2WYQA 5CHVC 2KWVB 4FA6A 4HWIB 2ZVNA 1R4MI 2LD9A 1EO6A 2YLMA 3NS8A 5DPSA 2K39A 3PS6A 2WX1A 2N9EB 1WYWB 1ZGUB 2LUEA 4HPLB 4IG7B 4HLEA 5IA7A 2XBBC 2K8HA 4IWQA 5DPRA 3UF8A 3VVWB 4IUMB 4G50A 3ZNGC 3SD5A 5JZEB 3ZTDA 4HDOA 5D94A 3ZNID 2CS4A 3TBLD 3VQIA 1FXTB 3IBEA 4NNJB 2LRWA 3DVGY 1NBFC 3NHEB 2VRRB 2N4FA 2L0FA 4G11A 4AJYB 5E6OA 3SU8X 1YQBA 3DCGA 4WJOA 2OJRA 3UIOB 4ICUA 4HK2A 4W9CA 3PV1A 1P98A 1UGMA 3R3MA 4FLHA 4RM9A 2XEWA 1OEYJ 1WY8A 1WGDA 4GMVA 4K7WA 1ZKHA 2L3ZA 5CX3A 3L17A 4I6LB 2PEAA 4ASWC 2O6VA 4M8MA 3VH4B 1EF1A 3WANA 4WQOB 4ZDVA 5JHAA 2D3GA 2DZJA 4X57B 4PS3A 2LXCA 2IO0B 1UBQA 2J7QB 3HK0A 2ZPNA 4PS7A 4W9JA 1VD2A 2FIFA 1TZ1A 3A33B 3AU5A 1V9JA 2EKEC 4JL9A 5CHFA 1IPGA 5G55A 3PREA 3A9JA 2KVRA 1P3QU 1SIFA 3V60A 2K8CA 4W9FA 3AU4A 3PZDA 2CKHB 5D2MB 1WIAA 5EDSA 2N1VA 2NR2A 3PGEA 2LVOA 2BF8B 4I6NB 3NZUA 4MSQB 3DVGX 2R2OA 2KO3A 4FJYA 4XC2A 1R4NI 4E3CA 5J17A 1L2NA 1WE7A 2XK5B 3I3TB 3S2AA 2KLGA 2MA9B 5KHOA 1Q0WB 3MHSD 3NY5A 2G45B 1J0GA 2KANA 4BKSD 1P9DU 3M62B 5LXIB 1V80A 2DZKA 2O2VB 3L16A 2KWUB 4B9KA 4ANWA 1H8CA 2KDEB 3MJWA 3A1QA 3EHVA 4TV3A 4IC7B 2FIDA 4FHJA 3PLUA 2KTFA 3ZRCA 3VFKA 1E8YA 3NZSA 3QK0A 3WALA 2LXAA 5HKHA 4MELA 2MP2B 3KUCB 4WWPA 2AL3A 3DVNV 2KOXA 2NS5A 4PS8A 2KFJA 2RPQA 3ZNZB 2CU1A 4GDKA 4GDLA 3VUXA 1WXMA 3LJ3A 2KDBA 1WXVA 5JHBA 4LDTD 4AUQC 2IYDB 2A4ZA 2C60A 2M1MA 3HM3A 3TL5A 2IY0B 3R7QA 3AULA 1Z5SB 4GDKB 2LJ5A 3DPDA 3M95A 2K8BA 1WX9A 3WAOA 4IM0A 1H4RA 5L95C 2D11A 2GBJA 4ZRKA 3RUIB 2QHOA 1EF5A 2KFKB 3N3KB 3VXWA 3V6CB 3ECIA 4DXAB 4B6WA 3DBLI 1Q1OA 3VTVA 2DHZA 4W9LA 3EFUA 3PTFC 3IG3A 2MBHA 4W9KA 4MSMB 4DHZE 1Z2MA 4DBGA 2KC1A 2FNJB 2JRHA 3CSTA 4WJPA 2GBRA 4MJSB 2PJHA 3ZO5B 1U4AA 1JRUA 4KZCA 2JWZA 2L00B 2FCSA 3BY4B 1SGHA 4WAAA 3QAQA 1WJNA 2DYBA 1WMHB 2NBUA 2Z0EB 2FCQA 4LJOB 1WE6A 3DVNU 2KC2A 4HCPB 2JRIB 1E8ZA 4K7UA 2KNBA 4FJZA 2ZVOA 4K1RB 2L0TA 4II2B 1BT0A 3A9JB 3O65B 1ZW7A 5DPWA 5AZFA 2RD0A 4GDLB 3JYUA 1IP9A 1V5OA 3DOWA 1WJ6A 3HHMA 5KHQA 5AZGA 2I1JA 4NJ6A 1NI2A 3ML9A 3Q3FA 2KHWB 2KDIA 1EUVB 1WX8A 3L54A 2LASA 5C1ZA 3VHTC 4KV2A 2L7RA 2M8SA 1WR1A 2W9NA 3OAWA 4TQ0A 2KXJA 1GNUA 4MGZE 3VTWA 1E7UA 4KIKA 1KOTA 3PLVA 3X23A 3A4RA 4LCDE 2KZRA 2NCNA 3JSVA 4OVUA 2MCNB 2HE7A 4HPMB 4GOCA 1WXAA 2L76A 4GGQA 4LJPB 3U7DA 3V62A 3UQAA 4EUTA 2C9WB 3OJ3A 1PQSA 2BKRB 1TBEA 2DAFA 4F1SA 2IO2B 2A5UA 5D7GA 4EZJA 2EMSA 4K7SA 4PYZA 2KK8A 3PRMB 2ZNVC 1WR6E 5AEKB 3ZUNA 2N7EA 3R66C 4EOYA 1E5WA 3H9DA 4NQKE 2LGDA 3L0WB 3PT2B 5L83A 4GSWA 2DYMA 4FHKA 4EFOA 3HM6X 1GC6A 1RAXA 2KQSA 4ZRIA 2K25A 4AP4C 3C0RB 4KVGB 3TJPA 1C3TA 1WX7A 3TMPB 5BO4B 1GUAB 4WJQA 1VCBA 3ALBA 3DDCB 4W9IA 2BGFA 2L8JA 2M17A 1WM2A 1K8RB 1WM3A 4I6PA 4HVBA 2NBVB 3PVLA 3H7PA 4MDKE 5G2NA 2ZCCA 1LXDA 2ZJDA 3L08A 3LDZE 4IW0A 4BKTA 4GU2A 1V81A 1TTNA 4WJNA 4JLCA 2K6QA 1E8XA 1MG8A 2AEHA 3M63B 5E6NA 3V6EB 1XT9B 4JGHB 1S1QB 4GXBA 2IY1B 4N9F4 3VH3B 3X0WA 4A3PA 2G3QB 4CO7A 1TGZB 4G0NB 3KUDB 3M3JA 2MBQA 4BBNC 5JH5C 1QZEA 5CTRC 4LDTB 2PE6B 4F7ZA 4HDQA 3JW0X 1WZ0A 2WDTB 5AZHA 4AOFA 3QWZB 3UINB 4F8CB 1UD7A 4B95A 2MW5A 2KJ6A 1XD3B 3N30A 2KN5A 1P1AA 4URKA 2LWPA 4TQ1A 1OEYA 2M0XA 3RZWC 3A1QB 3ML8A 3ZKJC 2RR9A 2UYZB 2WWZA 3CF6E 2HJ8A 1WGRA 3DBSA 2UWQA 2KWCA 4HJKA 1YJ1A 3MTNB 4FULA 1I35A 2JY6A 2AWTA 3IVFA 3UIPB 4ANVA 4MH0E 1G6JA 5J18A 2LRUA 2HD5B 3PHXB 1IYFA 1D3ZA 2D10A 2G4SA 4A3OA 2KTRB 2KX0A 2D2QA 3B0AA 3KH0A 2MLBA 2MQJA 2V1YA 2NBWB 2IO3B 2KD0A 2FCMA 4PYUA 2NPTA 3KYCD 2AYOB 4MM3A 5C23A 3W1SC 4E71A 2JT4B 2LVQA 3ZNHB 4FBJB 2L05A 4ICVA 1Y8RC 1F9JA 4CYEA 2HTHA 2R2QA 3WAMA 2CHWA 2LI5A 2PE9A 3APFA 4BVUC 2KMAA 3KW5B 4MGIE 1HE8A 3ZW3A 4EZLA 3WIMA 4HCNB 3R7RA 3UGBB 2KQ7A 1S3SG 4KIKB 2LVPA 4RM8A 4A20A 5D6JB 3AI5A 4EKUA 2RGFA 5E6PA 2RSUA 2CR5A 4W9EA 4HXDA 2BWFA 2JVCA 2J0KA 2MBOA 4NPNA 4GB9A 2Z0DB 4AJWA 2MP2A 2M4NA 2N1WA 4GIVA 1LQBA 2LGYA 2ZZPB 1V49A 3B1LX 2D07B 2CHXA 3RT3B 2ZPYA 4J6IA 4KDLB 2N9PC 3WA0A 1V5TA 1WMHA 4NJ7A 4EZKA 1XQQA 3KVFB 1AARA 2ASQA 3ONSA 3PRZA 3PPAA 3QCAA 3NOBA 4NAWA 2BPSA 3SDLC 3IHPC 4ANUA 3VUWA 4MEMA 5DPTA 2MSED 1WGHA 2BYEA 2C7MB 2C7NB 2BWES 1J19A 3RZFA 1YX6B 5J2RA 4DHJD 3PSEB 3WAPA 2CHZA 3A9KB 3DQVA 2KFKA 3ZDTA 4KDIC 4ZRJA 5GMVA 3K9OB 2DENB 5DCNA 3APCA 2EMTA 3BINA 3JSVB 4MGYE 1GG3A 3QHTA 3VTUA 1C1YB 1ISNA 2B3AA
chains in the Genus database with same CATH superfamily
1XEEA 1YQ4B 2GBNA 2RDBC 3VUYA 4BOZB 2V3SA 2JU6X 3BWUD 2WDRB 2JUOA 3NRZA 3E9SA 2J0MA 4BOSC 4G3XB 4J3OD 2G4DB 3ZVVA 2K6DB 1M94A 1TKGA 1V8CA 4KZ0A 4GN1A 2KJRA 5LLIA 1NEKB 3Q2AC 2I1KA 4KKJA 4YT0B 2C5LC 2J4XA 3T8MA 5TR5A 1TY2A 2GOWA 4LNKA 3DBHI 3P2BA 4IM3A 4A55A 2JZ3B 1P0RA 1CMXB 4WWOA 3EC8A 1GC7A 3W1YA 2MWSB 3HIZA 4BFRA 4BBNF 1QKZA 4OVVA 3RN9C 2GI9A 2M19A 3BIID 1SE3A 1V6EA 3B2FA 4IKGA 4BKSA 1RLFA 1PGBA 4MJSA 3H1UA 2LEKA 3CWIA 4W9HA 1TIFA 2XK5A 3H8HA 3AE5B 1WI0A 2QJLA 1MHXA 2FE8A 4YTPB 3LYYA 4WWNA 3AE3B 3KYDD 3DBRB 3W1SA 4K81A 3K9PB 1JQ4A 3SFDB 4RCOA 1L7YA 4DK5A 4NY0A 2N9XA 4WAFA 4XE0A 4BKGA 1STEA 1I42A 1V2YA 3AXCA 1VZ7A 2Q5WD 4DDID 3GOEA 3KWVA 2GMIC 3HUIA 4JQWC 2ZVNA 3GE3C 2E3TA 3RNCC 2DBYA 4HPLB 1WYWB 4IG7B 1GPXA 4HLEA 5IA7A 4IWQA 5DPRA 3ZNGC 3E56A 1XLNA 3ZTDA 2K5PA 5IN7A 4R3DA 2VRRB 3Q8EA 1VDVA 2N4FA 2L0FA 4G11A 4AJYB 3SU8X 3DCGA 4ICUA 4W9CA 2EKIA 1UGMA 3AEEB 3P63A 3TSSA 4NJCA 3R3MA 5BYQA 2PEAA 2O6VA 4M8MA 4KGRA 2QMTA 4OVZA 1EF1A 5JHAA 2DZJA 1AW7A 1RM6C 1TZ1A 3NVWA 1V9JA 2EKEC 4JL9A 1OFFA 2PVGC 4W9FA 3AU4A 5D2MB 1AWDA 1WIAA 2INDC 3EA6A 2AQ3B 1YJJA 3NVZA 3DVGX 4FJYA 4HKQA 1L2NA 4E3CA 1R4NI 4L23A 1WE7A 1XCQL 2XK5B 3S2AA 2KLGA 2HTME 3NY5A 2G45B 2IJ0A 4BKSD 3M62B 5LXIB 2O2VB 2LHEA 1XXGA 1UNSA 4ANWA 1C76A 3MJWA 4IC7B 2KTFA 2DLBA 1DOXA 4MELA 3LB8C 3KUCB 4WWPA 1WWTA 2KFJA 2RPQA 1F2RC 1P7EA 5IKCM 3TL5A 2NTSA 3R7QA 3KQ4A 1JWSD 2RPVA 4GDKB 2ONQA 3DPDA 5I4DA 1WX9A 3WAOA 1L6VA 2WHIA 4ZRKA 3RUIB 1EF5A 3V6CB 2WXRA 3DBLI 5C3JB 4W9LA 2K22A 4QAYA 3EFUA 3PTFC 2MBHA 4WJPA 1FIQA 4MJSB 1JRUA 2JWZA 3W5UB 3DWGC 3BY4B 1SGHA 4WAAA 3QAQA 4XDCA 2FCQA 1WE6A 1E8ZA 2KNBA 2KQ4X 4FJZA 2W3RA 5DPWA 1ZW7A 1QOFA 2QIEB 4JPSA 5AZFA 2RD0A 1T0QC 3JYUA 3RNBC 1SIJA 2KDIA 1EUVB 4ARCA 2V4IB 2ICIA 2MJ3A 2L7RA 3FILA 1WR1A 4S17A 2W9NA 4MGZE 2KT7A 3A4RA 4LCDE 4C7YA 3AE7B 2LFIA 3RNGC 2KAJA 3IXSA 1PYWD 1WXAA 1TZOA 3V62A 4K3BA 2DAFA 2IO2B 2A5UA 4EZJA 2LJIA 1SEBD 3FAHA 3ZUNA 3Q3NC 4EOYA 2L52A 4MACA 2LGDA 5L83A 4GSWA 4B0MA 1RAXA 2KQSA 3C0RB 4KVGB 3TJPA 1KF6B 1WX7A 2VH2A 1GUAB 3BVGA 2IDYA 1VCBA 3ALBA 4ZYSA 3N20C 5G2NA 1SE2A 1SB3C 2ZJDA 2AQ2B 3L08A 3V3XA 3WCQA 1HZ6A 4IW0A 4GU2A 3TEWA 1V81A 4B0EA 4JLCA 1E8XA 1E7PB 2FBWB 1TGZB 3FC4A 3KLSX 3M3JA 2MBQA 3AE4B 2WDQB 1FCCC 3UINB 4F8CB 3N30A 4URKA 4TQ1A 3RZWC 3ML8A 4ARIA 3ZKJC 2RR9A 2LGIA 1I4GA 3CF6E 2BS4B 1QILA 3AN1A 4FULA 3MTNB 4ANVA 3UIPB 4XGAB 5E6JA 5J18A 1ZDXA 1FFUA 5H92C 2D10A 4A3OA 2KTRB 2NBWB 5FKAC 4MM3A 1XLOA 2YEPF 2OHFA 3WAMA 1LGRA 1HE8A 1S3SG 2Z8LA 1YNTE 2MBOA 4AJWA 2N1WA 2LGYA 1YN5A 2CHXA 2ZPYA 1V5TA 4EZKA 4NJ7A 1AARA 3PPAA 1N6ZA 4NAWA 3IHPC 4MEMA 1AN8A 5DPTA 2BWES 1J19A 2V3NA 3PSEB 4NZLB 2JZPA 3DQVA 2J52A 4KDIC 3K9OB 2N9KA 4HKZE 4MGYE 3QHTA 1BUIC 4FA6A 3U2SC 1ISNA 1HTQA 1XCTL 3T9LA 2ZCBA 3RNFC 2BW2A 1YN4A 4KSLC 4YL8A 1TYGB 2N9LA 2WXMA 4M8NA 3RYTA 2PIAA 2D5GA 1UH6A 1KM7A 3TCAA 2FUHB 1ZDVA 4KKIA 4C4VA 2JPHA 3RD2A 3QARA 4MH8A 1E90A 1KJTA 3A9KA 3AV8A 3N1YC 3U8ZA 5CHWA 1KRHA 1NDDA 1B1ZA 1WXSA 1I4QA 3URYA 3H7PB 4US8A 2WXOA 1E0ZA 2HJ1A 1WGYA 4FADA 2JX5A 2K1FA 4EEWA 2MBBB 3OWEB 4M0WB 4AS1A 2WXKA 3APDA 1D4BA 2DZMA 4DHJB 2AL6A 3L10B 5IOIA 2WXQA 1A70A 1JW9D 2KMCA 1FM0D 1PGXA 1I4PA 2JF5A 1CK1A 3MC8A 1QT9A 4IM2A 1WJUA 2WS3B 4P7IA 4XX5A 3ZLZA 3MC0B 2NMQA 2JXXA 3KUZA 4DHZB 3JVZX 3TEYA 4C00A 1JWBD 1WSPA 5TSSA 4LNNA 1WJ4A 3QQ8B 1KLVA 4BZAA 2KX3A 4WIPA 3Q3JA 2BKFA 3GS2A 5G5GA 1MFWA 4M01A 2VH1A 4A8XC 3PHWB 1GJZA 1LFDA 3B08A 2WGSA 3Q8CA 2I2YA 1D6EC 4FN2A 1MI0A 3GB1A 2V4LA 1I7HA 3DBLB 1V86A 2DNFA 4LK0M 2OEDA 2M56B 2YLMA 4JE3B 3NS8A 5DPSA 2LUEA 1F1HA 3BVMA 2K8HA 3KWLA 4IUMB 5JZEB 3ZNID 3VQIA 3DVGY 1NBFC 1VJKA 4OZAA 3Q14C 5E6OA 1YQBA 2OJRA 3MC9A 3PV1A 1P98A 1JWUD 1IUEA 4FLHA 1TKYA 1WGDA 3R2IA 4K7WA 2L3ZA 4XYCA 1M4VA 3L17A 3VH4B 4RF1A 3WANA 4WQOB 4ZDVA 4X57B 4PS3A 3AE2B 3AEFB 2LXCA 2J7QB 3HK0A 3UI3A 3AE8B 2MHJA 3A33B 5CHFA 3AEAB 5G55A 2K8CA 3Q6BA 1T0RC 3BVZA 1QOAA 4I6NB 1PUTA 3Q8AA 5J17A 3NZ3A 3ZXRA 1JCKB 2IGDA 2MA9B 4OZBA 3VR9B 2W55A 3I57A 2KANA 3P4QB 1L0YB 3L16A 1ACCA 1CJEA 4B9KA 1C78A 1H8CA 3EHVA 2FIDA 3ZRCA 3VFKA 1E8YA 3DVNV 2KOXA 4PS8A 3ZNZB 2DWQA 1T0SC 2CU1A 1VRAB 4GDLA 3VUXA 1SJED 2IYDB 4KX6B 2RDHA 3NUHB 1Y56A 2K8BA 2BTEA 4IM0A 1H4RA 2QCZA 3VXWA 4DXAB 5EE9A 1Q1OA 3VTVA 1GB1A 2GLSA 1YJIA 3IG3A 2KMMA 4DBGA 2KC1A 2JRHA 5H8YE 1NYRA 2PJHA 3O13A 2J42A 2DYBA 2Z0EB 4LJOB 4OW0A 1ZOYB 2QEJC 2WXIA 3DVNU 4K7UA 2PTLA 2ZVOA 3P4PB 1BT0A 3O65B 3ZJVA 4LNIA 1IP9A 4JWSC 1V5OA 3DOWA 5LNK1 3EFCA 1XLPA 5AZGA 4NJ6A 3ML9A 1EWCA 2KHWB 3BYYB 4ZHPA 1WX8A 4XDDA 5C1ZA 4KV2A 2M8SA 5HG2A 2KXJA 2WLBA 5C2TB 3VTWA 5GXGB 2ON8A 3RPFC 1EWYC 4S0RA 3JSVA 2MCNB 4HPMB 1FEHA 4GOCA 2L76A 4LJPB 4EUTA 1PQSA 4JX1C 3GP7A 4LNFA 5D7GA 2KK8A 5AEKB 3DHIC 1F2RI 1E5WA 4NQKE 3PZ7A 4AP4C 4JWUC 1IGCA 2Y3AA 3DDCB 1SXTA 2M17A 1PGAA 3P1MA 4MT5A 1WM3A 2NBVB 4MDKE 2ZCCA 3NS1A 3M63B 1N62A 3AB5A 5E6NA 4WURA 1V1OA 2CJOA 2IY1B 3VH3B 1WGKA 3X0WA 1UF0A 2G3QB 4CO7A 4WWMA 2V9HA 4G0NB 3KUDB 3ZJTA 5JH5C 5CTRC 3ZXVA 2PE6B 3JW0X 1WZ0A 2JYEA 5AZHA 2KJ6A 2KN5A 1P1AA 2M0XA 3A1QB 2D3CA 1ENFA 2UYZB 2HJ8A 3I9V1 2KWCA 4HJKA 1YJ1A 2LHDA 2JY6A 2MEKA 4MH0E 2LRUA 2HD5B 5FK9C 3PHXB 4C4VB 1IYFA 2G4SA 1TS2A 2D2QA 5HI1A 2RDGA 2MQJA 2V1YA 2IO3B 2L1AA 4ZRPA 4FBJB 1Y8RC 2WU5B 2CU3A 2HTHA 2R2QA 2LI5A 3APFA 1NVID 3MP9A 4MGIE 4EZLA 4HCNB 4PK1A 3BZDB 2KQ7A 2LVPA 4A20A 3AI5A 4EKUA 2RGFA 5E6PA 4HXDA 2BWFA 2JVCA 2IGGA 2MP2A 1LQBA 2ZZPB 1V49A 4J6IA 3SFEB 2N9PC 2VZKB 1WMHA 1KFYB 2I38A 2W82A 2PLPA 1L6UA 1FD6A 2BPSA 3VUWA 3T3NA 1WGHA 3U52E 2C7NB 3PZ8A 4RNAA 2MH7A 2PKOA 3Q8FA 2EELA 1FMAD 1XO3A 5DCNA 1GG3A 1F77A 1VR9A 2B3AA 1YN3A 1YMHE 4MGKE 1EU3A 1DOYA 3Q3OC 1WFYA 4KSKC 2DYOA 4IWOA 3W2DA 2N7DA 1K50A 2KDFB 5BYSA 1WRDB 2GB1A 3GZNI 1HXYD 2BYFA 1SF0A 1YX5B 1WH3A 3HRDD 2KTRA 2IO1B 3QIJA 2N0SB 3Q3MC 4NQLB 4DDGD 2SAKA 1C4PA 4NAWB 1KLUD 2MBEA 2NVUI 1MVKA 4FJVB 2OJWA 4TUUA 4AWJA 1J8CA 2GBKA 4M0WA 4W9DA 3OLMD 3NVVA 5D3IB 1WZ3A 2PMVA 2KKCA 4E74A 2LGSA 3U30A 2JSVX 3RCZA 3QA8A 4DWFA 3SHQA 2WP9B 1V97A 2WXJA 4L2YA 2LZ6A 2WX0A 2N7JA 1GAQB 2ZNVB 1UELA 3MHZA 2DX5B 3QC8B 1E7VA 1JWAD 1L0XB 4HROA 2O6VB 4DQOC 1YD8U 2ZEQA 3T3OA 3DBHB 2J0JA 3A4SC 3ZDMC 4II3B 2BB5A 5EE3A 2Y5BB 2IBIB 2YVCA 2REXA 1X1MA 1RFAA 3DHHC 2WXNA 3AMZA 3AE9B 3ZTCA 4RGMA 1FRRA 2J53A 3UQBA 1FXAA 1Q5WB 1JWMD 1XF5L 3CMMB 4ZYNA 2Y5CA 1E9MA 4TKNA 5CHVC 1SSNA 4OZCA 1R4NB 1TS4A 1PFDA 1YOVB 3Q8BA 1Q10A 4BAXA 3SD5A 2CS4A 1FXTB 5AUKA 3R8BA 3NHEB 3VRAB 2X8XX 1EU4A 1L4ZB 4WQMA 1R4MB 3IAS1 4M00A 4ITKA 1C77A 1OEYJ 1WY8A 2UU7A 1WXQA 3AEDB 2D3GA 2ZPNA 1VD2A 2W3SA 2FIFA 4N58A 2JXTA 4YTMB 3PREA 3A9JA 1P3QU 1SIFA 2KVRA 1TS5A 2CKHB 4RGNA 5EDSA 3TUOA 1JROA 1NYQA 4FXCA 3PGEA 4DXGA 3NZUA 3U7ZA 4XC2A 2R2OA 2KO3A 1IGDA 3DHGC 3I3TB 4H2AA 1JMLA 3MHSD 1P9DU 2BT6A 2KWUB 4KGSA 3A1QA 4TV3A 4C80A 4FHJA 3ETRA 3PLUA 1UGJA 3WALA 2LXAA 2GRIA 3BK1A 3IT6B 1F0ZA 1ESFA 2MP2B 2NS5A 3TEZA 4GDKA 2MJEA 3RFZB 4AUQC 2A4ZA 2C60A 1NENB 2IY0B 3I63C 3AULA 1Z5SB 3RI7C 1D5ZC 3M95A 5L95C 2D11A 3AEBB 2QHOA 2KFKB 3N3KB 3ECIA 4ZOHC 1T5XD 3B9JA 1K52A 4MSMB 4DHZE 1QOBA 3PO0A 1L4DB 2FNJB 3CSTA 1N61A 4IOIE 3ZO5B 1U4AA 4KZCA 3AH7A 2FCSA 1WJNA 2M0AA 2TSSA 1I4HA 4HCPB 1SBBB 2QSDA 2L0TA 3EGRA 2SEBD 1B9RA 3W9CB 2PVOD 3IAM1 1WJ6A 3MJ5A 1NI2A 1ZPSA 2LASA 2PW9A 4TQ0A 1GNUA 1KOTA 1E7UA 4KIKA 2KZRA 2NCNA 2L83A 5BMHA 4GGQA 3U7DA 3UQAA 2C9WB 2BKRB 1TBEA 4F1SA 3AECB 2XN9C 4K7SA 3PRMB 5T8IA 2ZNVC 1WR6E 4Q2JA 1ET6A 1N5XA 2N7EA 2WQYB 3MFGA 4FHKA 4EFOA 1GC6A 2K25A 1OQQA 5BO4B 2WXLA 1C4AA 4W9IA 2BGFA 1CQVA 3H7PA 4YTNB 3HVZA 3EUB2 4AQ7A 1DYQA 4O1NA 4WJNA 3RNAC 1GOZA 2IGHA 1MG8A 4XWTA 4JGHB 4YSZB 1C4CA 1S1QB 1FNWA 4N9F4 2BQQA 4BBNC 1QZEA 4LDTB 1AYFA 4F7ZA 4HDQA 4AOFA 2MW5A 1XD3B 1OEYA 3DBSA 3I5JC 1I35A 2AWTA 1WYGA 2D3BA 4K3CA 4USAA 1D3ZA 2G9HD 3VRBB 1IBXB 2KX0A 3B0AA 5BMIA 4P1BC 2MLBA 2WNMA 2KD0A 1DOIA 4PYUA 2NPTA 3KYCD 5C23A 2QILA 2JT4B 2L05A 4ICVA 1F9JA 2L32A 4BVUC 1VZ6A 3ZW3A 2QC8A 3R7RA 4W9EA 3NVYA 2J0KA 4XWWA 1I4RA 4KGTA 2Z0DB 3ABVB 1FCLA 2JWUA 3L4PA 2D07B 3RT3B 1XQQA 2INCC 3KVFB 3ONSA 2FUG1 2BB6A 3DWMA 3QCAA 3NOBA 4RGTA 2JQRB 3SDLC 2X38A 2MSED 3ZJUA 2BVCA 1YX6B 4US9A 5J2RA 4REZA 4DHJD 3WAPA 1ZUD2 2KFKA 3BK2A 4LNOA 4ZRJA 3APCA 3BINA 3NG0A 1C1YB 1K51A 2INPE 3TIXA 4RMAA 4A6QA 2JZZA 4GLSC 4ANXA 4CQNA 5G5HA 1SE4A 2LGXA 2PPHA 2K3UA 1WGGA 2KN4A 1ZP0B 4OHJA 5IAAC 3DBRI 2KJHB 4CHKA 3AE6B 3ZRFA 3V61A 2O2VA 4W9GA 3N32A 3BYTB 3VAWA 3OJ4B 1OQYA 3H7SA 5LXHA 2DAJA 3ENEA 2C7HA 3PRPB 1UZXB 4LLGM 2BBCA 3CIRB 1WF9A 2JYTA 4XZ4A 5MPOA 1F52A 3QX1A 2OOBB 4IWPA 3ZGZA 3V05A 1MG4A 1MHHE 1K53A 3RULA 1RWSA 4YSXB 1BMLC 3H6NA 1J7AA 5IP4D 3ZIMA 4ZRQA 2FAZA 1YQ3B 1LO5D 4MM3B 2LUMA 2BYTA 1LM8B 3EECA 3P4RB 1EM7A 3VDZA 1OGWA 1TT5B 1E8WA 1PDXA 3OG5A 1RRBA 1J7CA 2WXPA 1UBIA 4JIOU 1T3QA 2WXGA 2O6VD 2RMMA 2MRPA 2IPKD 1OQRA 1ZE3D 3FKYA 1T0YA 3ZQ4A 1N63A 2KYWA 2ZW1A 2DZIA 3L13A 2GBMA 2Z59B 3QJZA 2BYVE 3D32A 4A9AA 4YWGG 3IFWB 3U4EG 2MJDA 1YIWA 2NPTB 3CSFA 1V1PA 2FCNA 2INNE 1UWXA 1A5RA 1OTRB 2IZVB 5FR6A 1QF6A 1FPYA 2MX2A 1SE9A 1T6BX 2KLCA 2KVZA 1FNUA 2WYQA 2KWVB 4HWIB 1R4MI 5FR3A 2LD9A 1EO6A 5EE1A 2K39A 3PS6A 2WX1A 2N9EB 1ZGUB 1MJDA 4NAMA 2XBBC 4HEA1 1L5PA 2NTTA 3UF8A 1HZ5A 3VVWB 4G50A 1VLBA 4HDOA 5D94A 1C9FA 3TBLD 5HFYA 3VR8B 3IBEA 3P4SB 4NNJB 5BMGA 2LRWA 1N60A 5D3DA 4WJOA 3UIOB 2K0PA 4HK2A 4RM9A 1TKEA 2XEWA 4GMVA 1ZKHA 5CX3A 4I6LB 3C8YA 4ASWC 1FFVA 1GB4A 2IO0B 4W9JA 1UBQA 1BXTA 3C19A 4P6VF 4PS7A 3Q69A 3AU5A 1HTOA 1IPGA 2K9XA 2ZW0A 3V60A 3PZDA 2N1VA 2NR2A 2H88B 4C56C 1RFKA 2LVOA 2BF8B 1CZPA 1FRDA 4MSQB 4DXFA 1RYJA 1TS3A 4YSYB 3IT4B 1MPEA 2W54A 5KHOA 1Q0WB 4N59A 1UUPA 1J0GA 2LMCA 1J7BA 1V80A 2DZKA 4M02A 2KDEB 4RGOS 3B2GA 1QLBB 3NZSA 3QK0A 1DGJA 5HKHA 1KLGD 2WXHA 2AL3A 3AEGB 2ACZB 2WXFA 3N1XC 2QDFA 1WXMA 4D2KA 3LJ3A 4TSSA 2KDBA 1WXVA 5JHBA 4LDTD 1V1PB 2M1MA 3HM3A 2LJ5A 3ZYYX 5JXVA 2GBJA 3SR6A 4B6WA 2DHZA 2E6XA 1ZXIA 2D3AA 4W9KA 1C79A 1Z2MA 1QQRA 4RF0A 2AQ1B 2GBRA 4ACFA 4TMAB 3N1ZC 2L00B 1WMHB 2NBUA 2KC2A 2JRIB 3SEBA 5IO9A 4K1RB 4II2B 3A9JB 4GDLB 1D5MC 1I4XA 1KH0A 3HHMA 5KHQA 2I1JA 1HEZE 3Q3FA 5AUIA 3L54A 3VHTC 3OAWA 4N6EB 1N5WA 3PLVA 3X23A 1E10A 3TEXA 2WDVB 4P16A 4OVUA 1ZXHA 2HE7A 3OJ3A 1TJEA 2R61A 5HHDG 4RFBA 3W5VB 2EMSA 4PYZA 3J9CA 3NJTA 3AM9A 4YXDB 3R66C 4HJGE 3H9DA 3L0WB 3PT2B 2DYMA 4WH4A 5BYRA 3HM6X 4ZRIA 4PT5A 1C3TA 3TMPB 1NI3A 4WJQA 2L8JA 1JALA 1WM2A 1D5XC 1K8RB 4I6PA 4HVBA 4UDUC 2CJNA 3PVLA 1LXDA 1JRPA 3LDZE 3GZNB 3R2TA 2YEPB 4BKTA 5EE0A 1TTNA 3RNEC 2K6QA 2AEHA 3RMKC 3V6EB 3HVDA 1XT9B 2H89B 4GXBA 4C7ZA 1HQRD 4A3PA 1R7SA 4L1BA 3GE8C 2Y5PA 4LTUA 1WRIA 1FO4A 2WDTB 3QWZB 1UD7A 4B95A 1ET9A 2HDEA 2LWPA 1FXIA 2WWZA 1VZ8A 4HPPA 1WGRA 2UWQA 1UWMA 1XLQA 1TY0A 3IVFA 4ZHOA 1G6JA 1FNVA 3KH0A 1QOGA 4EE2A 2V0GA 2VZKD 2FCMA 3P42A 2AYOB 3W1SC 1IBXA 4E71A 2LVQA 3ZNHB 4CYEA 2CHWA 2PE9A 2KMAA 3KW5B 3WIMA 3UGBB 4P1CC 4KIKB 4RM8A 5D6JB 2RSUA 2CR5A 2AX5A 3AE1B 4NPNA 4GB9A 1L0VB 2M4NA 4GIVA 1KTKA 3B1LX 1ROEA 4KDLB 3WA0A 4RH6A 2WU2B 1SJHD 1HA5A 2ASQA 2KDMA 2G1EA 3PRZA 4ANUA 4A90A 3RZFA 2C7MB 2BYEA 2V3PA 2CHZA 3A9KB 4HRSA 3FILB 1E6EB 3ZDTA 1P7FA 2B76B 2XNAC 5GMVA 2DENB 2KWDA 2EMTA 2KACA 2BS3B 3JSVB 3LXFA 3N9YC 3VTUA 4IDIA 2BS2B
chains in the Genus database with same CATH topology
4MGKE 3TIXA 4RMAA 2GBNA 3T9LA 2JZZA 4ANXA 3VUYA 2ZCBA 4BOZB 2V3SA 1WFYA 4KSKC 2DYOA 4IWOA 2LGXA 2N7DA 2JUOA 2PPHA 4KSLC 4YL8A 1WGGA 4M8NA 2J0MA 3RYTA 5IAAC 2KDFB 1WRDB 4BOSC 3DBRI 4G3XB 2KJHB 2G4DB 3GZNI 4CHKA 3ZVVA 2BYFA 2K6DB 3ZRFA 3V61A 1YX5B 1WH3A 1UH6A 1KM7A 2O2VA 3N32A 2KTRA 1M94A 2IO1B 2FUHB 3QIJA 4W9GA 4NQLB 3VAWA 4KZ0A 4DDGD 4GN1A 2KJRA 4NAWB 2JPHA 2MBEA 1OQYA 2NVUI 3OJ4B 5LLIA 3RD2A 3QARA 4FJVB 3H7SA 5LXHA 2DAJA 3ENEA 1E90A 2C7HA 3PRPB 4TUUA 1KJTA 1UZXB 2I1KA 3A9KA 3U8ZA 4AWJA 1J8CA 5CHWA 2GBKA 2C5LC 1NDDA 1WXSA 3T8MA 1WF9A 5TR5A 3H7PB 2GOWA 4W9DA 3OLMD 3DBHI 3P2BA 4IM3A 4XZ4A 2JZ3B 1WZ3A 3QX1A 1P0RA 2KKCA 2OOBB 4E74A 1CMXB 4IWPA 3U30A 4WWOA 1WGYA 3EC8A 1GC7A 3W1YA 4FADA 3RCZA 2MWSB 2K1FA 3HIZA 3QA8A 4DWFA 4BFRA 3RULA 4EEWA 3SHQA 2MBBB 3H6NA 4BBNF 4OVVA 3ZIMA 4M0WB 2LZ6A 2WX0A 2FAZA 3APDA 1V6EA 1LM8B 2DZMA 3EECA 4DHJB 2AL6A 2ZNVB 3L10B 3VDZA 4BKSA 1UELA 2KMCA 3TCAA 1OGWA 2DX5B 1RLFA 1E8WA 3QC8B 1E7VA 4MJSA 1RRBA 2JF5A 3H1UA 4W9HA 1UBIA 4JIOU 2XK5A 2O6VD 2O6VB 2MRPA 1YD8U 1WI0A 4IM2A 1WJUA 2ZEQA 4P7IA 4XX5A 3ZLZA 2J0JA 2JXXA 3A4SC 3KUZA 3JVZX 3ZDMC 4DHZB 4II3B 1T0YA 4WWNA 2Y5BB 2IBIB 2YVCA 2REXA 2DZIA 1WJ4A 1X1MA 3KYDD 3QQ8B 1RFAA 1KLVA 3W1SA 2KX3A 3L13A 4K81A 2GBMA 2Z59B 3K9PB 3Q3JA 2BKFA 3QJZA 4DK5A 1L7YA 2BYVE 3ZTCA 3D32A 4NY0A 2N9XA 4BKGA 3PHWB 3IFWB 1GJZA 1I42A 1LFDA 3B08A 3UQBA 1V2YA 1YIWA 2NPTB 1Q5WB 3CSFA 3AXCA 3CMMB 2FCNA 4ZYNA 4DDID 4FN2A 1A5RA 1OTRB 2IZVB 2V4LA 4TKNA 5FR6A 3GOEA 2MX2A 1SE9A 2GMIC 2KLCA 4JQWC 1V86A 2WYQA 5CHVC 2KWVB 4FA6A 4HWIB 2ZVNA 1R4MI 2LD9A 1EO6A 2YLMA 3NS8A 5DPSA 2K39A 3PS6A 2WX1A 2N9EB 1WYWB 1ZGUB 2LUEA 4HPLB 4IG7B 4HLEA 5IA7A 2XBBC 2K8HA 4IWQA 5DPRA 3UF8A 3VVWB 4IUMB 4G50A 3ZNGC 3SD5A 5JZEB 3ZTDA 4HDOA 5D94A 3ZNID 2CS4A 3TBLD 3VQIA 1FXTB 3IBEA 4NNJB 2LRWA 3DVGY 1NBFC 3NHEB 2VRRB 2N4FA 2L0FA 4G11A 4AJYB 5E6OA 3SU8X 1YQBA 3DCGA 4WJOA 2OJRA 3UIOB 4ICUA 4HK2A 4W9CA 3PV1A 1P98A 1UGMA 3R3MA 4FLHA 4RM9A 2XEWA 1OEYJ 1WY8A 1WGDA 4GMVA 4K7WA 1ZKHA 2L3ZA 5CX3A 3L17A 4I6LB 2PEAA 4ASWC 2O6VA 4M8MA 3VH4B 1EF1A 3WANA 4WQOB 4ZDVA 5JHAA 2D3GA 2DZJA 4X57B 4PS3A 2LXCA 2IO0B 1UBQA 2J7QB 3HK0A 2ZPNA 4PS7A 4W9JA 1VD2A 2FIFA 1TZ1A 3A33B 3AU5A 1V9JA 2EKEC 4JL9A 5CHFA 1IPGA 5G55A 3PREA 3A9JA 2KVRA 1P3QU 1SIFA 3V60A 2K8CA 4W9FA 3AU4A 3PZDA 2CKHB 5D2MB 1WIAA 5EDSA 2N1VA 2NR2A 3PGEA 2LVOA 2BF8B 4I6NB 3NZUA 4MSQB 3DVGX 2R2OA 2KO3A 4FJYA 4XC2A 1R4NI 4E3CA 5J17A 1L2NA 1WE7A 2XK5B 3I3TB 3S2AA 2KLGA 2MA9B 5KHOA 1Q0WB 3MHSD 3NY5A 2G45B 1J0GA 2KANA 4BKSD 1P9DU 3M62B 5LXIB 1V80A 2DZKA 2O2VB 3L16A 2KWUB 4B9KA 4ANWA 1H8CA 2KDEB 3MJWA 3A1QA 3EHVA 4TV3A 4IC7B 2FIDA 4FHJA 3PLUA 2KTFA 3ZRCA 3VFKA 1E8YA 3NZSA 3QK0A 3WALA 2LXAA 5HKHA 4MELA 2MP2B 3KUCB 4WWPA 2AL3A 3DVNV 2KOXA 2NS5A 4PS8A 2KFJA 2RPQA 3ZNZB 2CU1A 4GDKA 4GDLA 3VUXA 1WXMA 3LJ3A 2KDBA 1WXVA 5JHBA 4LDTD 4AUQC 2IYDB 2A4ZA 2C60A 2M1MA 3HM3A 3TL5A 2IY0B 3R7QA 3AULA 1Z5SB 4GDKB 2LJ5A 3DPDA 3M95A 2K8BA 1WX9A 3WAOA 4IM0A 1H4RA 5L95C 2D11A 2GBJA 4ZRKA 3RUIB 2QHOA 1EF5A 2KFKB 3N3KB 3VXWA 3V6CB 3ECIA 4DXAB 4B6WA 3DBLI 1Q1OA 3VTVA 2DHZA 4W9LA 3EFUA 3PTFC 3IG3A 2MBHA 4W9KA 4MSMB 4DHZE 1Z2MA 4DBGA 2KC1A 2FNJB 2JRHA 3CSTA 4WJPA 2GBRA 4MJSB 2PJHA 3ZO5B 1U4AA 1JRUA 4KZCA 2JWZA 2L00B 2FCSA 3BY4B 1SGHA 4WAAA 3QAQA 1WJNA 2DYBA 1WMHB 2NBUA 2Z0EB 2FCQA 4LJOB 1WE6A 3DVNU 2KC2A 4HCPB 2JRIB 1E8ZA 4K7UA 2KNBA 4FJZA 2ZVOA 4K1RB 2L0TA 4II2B 1BT0A 3A9JB 3O65B 1ZW7A 5DPWA 5AZFA 2RD0A 4GDLB 3JYUA 1IP9A 1V5OA 3DOWA 1WJ6A 3HHMA 5KHQA 5AZGA 2I1JA 4NJ6A 1NI2A 3ML9A 3Q3FA 2KHWB 2KDIA 1EUVB 1WX8A 3L54A 2LASA 5C1ZA 3VHTC 4KV2A 2L7RA 2M8SA 1WR1A 2W9NA 3OAWA 4TQ0A 2KXJA 1GNUA 4MGZE 3VTWA 1E7UA 4KIKA 1KOTA 3PLVA 3X23A 3A4RA 4LCDE 2KZRA 2NCNA 3JSVA 4OVUA 2MCNB 2HE7A 4HPMB 4GOCA 1WXAA 2L76A 4GGQA 4LJPB 3U7DA 3V62A 3UQAA 4EUTA 2C9WB 3OJ3A 1PQSA 2BKRB 1TBEA 2DAFA 4F1SA 2IO2B 2A5UA 5D7GA 4EZJA 2EMSA 4K7SA 4PYZA 2KK8A 3PRMB 2ZNVC 1WR6E 5AEKB 3ZUNA 2N7EA 3R66C 4EOYA 1E5WA 3H9DA 4NQKE 2LGDA 3L0WB 3PT2B 5L83A 4GSWA 2DYMA 4FHKA 4EFOA 3HM6X 1GC6A 1RAXA 2KQSA 4ZRIA 2K25A 4AP4C 3C0RB 4KVGB 3TJPA 1C3TA 1WX7A 3TMPB 5BO4B 1GUAB 4WJQA 1VCBA 3ALBA 3DDCB 4W9IA 2BGFA 2L8JA 2M17A 1WM2A 1K8RB 1WM3A 4I6PA 4HVBA 2NBVB 3PVLA 3H7PA 4MDKE 5G2NA 2ZCCA 1LXDA 2ZJDA 3L08A 3LDZE 4IW0A 4BKTA 4GU2A 1V81A 1TTNA 4WJNA 4JLCA 2K6QA 1E8XA 1MG8A 2AEHA 3M63B 5E6NA 3V6EB 1XT9B 4JGHB 1S1QB 4GXBA 2IY1B 4N9F4 3VH3B 3X0WA 4A3PA 2G3QB 4CO7A 1TGZB 4G0NB 3KUDB 3M3JA 2MBQA 4BBNC 5JH5C 1QZEA 5CTRC 4LDTB 2PE6B 4F7ZA 4HDQA 3JW0X 1WZ0A 2WDTB 5AZHA 4AOFA 3QWZB 3UINB 4F8CB 1UD7A 4B95A 2MW5A 2KJ6A 1XD3B 3N30A 2KN5A 1P1AA 4URKA 2LWPA 4TQ1A 1OEYA 2M0XA 3RZWC 3A1QB 3ML8A 3ZKJC 2RR9A 2UYZB 2WWZA 3CF6E 2HJ8A 1WGRA 3DBSA 2UWQA 2KWCA 4HJKA 1YJ1A 3MTNB 4FULA 1I35A 2JY6A 2AWTA 3IVFA 3UIPB 4ANVA 4MH0E 1G6JA 5J18A 2LRUA 2HD5B 3PHXB 1IYFA 1D3ZA 2D10A 2G4SA 4A3OA 2KTRB 2KX0A 2D2QA 3B0AA 3KH0A 2MLBA 2MQJA 2V1YA 2NBWB 2IO3B 2KD0A 2FCMA 4PYUA 2NPTA 3KYCD 2AYOB 4MM3A 5C23A 3W1SC 4E71A 2JT4B 2LVQA 3ZNHB 4FBJB 2L05A 4ICVA 1Y8RC 1F9JA 4CYEA 2HTHA 2R2QA 3WAMA 2CHWA 2LI5A 2PE9A 3APFA 4BVUC 2KMAA 3KW5B 4MGIE 1HE8A 3ZW3A 4EZLA 3WIMA 4HCNB 3R7RA 3UGBB 2KQ7A 1S3SG 4KIKB 2LVPA 4RM8A 4A20A 5D6JB 3AI5A 4EKUA 2RGFA 5E6PA 2RSUA 2CR5A 4W9EA 4HXDA 2BWFA 2JVCA 2J0KA 2MBOA 4NPNA 4GB9A 2Z0DB 4AJWA 2MP2A 2M4NA 2N1WA 4GIVA 1LQBA 2LGYA 2ZZPB 1V49A 3B1LX 2D07B 2CHXA 3RT3B 2ZPYA 4J6IA 4KDLB 2N9PC 3WA0A 1V5TA 1WMHA 4NJ7A 4EZKA 1XQQA 3KVFB 1AARA 2ASQA 3ONSA 3PRZA 3PPAA 3QCAA 3NOBA 4NAWA 2BPSA 3SDLC 3IHPC 4ANUA 3VUWA 4MEMA 5DPTA 2MSED 1WGHA 2BYEA 2C7MB 2C7NB 2BWES 1J19A 3RZFA 1YX6B 5J2RA 4DHJD 3PSEB 3WAPA 2CHZA 3A9KB 3DQVA 2KFKA 3ZDTA 4KDIC 4ZRJA 5GMVA 3K9OB 2DENB 5DCNA 3APCA 2EMTA 3BINA 3JSVB 4MGYE 1GG3A 3QHTA 3VTUA 1C1YB 1ISNA 2B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGK E;  3TIX A;  4RMA A;  2GBN A;  3T9L A;  2JZZ A;  4ANX A;  3VUY A;  2ZCB A;  4BOZ B;  2V3S A;  1WFY A;  4KSK C;  2DYO A;  4IWO A;  2LGX A;  2N7D A;  2JUO A;  2PPH A;  4KSL C;  4YL8 A;  1WGG A;  4M8N A;  2J0M A;  3RYT A;  5IAA C;  2KDF B;  1WRD B;  4BOS C;  3DBR I;  4G3X B;  2KJH B;  2G4D B;  3GZN I;  4CHK A;  3ZVV A;  2BYF A;  2K6D B;  3ZRF A;  3V61 A;  1YX5 B;  1WH3 A;  1UH6 A;  1KM7 A;  2O2V A;  3N32 A;  2KTR A;  1M94 A;  2IO1 B;  2FUH B;  3QIJ A;  4W9G A;  4NQL B;  3VAW A;  4KZ0 A;  4DDG D;  4GN1 A;  2KJR A;  4NAW B;  2JPH A;  2MBE A;  1OQY A;  2NVU I;  3OJ4 B;  5LLI A;  3RD2 A;  3QAR A;  4FJV B;  3H7S A;  5LXH A;  2DAJ A;  3ENE A;  1E90 A;  2C7H A;  3PRP B;  4TUU A;  1KJT A;  1UZX B;  2I1K A;  3A9K A;  3U8Z A;  4AWJ A;  1J8C A;  5CHW A;  2GBK A;  2C5L C;  1NDD A;  1WXS A;  3T8M A;  1WF9 A;  5TR5 A;  3H7P B;  2GOW A;  4W9D A;  3OLM D;  3DBH I;  3P2B A;  4IM3 A;  4XZ4 A;  2JZ3 B;  1WZ3 A;  3QX1 A;  1P0R A;  2KKC A;  2OOB B;  4E74 A;  1CMX B;  4IWP A;  3U30 A;  4WWO A;  1WGY A;  3EC8 A;  1GC7 A;  3W1Y A;  4FAD A;  3RCZ A;  2MWS B;  2K1F A;  3HIZ A;  3QA8 A;  4DWF A;  4BFR A;  3RUL A;  4EEW A;  3SHQ A;  2MBB B;  3H6N A;  4BBN F;  4OVV A;  3ZIM A;  4M0W B;  2LZ6 A;  2WX0 A;  2FAZ A;  3APD A;  1V6E A;  1LM8 B;  2DZM A;  3EEC A;  4DHJ B;  2AL6 A;  2ZNV B;  3L10 B;  3VDZ A;  4BKS A;  1UEL A;  2KMC A;  3TCA A;  1OGW A;  2DX5 B;  1RLF A;  1E8W A;  3QC8 B;  1E7V A;  4MJS A;  1RRB A;  2JF5 A;  3H1U A;  4W9H A;  1UBI A;  4JIO U;  2XK5 A;  2O6V D;  2O6V B;  2MRP A;  1YD8 U;  1WI0 A;  4IM2 A;  1WJU A;  2ZEQ A;  4P7I A;  4XX5 A;  3ZLZ A;  2J0J A;  2JXX A;  3A4S C;  3KUZ A;  3JVZ X;  3ZDM C;  4DHZ B;  4II3 B;  1T0Y A;  4WWN A;  2Y5B B;  2IBI B;  2YVC A;  2REX A;  2DZI A;  1WJ4 A;  1X1M A;  3KYD D;  3QQ8 B;  1RFA A;  1KLV A;  3W1S A;  2KX3 A;  3L13 A;  4K81 A;  2GBM A;  2Z59 B;  3K9P B;  3Q3J A;  2BKF A;  3QJZ A;  4DK5 A;  1L7Y A;  2BYV E;  3ZTC A;  3D32 A;  4NY0 A;  2N9X A;  4BKG A;  3PHW B;  3IFW B;  1GJZ A;  1I42 A;  1LFD A;  3B08 A;  3UQB A;  1V2Y A;  1YIW A;  2NPT B;  1Q5W B;  3CSF A;  3AXC A;  3CMM B;  2FCN A;  4ZYN A;  4DDI D;  4FN2 A;  1A5R A;  1OTR B;  2IZV B;  2V4L A;  4TKN A;  5FR6 A;  3GOE A;  2MX2 A;  1SE9 A;  2GMI C;  2KLC A;  4JQW C;  1V86 A;  2WYQ A;  5CHV C;  2KWV B;  4FA6 A;  4HWI B;  2ZVN A;  1R4M I;  2LD9 A;  1EO6 A;  2YLM A;  3NS8 A;  5DPS A;  2K39 A;  3PS6 A;  2WX1 A;  2N9E B;  1WYW B;  1ZGU B;  2LUE A;  4HPL B;  4IG7 B;  4HLE A;  5IA7 A;  2XBB C;  2K8H A;  4IWQ A;  5DPR A;  3UF8 A;  3VVW B;  4IUM B;  4G50 A;  3ZNG C;  3SD5 A;  5JZE B;  3ZTD A;  4HDO A;  5D94 A;  3ZNI D;  2CS4 A;  3TBL D;  3VQI A;  1FXT B;  3IBE A;  4NNJ B;  2LRW A;  3DVG Y;  1NBF C;  3NHE B;  2VRR B;  2N4F A;  2L0F A;  4G11 A;  4AJY B;  5E6O A;  3SU8 X;  1YQB A;  3DCG A;  4WJO A;  2OJR A;  3UIO B;  4ICU A;  4HK2 A;  4W9C A;  3PV1 A;  1P98 A;  1UGM A;  3R3M A;  4FLH A;  4RM9 A;  2XEW A;  1OEY J;  1WY8 A;  1WGD A;  4GMV A;  4K7W A;  1ZKH A;  2L3Z A;  5CX3 A;  3L17 A;  4I6L B;  2PEA A;  4ASW C;  2O6V A;  4M8M A;  3VH4 B;  1EF1 A;  3WAN A;  4WQO B;  4ZDV A;  5JHA A;  2D3G A;  2DZJ A;  4X57 B;  4PS3 A;  2LXC A;  2IO0 B;  1UBQ A;  2J7Q B;  3HK0 A;  2ZPN A;  4PS7 A;  4W9J A;  1VD2 A;  2FIF A;  1TZ1 A;  3A33 B;  3AU5 A;  1V9J A;  2EKE C;  4JL9 A;  5CHF A;  1IPG A;  5G55 A;  3PRE A;  3A9J A;  2KVR A;  1P3Q U;  1SIF A;  3V60 A;  2K8C A;  4W9F A;  3AU4 A;  3PZD A;  2CKH B;  5D2M B;  1WIA A;  5EDS A;  2N1V A;  2NR2 A;  3PGE A;  2LVO A;  2BF8 B;  4I6N B;  3NZU A;  4MSQ B;  3DVG X;  2R2O A;  2KO3 A;  4FJY A;  4XC2 A;  1R4N I;  4E3C A;  5J17 A;  1L2N A;  1WE7 A;  2XK5 B;  3I3T B;  3S2A A;  2KLG A;  2MA9 B;  5KHO A;  1Q0W B;  3MHS D;  3NY5 A;  2G45 B;  1J0G A;  2KAN A;  4BKS D;  1P9D U;  3M62 B;  5LXI B;  1V80 A;  2DZK A;  2O2V B;  3L16 A;  2KWU B;  4B9K A;  4ANW A;  1H8C A;  2KDE B;  3MJW A;  3A1Q A;  3EHV A;  4TV3 A;  4IC7 B;  2FID A;  4FHJ A;  3PLU A;  2KTF A;  3ZRC A;  3VFK A;  1E8Y A;  3NZS A;  3QK0 A;  3WAL A;  2LXA A;  5HKH A;  4MEL A;  2MP2 B;  3KUC B;  4WWP A;  2AL3 A;  3DVN V;  2KOX A;  2NS5 A;  4PS8 A;  2KFJ A;  2RPQ A;  3ZNZ B;  2CU1 A;  4GDK A;  4GDL A;  3VUX A;  1WXM A;  3LJ3 A;  2KDB A;  1WXV A;  5JHB A;  4LDT D;  4AUQ C;  2IYD B;  2A4Z A;  2C60 A;  2M1M A;  3HM3 A;  3TL5 A;  2IY0 B;  3R7Q A;  3AUL A;  1Z5S B;  4GDK B;  2LJ5 A;  3DPD A;  3M95 A;  2K8B A;  1WX9 A;  3WAO A;  4IM0 A;  1H4R A;  5L95 C;  2D11 A;  2GBJ A;  4ZRK A;  3RUI B;  2QHO A;  1EF5 A;  2KFK B;  3N3K B;  3VXW A;  3V6C B;  3ECI A;  4DXA B;  4B6W A;  3DBL I;  1Q1O A;  3VTV A;  2DHZ A;  4W9L A;  3EFU A;  3PTF C;  3IG3 A;  2MBH A;  4W9K A;  4MSM B;  4DHZ E;  1Z2M A;  4DBG A;  2KC1 A;  2FNJ B;  2JRH A;  3CST A;  4WJP A;  2GBR A;  4MJS B;  2PJH A;  3ZO5 B;  1U4A A;  1JRU A;  4KZC A;  2JWZ A;  2L00 B;  2FCS A;  3BY4 B;  1SGH A;  4WAA A;  3QAQ A;  1WJN A;  2DYB A;  1WMH B;  2NBU A;  2Z0E B;  2FCQ A;  4LJO B;  1WE6 A;  3DVN U;  2KC2 A;  4HCP B;  2JRI B;  1E8Z A;  4K7U A;  2KNB A;  4FJZ A;  2ZVO A;  4K1R B;  2L0T A;  4II2 B;  1BT0 A;  3A9J B;  3O65 B;  1ZW7 A;  5DPW A;  5AZF A;  2RD0 A;  4GDL B;  3JYU A;  1IP9 A;  1V5O A;  3DOW A;  1WJ6 A;  3HHM A;  5KHQ A;  5AZG A;  2I1J A;  4NJ6 A;  1NI2 A;  3ML9 A;  3Q3F A;  2KHW B;  2KDI A;  1EUV B;  1WX8 A;  3L54 A;  2LAS A;  5C1Z A;  3VHT C;  4KV2 A;  2L7R A;  2M8S A;  1WR1 A;  2W9N A;  3OAW A;  4TQ0 A;  2KXJ A;  1GNU A;  4MGZ E;  3VTW A;  1E7U A;  4KIK A;  1KOT A;  3PLV A;  3X23 A;  3A4R A;  4LCD E;  2KZR A;  2NCN A;  3JSV A;  4OVU A;  2MCN B;  2HE7 A;  4HPM B;  4GOC A;  1WXA A;  2L76 A;  4GGQ A;  4LJP B;  3U7D A;  3V62 A;  3UQA A;  4EUT A;  2C9W B;  3OJ3 A;  1PQS A;  2BKR B;  1TBE A;  2DAF A;  4F1S A;  2IO2 B;  2A5U A;  5D7G A;  4EZJ A;  2EMS A;  4K7S A;  4PYZ A;  2KK8 A;  3PRM B;  2ZNV C;  1WR6 E;  5AEK B;  3ZUN A;  2N7E A;  3R66 C;  4EOY A;  1E5W A;  3H9D A;  4NQK E;  2LGD A;  3L0W B;  3PT2 B;  5L83 A;  4GSW A;  2DYM A;  4FHK A;  4EFO A;  3HM6 X;  1GC6 A;  1RAX A;  2KQS A;  4ZRI A;  2K25 A;  4AP4 C;  3C0R B;  4KVG B;  3TJP A;  1C3T A;  1WX7 A;  3TMP B;  5BO4 B;  1GUA B;  4WJQ A;  1VCB A;  3ALB A;  3DDC B;  4W9I A;  2BGF A;  2L8J A;  2M17 A;  1WM2 A;  1K8R B;  1WM3 A;  4I6P A;  4HVB A;  2NBV B;  3PVL A;  3H7P A;  4MDK E;  5G2N A;  2ZCC A;  1LXD A;  2ZJD A;  3L08 A;  3LDZ E;  4IW0 A;  4BKT A;  4GU2 A;  1V81 A;  1TTN A;  4WJN A;  4JLC A;  2K6Q A;  1E8X A;  1MG8 A;  2AEH A;  3M63 B;  5E6N A;  3V6E B;  1XT9 B;  4JGH B;  1S1Q B;  4GXB A;  2IY1 B;  4N9F 4;  3VH3 B;  3X0W A;  4A3P A;  2G3Q B;  4CO7 A;  1TGZ B;  4G0N B;  3KUD B;  3M3J A;  2MBQ A;  4BBN C;  5JH5 C;  1QZE A;  5CTR C;  4LDT B;  2PE6 B;  4F7Z A;  4HDQ A;  3JW0 X;  1WZ0 A;  2WDT B;  5AZH A;  4AOF A;  3QWZ B;  3UIN B;  4F8C B;  1UD7 A;  4B95 A;  2MW5 A;  2KJ6 A;  1XD3 B;  3N30 A;  2KN5 A;  1P1A A;  4URK A;  2LWP A;  4TQ1 A;  1OEY A;  2M0X A;  3RZW C;  3A1Q B;  3ML8 A;  3ZKJ C;  2RR9 A;  2UYZ B;  2WWZ A;  3CF6 E;  2HJ8 A;  1WGR A;  3DBS A;  2UWQ A;  2KWC A;  4HJK A;  1YJ1 A;  3MTN B;  4FUL A;  1I35 A;  2JY6 A;  2AWT A;  3IVF A;  3UIP B;  4ANV A;  4MH0 E;  1G6J A;  5J18 A;  2LRU A;  2HD5 B;  3PHX B;  1IYF A;  1D3Z A;  2D10 A;  2G4S A;  4A3O A;  2KTR B;  2KX0 A;  2D2Q A;  3B0A A;  3KH0 A;  2MLB A;  2MQJ A;  2V1Y A;  2NBW B;  2IO3 B;  2KD0 A;  2FCM A;  4PYU A;  2NPT A;  3KYC D;  2AYO B;  4MM3 A;  5C23 A;  3W1S C;  4E71 A;  2JT4 B;  2LVQ A;  3ZNH B;  4FBJ B;  2L05 A;  4ICV A;  1Y8R C;  1F9J A;  4CYE A;  2HTH A;  2R2Q A;  3WAM A;  2CHW A;  2LI5 A;  2PE9 A;  3APF A;  4BVU C;  2KMA A;  3KW5 B;  4MGI E;  1HE8 A;  3ZW3 A;  4EZL A;  3WIM A;  4HCN B;  3R7R A;  3UGB B;  2KQ7 A;  1S3S G;  4KIK B;  2LVP A;  4RM8 A;  4A20 A;  5D6J B;  3AI5 A;  4EKU A;  2RGF A;  5E6P A;  2RSU A;  2CR5 A;  4W9E A;  4HXD A;  2BWF A;  2JVC A;  2J0K A;  2MBO A;  4NPN A;  4GB9 A;  2Z0D B;  4AJW A;  2MP2 A;  2M4N A;  2N1W A;  4GIV A;  1LQB A;  2LGY A;  2ZZP B;  1V49 A;  3B1L X;  2D07 B;  2CHX A;  3RT3 B;  2ZPY A;  4J6I A;  4KDL B;  2N9P C;  3WA0 A;  1V5T A;  1WMH A;  4NJ7 A;  4EZK A;  1XQQ A;  3KVF B;  1AAR A;  2ASQ A;  3ONS A;  3PRZ A;  3PPA A;  3QCA A;  3NOB A;  4NAW A;  2BPS A;  3SDL C;  3IHP C;  4ANU A;  3VUW A;  4MEM A;  5DPT A;  2MSE D;  1WGH A;  2BYE A;  2C7M B;  2C7N B;  2BWE S;  1J19 A;  3RZF A;  1YX6 B;  5J2R A;  4DHJ D;  3PSE B;  3WAP A;  2CHZ A;  3A9K B;  3DQV A;  2KFK A;  3ZDT A;  4KDI C;  4ZRJ A;  5GMV A;  3K9O B;  2DEN B;  5DCN A;  3APC A;  2EMT A;  3BIN A;  3JSV B;  4MGY E;  1GG3 A;  3QHT A;  3VTU A;  1C1Y B;  1ISN A;  2B3A A; 
#chains in the Genus database with same CATH topology
 1XEE A;  1YQ4 B;  2GBN A;  2RDB C;  3VUY A;  4BOZ B;  2V3S A;  2JU6 X;  3BWU D;  2WDR B;  2JUO A;  3NRZ A;  3E9S A;  2J0M A;  4BOS C;  4G3X B;  4J3O D;  2G4D B;  3ZVV A;  2K6D B;  1M94 A;  1TKG A;  1V8C A;  4KZ0 A;  4GN1 A;  2KJR A;  5LLI A;  1NEK B;  3Q2A C;  2I1K A;  4KKJ A;  4YT0 B;  2C5L C;  2J4X A;  3T8M A;  5TR5 A;  1TY2 A;  2GOW A;  4LNK A;  3DBH I;  3P2B A;  4IM3 A;  4A55 A;  2JZ3 B;  1P0R A;  1CMX B;  4WWO A;  3EC8 A;  1GC7 A;  3W1Y A;  2MWS B;  3HIZ A;  4BFR A;  4BBN F;  1QKZ A;  4OVV A;  3RN9 C;  2GI9 A;  2M19 A;  3BII D;  1SE3 A;  1V6E A;  3B2F A;  4IKG A;  4BKS A;  1RLF A;  1PGB A;  4MJS A;  3H1U A;  2LEK A;  3CWI A;  4W9H A;  1TIF A;  2XK5 A;  3H8H A;  3AE5 B;  1WI0 A;  2QJL A;  1MHX A;  2FE8 A;  4YTP B;  3LYY A;  4WWN A;  3AE3 B;  3KYD D;  3DBR B;  3W1S A;  4K81 A;  3K9P B;  1JQ4 A;  3SFD B;  4RCO A;  1L7Y A;  4DK5 A;  4NY0 A;  2N9X A;  4WAF A;  4XE0 A;  4BKG A;  1STE A;  1I42 A;  1V2Y A;  3AXC A;  1VZ7 A;  2Q5W D;  4DDI D;  3GOE A;  3KWV A;  2GMI C;  3HUI A;  4JQW C;  2ZVN A;  3GE3 C;  2E3T A;  3RNC C;  2DBY A;  4HPL B;  1WYW B;  4IG7 B;  1GPX A;  4HLE A;  5IA7 A;  4IWQ A;  5DPR A;  3ZNG C;  3E56 A;  1XLN A;  3ZTD A;  2K5P A;  5IN7 A;  4R3D A;  2VRR B;  3Q8E A;  1VDV A;  2N4F A;  2L0F A;  4G11 A;  4AJY B;  3SU8 X;  3DCG A;  4ICU A;  4W9C A;  2EKI A;  1UGM A;  3AEE B;  3P63 A;  3TSS A;  4NJC A;  3R3M A;  5BYQ A;  2PEA A;  2O6V A;  4M8M A;  4KGR A;  2QMT A;  4OVZ A;  1EF1 A;  5JHA A;  2DZJ A;  1AW7 A;  1RM6 C;  1TZ1 A;  3NVW A;  1V9J A;  2EKE C;  4JL9 A;  1OFF A;  2PVG C;  4W9F A;  3AU4 A;  5D2M B;  1AWD A;  1WIA A;  2IND C;  3EA6 A;  2AQ3 B;  1YJJ A;  3NVZ A;  3DVG X;  4FJY A;  4HKQ A;  1L2N A;  4E3C A;  1R4N I;  4L23 A;  1WE7 A;  1XCQ L;  2XK5 B;  3S2A A;  2KLG A;  2HTM E;  3NY5 A;  2G45 B;  2IJ0 A;  4BKS D;  3M62 B;  5LXI B;  2O2V B;  2LHE A;  1XXG A;  1UNS A;  4ANW A;  1C76 A;  3MJW A;  4IC7 B;  2KTF A;  2DLB A;  1DOX A;  4MEL A;  3LB8 C;  3KUC B;  4WWP A;  1WWT A;  2KFJ A;  2RPQ A;  1F2R C;  1P7E A;  5IKC M;  3TL5 A;  2NTS A;  3R7Q A;  3KQ4 A;  1JWS D;  2RPV A;  4GDK B;  2ONQ A;  3DPD A;  5I4D A;  1WX9 A;  3WAO A;  1L6V A;  2WHI A;  4ZRK A;  3RUI B;  1EF5 A;  3V6C B;  2WXR A;  3DBL I;  5C3J B;  4W9L A;  2K22 A;  4QAY A;  3EFU A;  3PTF C;  2MBH A;  4WJP A;  1FIQ A;  4MJS B;  1JRU A;  2JWZ A;  3W5U B;  3DWG C;  3BY4 B;  1SGH A;  4WAA A;  3QAQ A;  4XDC A;  2FCQ A;  1WE6 A;  1E8Z A;  2KNB A;  2KQ4 X;  4FJZ A;  2W3R A;  5DPW A;  1ZW7 A;  1QOF A;  2QIE B;  4JPS A;  5AZF A;  2RD0 A;  1T0Q C;  3JYU A;  3RNB C;  1SIJ A;  2KDI A;  1EUV B;  4ARC A;  2V4I B;  2ICI A;  2MJ3 A;  2L7R A;  3FIL A;  1WR1 A;  4S17 A;  2W9N A;  4MGZ E;  2KT7 A;  3A4R A;  4LCD E;  4C7Y A;  3AE7 B;  2LFI A;  3RNG C;  2KAJ A;  3IXS A;  1PYW D;  1WXA A;  1TZO A;  3V62 A;  4K3B A;  2DAF A;  2IO2 B;  2A5U A;  4EZJ A;  2LJI A;  1SEB D;  3FAH A;  3ZUN A;  3Q3N C;  4EOY A;  2L52 A;  4MAC A;  2LGD A;  5L83 A;  4GSW A;  4B0M A;  1RAX A;  2KQS A;  3C0R B;  4KVG B;  3TJP A;  1KF6 B;  1WX7 A;  2VH2 A;  1GUA B;  3BVG A;  2IDY A;  1VCB A;  3ALB A;  4ZYS A;  3N20 C;  5G2N A;  1SE2 A;  1SB3 C;  2ZJD A;  2AQ2 B;  3L08 A;  3V3X A;  3WCQ A;  1HZ6 A;  4IW0 A;  4GU2 A;  3TEW A;  1V81 A;  4B0E A;  4JLC A;  1E8X A;  1E7P B;  2FBW B;  1TGZ B;  3FC4 A;  3KLS X;  3M3J A;  2MBQ A;  3AE4 B;  2WDQ B;  1FCC C;  3UIN B;  4F8C B;  3N30 A;  4URK A;  4TQ1 A;  3RZW C;  3ML8 A;  4ARI A;  3ZKJ C;  2RR9 A;  2LGI A;  1I4G A;  3CF6 E;  2BS4 B;  1QIL A;  3AN1 A;  4FUL A;  3MTN B;  4ANV A;  3UIP B;  4XGA B;  5E6J A;  5J18 A;  1ZDX A;  1FFU A;  5H92 C;  2D10 A;  4A3O A;  2KTR B;  2NBW B;  5FKA C;  4MM3 A;  1XLO A;  2YEP F;  2OHF A;  3WAM A;  1LGR A;  1HE8 A;  1S3S G;  2Z8L A;  1YNT E;  2MBO A;  4AJW A;  2N1W A;  2LGY A;  1YN5 A;  2CHX A;  2ZPY A;  1V5T A;  4EZK A;  4NJ7 A;  1AAR A;  3PPA A;  1N6Z A;  4NAW A;  3IHP C;  4MEM A;  1AN8 A;  5DPT A;  2BWE S;  1J19 A;  2V3N A;  3PSE B;  4NZL B;  2JZP A;  3DQV A;  2J52 A;  4KDI C;  3K9O B;  2N9K A;  4HKZ E;  4MGY E;  3QHT A;  1BUI C;  4FA6 A;  3U2S C;  1ISN A;  1HTQ A;  1XCT L;  3T9L A;  2ZCB A;  3RNF C;  2BW2 A;  1YN4 A;  4KSL C;  4YL8 A;  1TYG B;  2N9L A;  2WXM A;  4M8N A;  3RYT A;  2PIA A;  2D5G A;  1UH6 A;  1KM7 A;  3TCA A;  2FUH B;  1ZDV A;  4KKI A;  4C4V A;  2JPH A;  3RD2 A;  3QAR A;  4MH8 A;  1E90 A;  1KJT A;  3A9K A;  3AV8 A;  3N1Y C;  3U8Z A;  5CHW A;  1KRH A;  1NDD A;  1B1Z A;  1WXS A;  1I4Q A;  3URY A;  3H7P B;  4US8 A;  2WXO A;  1E0Z A;  2HJ1 A;  1WGY A;  4FAD A;  2JX5 A;  2K1F A;  4EEW A;  2MBB B;  3OWE B;  4M0W B;  4AS1 A;  2WXK A;  3APD A;  1D4B A;  2DZM A;  4DHJ B;  2AL6 A;  3L10 B;  5IOI A;  2WXQ A;  1A70 A;  1JW9 D;  2KMC A;  1FM0 D;  1PGX A;  1I4P A;  2JF5 A;  1CK1 A;  3MC8 A;  1QT9 A;  4IM2 A;  1WJU A;  2WS3 B;  4P7I A;  4XX5 A;  3ZLZ A;  3MC0 B;  2NMQ A;  2JXX A;  3KUZ A;  4DHZ B;  3JVZ X;  3TEY A;  4C00 A;  1JWB D;  1WSP A;  5TSS A;  4LNN A;  1WJ4 A;  3QQ8 B;  1KLV A;  4BZA A;  2KX3 A;  4WIP A;  3Q3J A;  2BKF A;  3GS2 A;  5G5G A;  1MFW A;  4M01 A;  2VH1 A;  4A8X C;  3PHW B;  1GJZ A;  1LFD A;  3B08 A;  2WGS A;  3Q8C A;  2I2Y A;  1D6E C;  4FN2 A;  1MI0 A;  3GB1 A;  2V4L A;  1I7H A;  3DBL B;  1V86 A;  2DNF A;  4LK0 M;  2OED A;  2M56 B;  2YLM A;  4JE3 B;  3NS8 A;  5DPS A;  2LUE A;  1F1H A;  3BVM A;  2K8H A;  3KWL A;  4IUM B;  5JZE B;  3ZNI D;  3VQI A;  3DVG Y;  1NBF C;  1VJK A;  4OZA A;  3Q14 C;  5E6O A;  1YQB A;  2OJR A;  3MC9 A;  3PV1 A;  1P98 A;  1JWU D;  1IUE A;  4FLH A;  1TKY A;  1WGD A;  3R2I A;  4K7W A;  2L3Z A;  4XYC A;  1M4V A;  3L17 A;  3VH4 B;  4RF1 A;  3WAN A;  4WQO B;  4ZDV A;  4X57 B;  4PS3 A;  3AE2 B;  3AEF B;  2LXC A;  2J7Q B;  3HK0 A;  3UI3 A;  3AE8 B;  2MHJ A;  3A33 B;  5CHF A;  3AEA B;  5G55 A;  2K8C A;  3Q6B A;  1T0R C;  3BVZ A;  1QOA A;  4I6N B;  1PUT A;  3Q8A A;  5J17 A;  3NZ3 A;  3ZXR A;  1JCK B;  2IGD A;  2MA9 B;  4OZB A;  3VR9 B;  2W55 A;  3I57 A;  2KAN A;  3P4Q B;  1L0Y B;  3L16 A;  1ACC A;  1CJE A;  4B9K A;  1C78 A;  1H8C A;  3EHV A;  2FID A;  3ZRC A;  3VFK A;  1E8Y A;  3DVN V;  2KOX A;  4PS8 A;  3ZNZ B;  2DWQ A;  1T0S C;  2CU1 A;  1VRA B;  4GDL A;  3VUX A;  1SJE D;  2IYD B;  4KX6 B;  2RDH A;  3NUH B;  1Y56 A;  2K8B A;  2BTE A;  4IM0 A;  1H4R A;  2QCZ A;  3VXW A;  4DXA B;  5EE9 A;  1Q1O A;  3VTV A;  1GB1 A;  2GLS A;  1YJI A;  3IG3 A;  2KMM A;  4DBG A;  2KC1 A;  2JRH A;  5H8Y E;  1NYR A;  2PJH A;  3O13 A;  2J42 A;  2DYB A;  2Z0E B;  4LJO B;  4OW0 A;  1ZOY B;  2QEJ C;  2WXI A;  3DVN U;  4K7U A;  2PTL A;  2ZVO A;  3P4P B;  1BT0 A;  3O65 B;  3ZJV A;  4LNI A;  1IP9 A;  4JWS C;  1V5O A;  3DOW A;  5LNK 1;  3EFC A;  1XLP A;  5AZG A;  4NJ6 A;  3ML9 A;  1EWC A;  2KHW B;  3BYY B;  4ZHP A;  1WX8 A;  4XDD A;  5C1Z A;  4KV2 A;  2M8S A;  5HG2 A;  2KXJ A;  2WLB A;  5C2T B;  3VTW A;  5GXG B;  2ON8 A;  3RPF C;  1EWY C;  4S0R A;  3JSV A;  2MCN B;  4HPM B;  1FEH A;  4GOC A;  2L76 A;  4LJP B;  4EUT A;  1PQS A;  4JX1 C;  3GP7 A;  4LNF A;  5D7G A;  2KK8 A;  5AEK B;  3DHI C;  1F2R I;  1E5W A;  4NQK E;  3PZ7 A;  4AP4 C;  4JWU C;  1IGC A;  2Y3A A;  3DDC B;  1SXT A;  2M17 A;  1PGA A;  3P1M A;  4MT5 A;  1WM3 A;  2NBV B;  4MDK E;  2ZCC A;  3NS1 A;  3M63 B;  1N62 A;  3AB5 A;  5E6N A;  4WUR A;  1V1O A;  2CJO A;  2IY1 B;  3VH3 B;  1WGK A;  3X0W A;  1UF0 A;  2G3Q B;  4CO7 A;  4WWM A;  2V9H A;  4G0N B;  3KUD B;  3ZJT A;  5JH5 C;  5CTR C;  3ZXV A;  2PE6 B;  3JW0 X;  1WZ0 A;  2JYE A;  5AZH A;  2KJ6 A;  2KN5 A;  1P1A A;  2M0X A;  3A1Q B;  2D3C A;  1ENF A;  2UYZ B;  2HJ8 A;  3I9V 1;  2KWC A;  4HJK A;  1YJ1 A;  2LHD A;  2JY6 A;  2MEK A;  4MH0 E;  2LRU A;  2HD5 B;  5FK9 C;  3PHX B;  4C4V B;  1IYF A;  2G4S A;  1TS2 A;  2D2Q A;  5HI1 A;  2RDG A;  2MQJ A;  2V1Y A;  2IO3 B;  2L1A A;  4ZRP A;  4FBJ B;  1Y8R C;  2WU5 B;  2CU3 A;  2HTH A;  2R2Q A;  2LI5 A;  3APF A;  1NVI D;  3MP9 A;  4MGI E;  4EZL A;  4HCN B;  4PK1 A;  3BZD B;  2KQ7 A;  2LVP A;  4A20 A;  3AI5 A;  4EKU A;  2RGF A;  5E6P A;  4HXD A;  2BWF A;  2JVC A;  2IGG A;  2MP2 A;  1LQB A;  2ZZP B;  1V49 A;  4J6I A;  3SFE B;  2N9P C;  2VZK B;  1WMH A;  1KFY B;  2I38 A;  2W82 A;  2PLP A;  1L6U A;  1FD6 A;  2BPS A;  3VUW A;  3T3N A;  1WGH A;  3U52 E;  2C7N B;  3PZ8 A;  4RNA A;  2MH7 A;  2PKO A;  3Q8F A;  2EEL A;  1FMA D;  1XO3 A;  5DCN A;  1GG3 A;  1F77 A;  1VR9 A;  2B3A A;  1YN3 A;  1YMH E;  4MGK E;  1EU3 A;  1DOY A;  3Q3O C;  1WFY A;  4KSK C;  2DYO A;  4IWO A;  3W2D A;  2N7D A;  1K50 A;  2KDF B;  5BYS A;  1WRD B;  2GB1 A;  3GZN I;  1HXY D;  2BYF A;  1SF0 A;  1YX5 B;  1WH3 A;  3HRD D;  2KTR A;  2IO1 B;  3QIJ A;  2N0S B;  3Q3M C;  4NQL B;  4DDG D;  2SAK A;  1C4P A;  4NAW B;  1KLU D;  2MBE A;  2NVU I;  1MVK A;  4FJV B;  2OJW A;  4TUU A;  4AWJ A;  1J8C A;  2GBK A;  4M0W A;  4W9D A;  3OLM D;  3NVV A;  5D3I B;  1WZ3 A;  2PMV A;  2KKC A;  4E74 A;  2LGS A;  3U30 A;  2JSV X;  3RCZ A;  3QA8 A;  4DWF A;  3SHQ A;  2WP9 B;  1V97 A;  2WXJ A;  4L2Y A;  2LZ6 A;  2WX0 A;  2N7J A;  1GAQ B;  2ZNV B;  1UEL A;  3MHZ A;  2DX5 B;  3QC8 B;  1E7V A;  1JWA D;  1L0X B;  4HRO A;  2O6V B;  4DQO C;  1YD8 U;  2ZEQ A;  3T3O A;  3DBH B;  2J0J A;  3A4S C;  3ZDM C;  4II3 B;  2BB5 A;  5EE3 A;  2Y5B B;  2IBI B;  2YVC A;  2REX A;  1X1M A;  1RFA A;  3DHH C;  2WXN A;  3AMZ A;  3AE9 B;  3ZTC A;  4RGM A;  1FRR A;  2J53 A;  3UQB A;  1FXA A;  1Q5W B;  1JWM D;  1XF5 L;  3CMM B;  4ZYN A;  2Y5C A;  1E9M A;  4TKN A;  5CHV C;  1SSN A;  4OZC A;  1R4N B;  1TS4 A;  1PFD A;  1YOV B;  3Q8B A;  1Q10 A;  4BAX A;  3SD5 A;  2CS4 A;  1FXT B;  5AUK A;  3R8B A;  3NHE B;  3VRA B;  2X8X X;  1EU4 A;  1L4Z B;  4WQM A;  1R4M B;  3IAS 1;  4M00 A;  4ITK A;  1C77 A;  1OEY J;  1WY8 A;  2UU7 A;  1WXQ A;  3AED B;  2D3G A;  2ZPN A;  1VD2 A;  2W3S A;  2FIF A;  4N58 A;  2JXT A;  4YTM B;  3PRE A;  3A9J A;  1P3Q U;  1SIF A;  2KVR A;  1TS5 A;  2CKH B;  4RGN A;  5EDS A;  3TUO A;  1JRO A;  1NYQ A;  4FXC A;  3PGE A;  4DXG A;  3NZU A;  3U7Z A;  4XC2 A;  2R2O A;  2KO3 A;  1IGD A;  3DHG C;  3I3T B;  4H2A A;  1JML A;  3MHS D;  1P9D U;  2BT6 A;  2KWU B;  4KGS A;  3A1Q A;  4TV3 A;  4C80 A;  4FHJ A;  3ETR A;  3PLU A;  1UGJ A;  3WAL A;  2LXA A;  2GRI A;  3BK1 A;  3IT6 B;  1F0Z A;  1ESF A;  2MP2 B;  2NS5 A;  3TEZ A;  4GDK A;  2MJE A;  3RFZ B;  4AUQ C;  2A4Z A;  2C60 A;  1NEN B;  2IY0 B;  3I63 C;  3AUL A;  1Z5S B;  3RI7 C;  1D5Z C;  3M95 A;  5L95 C;  2D11 A;  3AEB B;  2QHO A;  2KFK B;  3N3K B;  3ECI A;  4ZOH C;  1T5X D;  3B9J A;  1K52 A;  4MSM B;  4DHZ E;  1QOB A;  3PO0 A;  1L4D B;  2FNJ B;  3CST A;  1N61 A;  4IOI E;  3ZO5 B;  1U4A A;  4KZC A;  3AH7 A;  2FCS A;  1WJN A;  2M0A A;  2TSS A;  1I4H A;  4HCP B;  1SBB B;  2QSD A;  2L0T A;  3EGR A;  2SEB D;  1B9R A;  3W9C B;  2PVO D;  3IAM 1;  1WJ6 A;  3MJ5 A;  1NI2 A;  1ZPS A;  2LAS A;  2PW9 A;  4TQ0 A;  1GNU A;  1KOT A;  1E7U A;  4KIK A;  2KZR A;  2NCN A;  2L83 A;  5BMH A;  4GGQ A;  3U7D A;  3UQA A;  2C9W B;  2BKR B;  1TBE A;  4F1S A;  3AEC B;  2XN9 C;  4K7S A;  3PRM B;  5T8I A;  2ZNV C;  1WR6 E;  4Q2J A;  1ET6 A;  1N5X A;  2N7E A;  2WQY B;  3MFG A;  4FHK A;  4EFO A;  1GC6 A;  2K25 A;  1OQQ A;  5BO4 B;  2WXL A;  1C4A A;  4W9I A;  2BGF A;  1CQV A;  3H7P A;  4YTN B;  3HVZ A;  3EUB 2;  4AQ7 A;  1DYQ A;  4O1N A;  4WJN A;  3RNA C;  1GOZ A;  2IGH A;  1MG8 A;  4XWT A;  4JGH B;  4YSZ B;  1C4C A;  1S1Q B;  1FNW A;  4N9F 4;  2BQQ A;  4BBN C;  1QZE A;  4LDT B;  1AYF A;  4F7Z A;  4HDQ A;  4AOF A;  2MW5 A;  1XD3 B;  1OEY A;  3DBS A;  3I5J C;  1I35 A;  2AWT A;  1WYG A;  2D3B A;  4K3C A;  4USA A;  1D3Z A;  2G9H D;  3VRB B;  1IBX B;  2KX0 A;  3B0A A;  5BMI A;  4P1B C;  2MLB A;  2WNM A;  2KD0 A;  1DOI A;  4PYU A;  2NPT A;  3KYC D;  5C23 A;  2QIL A;  2JT4 B;  2L05 A;  4ICV A;  1F9J A;  2L32 A;  4BVU C;  1VZ6 A;  3ZW3 A;  2QC8 A;  3R7R A;  4W9E A;  3NVY A;  2J0K A;  4XWW A;  1I4R A;  4KGT A;  2Z0D B;  3ABV B;  1FCL A;  2JWU A;  3L4P A;  2D07 B;  3RT3 B;  1XQQ A;  2INC C;  3KVF B;  3ONS A;  2FUG 1;  2BB6 A;  3DWM A;  3QCA A;  3NOB A;  4RGT A;  2JQR B;  3SDL C;  2X38 A;  2MSE D;  3ZJU A;  2BVC A;  1YX6 B;  4US9 A;  5J2R A;  4REZ A;  4DHJ D;  3WAP A;  1ZUD 2;  2KFK A;  3BK2 A;  4LNO A;  4ZRJ A;  3APC A;  3BIN A;  3NG0 A;  1C1Y B;  1K51 A;  2INP E;  3TIX A;  4RMA A;  4A6Q A;  2JZZ A;  4GLS C;  4ANX A;  4CQN A;  5G5H A;  1SE4 A;  2LGX A;  2PPH A;  2K3U A;  1WGG A;  2KN4 A;  1ZP0 B;  4OHJ A;  5IAA C;  3DBR I;  2KJH B;  4CHK A;  3AE6 B;  3ZRF A;  3V61 A;  2O2V A;  4W9G A;  3N32 A;  3BYT B;  3VAW A;  3OJ4 B;  1OQY A;  3H7S A;  5LXH A;  2DAJ A;  3ENE A;  2C7H A;  3PRP B;  1UZX B;  4LLG M;  2BBC A;  3CIR B;  1WF9 A;  2JYT A;  4XZ4 A;  5MPO A;  1F52 A;  3QX1 A;  2OOB B;  4IWP A;  3ZGZ A;  3V05 A;  1MG4 A;  1MHH E;  1K53 A;  3RUL A;  1RWS A;  4YSX B;  1BML C;  3H6N A;  1J7A A;  5IP4 D;  3ZIM A;  4ZRQ A;  2FAZ A;  1YQ3 B;  1LO5 D;  4MM3 B;  2LUM A;  2BYT A;  1LM8 B;  3EEC A;  3P4R B;  1EM7 A;  3VDZ A;  1OGW A;  1TT5 B;  1E8W A;  1PDX A;  3OG5 A;  1RRB A;  1J7C A;  2WXP A;  1UBI A;  4JIO U;  1T3Q A;  2WXG A;  2O6V D;  2RMM A;  2MRP A;  2IPK D;  1OQR A;  1ZE3 D;  3FKY A;  1T0Y A;  3ZQ4 A;  1N63 A;  2KYW A;  2ZW1 A;  2DZI A;  3L13 A;  2GBM A;  2Z59 B;  3QJZ A;  2BYV E;  3D32 A;  4A9A A;  4YWG G;  3IFW B;  3U4E G;  2MJD A;  1YIW A;  2NPT B;  3CSF A;  1V1P A;  2FCN A;  2INN E;  1UWX A;  1A5R A;  1OTR B;  2IZV B;  5FR6 A;  1QF6 A;  1FPY A;  2MX2 A;  1SE9 A;  1T6B X;  2KLC A;  2KVZ A;  1FNU A;  2WYQ A;  2KWV B;  4HWI B;  1R4M I;  5FR3 A;  2LD9 A;  1EO6 A;  5EE1 A;  2K39 A;  3PS6 A;  2WX1 A;  2N9E B;  1ZGU B;  1MJD A;  4NAM A;  2XBB C;  4HEA 1;  1L5P A;  2NTT A;  3UF8 A;  1HZ5 A;  3VVW B;  4G50 A;  1VLB A;  4HDO A;  5D94 A;  1C9F A;  3TBL D;  5HFY A;  3VR8 B;  3IBE A;  3P4S B;  4NNJ B;  5BMG A;  2LRW A;  1N60 A;  5D3D A;  4WJO A;  3UIO B;  2K0P A;  4HK2 A;  4RM9 A;  1TKE A;  2XEW A;  4GMV A;  1ZKH A;  5CX3 A;  4I6L B;  3C8Y A;  4ASW C;  1FFV A;  1GB4 A;  2IO0 B;  4W9J A;  1UBQ A;  1BXT A;  3C19 A;  4P6V F;  4PS7 A;  3Q69 A;  3AU5 A;  1HTO A;  1IPG A;  2K9X A;  2ZW0 A;  3V60 A;  3PZD A;  2N1V A;  2NR2 A;  2H88 B;  4C56 C;  1RFK A;  2LVO A;  2BF8 B;  1CZP A;  1FRD A;  4MSQ B;  4DXF A;  1RYJ A;  1TS3 A;  4YSY B;  3IT4 B;  1MPE A;  2W54 A;  5KHO A;  1Q0W B;  4N59 A;  1UUP A;  1J0G A;  2LMC A;  1J7B A;  1V80 A;  2DZK A;  4M02 A;  2KDE B;  4RGO S;  3B2G A;  1QLB B;  3NZS A;  3QK0 A;  1DGJ A;  5HKH A;  1KLG D;  2WXH A;  2AL3 A;  3AEG B;  2ACZ B;  2WXF A;  3N1X C;  2QDF A;  1WXM A;  4D2K A;  3LJ3 A;  4TSS A;  2KDB A;  1WXV A;  5JHB A;  4LDT D;  1V1P B;  2M1M A;  3HM3 A;  2LJ5 A;  3ZYY X;  5JXV A;  2GBJ A;  3SR6 A;  4B6W A;  2DHZ A;  2E6X A;  1ZXI A;  2D3A A;  4W9K A;  1C79 A;  1Z2M A;  1QQR A;  4RF0 A;  2AQ1 B;  2GBR A;  4ACF A;  4TMA B;  3N1Z C;  2L00 B;  1WMH B;  2NBU A;  2KC2 A;  2JRI B;  3SEB A;  5IO9 A;  4K1R B;  4II2 B;  3A9J B;  4GDL B;  1D5M C;  1I4X A;  1KH0 A;  3HHM A;  5KHQ A;  2I1J A;  1HEZ E;  3Q3F A;  5AUI A;  3L54 A;  3VHT C;  3OAW A;  4N6E B;  1N5W A;  3PLV A;  3X23 A;  1E10 A;  3TEX A;  2WDV B;  4P16 A;  4OVU A;  1ZXH A;  2HE7 A;  3OJ3 A;  1TJE A;  2R61 A;  5HHD G;  4RFB A;  3W5V B;  2EMS A;  4PYZ A;  3J9C A;  3NJT A;  3AM9 A;  4YXD B;  3R66 C;  4HJG E;  3H9D A;  3L0W B;  3PT2 B;  2DYM A;  4WH4 A;  5BYR A;  3HM6 X;  4ZRI A;  4PT5 A;  1C3T A;  3TMP B;  1NI3 A;  4WJQ A;  2L8J A;  1JAL A;  1WM2 A;  1D5X C;  1K8R B;  4I6P A;  4HVB A;  4UDU C;  2CJN A;  3PVL A;  1LXD A;  1JRP A;  3LDZ E;  3GZN B;  3R2T A;  2YEP B;  4BKT A;  5EE0 A;  1TTN A;  3RNE C;  2K6Q A;  2AEH A;  3RMK C;  3V6E B;  3HVD A;  1XT9 B;  2H89 B;  4GXB A;  4C7Z A;  1HQR D;  4A3P A;  1R7S A;  4L1B A;  3GE8 C;  2Y5P A;  4LTU A;  1WRI A;  1FO4 A;  2WDT B;  3QWZ B;  1UD7 A;  4B95 A;  1ET9 A;  2HDE A;  2LWP A;  1FXI A;  2WWZ A;  1VZ8 A;  4HPP A;  1WGR A;  2UWQ A;  1UWM A;  1XLQ A;  1TY0 A;  3IVF A;  4ZHO A;  1G6J A;  1FNV A;  3KH0 A;  1QOG A;  4EE2 A;  2V0G A;  2VZK D;  2FCM A;  3P42 A;  2AYO B;  3W1S C;  1IBX A;  4E71 A;  2LVQ A;  3ZNH B;  4CYE A;  2CHW A;  2PE9 A;  2KMA A;  3KW5 B;  3WIM A;  3UGB B;  4P1C C;  4KIK B;  4RM8 A;  5D6J B;  2RSU A;  2CR5 A;  2AX5 A;  3AE1 B;  4NPN A;  4GB9 A;  1L0V B;  2M4N A;  4GIV A;  1KTK A;  3B1L X;  1ROE A;  4KDL B;  3WA0 A;  4RH6 A;  2WU2 B;  1SJH D;  1HA5 A;  2ASQ A;  2KDM A;  2G1E A;  3PRZ A;  4ANU A;  4A90 A;  3RZF A;  2C7M B;  2BYE A;  2V3P A;  2CHZ A;  3A9K B;  4HRS A;  3FIL B;  1E6E B;  3ZDT A;  1P7F A;  2B76 B;  2XNA C;  5GMV A;  2DEN B;  2KWD A;  2EMT A;  2KAC A;  2BS3 B;  3JSV B;  3LXF A;  3N9Y C;  3VTU A;  4IDI A;  2BS2 B; 
#chains in the Genus database with same CATH homology
 4MGK E;  3TIX A;  4RMA A;  2GBN A;  3T9L A;  2JZZ A;  4ANX A;  3VUY A;  2ZCB A;  4BOZ B;  2V3S A;  1WFY A;  4KSK C;  2DYO A;  4IWO A;  2LGX A;  2N7D A;  2JUO A;  2PPH A;  4KSL C;  4YL8 A;  1WGG A;  4M8N A;  2J0M A;  3RYT A;  5IAA C;  2KDF B;  1WRD B;  4BOS C;  3DBR I;  4G3X B;  2KJH B;  2G4D B;  3GZN I;  4CHK A;  3ZVV A;  2BYF A;  2K6D B;  3ZRF A;  3V61 A;  1YX5 B;  1WH3 A;  1UH6 A;  1KM7 A;  2O2V A;  3N32 A;  2KTR A;  1M94 A;  2IO1 B;  2FUH B;  3QIJ A;  4W9G A;  4NQL B;  3VAW A;  4KZ0 A;  4DDG D;  4GN1 A;  2KJR A;  4NAW B;  2JPH A;  2MBE A;  1OQY A;  2NVU I;  3OJ4 B;  5LLI A;  3RD2 A;  3QAR A;  4FJV B;  3H7S A;  5LXH A;  2DAJ A;  3ENE A;  1E90 A;  2C7H A;  3PRP B;  4TUU A;  1KJT A;  1UZX B;  2I1K A;  3A9K A;  3U8Z A;  4AWJ A;  1J8C A;  5CHW A;  2GBK A;  2C5L C;  1NDD A;  1WXS A;  3T8M A;  1WF9 A;  5TR5 A;  3H7P B;  2GOW A;  4W9D A;  3OLM D;  3DBH I;  3P2B A;  4IM3 A;  4XZ4 A;  2JZ3 B;  1WZ3 A;  3QX1 A;  1P0R A;  2KKC A;  2OOB B;  4E74 A;  1CMX B;  4IWP A;  3U30 A;  4WWO A;  1WGY A;  3EC8 A;  1GC7 A;  3W1Y A;  4FAD A;  3RCZ A;  2MWS B;  2K1F A;  3HIZ A;  3QA8 A;  4DWF A;  4BFR A;  3RUL A;  4EEW A;  3SHQ A;  2MBB B;  3H6N A;  4BBN F;  4OVV A;  3ZIM A;  4M0W B;  2LZ6 A;  2WX0 A;  2FAZ A;  3APD A;  1V6E A;  1LM8 B;  2DZM A;  3EEC A;  4DHJ B;  2AL6 A;  2ZNV B;  3L10 B;  3VDZ A;  4BKS A;  1UEL A;  2KMC A;  3TCA A;  1OGW A;  2DX5 B;  1RLF A;  1E8W A;  3QC8 B;  1E7V A;  4MJS A;  1RRB A;  2JF5 A;  3H1U A;  4W9H A;  1UBI A;  4JIO U;  2XK5 A;  2O6V D;  2O6V B;  2MRP A;  1YD8 U;  1WI0 A;  4IM2 A;  1WJU A;  2ZEQ A;  4P7I A;  4XX5 A;  3ZLZ A;  2J0J A;  2JXX A;  3A4S C;  3KUZ A;  3JVZ X;  3ZDM C;  4DHZ B;  4II3 B;  1T0Y A;  4WWN A;  2Y5B B;  2IBI B;  2YVC A;  2REX A;  2DZI A;  1WJ4 A;  1X1M A;  3KYD D;  3QQ8 B;  1RFA A;  1KLV A;  3W1S A;  2KX3 A;  3L13 A;  4K81 A;  2GBM A;  2Z59 B;  3K9P B;  3Q3J A;  2BKF A;  3QJZ A;  4DK5 A;  1L7Y A;  2BYV E;  3ZTC A;  3D32 A;  4NY0 A;  2N9X A;  4BKG A;  3PHW B;  3IFW B;  1GJZ A;  1I42 A;  1LFD A;  3B08 A;  3UQB A;  1V2Y A;  1YIW A;  2NPT B;  1Q5W B;  3CSF A;  3AXC A;  3CMM B;  2FCN A;  4ZYN A;  4DDI D;  4FN2 A;  1A5R A;  1OTR B;  2IZV B;  2V4L A;  4TKN A;  5FR6 A;  3GOE A;  2MX2 A;  1SE9 A;  2GMI C;  2KLC A;  4JQW C;  1V86 A;  2WYQ A;  5CHV C;  2KWV B;  4FA6 A;  4HWI B;  2ZVN A;  1R4M I;  2LD9 A;  1EO6 A;  2YLM A;  3NS8 A;  5DPS A;  2K39 A;  3PS6 A;  2WX1 A;  2N9E B;  1WYW B;  1ZGU B;  2LUE A;  4HPL B;  4IG7 B;  4HLE A;  5IA7 A;  2XBB C;  2K8H A;  4IWQ A;  5DPR A;  3UF8 A;  3VVW B;  4IUM B;  4G50 A;  3ZNG C;  3SD5 A;  5JZE B;  3ZTD A;  4HDO A;  5D94 A;  3ZNI D;  2CS4 A;  3TBL D;  3VQI A;  1FXT B;  3IBE A;  4NNJ B;  2LRW A;  3DVG Y;  1NBF C;  3NHE B;  2VRR B;  2N4F A;  2L0F A;  4G11 A;  4AJY B;  5E6O A;  3SU8 X;  1YQB A;  3DCG A;  4WJO A;  2OJR A;  3UIO B;  4ICU A;  4HK2 A;  4W9C A;  3PV1 A;  1P98 A;  1UGM A;  3R3M A;  4FLH A;  4RM9 A;  2XEW A;  1OEY J;  1WY8 A;  1WGD A;  4GMV A;  4K7W A;  1ZKH A;  2L3Z A;  5CX3 A;  3L17 A;  4I6L B;  2PEA A;  4ASW C;  2O6V A;  4M8M A;  3VH4 B;  1EF1 A;  3WAN A;  4WQO B;  4ZDV A;  5JHA A;  2D3G A;  2DZJ A;  4X57 B;  4PS3 A;  2LXC A;  2IO0 B;  1UBQ A;  2J7Q B;  3HK0 A;  2ZPN A;  4PS7 A;  4W9J A;  1VD2 A;  2FIF A;  1TZ1 A;  3A33 B;  3AU5 A;  1V9J A;  2EKE C;  4JL9 A;  5CHF A;  1IPG A;  5G55 A;  3PRE A;  3A9J A;  2KVR A;  1P3Q U;  1SIF A;  3V60 A;  2K8C A;  4W9F A;  3AU4 A;  3PZD A;  2CKH B;  5D2M B;  1WIA A;  5EDS A;  2N1V A;  2NR2 A;  3PGE A;  2LVO A;  2BF8 B;  4I6N B;  3NZU A;  4MSQ B;  3DVG X;  2R2O A;  2KO3 A;  4FJY A;  4XC2 A;  1R4N I;  4E3C A;  5J17 A;  1L2N A;  1WE7 A;  2XK5 B;  3I3T B;  3S2A A;  2KLG A;  2MA9 B;  5KHO A;  1Q0W B;  3MHS D;  3NY5 A;  2G45 B;  1J0G A;  2KAN A;  4BKS D;  1P9D U;  3M62 B;  5LXI B;  1V80 A;  2DZK A;  2O2V B;  3L16 A;  2KWU B;  4B9K A;  4ANW A;  1H8C A;  2KDE B;  3MJW A;  3A1Q A;  3EHV A;  4TV3 A;  4IC7 B;  2FID A;  4FHJ A;  3PLU A;  2KTF A;  3ZRC A;  3VFK A;  1E8Y A;  3NZS A;  3QK0 A;  3WAL A;  2LXA A;  5HKH A;  4MEL A;  2MP2 B;  3KUC B;  4WWP A;  2AL3 A;  3DVN V;  2KOX A;  2NS5 A;  4PS8 A;  2KFJ A;  2RPQ A;  3ZNZ B;  2CU1 A;  4GDK A;  4GDL A;  3VUX A;  1WXM A;  3LJ3 A;  2KDB A;  1WXV A;  5JHB A;  4LDT D;  4AUQ C;  2IYD B;  2A4Z A;  2C60 A;  2M1M A;  3HM3 A;  3TL5 A;  2IY0 B;  3R7Q A;  3AUL A;  1Z5S B;  4GDK B;  2LJ5 A;  3DPD A;  3M95 A;  2K8B A;  1WX9 A;  3WAO A;  4IM0 A;  1H4R A;  5L95 C;  2D11 A;  2GBJ A;  4ZRK A;  3RUI B;  2QHO A;  1EF5 A;  2KFK B;  3N3K B;  3VXW A;  3V6C B;  3ECI A;  4DXA B;  4B6W A;  3DBL I;  1Q1O A;  3VTV A;  2DHZ A;  4W9L A;  3EFU A;  3PTF C;  3IG3 A;  2MBH A;  4W9K A;  4MSM B;  4DHZ E;  1Z2M A;  4DBG A;  2KC1 A;  2FNJ B;  2JRH A;  3CST A;  4WJP A;  2GBR A;  4MJS B;  2PJH A;  3ZO5 B;  1U4A A;  1JRU A;  4KZC A;  2JWZ A;  2L00 B;  2FCS A;  3BY4 B;  1SGH A;  4WAA A;  3QAQ A;  1WJN A;  2DYB A;  1WMH B;  2NBU A;  2Z0E B;  2FCQ A;  4LJO B;  1WE6 A;  3DVN U;  2KC2 A;  4HCP B;  2JRI B;  1E8Z A;  4K7U A;  2KNB A;  4FJZ A;  2ZVO A;  4K1R B;  2L0T A;  4II2 B;  1BT0 A;  3A9J B;  3O65 B;  1ZW7 A;  5DPW A;  5AZF A;  2RD0 A;  4GDL B;  3JYU A;  1IP9 A;  1V5O A;  3DOW A;  1WJ6 A;  3HHM A;  5KHQ A;  5AZG A;  2I1J A;  4NJ6 A;  1NI2 A;  3ML9 A;  3Q3F A;  2KHW B;  2KDI A;  1EUV B;  1WX8 A;  3L54 A;  2LAS A;  5C1Z A;  3VHT C;  4KV2 A;  2L7R A;  2M8S A;  1WR1 A;  2W9N A;  3OAW A;  4TQ0 A;  2KXJ A;  1GNU A;  4MGZ E;  3VTW A;  1E7U A;  4KIK A;  1KOT A;  3PLV A;  3X23 A;  3A4R A;  4LCD E;  2KZR A;  2NCN A;  3JSV A;  4OVU A;  2MCN B;  2HE7 A;  4HPM B;  4GOC A;  1WXA A;  2L76 A;  4GGQ A;  4LJP B;  3U7D A;  3V62 A;  3UQA A;  4EUT A;  2C9W B;  3OJ3 A;  1PQS A;  2BKR B;  1TBE A;  2DAF A;  4F1S A;  2IO2 B;  2A5U A;  5D7G A;  4EZJ A;  2EMS A;  4K7S A;  4PYZ A;  2KK8 A;  3PRM B;  2ZNV C;  1WR6 E;  5AEK B;  3ZUN A;  2N7E A;  3R66 C;  4EOY A;  1E5W A;  3H9D A;  4NQK E;  2LGD A;  3L0W B;  3PT2 B;  5L83 A;  4GSW A;  2DYM A;  4FHK A;  4EFO A;  3HM6 X;  1GC6 A;  1RAX A;  2KQS A;  4ZRI A;  2K25 A;  4AP4 C;  3C0R B;  4KVG B;  3TJP A;  1C3T A;  1WX7 A;  3TMP B;  5BO4 B;  1GUA B;  4WJQ A;  1VCB A;  3ALB A;  3DDC B;  4W9I A;  2BGF A;  2L8J A;  2M17 A;  1WM2 A;  1K8R B;  1WM3 A;  4I6P A;  4HVB A;  2NBV B;  3PVL A;  3H7P A;  4MDK E;  5G2N A;  2ZCC A;  1LXD A;  2ZJD A;  3L08 A;  3LDZ E;  4IW0 A;  4BKT A;  4GU2 A;  1V81 A;  1TTN A;  4WJN A;  4JLC A;  2K6Q A;  1E8X A;  1MG8 A;  2AEH A;  3M63 B;  5E6N A;  3V6E B;  1XT9 B;  4JGH B;  1S1Q B;  4GXB A;  2IY1 B;  4N9F 4;  3VH3 B;  3X0W A;  4A3P A;  2G3Q B;  4CO7 A;  1TGZ B;  4G0N B;  3KUD B;  3M3J A;  2MBQ A;  4BBN C;  5JH5 C;  1QZE A;  5CTR C;  4LDT B;  2PE6 B;  4F7Z A;  4HDQ A;  3JW0 X;  1WZ0 A;  2WDT B;  5AZH A;  4AOF A;  3QWZ B;  3UIN B;  4F8C B;  1UD7 A;  4B95 A;  2MW5 A;  2KJ6 A;  1XD3 B;  3N30 A;  2KN5 A;  1P1A A;  4URK A;  2LWP A;  4TQ1 A;  1OEY A;  2M0X A;  3RZW C;  3A1Q B;  3ML8 A;  3ZKJ C;  2RR9 A;  2UYZ B;  2WWZ A;  3CF6 E;  2HJ8 A;  1WGR A;  3DBS A;  2UWQ A;  2KWC A;  4HJK A;  1YJ1 A;  3MTN B;  4FUL A;  1I35 A;  2JY6 A;  2AWT A;  3IVF A;  3UIP B;  4ANV A;  4MH0 E;  1G6J A;  5J18 A;  2LRU A;  2HD5 B;  3PHX B;  1IYF A;  1D3Z A;  2D10 A;  2G4S A;  4A3O A;  2KTR B;  2KX0 A;  2D2Q A;  3B0A A;  3KH0 A;  2MLB A;  2MQJ A;  2V1Y A;  2NBW B;  2IO3 B;  2KD0 A;  2FCM A;  4PYU A;  2NPT A;  3KYC D;  2AYO B;  4MM3 A;  5C23 A;  3W1S C;  4E71 A;  2JT4 B;  2LVQ A;  3ZNH B;  4FBJ B;  2L05 A;  4ICV A;  1Y8R C;  1F9J A;  4CYE A;  2HTH A;  2R2Q A;  3WAM A;  2CHW A;  2LI5 A;  2PE9 A;  3APF A;  4BVU C;  2KMA A;  3KW5 B;  4MGI E;  1HE8 A;  3ZW3 A;  4EZL A;  3WIM A;  4HCN B;  3R7R A;  3UGB B;  2KQ7 A;  1S3S G;  4KIK B;  2LVP A;  4RM8 A;  4A20 A;  5D6J B;  3AI5 A;  4EKU A;  2RGF A;  5E6P A;  2RSU A;  2CR5 A;  4W9E A;  4HXD A;  2BWF A;  2JVC A;  2J0K A;  2MBO A;  4NPN A;  4GB9 A;  2Z0D B;  4AJW A;  2MP2 A;  2M4N A;  2N1W A;  4GIV A;  1LQB A;  2LGY A;  2ZZP B;  1V49 A;  3B1L X;  2D07 B;  2CHX A;  3RT3 B;  2ZPY A;  4J6I A;  4KDL B;  2N9P C;  3WA0 A;  1V5T A;  1WMH A;  4NJ7 A;  4EZK A;  1XQQ A;  3KVF B;  1AAR A;  2ASQ A;  3ONS A;  3PRZ A;  3PPA A;  3QCA A;  3NOB A;  4NAW A;  2BPS A;  3SDL C;  3IHP C;  4ANU A;  3VUW A;  4MEM A;  5DPT A;  2MSE D;  1WGH A;  2BYE A;  2C7M B;  2C7N B;  2BWE S;  1J19 A;  3RZF A;  1YX6 B;  5J2R A;  4DHJ D;  3PSE B;  3WAP A;  2CHZ A;  3A9K B;  3DQV A;  2KFK A;  3ZDT A;  4KDI C;  4ZRJ A;  5GMV A;  3K9O B;  2DEN B;  5DCN A;  3APC A;  2EMT A;  3BIN A;  3JSV B;  4MGY E;  1GG3 A;  3QHT A;  3VTU A;  1C1Y B;  1ISN A;  2B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...