5FR6A

The structure of polycomb uld complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
83
Chain Sequence
DDEIISLSIEFFKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords POLYCOMB COMPLEX PROTEIN BMI-1
total genus 21
structure length 83
sequence length 105
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5fr6A00
1V6EA 4HXDA 3MTNB 4PS7A 4KIKB 4ZRIA 3WA0A 3LJ3A 4X57B 5KHOA 4BKGA 2UWQA 2PE6B 2MLBA 2N4FA 5C1ZA 4FJZA 1UGMA 1X1MA 3RZWC 4B6WA 4DBGA 2N1WA 3GOEA 3OJ4B 2HE7A 1EUVB 1V81A 4IWPA 2L05A 4KIKA 3VUYA 1XD3B 3PTFC 1Q1OA 4JQWC 4RM9A 2YLMA 2LI5A 2O6VA 4M8NA 4F7ZA 2KFJA 2QHOA 2JRIB 4HWIB 2LVPA 4XC2A 2KDEB 2KLGA 2MQJA 4LJOB 4BVUC 1WX8A 1M94A 4E74A 2WDTB 1WXSA 2LGYA 3ECIA 4BOSC 4GGQA 5JH5C 1VD2A 3I3TB 3MHSD 4WQOB 5D2MB 2WWZA 4WWOA 2OOBB 4G11A 2K8HA 4PYZA 1SIFA 3RD2A 2NPTB 3TCAA 2C9WB 3O65B 4FJVB 4FULA 1EF1A 3HM3A 3H7SA 5D6JB 4A3OA 2CKHB 2DZJA 3ONSA 4FHJA 2XK5B 2IY1B 3R7RA 3PT2B 2MBBB 2BYFA 3R66C 1L2NA 3KH0A 3ENEA 2MCNB 2K25A 2O6VB 3PSEB 3U30A 2PE9A 3WAOA 3RULA 2NCNA 4WAAA 4ZRKA 1V86A 1OQYA 4N9F4 4I6NB 1P98A 3V62A 4IM0A 1R4MI 2DYOA 3A33B 4IM2A 1WJ6A 3TIXA 2J0KA 4FBJB 2UYZB 2W9NA 1WJ4A 1OTRB 2KZRA 5G55A 2O6VD 5CHVC 5JHAA 5L83A 1TZ1A 3D32A 2BWES 1WGHA 5KHQA 3SHQA 2ZVNA 3R7QA 3B08A 4RMAA 3S2AA 3UINB 1UH6A 3A4RA 1RRBA 5AZFA 3TMPB 1LXDA 1WMHB 2CHZA 2GBNA 2NR2A 4K7WA 1WY8A 2G4DB 2KWUB 5BO4B 2VRRB 2A4ZA 4W9IA 2BKFA 2OJRA 3WANA 1IYFA 4IUMB 3M63B 2IO1B 3KUCB 4GXBA 2HJ8A 3UIPB 1J19A 3RT3B 4MSMB 3W1SC 1WE7A 2LWPA 1NBFC 2CHWA 3EFUA 2DZIA 3AI5A 3PV1A 4GSWA 4W9GA 2D3GA 1EF5A 1WF9A 3QC8B 3RYTA 2ZCCA 2RSUA 4JGHB 2KFKA 1MG8A 3V60A 2J7QB 3DDCB 1Z2MA 2NVUI 3OAWA 2MBHA 3AULA 4P7IA 4KV2A 3ZNID 2D11A 2FCNA 4XX5A 2M1MA 2KC1A 1SE9A 3A1QB 3ZNGC 3NY5A 2G4SA 2JWZA 4W9FA 3T9LA 4ANXA 5L95C 2PEAA 4MGKE 3IBEA 3RZFA 3VUXA 2KJ6A 2MSED 3ZO5B 3Q3FA 1V5TA 2AL3A 2FCMA 2KTRA 3WALA 1V9JA 2XBBC 3KUZA 3QCAA 4XZ4A 2DENB 4W9JA 5DPSA 3PLVA 4WJNA 5TR5A 3VAWA 2MBOA 4MJSB 5AZGA 4GB9A 3N32A 2KFKB 1V49A 1Y8RC 4DDID 4AP4C 2LZ6A 2DX5B 1E8YA 1UELA 2BYEA 1P9DU 2JUOA 2K39A 3PREA 4MGYE 3AXCA 2JRHA 3VXWA 1Q0WB 1FXTB 4URKA 2DZKA 5LXIB 2K8CA 1WJUA 3H6NA 4EUTA 4LDTB 2Z59B 3PZDA 2LD9A 4HDOA 3CSTA 2LGXA 2XEWA 3RCZA 1OGWA 4OVVA 2KQSA 1WX9A 2HD5B 3KW5B 3QA8A 3TJPA 3IG3A 1CMXB 3U7DA 1WIAA 3VFKA 4BKSA 2D07B 4MM3A 2KWCA 4GDKB 1Q5WB 2N7EA 4W9HA 5AZHA 4A20A 2L76A 4EZKA 4HLEA 4FA6A 4CHKA 2L3ZA 2KLCA 4HVBA 2LRWA 4GU2A 3C0RB 3BY4B 2KQ7A 4RM8A 2FAZA 3H7PA 2L0TA 1T0YA 4GMVA 3L54A 3ML8A 3KYCD 4G0NB 1WJNA 2KMAA 2MP2B 5CX3A 1V2YA 1LFDA 1G6JA 1U4AA 4AJWA 1H4RA 1XT9B 2GMIC 4TKNA 3H1UA 4IWQA 1ZW7A 1RFAA 1WGDA 4DDGD 2L0FA 3VH4B 3DOWA 1P0RA 3U8ZA 1E8XA 2HTHA 3K9PB 4WJPA 3NZSA 3DVGX 2M4NA 4BBNC 1RAXA 3PGEA 2NPTA 5AEKB 3ZTCA 2AEHA 3ZNZB 1SGHA 2LXCA 3QQ8B 3LDZE 2LVQA 3A9JA 2FCSA 3PPAA 4CYEA 4ICUA 2N9PC 3W1SA 3APFA 2DHZA 2M17A 2AYOB 2KWVB 4FLHA 4NAWA 3V61A 3ZNHB 4DK5A 5IA7A 4KZCA 3PRPB 4G50A 4LDTD 2I1KA 2C60A 3W1YA 4DHZB 4JLCA 1KJTA 1TBEA 4TUUA 3IHPC 5JHBA 1TGZB 4GOCA 2DYBA 2N9EB 2ZCBA 3VHTC 3DVNV 3IVFA 4GN1A 4HPMB 4M8MA 4EEWA 2R2OA 4PS8A 4BOZB 2KANA 2K1FA 3WAMA 1F9JA 3CF6E 2LJ5A 2JVCA 5D94A 2REXA 2N9XA 3L08A 1E7UA 4W9KA 1WR6E 4DHJD 4NJ7A 4IG7B 3AU5A 2KNBA 3P2BA 3PRZA 4FN2A 1J0GA 2KD0A 4K1RB 1E90A 3R3MA 2MBEA 4JL9A 3K9OB 2BWFA 3PS6A 2N7DA 3L0WB 4I6LB 2K6QA 3M95A 3ALBA 3SD5A 4PS3A 4K7UA 1WGYA 4KDIC 4FADA 4EZLA 2WX0A 3DBHI 2O2VA 4HJKA 1WGGA 4JIOU 4KVGB 4MH0E 3UF8A 3X0WA 3L13A 2N1VA 2RD0A 2G3QB 2MA9B 2MWSB 4HCPB 3JSVB 3KVFB 4WWPA 4F8CB 3ZTDA 3L16A 3ZRFA 1YX5B 4AJYB 4DXAB 1L7YA 3QWZB 2RR9A 3KUDB 4TQ0A 3NZUA 4TV3A 3EHVA 1GUAB 2KOXA 1I35A 2BF8B 4NQKE 4E71A 4WWNA 1UBIA 4EKUA 4KZ0A 1C3TA 4NNJB 1V5OA 4M0WB 2EKEC 4ANVA 2DAFA 2JZZA 2LASA 3QARA 4MJSA 4WJOA 4ZDVA 3B1LX 1WH3A 1S3SG 5LXHA 1GJZA 2ZPYA 3PLUA 1GNUA 1WX7A 4KSKC 3V6EB 2RGFA 3JW0X 2CR5A 1WYWB 2ZNVC 2C5LC 1IPGA 2NBWB 2MRPA 1WR1A 4HCNB 1OEYA 4HDQA 5E6NA 3DVGY 2JXXA 3VTVA 2R2QA 3N30A 4MGZE 2Z0DB 1WGRA 4PYUA 5DPRA 4AWJA 2KJHB 3DQVA 3IFWB 5JZEB 1XQQA 3QIJA 1K8RB 2BKRB 3CSFA 1WZ3A 2D10A 3QJZA 4ZYNA 2CHXA 2FNJB 1H8CA 5CHWA 1JRUA 1NDDA 3ZIMA 3UGBB 2LGDA 3QAQA 3A9KB 4FHKA 2GBJA 3H7PB 5IAAC 3JSVA 5D7GA 3APCA 3X23A 2LRUA 4YL8A 1P1AA 4A3PA 3VUWA 1YD8U 4ZRJA 1R4NI 2CU1A 3BINA 5GMVA 2ZJDA 2KDFB 4NJ6A 2GBKA 3UQAA 1A5RA 4GDLB 1LM8B 2KDBA 2ZZPB 3L17A 1E8WA 5C23A 2LXAA 3DBRI 2KN5A 3ZDTA 5J18A 2IY0B 2NBVB 4LCDE 2JZ3B 4MELA 1KM7A 1WM2A 2ZEQA 5HKHA 4NY0A 2BPSA 3A4SC 3SU8X 1C1YB 1GG3A 1HE8A 1WFYA 4II3B 3ZW3A 3DBLI 2KX3A 2L00B 2Y5BB 2ASQA 2KKCA 4IC7B 4NAWB 4W9EA 2DYMA 2JPHA 1QZEA 2WX1A 2AL6A 5G2NA 2D2QA 1AARA 3A9JB 1ZGUB 2V4LA 3AU4A 4LJPB 2FIDA 1WXMA 3QHTA 2NBUA 3PRMB 1UD7A 4ICVA 2C7NB 3WIMA 4ASWC 2GOWA 2NS5A 4AOFA 2KX0A 2M0XA 1WI0A 2J0MA 5DPWA 4J6IA 3ZUNA 4G3XB 2JF5A 3M62B 2KO3A 1Z5SB 1ZKHA 2KTFA 4I6PA 4KDLB 1E7VA 5J17A 4CO7A 1YJ1A 4WJQA 4IWOA 3HM6X 4ANUA 4KSLC 2FIFA 2KTRB 3M3JA 5LLIA 3NS8A 2EMSA 3V6CB 1J8CA 4MEMA 3PVLA 2KHWB 3N3KB 2M8SA 1I42A 4W9DA 1YQBA 4ANWA 4W9LA 3A1QA 4TQ1A 2KDIA 5E6OA 1E8ZA 4II2B 2DZMA 1WE6A 3SDLC 3VVWB 1D3ZA 1BT0A 3ZKJC 2IBIB 4B95A 4GDLA 2ZPNA 2KC2A 2YVCA 5DCNA 1UZXB 4GDKA 4BKTA 2DAJA 4EFOA 1KLVA 1ISNA 3Q3JA 2BYVE 1VCBA 4OVUA 4B9KA 1RLFA 4MSQB 1YX6B 3TL5A 3NOBA 1TTNA 2IO0B 2IYDB 2C7HA 1KOTA 3A9KA 3RUIB 3T8MA 1GC7A 3DCGA 2KXJA 4BKSD 2J0JA 5FR6A 3OJ3A 2V1YA 2C7MB 2FCQA 3VDZA 4DHJB 3UIOB 1GC6A 5EDSA 3CMMB 1NI2A 5CTRC 3H9DA 2GBMA 3VH3B 4K81A 3VTWA 4BBNF 2PJHA 2WYQA 3HK0A 3APDA 4MGIE 3TBLD 4IW0A 1P3QU 2I1JA 2XK5A 5E6PA 4K7SA 1WRDB 3B0AA 4F1SA 3UQBA 4EOYA 2IO2B 2G45B 2B3AA 3PHXB 4IM3A 3WAPA 4AUQC 5CHFA 2MW5A 2IZVB 3QK0A 4DWFA 2JY6A 2LVOA 2IO3B 2GBRA 2A5UA 1IP9A 2K8BA 2PPHA 2ZVOA 3DPDA 3ZVVA 3ZDMC 2Z0EB 2KK8A 2JT4B 3MJWA 2MP2A 3JYUA 4HK2A 4NPNA 3OLMD 1EO6A 1WZ0A 4E3CA 4HPLB 3KYDD 3EECA 3HIZA 3NHEB 1UBQA 2LUEA 1WXAA 2EMTA 2RPQA 3JVZX 2MBQA 2KMCA 1LQBA 2K6DB 1OEYJ 2O2VB 4EZJA 4NQLB 2KVRA 2CS4A 3DBSA 2L8JA 3VQIA 1PQSA 3PHWB 5J2RA 3ML9A 3ZRCA 1WMHA 4DHZE 1YIWA 4GIVA 1E5WA 2ZNVB 3QX1A 4MDKE 1WXVA 2L7RA 3DVNU 5DPTA 2KJRA 4FJYA 4BFRA 2BGFA 3GZNI 3L10B 1S1QB 2AWTA 1V80A 3EC8A 2FUHB 2V3SA 3HHMA 3VTUA 2MX2A 3ZLZA 1WM3A 4W9CA
chains in the Genus database with same CATH superfamily
1D5XC 4ZRIA 1UGMA 2WXQA 4IWPA 2L05A 1WWTA 3RI7C 4JQWC 1Q1OA 3N20C 3AB5A 2KACA 4KX6B 2UU7A 4XWTA 4LJOB 1WX8A 2R61A 3VRAB 3SFDB 2INPE 3Q14C 3ECIA 4ZRPA 4HKZE 1L5PA 2K8HA 3GS2A 2C9WB 3L4PA 3Q3NC 3P4RB 4FULA 2WXGA 3H7SA 1SB3C 2XK5B 3PT2B 3URYA 2BYFA 3R66C 1T3QA 3PSEB 1JRPA 2NCNA 1K52A 4WAAA 1P98A 4IM0A 1R4MI 1IBXB 3BYTB 4NJCA 2J0KA 2W9NA 2O6VD 4S0RA 3UI3A 4EE2A 3AEGB 4S17A 3R7QA 1QKZA 1L0XB 3S2AA 2WXIA 3UINB 1UH6A 3IAM1 1DOYA 2CHZA 1WY8A 1R4MB 2KWUB 1SE4A 1AWDA 2A4ZA 2OJRA 1YNTE 4GXBA 2IO1B 2HJ8A 3UIPB 4MSMB 1PGXA 1RFKA 4W9GA 2D3GA 3QC8B 3RYTA 3RMKC 2RDBC 3DDCB 4OHJA 3ZXRA 2M1MA 1QLBB 3A1QB 1PGBA 4MGKE 1FNVA 3FKYA 3VUXA 2MSED 3ZQ4A 1HZ5A 2FCMA 3WALA 2KTRA 5TR5A 4W9JA 3PLVA 2W3SA 3LB8C 4GB9A 4DDID 4ZHPA 1E8YA 2JUOA 1P9DU 3PREA 5LXIB 1WJUA 2QEJC 2Z59B 3PZDA 3U52E 4JE3B 2HJ1A 3Q8AA 1J7AA 1CMXB 1WIAA 2D07B 2KWCA 4EZKA 4HLEA 1GB4A 3C0RB 4L23A 3BY4B 2KQ7A 2OHFA 3IAS1 3KYCD 2KMMA 1TY2A 1UGJA 2KMAA 1V2YA 3VR8B 1KTKA 1LFDA 4A55A 5IN7A 5BMGA 3DBHB 3H1UA 1RFAA 4YTMB 1GAQB 1OQQA 1XLOA 3N9YC 3K9PB 4BBNC 2J52A 1SBBB 4YT0B 3ZTCA 2GLSA 2KWDA 1IGCA 2LVQA 3A9JA 1DOXA 4KZCA 2PLPA 2Y5CA 2C60A 2BB5A 1KJTA 3RN9C 3IHPC 2DYBA 3VHTC 3DVNV 3IVFA 4GN1A 4EEWA 3N1XC 1HA5A 2R2OA 3CF6E 4JWUC 1NENB 4IG7B 4FN2A 1J0GA 3R3MA 2MBEA 4JL9A 2BWFA 2K3UA 4I6LB 4DXFA 4H2AA 3ZXVA 4A6QA 3GP7A 3L13A 2MA9B 2MWSB 4WWPA 3L16A 3ZRFA 1YX5B 4USAA 3QWZB 2RR9A 2J42A 1GUAB 2KOXA 4NQKE 4E71A 1FO4A 5T8IA 1D4BA 1UBIA 1JMLA 2GB1A 3LXFA 4EKUA 1ACCA 2N9LA 4M0WB 2JZZA 4MJSA 4A8XC 5LXHA 2ZPYA 3PLUA 3V6EB 3JW0X 1WYWB 2ZNVC 2W55A 2QILA 1UWXA 2NBWB 2MRPA 4MGZE 2Z0DB 3BK2A 1WGRA 3IFWB 1XQQA 1WZ3A 2M0AA 2FNJB 4ZYSA 3B2GA 5CHWA 1J7CA 1JRUA 3Q6BA 3ZIMA 3PZ7A 3QAQA 4IOIE 4OZBA 5D7GA 4YL8A 1P1AA 3GZNB 1YD8U 1F1HA 2JYTA 1L4ZB 1I4PA 4ZRJA 3W5VB 4NJ6A 3UQAA 1ZP0B 4NZLB 2KDBA 2IY0B 2H89B 4LCDE 1ET6A 1ZXIA 2JZ3B 3CWIA 2ZW0A 4P6VF 5HKHA 3A4SC 3RNGC 3SU8X 3T3OA 3DBLI 2KX3A 4US8A 4OW0A 1NYRA 2DYMA 2JPHA 2QSDA 2AL6A 2D2QA 4TMAB 1AARA 4LJPB 3ZJUA 1TS3A 2NBUA 3PRMB 1YQ4B 1TS4A 2KX0A 3BWUD 3TEYA 2JF5A 2KO3A 1ZKHA 1RYJA 2Y3AA 1V1OA 4IWOA 3I9V1 4ANUA 1DOIA 1L6UA 1J8CA 3J9CA 2CJOA 4CQNA 2KDIA 2RPVA 1XLPA 1WE6A 3SDLC 2IBIB 2YVCA 2KVZA 1FXIA 2BYVE 4OVUA 3MHZA 1YX6B 2RMMA 1F0ZA 1ENFA 2C7HA 2ACZB 1ZDXA 3TEZA 4US9A 4BKSD 2PIAA 5EDSA 3CMMB 2WDRB 2BB6A 3MC9A 3VH3B 3HK0A 3APDA 1P3QU 3DHGC 2XK5A 4K7SA 2IJ0A 1CJEA 2IO2B 3PHXB 3WAPA 2NTTA 1WGKA 2MW5A 4DWFA 2LVOA 2IO3B 1HTQA 4LK0M 1IP9A 2INCC 2PPHA 4YTPB 3ZVVA 2N9KA 3MJWA 3JYUA 3RNEC 2LGSA 4HPLB 2QJLA 4C7ZA 3HIZA 2AQ2B 2MBQA 1C4PA 4EZJA 5GXGB 1PQSA 1WMHA 4DHZE 3MP9A 5DPTA 3VTUA 4ZOHC 3ABVB 2GI9A 1WM3A 4OVZA 3IT4B 4PS7A 1YN5A 3LJ3A 4MM3B 2PE6B 2MLBA 2WDQB 1C78A 5G5GA 2MH7A 4DBGA 1F2RI 3GOEA 3OJ4B 4C7YA 3FC4A 3PTFC 5IP4D 1JWUD 4M8NA 3DBLB 3RNBC 4HWIB 2TSSA 2KDEB 2MQJA 3TEWA 4E74A 1VDVA 4GGQA 2QDFA 4WQOB 2WWZA 3AE6B 3NRZA 4G11A 4LLGM 5IO9A 5EE1A 4PYZA 1SIFA 3RD2A 3TCAA 1TZOA 1D6EC 1UF0A 4A3OA 2DZJA 3ONSA 4XDDA 2DWQA 1N62A 1UWMA 1SXTA 3WAOA 2PE9A 3RULA 2BBCA 1V86A 1XCQL 2DBYA 4I6NB 3A33B 2DYOA 1WJ6A 3WCQA 4TSSA 1OTRB 2KZRA 4RF1A 3Q69A 2WGSA 1MFWA 1WGHA 3NUHB 5KHQA 3SHQA 4M01A 1SF0A 3Q3MC 4RGTA 5AZFA 3TMPB 3W5UB 1WMHB 2NR2A 2G4DB 1MI0A 1WXQA 2BKFA 3KWVA 3WANA 1TYGB 5FKAC 5C2TB 1J19A 2LWPA 1NBFC 3EFUA 4GSWA 4C00A 3NJTA 3MJ5A 1MG8A 3V60A 1FM0D 2BS3B 2FCNA 1SE9A 3NY5A 2JWZA 2YEPB 4LTUA 3Q3FA 1KF6B 1PUTA 1FEHA 3VAWA 2MBOA 5AZGA 1TS2A 4ARCA 1Y8RC 3AEEB 2CJNA 2LZ6A 4AP4C 5HHDG 4ARIA 2ICIA 3VXWA 2JRHA 2OEDA 2K8CA 4KKIA 4HDOA 3CSTA 2LGXA 1VZ8A 1OGWA 4OVVA 1WX9A 1XXGA 2QCZA 2L1AA 1DGJA 2BT6A 4W9HA 2L76A 1JW9D 1ZPSA 3P4SB 1HZ6A 1ROEA 2FAZA 1TJEA 3H7PA 4GMVA 1GB1A 4BZAA 1G6JA 1H4RA 1SE3A 1M4VA 2NTSA 4DDGD 3DOWA 1NVID 2HTHA 1C79A 5AUKA 3NZSA 2AEHA 3ZNZB 1E0ZA 2VH2A 2LXCA 2YEPF 1QF6A 5HFYA 5HG2A 4LNFA 2M17A 5IA7A 3PRPB 4G50A 2I1KA 4DHZB 3E9SA 4JLCA 2WXMA 3BVZA 3ETRA 2D3AA 2Z8LA 4HPMB 4YWGG 1K50A 4XWWA 4OZAA 2JVCA 4K3CA 1E7UA 1WR6E 3AU5A 5D3DA 2KD0A 4AS1A 1NEKB 3L0WB 5LNK1 4PS3A 2PVGC 1WGYA 4KDIC 4B0EA 4HJKA 2LMCA 1WGGA 2RDGA 4JIOU 4MH0E 3X0WA 2RD0A 2G3QB 2ONQA 3JSVB 1EWCA 2D3CA 4AJYB 1JWAD 2W3RA 3KUDB 4TQ0A 4TV3A 3EHVA 1I35A 1TIFA 1C3TA 4NNJB 2L32A 2EKEC 2GRIA 1L0YB 4ZDVA 3B1LX 1XF5L 1GJZA 1WX7A 2CR5A 2KDMA 1YQ3B 2R2QA 3N30A 3PZ8A 4AWJA 1QOFA 4KKJA 2N0SB 3QIJA 3QJZA 2RDHA 3UGBB 3C19A 3P63A 2GBJA 3JSVA 2IPKD 1XEEA 3R2IA 2LRUA 2H88B 3VUWA 2LJIA 1OFFA 4WURA 2K0PA 5H8YE 3BINA 2ZJDA 2JX5A 2GBKA 1A5RA 4GDLB 1E8WA 2LXAA 3DBRI 3DWMA 2NBVB 4WAFA 4MELA 2I2YA 2ZEQA 2JZPA 2BPSA 1HE8A 1WFYA 1WYGA 3ZW3A 2ASQA 2KKCA 4IC7B 1QOGA 2JQRB 3A9JB 1ZGUB 3AU4A 2AQ1B 3OG5A 3NVVA 2C7NB 2K9XA 2NS5A 4AOFA 2M0XA 3NZ3A 4G3XB 3M62B 1T5XD 1YJ1A 4WJQA 4KSLC 2KTRB 3M3JA 5LLIA 3NS8A 1E10A 2KT7A 2KHWB 1KH0A 2M8SA 2V9HA 3A1QA 2DZMA 3VVWB 1F52A 2L52A 2ZPNA 4RF0A 4RCOA 1UZXB 1T0RC 3AE4B 1ZOYB 2IO0B 2WXOA 3A9KA 1JWMD 4IDIA 2J0JA 5FR6A 3OJ3A 3AEDB 2W54A 3UIOB 1TKEA 5CTRC 2GBMA 1J7BA 4BBNF 2PJHA 2WYQA 1TKGA 1GPXA 4IW0A 3V3XA 2I1JA 5E6PA 4BAXA 3B0AA 1SJHD 4MACA 4IM3A 3ZYYX 4AUQC 4RGOS 5CHFA 2JY6A 3DPDA 2ZVOA 2JT4B 4HK2A 3OLMD 1WZ0A 3KYDD 3NHEB 4FXCA 1WXAA 4JWSC 2JYEA 1LQBA 3KLSX 2G1EA 4NQLB 3DBSA 3VQIA 3ZRCA 4GIVA 3QX1A 1WXVA 4M02A 1WSPA 2SEBD 4FJYA 3GZNI 2WLBA 3L10B 1XO3A 3EC8A 1MG4A 4PK1A 4W9CA 1FXAA 1V6EA 3GE8C 4HXDA 1ET9A 3MTNB 1HXYD 2ZW1A 4BKGA 1HEZE 2UWQA 2N4FA 4HPPA 3RZWC 4B6WA 2HE7A 1EUVB 3VUYA 1XD3B 4RM9A 2LI5A 2V4IB 2KFJA 3AECB 3MC8A 2WP9B 2M19A 2B76B 4XC2A 2KLGA 4BVUC 1WXSA 3AV8A 3MHSD 5D2MB 5FK9C 2V0GA 5FR3A 4WWOA 5BYRA 1FIQA 2JWUA 4C4VB 2AX5A 3NS1A 1B1ZA 2NPTB 4FJVB 1EF1A 3HM3A 5D6JB 4R3DA 3BYYB 2CKHB 2V3NA 1UUPA 4FHJA 2IY1B 1L2NA 3KH0A 2MCNB 1N5WA 3U30A 2E6XA 4D2KA 3Q8BA 1OQRA 3NVYA 3V62A 3TIXA 2UYZB 2FUG1 1WJ4A 5G55A 5CHVC 3P4PB 1L0VB 1TZ1A 2BWES 2JXTA 5TSSA 1SJED 2ZVNA 2KYWA 3B08A 1I4RA 1V97A 1RRBA 1LXDA 2VRRB 4JPSA 4W9IA 3RNCC 3KUCB 3AMZA 2MJEA 3W1SC 3RT3B 5J18A 1WE7A 2NMQA 2CHWA 3PV1A 2DZIA 3AI5A 2WXLA 1EF5A 2ZCCA 1CK1A 4JGHB 2KFKA 2J7QB 1Z2MA 3OAWA 3ZJVA 2MBHA 1HTOA 2QIEB 3AULA 3ZNID 3ZNGC 3AE3B 2G4SA 1YN4A 3AEAB 4W9FA 1AN8A 4UDUC 2M56B 1VR9A 3RZFA 4QAYA 2KJ6A 4C4VA 2XBBC 2WXPA 4WJNA 1B9RA 3N32A 1UELA 2BYEA 2K39A 1FFVA 4URKA 3MC0B 4WH4A 4A90A 3W9CB 3H6NA 2LD9A 2HDEA 2XEWA 3RCZA 1QT9A 2WXJA 2HD5B 2I38A 3HUIA 4GDKB 2N7EA 3Q3OC 4A20A 4HJGE 1PYWD 4FA6A 1R4NB 3EUB2 4CHKA 2L3ZA 4MT5A 2LRWA 4GU2A 1D5ZC 4RM8A 2L0TA 1I7HA 1T0YA 1C9FA 3ML8A 5G5HA 4AJWA 2GMIC 2JU6X 1C76A 1ZE3D 1CQVA 4IWQA 1ZW7A 3ZGZA 3HVZA 2L0FA 2LUMA 1E8XA 1FFUA 4REZA 3NVWA 1Y56A 3U4EG 4AQ7A 3Q8EA 3PPAA 4CYEA 1YJJA 4ICUA 2Q5WD 3W1SA 2WXHA 2DHZA 4NAWA 3ZNHB 2KWVB 2WXFA 4FLHA 3V61A 4DK5A 2LHDA 4LDTD 1N63A 1DYQA 3W1YA 1TBEA 4TUUA 4XDCA 4YSYB 2N9EB 2WXKA 4BOZB 2KANA 2K1FA 3WAMA 1P7EA 1V1PA 3GB1A 4ACFA 3C8YA 4W9KA 2BYTA 2IGGA 3PRZA 3P2BA 1ESFA 3NVZA 4RGMA 1E90A 4ZRQA 2MEKA 3PS6A 2N7DA 3M95A 3SD5A 2W82A 4K7UA 4FADA 3RNFC 2WX0A 2O2VA 4KVGB 3KVFB 2PW9A 1T6BX 3NZUA 4WWNA 1SSNA 4KZ0A 2LASA 3BK1A 2RGFA 1E9MA 3U7ZA 1STEA 3RNAC 3I5JC 2C5LC 5HI1A 1JWBD 4HCNB 1OEYA 1RWSA 5E6NA 3DVGY 2JXXA 3VTVA 1TS5A 4KGRA 1K8RB 2BKRB 3CSFA 4K3BA 1I4XA 2D10A 2CHXA 4N58A 5H92C 3DBRB 1H8CA 1NDDA 2X38A 4FHKA 5IAAC 3X23A 1VLBA 4A3PA 1MVKA 5C23A 3ZDTA 2KN5A 4YTNB 4RGNA 2LGIA 1GG3A 3FILA 2G9HD 4HROA 2JSVX 2INDC 4W9EA 2L00B 2Y5BB 1QZEA 4RFBA 2WX1A 1N60A 1A70A 1F77A 2FIDA 1WXMA 4M0WA 1ZDVA 3AM9A 1LO5D 2GOWA 2J0MA 1Z5SB 2E3TA 2KTFA 4KDLB 1EU3A 1E7VA 4CO7A 3HM6X 1V8CA 2K22A 5EE0A 2EMSA 1K53A 3FAHA 2OJWA 3N3KB 1I42A 3Q8CA 2PVOD 1VZ6A 1BT0A 1D5MC 2FE8A 5DCNA 3MFGA 3TUOA 3VR9B 2DAJA 4XYCA 4BKTA 3Q3JA 1VCBA 2PMVA 1HQRD 4DQOC 3I57A 4B9KA 1RLFA 4MSQB 1FRDA 3NOBA 1VZ7A 1TTNA 1VJKA 3RUIB 3T8MA 1GC7A 2V3PA 1EWYC 2KXJA 2KAJA 2CU3A 2FCQA 3VDZA 4DHJB 1NI2A 3H9DA 4K81A 2BVCA 4MGIE 2K5PA 1PGAA 3TBLD 3SEBA 2BTEA 1TT5B 2MJ3A 1SE2A 4F1SA 5MPOA 4LNKA 3UQBA 2G45B 2B3AA 3N1YC 1YJIA 2K8BA 3SFEB 2BS2B 3ZDMC 2Z0EB 3DWGC 3E56A 1EO6A 3LYYA 2SAKA 4E3CA 4P1BC 1UBQA 2LUEA 2EMTA 2KMCA 4YXDB 3BVMA 1OEYJ 2O2VB 2KVRA 2CS4A 2L8JA 3PHWB 2QMTA 1YIWA 2D3BA 3AE8B 2L7RA 3DVNU 2KJRA 4BFRA 4L2YA 2BGFA 1S1QB 2FUHB 2V3SA 3HHMA 3ZLZA 1QQRA 1EU4A 1FCCC 1FPYA 4KIKB 3WA0A 3N1ZC 4X57B 3IXSA 4XGAB 5D3IB 5KHOA 5C1ZA 4FJZA 1X1MA 4MH8A 5JXVA 2N1WA 1FMAD 3B2FA 1V81A 4KIKA 5EE9A 2YLMA 2O6VA 1WRIA 4F7ZA 2QHOA 2JRIB 1LGRA 2LVPA 4IKGA 1IBXA 2EELA 1XLNA 1M94A 1JALA 2WDTB 4HRSA 2LGYA 4BOSC 3B9JA 3AN1A 1VD2A 3I3TB 5JH5C 2OOBB 1JCKB 1N6ZA 3O65B 2PTLA 1ZUD2 3O13A 3R7RA 1R7SA 2MBBB 1MHHE 3ENEA 1KLGD 2K25A 2O6VB 4ZRKA 5I4DA 1OQYA 4N9F4 4IM2A 3KQ4A 1FCLA 4FBJB 5IOIA 3AEBB 4ITKA 4LNIA 4B0MA 5JHAA 5L83A 3D32A 2INNE 4RMAA 3P42A 1KFYB 3A4RA 3I63C 2QC8A 3SR6A 4K7WA 5BO4B 2GBNA 4P1CC 1IYFA 3HRDD 1Q10A 4IUMB 2AQ3B 1L4DB 3M63B 3Q8FA 2D5GA 5C3JB 4NAMA 1QILA 1I4HA 1MJDA 1WF9A 1VRAB 1SIJA 2RSUA 4HEA1 2NVUI 4P7IA 4KV2A 2D11A 4XX5A 2KC1A 3T9LA 2LFIA 5L95C 4ANXA 2PEAA 3IBEA 2X8XX 3ZO5B 1V5TA 1E6EB 2AL3A 1V9JA 3KUZA 3QCAA 4XZ4A 2DENB 5DPSA 4MJSB 1RM6C 2KFKB 1V49A 4C56C 3U2SC 2DX5B 4MGYE 3AXCA 1Q0WB 1FXTB 2DZKA 3DHHC 1I4GA 4EUTA 4LDTB 4JX1C 3AEFB 2L83A 4Q2JA 2KQSA 3KW5B 3QA8A 3TJPA 3IG3A 3U7DA 2VH1A 1QOAA 3VFKA 4BKSA 3RFZB 2VZKB 1BXTA 4MM3A 1FD6A 1Q5WB 4WWMA 1C4AA 5AZHA 1NYQA 4HVBA 2KLCA 3EA6A 1JROA 4J3OD 4DXGA 3T3NA 3L54A 2KN4A 4G0NB 5AUIA 1WJNA 3AE1B 4N6EB 4C80A 2MP2B 1BMLC 1XCTL 1U4AA 3EFCA 3VRBB 1XT9B 4TKNA 1WGDA 1N5XA 3TSSA 3VH4B 1P0RA 3U8ZA 1E7PB 1KLUD 4WJPA 3DVGX 2M4NA 1RAXA 3PGEA 5BYSA 2NPTA 4P16A 5AEKB 4GLSC 1I4QA 1SGHA 3QQ8B 2WXRA 3LDZE 2FCSA 2N9PC 3APFA 2AYOB 1GOZA 1AW7A 3FILB 1IUEA 1YN3A 3Q2AC 4XE0A 3OWEB 2XN9C 5JHBA 1TGZB 4GOCA 2ZCBA 4M8MA 3R2TA 1CZPA 1MHXA 4PS8A 1YOVB 1F9JA 2LJ5A 5D94A 2REXA 2N9XA 3L08A 4DHJD 4NJ7A 1IGDA 2KNBA 1N61A 1FNWA 3HVDA 4K1RB 3W2DA 3DHIC 3K9OB 3NG0A 2K6QA 2WNMA 3ALBA 2ON8A 4EZLA 3DBHI 1BUIC 3UF8A 1L6VA 5BMHA 2N1VA 4HCPB 4F8CB 3ZTDA 4DXAB 1L7YA 3BIID 2DLBA 1V1PB 2BF8B 1C77A 2WS3B 4A9AA 3AE2B 5BYQA 1K51A 1V5OA 1TKYA 4ANVA 2DAFA 3QARA 4WJOA 1WH3A 1S3SG 1KRHA 1GNUA 4KSKC 2PKOA 2N7JA 1IPGA 4LNOA 1WR1A 4HDQA 4PYUA 5DPRA 1T0SC 2KJHB 2XNAC 3DQVA 5JZEB 1JQ4A 4KGSA 4ZYNA 4WQMA 3R8BA 2LGDA 3A9KB 3H7PB 3APCA 2IGHA 3KWLA 1R4NI 2CU1A 3H8HA 5GMVA 2KDFB 1XLQA 2KQ4X 1LM8B 3PO0A 1T0QC 2ZZPB 3L17A 3CIRB 2WHIA 3ZJTA 3P4QB 3AE5B 1KM7A 1WM2A 4NY0A 4WIPA 2VZKD 2Y5PA 1C1YB 4II3B 3RPFC 1UNSA 3GE3C 2BS4B 4NAWB 1FRRA 3EGRA 4O1NA 2BW2A 5G2NA 1SEBD 2V4LA 2LHEA 3QHTA 4LNNA 1UD7A 4ICVA 1C4CA 3WIMA 4ASWC 4N59A 5E6JA 5IKCM 1WI0A 4RH6A 5DPWA 4J6IA 3ZUNA 2MJDA 1EM7A 2IGDA 1QOBA 4I6PA 1ZXHA 5J17A 2FIFA 3V6CB 4M00A 4MEMA 4OZCA 1FNUA 3PVLA 1MPEA 4W9DA 1YQBA 4ANWA 4W9LA 4TQ1A 5E6OA 1E8ZA 5EE3A 4II2B 3AH7A 4PT5A 2WQYB 1D3ZA 1AYFA 3ZKJC 4YSXB 1PDXA 3V05A 4B95A 4GDLA 2KC2A 2WXNA 4GDKA 4EFOA 1KLVA 1ISNA 3P1MA 3TL5A 5BMIA 2IYDB 3BZDB 1KOTA 3DCGA 2BQQA 2V1YA 2C7MB 1GC6A 3BVGA 3VTWA 2DNFA 2EKIA 1TY0A 4ZHOA 3IT6B 2MHJA 1WRDB 3TEXA 2IDYA 4EOYA 1JWSD 4HKQA 4YSZB 3QK0A 2IZVB 4RNAA 2WU2B 2HTME 1F2RC 1YMHE 2A5UA 2GBRA 2WU5B 2KK8A 2J53A 2MP2A 4NPNA 4L1BA 1NI3A 2LEKA 3EECA 2J4XA 2RPQA 3JVZX 3AE9B 2K6DB 2WDVB 1P7FA 2FBWB 5J2RA 3ML9A 4MDKE 1E5WA 2ZNVB 3AE7B 4KGTA 1PFDA 2AWTA 1V80A 2MX2A 5CX3A
chains in the Genus database with same CATH topology
1V6EA 4HXDA 3MTNB 4PS7A 4KIKB 4ZRIA 3WA0A 3LJ3A 4X57B 5KHOA 4BKGA 2UWQA 2PE6B 2MLBA 2N4FA 5C1ZA 4FJZA 1UGMA 1X1MA 3RZWC 4B6WA 4DBGA 2N1WA 3GOEA 3OJ4B 2HE7A 1EUVB 1V81A 4IWPA 2L05A 4KIKA 3VUYA 1XD3B 3PTFC 1Q1OA 4JQWC 4RM9A 2YLMA 2LI5A 2O6VA 4M8NA 4F7ZA 2KFJA 2QHOA 2JRIB 4HWIB 2LVPA 4XC2A 2KDEB 2KLGA 2MQJA 4LJOB 4BVUC 1WX8A 1M94A 4E74A 2WDTB 1WXSA 2LGYA 3ECIA 4BOSC 4GGQA 5JH5C 1VD2A 3I3TB 3MHSD 4WQOB 5D2MB 2WWZA 4WWOA 2OOBB 4G11A 2K8HA 4PYZA 1SIFA 3RD2A 2NPTB 3TCAA 2C9WB 3O65B 4FJVB 4FULA 1EF1A 3HM3A 3H7SA 5D6JB 4A3OA 2CKHB 2DZJA 3ONSA 4FHJA 2XK5B 2IY1B 3R7RA 3PT2B 2MBBB 2BYFA 3R66C 1L2NA 3KH0A 3ENEA 2MCNB 2K25A 2O6VB 3PSEB 3U30A 2PE9A 3WAOA 3RULA 2NCNA 4WAAA 4ZRKA 1V86A 1OQYA 4N9F4 4I6NB 1P98A 3V62A 4IM0A 1R4MI 2DYOA 3A33B 4IM2A 1WJ6A 3TIXA 2J0KA 4FBJB 2UYZB 2W9NA 1WJ4A 1OTRB 2KZRA 5G55A 2O6VD 5CHVC 5JHAA 5L83A 1TZ1A 3D32A 2BWES 1WGHA 5KHQA 3SHQA 2ZVNA 3R7QA 3B08A 4RMAA 3S2AA 3UINB 1UH6A 3A4RA 1RRBA 5AZFA 3TMPB 1LXDA 1WMHB 2CHZA 2GBNA 2NR2A 4K7WA 1WY8A 2G4DB 2KWUB 5BO4B 2VRRB 2A4ZA 4W9IA 2BKFA 2OJRA 3WANA 1IYFA 4IUMB 3M63B 2IO1B 3KUCB 4GXBA 2HJ8A 3UIPB 1J19A 3RT3B 4MSMB 3W1SC 1WE7A 2LWPA 1NBFC 2CHWA 3EFUA 2DZIA 3AI5A 3PV1A 4GSWA 4W9GA 2D3GA 1EF5A 1WF9A 3QC8B 3RYTA 2ZCCA 2RSUA 4JGHB 2KFKA 1MG8A 3V60A 2J7QB 3DDCB 1Z2MA 2NVUI 3OAWA 2MBHA 3AULA 4P7IA 4KV2A 3ZNID 2D11A 2FCNA 4XX5A 2M1MA 2KC1A 1SE9A 3A1QB 3ZNGC 3NY5A 2G4SA 2JWZA 4W9FA 3T9LA 4ANXA 5L95C 2PEAA 4MGKE 3IBEA 3RZFA 3VUXA 2KJ6A 2MSED 3ZO5B 3Q3FA 1V5TA 2AL3A 2FCMA 2KTRA 3WALA 1V9JA 2XBBC 3KUZA 3QCAA 4XZ4A 2DENB 4W9JA 5DPSA 3PLVA 4WJNA 5TR5A 3VAWA 2MBOA 4MJSB 5AZGA 4GB9A 3N32A 2KFKB 1V49A 1Y8RC 4DDID 4AP4C 2LZ6A 2DX5B 1E8YA 1UELA 2BYEA 1P9DU 2JUOA 2K39A 3PREA 4MGYE 3AXCA 2JRHA 3VXWA 1Q0WB 1FXTB 4URKA 2DZKA 5LXIB 2K8CA 1WJUA 3H6NA 4EUTA 4LDTB 2Z59B 3PZDA 2LD9A 4HDOA 3CSTA 2LGXA 2XEWA 3RCZA 1OGWA 4OVVA 2KQSA 1WX9A 2HD5B 3KW5B 3QA8A 3TJPA 3IG3A 1CMXB 3U7DA 1WIAA 3VFKA 4BKSA 2D07B 4MM3A 2KWCA 4GDKB 1Q5WB 2N7EA 4W9HA 5AZHA 4A20A 2L76A 4EZKA 4HLEA 4FA6A 4CHKA 2L3ZA 2KLCA 4HVBA 2LRWA 4GU2A 3C0RB 3BY4B 2KQ7A 4RM8A 2FAZA 3H7PA 2L0TA 1T0YA 4GMVA 3L54A 3ML8A 3KYCD 4G0NB 1WJNA 2KMAA 2MP2B 5CX3A 1V2YA 1LFDA 1G6JA 1U4AA 4AJWA 1H4RA 1XT9B 2GMIC 4TKNA 3H1UA 4IWQA 1ZW7A 1RFAA 1WGDA 4DDGD 2L0FA 3VH4B 3DOWA 1P0RA 3U8ZA 1E8XA 2HTHA 3K9PB 4WJPA 3NZSA 3DVGX 2M4NA 4BBNC 1RAXA 3PGEA 2NPTA 5AEKB 3ZTCA 2AEHA 3ZNZB 1SGHA 2LXCA 3QQ8B 3LDZE 2LVQA 3A9JA 2FCSA 3PPAA 4CYEA 4ICUA 2N9PC 3W1SA 3APFA 2DHZA 2M17A 2AYOB 2KWVB 4FLHA 4NAWA 3V61A 3ZNHB 4DK5A 5IA7A 4KZCA 3PRPB 4G50A 4LDTD 2I1KA 2C60A 3W1YA 4DHZB 4JLCA 1KJTA 1TBEA 4TUUA 3IHPC 5JHBA 1TGZB 4GOCA 2DYBA 2N9EB 2ZCBA 3VHTC 3DVNV 3IVFA 4GN1A 4HPMB 4M8MA 4EEWA 2R2OA 4PS8A 4BOZB 2KANA 2K1FA 3WAMA 1F9JA 3CF6E 2LJ5A 2JVCA 5D94A 2REXA 2N9XA 3L08A 1E7UA 4W9KA 1WR6E 4DHJD 4NJ7A 4IG7B 3AU5A 2KNBA 3P2BA 3PRZA 4FN2A 1J0GA 2KD0A 4K1RB 1E90A 3R3MA 2MBEA 4JL9A 3K9OB 2BWFA 3PS6A 2N7DA 3L0WB 4I6LB 2K6QA 3M95A 3ALBA 3SD5A 4PS3A 4K7UA 1WGYA 4KDIC 4FADA 4EZLA 2WX0A 3DBHI 2O2VA 4HJKA 1WGGA 4JIOU 4KVGB 4MH0E 3UF8A 3X0WA 3L13A 2N1VA 2RD0A 2G3QB 2MA9B 2MWSB 4HCPB 3JSVB 3KVFB 4WWPA 4F8CB 3ZTDA 3L16A 3ZRFA 1YX5B 4AJYB 4DXAB 1L7YA 3QWZB 2RR9A 3KUDB 4TQ0A 3NZUA 4TV3A 3EHVA 1GUAB 2KOXA 1I35A 2BF8B 4NQKE 4E71A 4WWNA 1UBIA 4EKUA 4KZ0A 1C3TA 4NNJB 1V5OA 4M0WB 2EKEC 4ANVA 2DAFA 2JZZA 2LASA 3QARA 4MJSA 4WJOA 4ZDVA 3B1LX 1WH3A 1S3SG 5LXHA 1GJZA 2ZPYA 3PLUA 1GNUA 1WX7A 4KSKC 3V6EB 2RGFA 3JW0X 2CR5A 1WYWB 2ZNVC 2C5LC 1IPGA 2NBWB 2MRPA 1WR1A 4HCNB 1OEYA 4HDQA 5E6NA 3DVGY 2JXXA 3VTVA 2R2QA 3N30A 4MGZE 2Z0DB 1WGRA 4PYUA 5DPRA 4AWJA 2KJHB 3DQVA 3IFWB 5JZEB 1XQQA 3QIJA 1K8RB 2BKRB 3CSFA 1WZ3A 2D10A 3QJZA 4ZYNA 2CHXA 2FNJB 1H8CA 5CHWA 1JRUA 1NDDA 3ZIMA 3UGBB 2LGDA 3QAQA 3A9KB 4FHKA 2GBJA 3H7PB 5IAAC 3JSVA 5D7GA 3APCA 3X23A 2LRUA 4YL8A 1P1AA 4A3PA 3VUWA 1YD8U 4ZRJA 1R4NI 2CU1A 3BINA 5GMVA 2ZJDA 2KDFB 4NJ6A 2GBKA 3UQAA 1A5RA 4GDLB 1LM8B 2KDBA 2ZZPB 3L17A 1E8WA 5C23A 2LXAA 3DBRI 2KN5A 3ZDTA 5J18A 2IY0B 2NBVB 4LCDE 2JZ3B 4MELA 1KM7A 1WM2A 2ZEQA 5HKHA 4NY0A 2BPSA 3A4SC 3SU8X 1C1YB 1GG3A 1HE8A 1WFYA 4II3B 3ZW3A 3DBLI 2KX3A 2L00B 2Y5BB 2ASQA 2KKCA 4IC7B 4NAWB 4W9EA 2DYMA 2JPHA 1QZEA 2WX1A 2AL6A 5G2NA 2D2QA 1AARA 3A9JB 1ZGUB 2V4LA 3AU4A 4LJPB 2FIDA 1WXMA 3QHTA 2NBUA 3PRMB 1UD7A 4ICVA 2C7NB 3WIMA 4ASWC 2GOWA 2NS5A 4AOFA 2KX0A 2M0XA 1WI0A 2J0MA 5DPWA 4J6IA 3ZUNA 4G3XB 2JF5A 3M62B 2KO3A 1Z5SB 1ZKHA 2KTFA 4I6PA 4KDLB 1E7VA 5J17A 4CO7A 1YJ1A 4WJQA 4IWOA 3HM6X 4ANUA 4KSLC 2FIFA 2KTRB 3M3JA 5LLIA 3NS8A 2EMSA 3V6CB 1J8CA 4MEMA 3PVLA 2KHWB 3N3KB 2M8SA 1I42A 4W9DA 1YQBA 4ANWA 4W9LA 3A1QA 4TQ1A 2KDIA 5E6OA 1E8ZA 4II2B 2DZMA 1WE6A 3SDLC 3VVWB 1D3ZA 1BT0A 3ZKJC 2IBIB 4B95A 4GDLA 2ZPNA 2KC2A 2YVCA 5DCNA 1UZXB 4GDKA 4BKTA 2DAJA 4EFOA 1KLVA 1ISNA 3Q3JA 2BYVE 1VCBA 4OVUA 4B9KA 1RLFA 4MSQB 1YX6B 3TL5A 3NOBA 1TTNA 2IO0B 2IYDB 2C7HA 1KOTA 3A9KA 3RUIB 3T8MA 1GC7A 3DCGA 2KXJA 4BKSD 2J0JA 5FR6A 3OJ3A 2V1YA 2C7MB 2FCQA 3VDZA 4DHJB 3UIOB 1GC6A 5EDSA 3CMMB 1NI2A 5CTRC 3H9DA 2GBMA 3VH3B 4K81A 3VTWA 4BBNF 2PJHA 2WYQA 3HK0A 3APDA 4MGIE 3TBLD 4IW0A 1P3QU 2I1JA 2XK5A 5E6PA 4K7SA 1WRDB 3B0AA 4F1SA 3UQBA 4EOYA 2IO2B 2G45B 2B3AA 3PHXB 4IM3A 3WAPA 4AUQC 5CHFA 2MW5A 2IZVB 3QK0A 4DWFA 2JY6A 2LVOA 2IO3B 2GBRA 2A5UA 1IP9A 2K8BA 2PPHA 2ZVOA 3DPDA 3ZVVA 3ZDMC 2Z0EB 2KK8A 2JT4B 3MJWA 2MP2A 3JYUA 4HK2A 4NPNA 3OLMD 1EO6A 1WZ0A 4E3CA 4HPLB 3KYDD 3EECA 3HIZA 3NHEB 1UBQA 2LUEA 1WXAA 2EMTA 2RPQA 3JVZX 2MBQA 2KMCA 1LQBA 2K6DB 1OEYJ 2O2VB 4EZJA 4NQLB 2KVRA 2CS4A 3DBSA 2L8JA 3VQIA 1PQSA 3PHWB 5J2RA 3ML9A 3ZRCA 1WMHA 4DHZE 1YIWA 4GIVA 1E5WA 2ZNVB 3QX1A 4MDKE 1WXVA 2L7RA 3DVNU 5DPTA 2KJRA 4FJYA 4BFRA 2BGFA 3GZNI 3L10B 1S1QB 2AWTA 1V80A 3EC8A 2FUHB 2V3SA 3HHMA 3VTUA 2MX2A 3ZLZA 1WM3A 4W9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6E A;  4HXD A;  3MTN B;  4PS7 A;  4KIK B;  4ZRI A;  3WA0 A;  3LJ3 A;  4X57 B;  5KHO A;  4BKG A;  2UWQ A;  2PE6 B;  2MLB A;  2N4F A;  5C1Z A;  4FJZ A;  1UGM A;  1X1M A;  3RZW C;  4B6W A;  4DBG A;  2N1W A;  3GOE A;  3OJ4 B;  2HE7 A;  1EUV B;  1V81 A;  4IWP A;  2L05 A;  4KIK A;  3VUY A;  1XD3 B;  3PTF C;  1Q1O A;  4JQW C;  4RM9 A;  2YLM A;  2LI5 A;  2O6V A;  4M8N A;  4F7Z A;  2KFJ A;  2QHO A;  2JRI B;  4HWI B;  2LVP A;  4XC2 A;  2KDE B;  2KLG A;  2MQJ A;  4LJO B;  4BVU C;  1WX8 A;  1M94 A;  4E74 A;  2WDT B;  1WXS A;  2LGY A;  3ECI A;  4BOS C;  4GGQ A;  5JH5 C;  1VD2 A;  3I3T B;  3MHS D;  4WQO B;  5D2M B;  2WWZ A;  4WWO A;  2OOB B;  4G11 A;  2K8H A;  4PYZ A;  1SIF A;  3RD2 A;  2NPT B;  3TCA A;  2C9W B;  3O65 B;  4FJV B;  4FUL A;  1EF1 A;  3HM3 A;  3H7S A;  5D6J B;  4A3O A;  2CKH B;  2DZJ A;  3ONS A;  4FHJ A;  2XK5 B;  2IY1 B;  3R7R A;  3PT2 B;  2MBB B;  2BYF A;  3R66 C;  1L2N A;  3KH0 A;  3ENE A;  2MCN B;  2K25 A;  2O6V B;  3PSE B;  3U30 A;  2PE9 A;  3WAO A;  3RUL A;  2NCN A;  4WAA A;  4ZRK A;  1V86 A;  1OQY A;  4N9F 4;  4I6N B;  1P98 A;  3V62 A;  4IM0 A;  1R4M I;  2DYO A;  3A33 B;  4IM2 A;  1WJ6 A;  3TIX A;  2J0K A;  4FBJ B;  2UYZ B;  2W9N A;  1WJ4 A;  1OTR B;  2KZR A;  5G55 A;  2O6V D;  5CHV C;  5JHA A;  5L83 A;  1TZ1 A;  3D32 A;  2BWE S;  1WGH A;  5KHQ A;  3SHQ A;  2ZVN A;  3R7Q A;  3B08 A;  4RMA A;  3S2A A;  3UIN B;  1UH6 A;  3A4R A;  1RRB A;  5AZF A;  3TMP B;  1LXD A;  1WMH B;  2CHZ A;  2GBN A;  2NR2 A;  4K7W A;  1WY8 A;  2G4D B;  2KWU B;  5BO4 B;  2VRR B;  2A4Z A;  4W9I A;  2BKF A;  2OJR A;  3WAN A;  1IYF A;  4IUM B;  3M63 B;  2IO1 B;  3KUC B;  4GXB A;  2HJ8 A;  3UIP B;  1J19 A;  3RT3 B;  4MSM B;  3W1S C;  1WE7 A;  2LWP A;  1NBF C;  2CHW A;  3EFU A;  2DZI A;  3AI5 A;  3PV1 A;  4GSW A;  4W9G A;  2D3G A;  1EF5 A;  1WF9 A;  3QC8 B;  3RYT A;  2ZCC A;  2RSU A;  4JGH B;  2KFK A;  1MG8 A;  3V60 A;  2J7Q B;  3DDC B;  1Z2M A;  2NVU I;  3OAW A;  2MBH A;  3AUL A;  4P7I A;  4KV2 A;  3ZNI D;  2D11 A;  2FCN A;  4XX5 A;  2M1M A;  2KC1 A;  1SE9 A;  3A1Q B;  3ZNG C;  3NY5 A;  2G4S A;  2JWZ A;  4W9F A;  3T9L A;  4ANX A;  5L95 C;  2PEA A;  4MGK E;  3IBE A;  3RZF A;  3VUX A;  2KJ6 A;  2MSE D;  3ZO5 B;  3Q3F A;  1V5T A;  2AL3 A;  2FCM A;  2KTR A;  3WAL A;  1V9J A;  2XBB C;  3KUZ A;  3QCA A;  4XZ4 A;  2DEN B;  4W9J A;  5DPS A;  3PLV A;  4WJN A;  5TR5 A;  3VAW A;  2MBO A;  4MJS B;  5AZG A;  4GB9 A;  3N32 A;  2KFK B;  1V49 A;  1Y8R C;  4DDI D;  4AP4 C;  2LZ6 A;  2DX5 B;  1E8Y A;  1UEL A;  2BYE A;  1P9D U;  2JUO A;  2K39 A;  3PRE A;  4MGY E;  3AXC A;  2JRH A;  3VXW A;  1Q0W B;  1FXT B;  4URK A;  2DZK A;  5LXI B;  2K8C A;  1WJU A;  3H6N A;  4EUT A;  4LDT B;  2Z59 B;  3PZD A;  2LD9 A;  4HDO A;  3CST A;  2LGX A;  2XEW A;  3RCZ A;  1OGW A;  4OVV A;  2KQS A;  1WX9 A;  2HD5 B;  3KW5 B;  3QA8 A;  3TJP A;  3IG3 A;  1CMX B;  3U7D A;  1WIA A;  3VFK A;  4BKS A;  2D07 B;  4MM3 A;  2KWC A;  4GDK B;  1Q5W B;  2N7E A;  4W9H A;  5AZH A;  4A20 A;  2L76 A;  4EZK A;  4HLE A;  4FA6 A;  4CHK A;  2L3Z A;  2KLC A;  4HVB A;  2LRW A;  4GU2 A;  3C0R B;  3BY4 B;  2KQ7 A;  4RM8 A;  2FAZ A;  3H7P A;  2L0T A;  1T0Y A;  4GMV A;  3L54 A;  3ML8 A;  3KYC D;  4G0N B;  1WJN A;  2KMA A;  2MP2 B;  5CX3 A;  1V2Y A;  1LFD A;  1G6J A;  1U4A A;  4AJW A;  1H4R A;  1XT9 B;  2GMI C;  4TKN A;  3H1U A;  4IWQ A;  1ZW7 A;  1RFA A;  1WGD A;  4DDG D;  2L0F A;  3VH4 B;  3DOW A;  1P0R A;  3U8Z A;  1E8X A;  2HTH A;  3K9P B;  4WJP A;  3NZS A;  3DVG X;  2M4N A;  4BBN C;  1RAX A;  3PGE A;  2NPT A;  5AEK B;  3ZTC A;  2AEH A;  3ZNZ B;  1SGH A;  2LXC A;  3QQ8 B;  3LDZ E;  2LVQ A;  3A9J A;  2FCS A;  3PPA A;  4CYE A;  4ICU A;  2N9P C;  3W1S A;  3APF A;  2DHZ A;  2M17 A;  2AYO B;  2KWV B;  4FLH A;  4NAW A;  3V61 A;  3ZNH B;  4DK5 A;  5IA7 A;  4KZC A;  3PRP B;  4G50 A;  4LDT D;  2I1K A;  2C60 A;  3W1Y A;  4DHZ B;  4JLC A;  1KJT A;  1TBE A;  4TUU A;  3IHP C;  5JHB A;  1TGZ B;  4GOC A;  2DYB A;  2N9E B;  2ZCB A;  3VHT C;  3DVN V;  3IVF A;  4GN1 A;  4HPM B;  4M8M A;  4EEW A;  2R2O A;  4PS8 A;  4BOZ B;  2KAN A;  2K1F A;  3WAM A;  1F9J A;  3CF6 E;  2LJ5 A;  2JVC A;  5D94 A;  2REX A;  2N9X A;  3L08 A;  1E7U A;  4W9K A;  1WR6 E;  4DHJ D;  4NJ7 A;  4IG7 B;  3AU5 A;  2KNB A;  3P2B A;  3PRZ A;  4FN2 A;  1J0G A;  2KD0 A;  4K1R B;  1E90 A;  3R3M A;  2MBE A;  4JL9 A;  3K9O B;  2BWF A;  3PS6 A;  2N7D A;  3L0W B;  4I6L B;  2K6Q A;  3M95 A;  3ALB A;  3SD5 A;  4PS3 A;  4K7U A;  1WGY A;  4KDI C;  4FAD A;  4EZL A;  2WX0 A;  3DBH I;  2O2V A;  4HJK A;  1WGG A;  4JIO U;  4KVG B;  4MH0 E;  3UF8 A;  3X0W A;  3L13 A;  2N1V A;  2RD0 A;  2G3Q B;  2MA9 B;  2MWS B;  4HCP B;  3JSV B;  3KVF B;  4WWP A;  4F8C B;  3ZTD A;  3L16 A;  3ZRF A;  1YX5 B;  4AJY B;  4DXA B;  1L7Y A;  3QWZ B;  2RR9 A;  3KUD B;  4TQ0 A;  3NZU A;  4TV3 A;  3EHV A;  1GUA B;  2KOX A;  1I35 A;  2BF8 B;  4NQK E;  4E71 A;  4WWN A;  1UBI A;  4EKU A;  4KZ0 A;  1C3T A;  4NNJ B;  1V5O A;  4M0W B;  2EKE C;  4ANV A;  2DAF A;  2JZZ A;  2LAS A;  3QAR A;  4MJS A;  4WJO A;  4ZDV A;  3B1L X;  1WH3 A;  1S3S G;  5LXH A;  1GJZ A;  2ZPY A;  3PLU A;  1GNU A;  1WX7 A;  4KSK C;  3V6E B;  2RGF A;  3JW0 X;  2CR5 A;  1WYW B;  2ZNV C;  2C5L C;  1IPG A;  2NBW B;  2MRP A;  1WR1 A;  4HCN B;  1OEY A;  4HDQ A;  5E6N A;  3DVG Y;  2JXX A;  3VTV A;  2R2Q A;  3N30 A;  4MGZ E;  2Z0D B;  1WGR A;  4PYU A;  5DPR A;  4AWJ A;  2KJH B;  3DQV A;  3IFW B;  5JZE B;  1XQQ A;  3QIJ A;  1K8R B;  2BKR B;  3CSF A;  1WZ3 A;  2D10 A;  3QJZ A;  4ZYN A;  2CHX A;  2FNJ B;  1H8C A;  5CHW A;  1JRU A;  1NDD A;  3ZIM A;  3UGB B;  2LGD A;  3QAQ A;  3A9K B;  4FHK A;  2GBJ A;  3H7P B;  5IAA C;  3JSV A;  5D7G A;  3APC A;  3X23 A;  2LRU A;  4YL8 A;  1P1A A;  4A3P A;  3VUW A;  1YD8 U;  4ZRJ A;  1R4N I;  2CU1 A;  3BIN A;  5GMV A;  2ZJD A;  2KDF B;  4NJ6 A;  2GBK A;  3UQA A;  1A5R A;  4GDL B;  1LM8 B;  2KDB A;  2ZZP B;  3L17 A;  1E8W A;  5C23 A;  2LXA A;  3DBR I;  2KN5 A;  3ZDT A;  5J18 A;  2IY0 B;  2NBV B;  4LCD E;  2JZ3 B;  4MEL A;  1KM7 A;  1WM2 A;  2ZEQ A;  5HKH A;  4NY0 A;  2BPS A;  3A4S C;  3SU8 X;  1C1Y B;  1GG3 A;  1HE8 A;  1WFY A;  4II3 B;  3ZW3 A;  3DBL I;  2KX3 A;  2L00 B;  2Y5B B;  2ASQ A;  2KKC A;  4IC7 B;  4NAW B;  4W9E A;  2DYM A;  2JPH A;  1QZE A;  2WX1 A;  2AL6 A;  5G2N A;  2D2Q A;  1AAR A;  3A9J B;  1ZGU B;  2V4L A;  3AU4 A;  4LJP B;  2FID A;  1WXM A;  3QHT A;  2NBU A;  3PRM B;  1UD7 A;  4ICV A;  2C7N B;  3WIM A;  4ASW C;  2GOW A;  2NS5 A;  4AOF A;  2KX0 A;  2M0X A;  1WI0 A;  2J0M A;  5DPW A;  4J6I A;  3ZUN A;  4G3X B;  2JF5 A;  3M62 B;  2KO3 A;  1Z5S B;  1ZKH A;  2KTF A;  4I6P A;  4KDL B;  1E7V A;  5J17 A;  4CO7 A;  1YJ1 A;  4WJQ A;  4IWO A;  3HM6 X;  4ANU A;  4KSL C;  2FIF A;  2KTR B;  3M3J A;  5LLI A;  3NS8 A;  2EMS A;  3V6C B;  1J8C A;  4MEM A;  3PVL A;  2KHW B;  3N3K B;  2M8S A;  1I42 A;  4W9D A;  1YQB A;  4ANW A;  4W9L A;  3A1Q A;  4TQ1 A;  2KDI A;  5E6O A;  1E8Z A;  4II2 B;  2DZM A;  1WE6 A;  3SDL C;  3VVW B;  1D3Z A;  1BT0 A;  3ZKJ C;  2IBI B;  4B95 A;  4GDL A;  2ZPN A;  2KC2 A;  2YVC A;  5DCN A;  1UZX B;  4GDK A;  4BKT A;  2DAJ A;  4EFO A;  1KLV A;  1ISN A;  3Q3J A;  2BYV E;  1VCB A;  4OVU A;  4B9K A;  1RLF A;  4MSQ B;  1YX6 B;  3TL5 A;  3NOB A;  1TTN A;  2IO0 B;  2IYD B;  2C7H A;  1KOT A;  3A9K A;  3RUI B;  3T8M A;  1GC7 A;  3DCG A;  2KXJ A;  4BKS D;  2J0J A;  5FR6 A;  3OJ3 A;  2V1Y A;  2C7M B;  2FCQ A;  3VDZ A;  4DHJ B;  3UIO B;  1GC6 A;  5EDS A;  3CMM B;  1NI2 A;  5CTR C;  3H9D A;  2GBM A;  3VH3 B;  4K81 A;  3VTW A;  4BBN F;  2PJH A;  2WYQ A;  3HK0 A;  3APD A;  4MGI E;  3TBL D;  4IW0 A;  1P3Q U;  2I1J A;  2XK5 A;  5E6P A;  4K7S A;  1WRD B;  3B0A A;  4F1S A;  3UQB A;  4EOY A;  2IO2 B;  2G45 B;  2B3A A;  3PHX B;  4IM3 A;  3WAP A;  4AUQ C;  5CHF A;  2MW5 A;  2IZV B;  3QK0 A;  4DWF A;  2JY6 A;  2LVO A;  2IO3 B;  2GBR A;  2A5U A;  1IP9 A;  2K8B A;  2PPH A;  2ZVO A;  3DPD A;  3ZVV A;  3ZDM C;  2Z0E B;  2KK8 A;  2JT4 B;  3MJW A;  2MP2 A;  3JYU A;  4HK2 A;  4NPN A;  3OLM D;  1EO6 A;  1WZ0 A;  4E3C A;  4HPL B;  3KYD D;  3EEC A;  3HIZ A;  3NHE B;  1UBQ A;  2LUE A;  1WXA A;  2EMT A;  2RPQ A;  3JVZ X;  2MBQ A;  2KMC A;  1LQB A;  2K6D B;  1OEY J;  2O2V B;  4EZJ A;  4NQL B;  2KVR A;  2CS4 A;  3DBS A;  2L8J A;  3VQI A;  1PQS A;  3PHW B;  5J2R A;  3ML9 A;  3ZRC A;  1WMH A;  4DHZ E;  1YIW A;  4GIV A;  1E5W A;  2ZNV B;  3QX1 A;  4MDK E;  1WXV A;  2L7R A;  3DVN U;  5DPT A;  2KJR A;  4FJY A;  4BFR A;  2BGF A;  3GZN I;  3L10 B;  1S1Q B;  2AWT A;  1V80 A;  3EC8 A;  2FUH B;  2V3S A;  3HHM A;  3VTU A;  2MX2 A;  3ZLZ A;  1WM3 A;  4W9C A; 
#chains in the Genus database with same CATH topology
 1D5X C;  4ZRI A;  1UGM A;  2WXQ A;  4IWP A;  2L05 A;  1WWT A;  3RI7 C;  4JQW C;  1Q1O A;  3N20 C;  3AB5 A;  2KAC A;  4KX6 B;  2UU7 A;  4XWT A;  4LJO B;  1WX8 A;  2R61 A;  3VRA B;  3SFD B;  2INP E;  3Q14 C;  3ECI A;  4ZRP A;  4HKZ E;  1L5P A;  2K8H A;  3GS2 A;  2C9W B;  3L4P A;  3Q3N C;  3P4R B;  4FUL A;  2WXG A;  3H7S A;  1SB3 C;  2XK5 B;  3PT2 B;  3URY A;  2BYF A;  3R66 C;  1T3Q A;  3PSE B;  1JRP A;  2NCN A;  1K52 A;  4WAA A;  1P98 A;  4IM0 A;  1R4M I;  1IBX B;  3BYT B;  4NJC A;  2J0K A;  2W9N A;  2O6V D;  4S0R A;  3UI3 A;  4EE2 A;  3AEG B;  4S17 A;  3R7Q A;  1QKZ A;  1L0X B;  3S2A A;  2WXI A;  3UIN B;  1UH6 A;  3IAM 1;  1DOY A;  2CHZ A;  1WY8 A;  1R4M B;  2KWU B;  1SE4 A;  1AWD A;  2A4Z A;  2OJR A;  1YNT E;  4GXB A;  2IO1 B;  2HJ8 A;  3UIP B;  4MSM B;  1PGX A;  1RFK A;  4W9G A;  2D3G A;  3QC8 B;  3RYT A;  3RMK C;  2RDB C;  3DDC B;  4OHJ A;  3ZXR A;  2M1M A;  1QLB B;  3A1Q B;  1PGB A;  4MGK E;  1FNV A;  3FKY A;  3VUX A;  2MSE D;  3ZQ4 A;  1HZ5 A;  2FCM A;  3WAL A;  2KTR A;  5TR5 A;  4W9J A;  3PLV A;  2W3S A;  3LB8 C;  4GB9 A;  4DDI D;  4ZHP A;  1E8Y A;  2JUO A;  1P9D U;  3PRE A;  5LXI B;  1WJU A;  2QEJ C;  2Z59 B;  3PZD A;  3U52 E;  4JE3 B;  2HJ1 A;  3Q8A A;  1J7A A;  1CMX B;  1WIA A;  2D07 B;  2KWC A;  4EZK A;  4HLE A;  1GB4 A;  3C0R B;  4L23 A;  3BY4 B;  2KQ7 A;  2OHF A;  3IAS 1;  3KYC D;  2KMM A;  1TY2 A;  1UGJ A;  2KMA A;  1V2Y A;  3VR8 B;  1KTK A;  1LFD A;  4A55 A;  5IN7 A;  5BMG A;  3DBH B;  3H1U A;  1RFA A;  4YTM B;  1GAQ B;  1OQQ A;  1XLO A;  3N9Y C;  3K9P B;  4BBN C;  2J52 A;  1SBB B;  4YT0 B;  3ZTC A;  2GLS A;  2KWD A;  1IGC A;  2LVQ A;  3A9J A;  1DOX A;  4KZC A;  2PLP A;  2Y5C A;  2C60 A;  2BB5 A;  1KJT A;  3RN9 C;  3IHP C;  2DYB A;  3VHT C;  3DVN V;  3IVF A;  4GN1 A;  4EEW A;  3N1X C;  1HA5 A;  2R2O A;  3CF6 E;  4JWU C;  1NEN B;  4IG7 B;  4FN2 A;  1J0G A;  3R3M A;  2MBE A;  4JL9 A;  2BWF A;  2K3U A;  4I6L B;  4DXF A;  4H2A A;  3ZXV A;  4A6Q A;  3GP7 A;  3L13 A;  2MA9 B;  2MWS B;  4WWP A;  3L16 A;  3ZRF A;  1YX5 B;  4USA A;  3QWZ B;  2RR9 A;  2J42 A;  1GUA B;  2KOX A;  4NQK E;  4E71 A;  1FO4 A;  5T8I A;  1D4B A;  1UBI A;  1JML A;  2GB1 A;  3LXF A;  4EKU A;  1ACC A;  2N9L A;  4M0W B;  2JZZ A;  4MJS A;  4A8X C;  5LXH A;  2ZPY A;  3PLU A;  3V6E B;  3JW0 X;  1WYW B;  2ZNV C;  2W55 A;  2QIL A;  1UWX A;  2NBW B;  2MRP A;  4MGZ E;  2Z0D B;  3BK2 A;  1WGR A;  3IFW B;  1XQQ A;  1WZ3 A;  2M0A A;  2FNJ B;  4ZYS A;  3B2G A;  5CHW A;  1J7C A;  1JRU A;  3Q6B A;  3ZIM A;  3PZ7 A;  3QAQ A;  4IOI E;  4OZB A;  5D7G A;  4YL8 A;  1P1A A;  3GZN B;  1YD8 U;  1F1H A;  2JYT A;  1L4Z B;  1I4P A;  4ZRJ A;  3W5V B;  4NJ6 A;  3UQA A;  1ZP0 B;  4NZL B;  2KDB A;  2IY0 B;  2H89 B;  4LCD E;  1ET6 A;  1ZXI A;  2JZ3 B;  3CWI A;  2ZW0 A;  4P6V F;  5HKH A;  3A4S C;  3RNG C;  3SU8 X;  3T3O A;  3DBL I;  2KX3 A;  4US8 A;  4OW0 A;  1NYR A;  2DYM A;  2JPH A;  2QSD A;  2AL6 A;  2D2Q A;  4TMA B;  1AAR A;  4LJP B;  3ZJU A;  1TS3 A;  2NBU A;  3PRM B;  1YQ4 B;  1TS4 A;  2KX0 A;  3BWU D;  3TEY A;  2JF5 A;  2KO3 A;  1ZKH A;  1RYJ A;  2Y3A A;  1V1O A;  4IWO A;  3I9V 1;  4ANU A;  1DOI A;  1L6U A;  1J8C A;  3J9C A;  2CJO A;  4CQN A;  2KDI A;  2RPV A;  1XLP A;  1WE6 A;  3SDL C;  2IBI B;  2YVC A;  2KVZ A;  1FXI A;  2BYV E;  4OVU A;  3MHZ A;  1YX6 B;  2RMM A;  1F0Z A;  1ENF A;  2C7H A;  2ACZ B;  1ZDX A;  3TEZ A;  4US9 A;  4BKS D;  2PIA A;  5EDS A;  3CMM B;  2WDR B;  2BB6 A;  3MC9 A;  3VH3 B;  3HK0 A;  3APD A;  1P3Q U;  3DHG C;  2XK5 A;  4K7S A;  2IJ0 A;  1CJE A;  2IO2 B;  3PHX B;  3WAP A;  2NTT A;  1WGK A;  2MW5 A;  4DWF A;  2LVO A;  2IO3 B;  1HTQ A;  4LK0 M;  1IP9 A;  2INC C;  2PPH A;  4YTP B;  3ZVV A;  2N9K A;  3MJW A;  3JYU A;  3RNE C;  2LGS A;  4HPL B;  2QJL A;  4C7Z A;  3HIZ A;  2AQ2 B;  2MBQ A;  1C4P A;  4EZJ A;  5GXG B;  1PQS A;  1WMH A;  4DHZ E;  3MP9 A;  5DPT A;  3VTU A;  4ZOH C;  3ABV B;  2GI9 A;  1WM3 A;  4OVZ A;  3IT4 B;  4PS7 A;  1YN5 A;  3LJ3 A;  4MM3 B;  2PE6 B;  2MLB A;  2WDQ B;  1C78 A;  5G5G A;  2MH7 A;  4DBG A;  1F2R I;  3GOE A;  3OJ4 B;  4C7Y A;  3FC4 A;  3PTF C;  5IP4 D;  1JWU D;  4M8N A;  3DBL B;  3RNB C;  4HWI B;  2TSS A;  2KDE B;  2MQJ A;  3TEW A;  4E74 A;  1VDV A;  4GGQ A;  2QDF A;  4WQO B;  2WWZ A;  3AE6 B;  3NRZ A;  4G11 A;  4LLG M;  5IO9 A;  5EE1 A;  4PYZ A;  1SIF A;  3RD2 A;  3TCA A;  1TZO A;  1D6E C;  1UF0 A;  4A3O A;  2DZJ A;  3ONS A;  4XDD A;  2DWQ A;  1N62 A;  1UWM A;  1SXT A;  3WAO A;  2PE9 A;  3RUL A;  2BBC A;  1V86 A;  1XCQ L;  2DBY A;  4I6N B;  3A33 B;  2DYO A;  1WJ6 A;  3WCQ A;  4TSS A;  1OTR B;  2KZR A;  4RF1 A;  3Q69 A;  2WGS A;  1MFW A;  1WGH A;  3NUH B;  5KHQ A;  3SHQ A;  4M01 A;  1SF0 A;  3Q3M C;  4RGT A;  5AZF A;  3TMP B;  3W5U B;  1WMH B;  2NR2 A;  2G4D B;  1MI0 A;  1WXQ A;  2BKF A;  3KWV A;  3WAN A;  1TYG B;  5FKA C;  5C2T B;  1J19 A;  2LWP A;  1NBF C;  3EFU A;  4GSW A;  4C00 A;  3NJT A;  3MJ5 A;  1MG8 A;  3V60 A;  1FM0 D;  2BS3 B;  2FCN A;  1SE9 A;  3NY5 A;  2JWZ A;  2YEP B;  4LTU A;  3Q3F A;  1KF6 B;  1PUT A;  1FEH A;  3VAW A;  2MBO A;  5AZG A;  1TS2 A;  4ARC A;  1Y8R C;  3AEE B;  2CJN A;  2LZ6 A;  4AP4 C;  5HHD G;  4ARI A;  2ICI A;  3VXW A;  2JRH A;  2OED A;  2K8C A;  4KKI A;  4HDO A;  3CST A;  2LGX A;  1VZ8 A;  1OGW A;  4OVV A;  1WX9 A;  1XXG A;  2QCZ A;  2L1A A;  1DGJ A;  2BT6 A;  4W9H A;  2L76 A;  1JW9 D;  1ZPS A;  3P4S B;  1HZ6 A;  1ROE A;  2FAZ A;  1TJE A;  3H7P A;  4GMV A;  1GB1 A;  4BZA A;  1G6J A;  1H4R A;  1SE3 A;  1M4V A;  2NTS A;  4DDG D;  3DOW A;  1NVI D;  2HTH A;  1C79 A;  5AUK A;  3NZS A;  2AEH A;  3ZNZ B;  1E0Z A;  2VH2 A;  2LXC A;  2YEP F;  1QF6 A;  5HFY A;  5HG2 A;  4LNF A;  2M17 A;  5IA7 A;  3PRP B;  4G50 A;  2I1K A;  4DHZ B;  3E9S A;  4JLC A;  2WXM A;  3BVZ A;  3ETR A;  2D3A A;  2Z8L A;  4HPM B;  4YWG G;  1K50 A;  4XWW A;  4OZA A;  2JVC A;  4K3C A;  1E7U A;  1WR6 E;  3AU5 A;  5D3D A;  2KD0 A;  4AS1 A;  1NEK B;  3L0W B;  5LNK 1;  4PS3 A;  2PVG C;  1WGY A;  4KDI C;  4B0E A;  4HJK A;  2LMC A;  1WGG A;  2RDG A;  4JIO U;  4MH0 E;  3X0W A;  2RD0 A;  2G3Q B;  2ONQ A;  3JSV B;  1EWC A;  2D3C A;  4AJY B;  1JWA D;  2W3R A;  3KUD B;  4TQ0 A;  4TV3 A;  3EHV A;  1I35 A;  1TIF A;  1C3T A;  4NNJ B;  2L32 A;  2EKE C;  2GRI A;  1L0Y B;  4ZDV A;  3B1L X;  1XF5 L;  1GJZ A;  1WX7 A;  2CR5 A;  2KDM A;  1YQ3 B;  2R2Q A;  3N30 A;  3PZ8 A;  4AWJ A;  1QOF A;  4KKJ A;  2N0S B;  3QIJ A;  3QJZ A;  2RDH A;  3UGB B;  3C19 A;  3P63 A;  2GBJ A;  3JSV A;  2IPK D;  1XEE A;  3R2I A;  2LRU A;  2H88 B;  3VUW A;  2LJI A;  1OFF A;  4WUR A;  2K0P A;  5H8Y E;  3BIN A;  2ZJD A;  2JX5 A;  2GBK A;  1A5R A;  4GDL B;  1E8W A;  2LXA A;  3DBR I;  3DWM A;  2NBV B;  4WAF A;  4MEL A;  2I2Y A;  2ZEQ A;  2JZP A;  2BPS A;  1HE8 A;  1WFY A;  1WYG A;  3ZW3 A;  2ASQ A;  2KKC A;  4IC7 B;  1QOG A;  2JQR B;  3A9J B;  1ZGU B;  3AU4 A;  2AQ1 B;  3OG5 A;  3NVV A;  2C7N B;  2K9X A;  2NS5 A;  4AOF A;  2M0X A;  3NZ3 A;  4G3X B;  3M62 B;  1T5X D;  1YJ1 A;  4WJQ A;  4KSL C;  2KTR B;  3M3J A;  5LLI A;  3NS8 A;  1E10 A;  2KT7 A;  2KHW B;  1KH0 A;  2M8S A;  2V9H A;  3A1Q A;  2DZM A;  3VVW B;  1F52 A;  2L52 A;  2ZPN A;  4RF0 A;  4RCO A;  1UZX B;  1T0R C;  3AE4 B;  1ZOY B;  2IO0 B;  2WXO A;  3A9K A;  1JWM D;  4IDI A;  2J0J A;  5FR6 A;  3OJ3 A;  3AED B;  2W54 A;  3UIO B;  1TKE A;  5CTR C;  2GBM A;  1J7B A;  4BBN F;  2PJH A;  2WYQ A;  1TKG A;  1GPX A;  4IW0 A;  3V3X A;  2I1J A;  5E6P A;  4BAX A;  3B0A A;  1SJH D;  4MAC A;  4IM3 A;  3ZYY X;  4AUQ C;  4RGO S;  5CHF A;  2JY6 A;  3DPD A;  2ZVO A;  2JT4 B;  4HK2 A;  3OLM D;  1WZ0 A;  3KYD D;  3NHE B;  4FXC A;  1WXA A;  4JWS C;  2JYE A;  1LQB A;  3KLS X;  2G1E A;  4NQL B;  3DBS A;  3VQI A;  3ZRC A;  4GIV A;  3QX1 A;  1WXV A;  4M02 A;  1WSP A;  2SEB D;  4FJY A;  3GZN I;  2WLB A;  3L10 B;  1XO3 A;  3EC8 A;  1MG4 A;  4PK1 A;  4W9C A;  1FXA A;  1V6E A;  3GE8 C;  4HXD A;  1ET9 A;  3MTN B;  1HXY D;  2ZW1 A;  4BKG A;  1HEZ E;  2UWQ A;  2N4F A;  4HPP A;  3RZW C;  4B6W A;  2HE7 A;  1EUV B;  3VUY A;  1XD3 B;  4RM9 A;  2LI5 A;  2V4I B;  2KFJ A;  3AEC B;  3MC8 A;  2WP9 B;  2M19 A;  2B76 B;  4XC2 A;  2KLG A;  4BVU C;  1WXS A;  3AV8 A;  3MHS D;  5D2M B;  5FK9 C;  2V0G A;  5FR3 A;  4WWO A;  5BYR A;  1FIQ A;  2JWU A;  4C4V B;  2AX5 A;  3NS1 A;  1B1Z A;  2NPT B;  4FJV B;  1EF1 A;  3HM3 A;  5D6J B;  4R3D A;  3BYY B;  2CKH B;  2V3N A;  1UUP A;  4FHJ A;  2IY1 B;  1L2N A;  3KH0 A;  2MCN B;  1N5W A;  3U30 A;  2E6X A;  4D2K A;  3Q8B A;  1OQR A;  3NVY A;  3V62 A;  3TIX A;  2UYZ B;  2FUG 1;  1WJ4 A;  5G55 A;  5CHV C;  3P4P B;  1L0V B;  1TZ1 A;  2BWE S;  2JXT A;  5TSS A;  1SJE D;  2ZVN A;  2KYW A;  3B08 A;  1I4R A;  1V97 A;  1RRB A;  1LXD A;  2VRR B;  4JPS A;  4W9I A;  3RNC C;  3KUC B;  3AMZ A;  2MJE A;  3W1S C;  3RT3 B;  5J18 A;  1WE7 A;  2NMQ A;  2CHW A;  3PV1 A;  2DZI A;  3AI5 A;  2WXL A;  1EF5 A;  2ZCC A;  1CK1 A;  4JGH B;  2KFK A;  2J7Q B;  1Z2M A;  3OAW A;  3ZJV A;  2MBH A;  1HTO A;  2QIE B;  3AUL A;  3ZNI D;  3ZNG C;  3AE3 B;  2G4S A;  1YN4 A;  3AEA B;  4W9F A;  1AN8 A;  4UDU C;  2M56 B;  1VR9 A;  3RZF A;  4QAY A;  2KJ6 A;  4C4V A;  2XBB C;  2WXP A;  4WJN A;  1B9R A;  3N32 A;  1UEL A;  2BYE A;  2K39 A;  1FFV A;  4URK A;  3MC0 B;  4WH4 A;  4A90 A;  3W9C B;  3H6N A;  2LD9 A;  2HDE A;  2XEW A;  3RCZ A;  1QT9 A;  2WXJ A;  2HD5 B;  2I38 A;  3HUI A;  4GDK B;  2N7E A;  3Q3O C;  4A20 A;  4HJG E;  1PYW D;  4FA6 A;  1R4N B;  3EUB 2;  4CHK A;  2L3Z A;  4MT5 A;  2LRW A;  4GU2 A;  1D5Z C;  4RM8 A;  2L0T A;  1I7H A;  1T0Y A;  1C9F A;  3ML8 A;  5G5H A;  4AJW A;  2GMI C;  2JU6 X;  1C76 A;  1ZE3 D;  1CQV A;  4IWQ A;  1ZW7 A;  3ZGZ A;  3HVZ A;  2L0F A;  2LUM A;  1E8X A;  1FFU A;  4REZ A;  3NVW A;  1Y56 A;  3U4E G;  4AQ7 A;  3Q8E A;  3PPA A;  4CYE A;  1YJJ A;  4ICU A;  2Q5W D;  3W1S A;  2WXH A;  2DHZ A;  4NAW A;  3ZNH B;  2KWV B;  2WXF A;  4FLH A;  3V61 A;  4DK5 A;  2LHD A;  4LDT D;  1N63 A;  1DYQ A;  3W1Y A;  1TBE A;  4TUU A;  4XDC A;  4YSY B;  2N9E B;  2WXK A;  4BOZ B;  2KAN A;  2K1F A;  3WAM A;  1P7E A;  1V1P A;  3GB1 A;  4ACF A;  3C8Y A;  4W9K A;  2BYT A;  2IGG A;  3PRZ A;  3P2B A;  1ESF A;  3NVZ A;  4RGM A;  1E90 A;  4ZRQ A;  2MEK A;  3PS6 A;  2N7D A;  3M95 A;  3SD5 A;  2W82 A;  4K7U A;  4FAD A;  3RNF C;  2WX0 A;  2O2V A;  4KVG B;  3KVF B;  2PW9 A;  1T6B X;  3NZU A;  4WWN A;  1SSN A;  4KZ0 A;  2LAS A;  3BK1 A;  2RGF A;  1E9M A;  3U7Z A;  1STE A;  3RNA C;  3I5J C;  2C5L C;  5HI1 A;  1JWB D;  4HCN B;  1OEY A;  1RWS A;  5E6N A;  3DVG Y;  2JXX A;  3VTV A;  1TS5 A;  4KGR A;  1K8R B;  2BKR B;  3CSF A;  4K3B A;  1I4X A;  2D10 A;  2CHX A;  4N58 A;  5H92 C;  3DBR B;  1H8C A;  1NDD A;  2X38 A;  4FHK A;  5IAA C;  3X23 A;  1VLB A;  4A3P A;  1MVK A;  5C23 A;  3ZDT A;  2KN5 A;  4YTN B;  4RGN A;  2LGI A;  1GG3 A;  3FIL A;  2G9H D;  4HRO A;  2JSV X;  2IND C;  4W9E A;  2L00 B;  2Y5B B;  1QZE A;  4RFB A;  2WX1 A;  1N60 A;  1A70 A;  1F77 A;  2FID A;  1WXM A;  4M0W A;  1ZDV A;  3AM9 A;  1LO5 D;  2GOW A;  2J0M A;  1Z5S B;  2E3T A;  2KTF A;  4KDL B;  1EU3 A;  1E7V A;  4CO7 A;  3HM6 X;  1V8C A;  2K22 A;  5EE0 A;  2EMS A;  1K53 A;  3FAH A;  2OJW A;  3N3K B;  1I42 A;  3Q8C A;  2PVO D;  1VZ6 A;  1BT0 A;  1D5M C;  2FE8 A;  5DCN A;  3MFG A;  3TUO A;  3VR9 B;  2DAJ A;  4XYC A;  4BKT A;  3Q3J A;  1VCB A;  2PMV A;  1HQR D;  4DQO C;  3I57 A;  4B9K A;  1RLF A;  4MSQ B;  1FRD A;  3NOB A;  1VZ7 A;  1TTN A;  1VJK A;  3RUI B;  3T8M A;  1GC7 A;  2V3P A;  1EWY C;  2KXJ A;  2KAJ A;  2CU3 A;  2FCQ A;  3VDZ A;  4DHJ B;  1NI2 A;  3H9D A;  4K81 A;  2BVC A;  4MGI E;  2K5P A;  1PGA A;  3TBL D;  3SEB A;  2BTE A;  1TT5 B;  2MJ3 A;  1SE2 A;  4F1S A;  5MPO A;  4LNK A;  3UQB A;  2G45 B;  2B3A A;  3N1Y C;  1YJI A;  2K8B A;  3SFE B;  2BS2 B;  3ZDM C;  2Z0E B;  3DWG C;  3E56 A;  1EO6 A;  3LYY A;  2SAK A;  4E3C A;  4P1B C;  1UBQ A;  2LUE A;  2EMT A;  2KMC A;  4YXD B;  3BVM A;  1OEY J;  2O2V B;  2KVR A;  2CS4 A;  2L8J A;  3PHW B;  2QMT A;  1YIW A;  2D3B A;  3AE8 B;  2L7R A;  3DVN U;  2KJR A;  4BFR A;  4L2Y A;  2BGF A;  1S1Q B;  2FUH B;  2V3S A;  3HHM A;  3ZLZ A;  1QQR A;  1EU4 A;  1FCC C;  1FPY A;  4KIK B;  3WA0 A;  3N1Z C;  4X57 B;  3IXS A;  4XGA B;  5D3I B;  5KHO A;  5C1Z A;  4FJZ A;  1X1M A;  4MH8 A;  5JXV A;  2N1W A;  1FMA D;  3B2F A;  1V81 A;  4KIK A;  5EE9 A;  2YLM A;  2O6V A;  1WRI A;  4F7Z A;  2QHO A;  2JRI B;  1LGR A;  2LVP A;  4IKG A;  1IBX A;  2EEL A;  1XLN A;  1M94 A;  1JAL A;  2WDT B;  4HRS A;  2LGY A;  4BOS C;  3B9J A;  3AN1 A;  1VD2 A;  3I3T B;  5JH5 C;  2OOB B;  1JCK B;  1N6Z A;  3O65 B;  2PTL A;  1ZUD 2;  3O13 A;  3R7R A;  1R7S A;  2MBB B;  1MHH E;  3ENE A;  1KLG D;  2K25 A;  2O6V B;  4ZRK A;  5I4D A;  1OQY A;  4N9F 4;  4IM2 A;  3KQ4 A;  1FCL A;  4FBJ B;  5IOI A;  3AEB B;  4ITK A;  4LNI A;  4B0M A;  5JHA A;  5L83 A;  3D32 A;  2INN E;  4RMA A;  3P42 A;  1KFY B;  3A4R A;  3I63 C;  2QC8 A;  3SR6 A;  4K7W A;  5BO4 B;  2GBN A;  4P1C C;  1IYF A;  3HRD D;  1Q10 A;  4IUM B;  2AQ3 B;  1L4D B;  3M63 B;  3Q8F A;  2D5G A;  5C3J B;  4NAM A;  1QIL A;  1I4H A;  1MJD A;  1WF9 A;  1VRA B;  1SIJ A;  2RSU A;  4HEA 1;  2NVU I;  4P7I A;  4KV2 A;  2D11 A;  4XX5 A;  2KC1 A;  3T9L A;  2LFI A;  5L95 C;  4ANX A;  2PEA A;  3IBE A;  2X8X X;  3ZO5 B;  1V5T A;  1E6E B;  2AL3 A;  1V9J A;  3KUZ A;  3QCA A;  4XZ4 A;  2DEN B;  5DPS A;  4MJS B;  1RM6 C;  2KFK B;  1V49 A;  4C56 C;  3U2S C;  2DX5 B;  4MGY E;  3AXC A;  1Q0W B;  1FXT B;  2DZK A;  3DHH C;  1I4G A;  4EUT A;  4LDT B;  4JX1 C;  3AEF B;  2L83 A;  4Q2J A;  2KQS A;  3KW5 B;  3QA8 A;  3TJP A;  3IG3 A;  3U7D A;  2VH1 A;  1QOA A;  3VFK A;  4BKS A;  3RFZ B;  2VZK B;  1BXT A;  4MM3 A;  1FD6 A;  1Q5W B;  4WWM A;  1C4A A;  5AZH A;  1NYQ A;  4HVB A;  2KLC A;  3EA6 A;  1JRO A;  4J3O D;  4DXG A;  3T3N A;  3L54 A;  2KN4 A;  4G0N B;  5AUI A;  1WJN A;  3AE1 B;  4N6E B;  4C80 A;  2MP2 B;  1BML C;  1XCT L;  1U4A A;  3EFC A;  3VRB B;  1XT9 B;  4TKN A;  1WGD A;  1N5X A;  3TSS A;  3VH4 B;  1P0R A;  3U8Z A;  1E7P B;  1KLU D;  4WJP A;  3DVG X;  2M4N A;  1RAX A;  3PGE A;  5BYS A;  2NPT A;  4P16 A;  5AEK B;  4GLS C;  1I4Q A;  1SGH A;  3QQ8 B;  2WXR A;  3LDZ E;  2FCS A;  2N9P C;  3APF A;  2AYO B;  1GOZ A;  1AW7 A;  3FIL B;  1IUE A;  1YN3 A;  3Q2A C;  4XE0 A;  3OWE B;  2XN9 C;  5JHB A;  1TGZ B;  4GOC A;  2ZCB A;  4M8M A;  3R2T A;  1CZP A;  1MHX A;  4PS8 A;  1YOV B;  1F9J A;  2LJ5 A;  5D94 A;  2REX A;  2N9X A;  3L08 A;  4DHJ D;  4NJ7 A;  1IGD A;  2KNB A;  1N61 A;  1FNW A;  3HVD A;  4K1R B;  3W2D A;  3DHI C;  3K9O B;  3NG0 A;  2K6Q A;  2WNM A;  3ALB A;  2ON8 A;  4EZL A;  3DBH I;  1BUI C;  3UF8 A;  1L6V A;  5BMH A;  2N1V A;  4HCP B;  4F8C B;  3ZTD A;  4DXA B;  1L7Y A;  3BII D;  2DLB A;  1V1P B;  2BF8 B;  1C77 A;  2WS3 B;  4A9A A;  3AE2 B;  5BYQ A;  1K51 A;  1V5O A;  1TKY A;  4ANV A;  2DAF A;  3QAR A;  4WJO A;  1WH3 A;  1S3S G;  1KRH A;  1GNU A;  4KSK C;  2PKO A;  2N7J A;  1IPG A;  4LNO A;  1WR1 A;  4HDQ A;  4PYU A;  5DPR A;  1T0S C;  2KJH B;  2XNA C;  3DQV A;  5JZE B;  1JQ4 A;  4KGS A;  4ZYN A;  4WQM A;  3R8B A;  2LGD A;  3A9K B;  3H7P B;  3APC A;  2IGH A;  3KWL A;  1R4N I;  2CU1 A;  3H8H A;  5GMV A;  2KDF B;  1XLQ A;  2KQ4 X;  1LM8 B;  3PO0 A;  1T0Q C;  2ZZP B;  3L17 A;  3CIR B;  2WHI A;  3ZJT A;  3P4Q B;  3AE5 B;  1KM7 A;  1WM2 A;  4NY0 A;  4WIP A;  2VZK D;  2Y5P A;  1C1Y B;  4II3 B;  3RPF C;  1UNS A;  3GE3 C;  2BS4 B;  4NAW B;  1FRR A;  3EGR A;  4O1N A;  2BW2 A;  5G2N A;  1SEB D;  2V4L A;  2LHE A;  3QHT A;  4LNN A;  1UD7 A;  4ICV A;  1C4C A;  3WIM A;  4ASW C;  4N59 A;  5E6J A;  5IKC M;  1WI0 A;  4RH6 A;  5DPW A;  4J6I A;  3ZUN A;  2MJD A;  1EM7 A;  2IGD A;  1QOB A;  4I6P A;  1ZXH A;  5J17 A;  2FIF A;  3V6C B;  4M00 A;  4MEM A;  4OZC A;  1FNU A;  3PVL A;  1MPE A;  4W9D A;  1YQB A;  4ANW A;  4W9L A;  4TQ1 A;  5E6O A;  1E8Z A;  5EE3 A;  4II2 B;  3AH7 A;  4PT5 A;  2WQY B;  1D3Z A;  1AYF A;  3ZKJ C;  4YSX B;  1PDX A;  3V05 A;  4B95 A;  4GDL A;  2KC2 A;  2WXN A;  4GDK A;  4EFO A;  1KLV A;  1ISN A;  3P1M A;  3TL5 A;  5BMI A;  2IYD B;  3BZD B;  1KOT A;  3DCG A;  2BQQ A;  2V1Y A;  2C7M B;  1GC6 A;  3BVG A;  3VTW A;  2DNF A;  2EKI A;  1TY0 A;  4ZHO A;  3IT6 B;  2MHJ A;  1WRD B;  3TEX A;  2IDY A;  4EOY A;  1JWS D;  4HKQ A;  4YSZ B;  3QK0 A;  2IZV B;  4RNA A;  2WU2 B;  2HTM E;  1F2R C;  1YMH E;  2A5U A;  2GBR A;  2WU5 B;  2KK8 A;  2J53 A;  2MP2 A;  4NPN A;  4L1B A;  1NI3 A;  2LEK A;  3EEC A;  2J4X A;  2RPQ A;  3JVZ X;  3AE9 B;  2K6D B;  2WDV B;  1P7F A;  2FBW B;  5J2R A;  3ML9 A;  4MDK E;  1E5W A;  2ZNV B;  3AE7 B;  4KGT A;  1PFD A;  2AWT A;  1V80 A;  2MX2 A;  5CX3 A; 
#chains in the Genus database with same CATH homology
 1V6E A;  4HXD A;  3MTN B;  4PS7 A;  4KIK B;  4ZRI A;  3WA0 A;  3LJ3 A;  4X57 B;  5KHO A;  4BKG A;  2UWQ A;  2PE6 B;  2MLB A;  2N4F A;  5C1Z A;  4FJZ A;  1UGM A;  1X1M A;  3RZW C;  4B6W A;  4DBG A;  2N1W A;  3GOE A;  3OJ4 B;  2HE7 A;  1EUV B;  1V81 A;  4IWP A;  2L05 A;  4KIK A;  3VUY A;  1XD3 B;  3PTF C;  1Q1O A;  4JQW C;  4RM9 A;  2YLM A;  2LI5 A;  2O6V A;  4M8N A;  4F7Z A;  2KFJ A;  2QHO A;  2JRI B;  4HWI B;  2LVP A;  4XC2 A;  2KDE B;  2KLG A;  2MQJ A;  4LJO B;  4BVU C;  1WX8 A;  1M94 A;  4E74 A;  2WDT B;  1WXS A;  2LGY A;  3ECI A;  4BOS C;  4GGQ A;  5JH5 C;  1VD2 A;  3I3T B;  3MHS D;  4WQO B;  5D2M B;  2WWZ A;  4WWO A;  2OOB B;  4G11 A;  2K8H A;  4PYZ A;  1SIF A;  3RD2 A;  2NPT B;  3TCA A;  2C9W B;  3O65 B;  4FJV B;  4FUL A;  1EF1 A;  3HM3 A;  3H7S A;  5D6J B;  4A3O A;  2CKH B;  2DZJ A;  3ONS A;  4FHJ A;  2XK5 B;  2IY1 B;  3R7R A;  3PT2 B;  2MBB B;  2BYF A;  3R66 C;  1L2N A;  3KH0 A;  3ENE A;  2MCN B;  2K25 A;  2O6V B;  3PSE B;  3U30 A;  2PE9 A;  3WAO A;  3RUL A;  2NCN A;  4WAA A;  4ZRK A;  1V86 A;  1OQY A;  4N9F 4;  4I6N B;  1P98 A;  3V62 A;  4IM0 A;  1R4M I;  2DYO A;  3A33 B;  4IM2 A;  1WJ6 A;  3TIX A;  2J0K A;  4FBJ B;  2UYZ B;  2W9N A;  1WJ4 A;  1OTR B;  2KZR A;  5G55 A;  2O6V D;  5CHV C;  5JHA A;  5L83 A;  1TZ1 A;  3D32 A;  2BWE S;  1WGH A;  5KHQ A;  3SHQ A;  2ZVN A;  3R7Q A;  3B08 A;  4RMA A;  3S2A A;  3UIN B;  1UH6 A;  3A4R A;  1RRB A;  5AZF A;  3TMP B;  1LXD A;  1WMH B;  2CHZ A;  2GBN A;  2NR2 A;  4K7W A;  1WY8 A;  2G4D B;  2KWU B;  5BO4 B;  2VRR B;  2A4Z A;  4W9I A;  2BKF A;  2OJR A;  3WAN A;  1IYF A;  4IUM B;  3M63 B;  2IO1 B;  3KUC B;  4GXB A;  2HJ8 A;  3UIP B;  1J19 A;  3RT3 B;  4MSM B;  3W1S C;  1WE7 A;  2LWP A;  1NBF C;  2CHW A;  3EFU A;  2DZI A;  3AI5 A;  3PV1 A;  4GSW A;  4W9G A;  2D3G A;  1EF5 A;  1WF9 A;  3QC8 B;  3RYT A;  2ZCC A;  2RSU A;  4JGH B;  2KFK A;  1MG8 A;  3V60 A;  2J7Q B;  3DDC B;  1Z2M A;  2NVU I;  3OAW A;  2MBH A;  3AUL A;  4P7I A;  4KV2 A;  3ZNI D;  2D11 A;  2FCN A;  4XX5 A;  2M1M A;  2KC1 A;  1SE9 A;  3A1Q B;  3ZNG C;  3NY5 A;  2G4S A;  2JWZ A;  4W9F A;  3T9L A;  4ANX A;  5L95 C;  2PEA A;  4MGK E;  3IBE A;  3RZF A;  3VUX A;  2KJ6 A;  2MSE D;  3ZO5 B;  3Q3F A;  1V5T A;  2AL3 A;  2FCM A;  2KTR A;  3WAL A;  1V9J A;  2XBB C;  3KUZ A;  3QCA A;  4XZ4 A;  2DEN B;  4W9J A;  5DPS A;  3PLV A;  4WJN A;  5TR5 A;  3VAW A;  2MBO A;  4MJS B;  5AZG A;  4GB9 A;  3N32 A;  2KFK B;  1V49 A;  1Y8R C;  4DDI D;  4AP4 C;  2LZ6 A;  2DX5 B;  1E8Y A;  1UEL A;  2BYE A;  1P9D U;  2JUO A;  2K39 A;  3PRE A;  4MGY E;  3AXC A;  2JRH A;  3VXW A;  1Q0W B;  1FXT B;  4URK A;  2DZK A;  5LXI B;  2K8C A;  1WJU A;  3H6N A;  4EUT A;  4LDT B;  2Z59 B;  3PZD A;  2LD9 A;  4HDO A;  3CST A;  2LGX A;  2XEW A;  3RCZ A;  1OGW A;  4OVV A;  2KQS A;  1WX9 A;  2HD5 B;  3KW5 B;  3QA8 A;  3TJP A;  3IG3 A;  1CMX B;  3U7D A;  1WIA A;  3VFK A;  4BKS A;  2D07 B;  4MM3 A;  2KWC A;  4GDK B;  1Q5W B;  2N7E A;  4W9H A;  5AZH A;  4A20 A;  2L76 A;  4EZK A;  4HLE A;  4FA6 A;  4CHK A;  2L3Z A;  2KLC A;  4HVB A;  2LRW A;  4GU2 A;  3C0R B;  3BY4 B;  2KQ7 A;  4RM8 A;  2FAZ A;  3H7P A;  2L0T A;  1T0Y A;  4GMV A;  3L54 A;  3ML8 A;  3KYC D;  4G0N B;  1WJN A;  2KMA A;  2MP2 B;  5CX3 A;  1V2Y A;  1LFD A;  1G6J A;  1U4A A;  4AJW A;  1H4R A;  1XT9 B;  2GMI C;  4TKN A;  3H1U A;  4IWQ A;  1ZW7 A;  1RFA A;  1WGD A;  4DDG D;  2L0F A;  3VH4 B;  3DOW A;  1P0R A;  3U8Z A;  1E8X A;  2HTH A;  3K9P B;  4WJP A;  3NZS A;  3DVG X;  2M4N A;  4BBN C;  1RAX A;  3PGE A;  2NPT A;  5AEK B;  3ZTC A;  2AEH A;  3ZNZ B;  1SGH A;  2LXC A;  3QQ8 B;  3LDZ E;  2LVQ A;  3A9J A;  2FCS A;  3PPA A;  4CYE A;  4ICU A;  2N9P C;  3W1S A;  3APF A;  2DHZ A;  2M17 A;  2AYO B;  2KWV B;  4FLH A;  4NAW A;  3V61 A;  3ZNH B;  4DK5 A;  5IA7 A;  4KZC A;  3PRP B;  4G50 A;  4LDT D;  2I1K A;  2C60 A;  3W1Y A;  4DHZ B;  4JLC A;  1KJT A;  1TBE A;  4TUU A;  3IHP C;  5JHB A;  1TGZ B;  4GOC A;  2DYB A;  2N9E B;  2ZCB A;  3VHT C;  3DVN V;  3IVF A;  4GN1 A;  4HPM B;  4M8M A;  4EEW A;  2R2O A;  4PS8 A;  4BOZ B;  2KAN A;  2K1F A;  3WAM A;  1F9J A;  3CF6 E;  2LJ5 A;  2JVC A;  5D94 A;  2REX A;  2N9X A;  3L08 A;  1E7U A;  4W9K A;  1WR6 E;  4DHJ D;  4NJ7 A;  4IG7 B;  3AU5 A;  2KNB A;  3P2B A;  3PRZ A;  4FN2 A;  1J0G A;  2KD0 A;  4K1R B;  1E90 A;  3R3M A;  2MBE A;  4JL9 A;  3K9O B;  2BWF A;  3PS6 A;  2N7D A;  3L0W B;  4I6L B;  2K6Q A;  3M95 A;  3ALB A;  3SD5 A;  4PS3 A;  4K7U A;  1WGY A;  4KDI C;  4FAD A;  4EZL A;  2WX0 A;  3DBH I;  2O2V A;  4HJK A;  1WGG A;  4JIO U;  4KVG B;  4MH0 E;  3UF8 A;  3X0W A;  3L13 A;  2N1V A;  2RD0 A;  2G3Q B;  2MA9 B;  2MWS B;  4HCP B;  3JSV B;  3KVF B;  4WWP A;  4F8C B;  3ZTD A;  3L16 A;  3ZRF A;  1YX5 B;  4AJY B;  4DXA B;  1L7Y A;  3QWZ B;  2RR9 A;  3KUD B;  4TQ0 A;  3NZU A;  4TV3 A;  3EHV A;  1GUA B;  2KOX A;  1I35 A;  2BF8 B;  4NQK E;  4E71 A;  4WWN A;  1UBI A;  4EKU A;  4KZ0 A;  1C3T A;  4NNJ B;  1V5O A;  4M0W B;  2EKE C;  4ANV A;  2DAF A;  2JZZ A;  2LAS A;  3QAR A;  4MJS A;  4WJO A;  4ZDV A;  3B1L X;  1WH3 A;  1S3S G;  5LXH A;  1GJZ A;  2ZPY A;  3PLU A;  1GNU A;  1WX7 A;  4KSK C;  3V6E B;  2RGF A;  3JW0 X;  2CR5 A;  1WYW B;  2ZNV C;  2C5L C;  1IPG A;  2NBW B;  2MRP A;  1WR1 A;  4HCN B;  1OEY A;  4HDQ A;  5E6N A;  3DVG Y;  2JXX A;  3VTV A;  2R2Q A;  3N30 A;  4MGZ E;  2Z0D B;  1WGR A;  4PYU A;  5DPR A;  4AWJ A;  2KJH B;  3DQV A;  3IFW B;  5JZE B;  1XQQ A;  3QIJ A;  1K8R B;  2BKR B;  3CSF A;  1WZ3 A;  2D10 A;  3QJZ A;  4ZYN A;  2CHX A;  2FNJ B;  1H8C A;  5CHW A;  1JRU A;  1NDD A;  3ZIM A;  3UGB B;  2LGD A;  3QAQ A;  3A9K B;  4FHK A;  2GBJ A;  3H7P B;  5IAA C;  3JSV A;  5D7G A;  3APC A;  3X23 A;  2LRU A;  4YL8 A;  1P1A A;  4A3P A;  3VUW A;  1YD8 U;  4ZRJ A;  1R4N I;  2CU1 A;  3BIN A;  5GMV A;  2ZJD A;  2KDF B;  4NJ6 A;  2GBK A;  3UQA A;  1A5R A;  4GDL B;  1LM8 B;  2KDB A;  2ZZP B;  3L17 A;  1E8W A;  5C23 A;  2LXA A;  3DBR I;  2KN5 A;  3ZDT A;  5J18 A;  2IY0 B;  2NBV B;  4LCD E;  2JZ3 B;  4MEL A;  1KM7 A;  1WM2 A;  2ZEQ A;  5HKH A;  4NY0 A;  2BPS A;  3A4S C;  3SU8 X;  1C1Y B;  1GG3 A;  1HE8 A;  1WFY A;  4II3 B;  3ZW3 A;  3DBL I;  2KX3 A;  2L00 B;  2Y5B B;  2ASQ A;  2KKC A;  4IC7 B;  4NAW B;  4W9E A;  2DYM A;  2JPH A;  1QZE A;  2WX1 A;  2AL6 A;  5G2N A;  2D2Q A;  1AAR A;  3A9J B;  1ZGU B;  2V4L A;  3AU4 A;  4LJP B;  2FID A;  1WXM A;  3QHT A;  2NBU A;  3PRM B;  1UD7 A;  4ICV A;  2C7N B;  3WIM A;  4ASW C;  2GOW A;  2NS5 A;  4AOF A;  2KX0 A;  2M0X A;  1WI0 A;  2J0M A;  5DPW A;  4J6I A;  3ZUN A;  4G3X B;  2JF5 A;  3M62 B;  2KO3 A;  1Z5S B;  1ZKH A;  2KTF A;  4I6P A;  4KDL B;  1E7V A;  5J17 A;  4CO7 A;  1YJ1 A;  4WJQ A;  4IWO A;  3HM6 X;  4ANU A;  4KSL C;  2FIF A;  2KTR B;  3M3J A;  5LLI A;  3NS8 A;  2EMS A;  3V6C B;  1J8C A;  4MEM A;  3PVL A;  2KHW B;  3N3K B;  2M8S A;  1I42 A;  4W9D A;  1YQB A;  4ANW A;  4W9L A;  3A1Q A;  4TQ1 A;  2KDI A;  5E6O A;  1E8Z A;  4II2 B;  2DZM A;  1WE6 A;  3SDL C;  3VVW B;  1D3Z A;  1BT0 A;  3ZKJ C;  2IBI B;  4B95 A;  4GDL A;  2ZPN A;  2KC2 A;  2YVC A;  5DCN A;  1UZX B;  4GDK A;  4BKT A;  2DAJ A;  4EFO A;  1KLV A;  1ISN A;  3Q3J A;  2BYV E;  1VCB A;  4OVU A;  4B9K A;  1RLF A;  4MSQ B;  1YX6 B;  3TL5 A;  3NOB A;  1TTN A;  2IO0 B;  2IYD B;  2C7H A;  1KOT A;  3A9K A;  3RUI B;  3T8M A;  1GC7 A;  3DCG A;  2KXJ A;  4BKS D;  2J0J A;  5FR6 A;  3OJ3 A;  2V1Y A;  2C7M B;  2FCQ A;  3VDZ A;  4DHJ B;  3UIO B;  1GC6 A;  5EDS A;  3CMM B;  1NI2 A;  5CTR C;  3H9D A;  2GBM A;  3VH3 B;  4K81 A;  3VTW A;  4BBN F;  2PJH A;  2WYQ A;  3HK0 A;  3APD A;  4MGI E;  3TBL D;  4IW0 A;  1P3Q U;  2I1J A;  2XK5 A;  5E6P A;  4K7S A;  1WRD B;  3B0A A;  4F1S A;  3UQB A;  4EOY A;  2IO2 B;  2G45 B;  2B3A A;  3PHX B;  4IM3 A;  3WAP A;  4AUQ C;  5CHF A;  2MW5 A;  2IZV B;  3QK0 A;  4DWF A;  2JY6 A;  2LVO A;  2IO3 B;  2GBR A;  2A5U A;  1IP9 A;  2K8B A;  2PPH A;  2ZVO A;  3DPD A;  3ZVV A;  3ZDM C;  2Z0E B;  2KK8 A;  2JT4 B;  3MJW A;  2MP2 A;  3JYU A;  4HK2 A;  4NPN A;  3OLM D;  1EO6 A;  1WZ0 A;  4E3C A;  4HPL B;  3KYD D;  3EEC A;  3HIZ A;  3NHE B;  1UBQ A;  2LUE A;  1WXA A;  2EMT A;  2RPQ A;  3JVZ X;  2MBQ A;  2KMC A;  1LQB A;  2K6D B;  1OEY J;  2O2V B;  4EZJ A;  4NQL B;  2KVR A;  2CS4 A;  3DBS A;  2L8J A;  3VQI A;  1PQS A;  3PHW B;  5J2R A;  3ML9 A;  3ZRC A;  1WMH A;  4DHZ E;  1YIW A;  4GIV A;  1E5W A;  2ZNV B;  3QX1 A;  4MDK E;  1WXV A;  2L7R A;  3DVN U;  5DPT A;  2KJR A;  4FJY A;  4BFR A;  2BGF A;  3GZN I;  3L10 B;  1S1Q B;  2AWT A;  1V80 A;  3EC8 A;  2FUH B;  2V3S A;  3HHM A;  3VTU A;  2MX2 A;  3ZLZ A;  1WM3 A;  4W9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...