5FRDA

Structure of a thermophilic esterase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
256
structure length
256
Chain Sequence
b'MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVEVNSVDEYAYYASESLKKTVGKAVVVGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLPEILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRNGKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELVVIPGASHMVMLEKHVEFNEALEKFLKKVGVAEVHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE (EST-2)
publication title Structural and Biochemical Characterisation of Archaeoglobus Fulgidus Esterase Reveals a Bound Coa Molecule in the Vicinity of the Active Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 107
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5frdA00
2J4FA 3QVMA 3QM1A 1WHTA 3SWWA 5LKAA 4K6KA 4LYEA 2PSJA 2C0QA 3IA2A 3H19A 4G9GA 1K5PA 4RE5A 1YAJA 3HRHA 5C7YA 4NS4A 3WYDA 3DJYA 1ODTC 2QVBA 1A88A 3C6ZA 2XUPA 1K8QA 3A70A 1XLWA 1QIJA 1L7AA 5BWCA 2FUKA 1EX9A 4KYVA 2H7YA 4FDMA 4DMKA 1FJ2A 3BL8A 3B3QA 2DHEA 1JFRA 3R0VA 3EF3A 4AMYA 3KDAA 2VTVA 1ZJ4A 4DYHA 4WJLA 2HL6A 1A8UA 1XZFA 1H2WA 3I28A 1IVYA 3R3XA 1TKRA 1QZ3A 3S8YA 3V48A 3FAKA 5DLPA 4GDMA 2WKWA 3BF7A 1LPOA 2CUTA 1HDEA 1I6WA 1WHSA 3WWPA 1F0NA 1DTEA 4YASA 2VA9A 2XMRA 2JGMA 4CFSA 1NU6A 4ZGBA 2WTNA 1FFAA 5IH7A 3AUKA 2PUHA 4ZXFA 1XZJA 4OU4A 2AJ8A 1X2BA 3RKSA 5FP0A 2WHPB 2C5FA 3WKAA 1CUCA 4A23A 4EY7A 2XQFA 3YASA 1EK1A 3DOIA 2XI4A 4MEBA 1TCCA 3WK5A 4C4YA 2XUHA 1LBTA 3G9XA 3LP5A 4H7HA 3HEAA 1SC9A 1XLUA 1AURA 4OB7A 6YASA 3E4DA 5IVIA 1CV2A 4E46A 1IZ8A 5JD5A 1P0PA 1XQWA 2H1IA 5HK9A 1ZI6A 3DCNA 5AM4A 1MU0A 5K3BA 4M0EA 1BN6A 4XX1A 1QO7A 5DNWA 5I8PA 3V9AA 5ALGA 1EDEA 3MGAA 3WKBA 2PSDA 4G5XA 3D4LA 3WZMA 2NW6A 4WDRA 4FKBA 4DNOA 2HU7A 5CT6A 4OU5A 2CB9A 4UPDA 2ZYIA 3W06A 2Q0XA 4NMWA 1EB8A 1XROA 4BAGA 1W4LA 3WK8A 2OAGA 4JUIA 4H7JA 2XUJA 3PFBA 3WL5A 5ALSA 3KD2A 1M33A 2HHAA 2ZSIA 3I1YA 2XQKA 1XZEA 3AILA 3ESCA 3WL6A 1OILA 3STUA 1YAHA 3ANSA 3AIOA 2HU5A 2EEPA 3D7RA 3D0KA 2AJDA 2Z8XA 5LIPA 1QIHA 2FJPA 5HCUA 3GA7A 1MJ5A 3STYA 3IUNA 3PUHA 3HABA 1QGED 3LIPA 3QH4A 3BWXA 1XRNA 1YB6A 3WWCA 3VDXA 2WU4A 2C4HA 2HM7A 2VT6A 4ITVA 4XIIA 3X3HA 5EHQA 4FWBA 3H2JA 5CMLA 3BIWA 3SX4A 4B7ZA 4BE4A 2WLSA 3I2JA 3IUQA 5A2GA 2VATA 2AJBA 4YPVA 4UFOA 4BCBA 3JYHA 4F0JA 2ROQA 4C87A 1EVEA 2VJAA 1GKLA 5JD6A 2XUOA 4Y7DA 4UHEA 4EY6A 1BE0A 4G8CA 3IBTA 1CLEA 3LLCA 4J03A 5CT8A 4X6XA 1XQVA 3FLBA 5DNVA 4DIUA 1VJ5A 2G63A 3DQZA 1IUOA 1YA8A 4MWSA 5AIBA 4E11A 2XUDA 1VE6A 2DSNA 4H77A 1Q84A 5AKHA 1EDBA 2Y6VA 4K2AA 3EIOA 3I6ZA 1VLQA 2OQVA 1EINA 4UBNA 5HF8A 5D6OA 5E2IA 4B85A 4X71A 4BBZA 2ZVDA 5EHNA 3NOXA 1ZI9A 3DD5A 1PV1A 5K3DA 3K6KA 1QIEA 4AZ3A 4Q05A 3O4IA 3EQ7A 4QDUA 2W6CX 4GEGA 5LYYA 2XLBA 4DM7A 2X5XA 5FV4A 2XE4A 1JJFA 5ALMA 3KSRA 5AH0A 1THTA 4TGLA 4ZRDA 1O6GA 2XUIA 1G66A 1XZMA 5AKEA 3D2AA 3AZPA 3H04A 2GBFA 1X2EA 2Z5GA 3MUNA 4GXNA 5JALA 1THGA 2WHPA 1UKCA 4F21A 2IITA 1SCQA 4C88A 5JAUA 4X94A 2BJHA 2WSLA 3RLIA 4QEKA 4MYSA 1UKAA 5I9IA 4RGYA 1CUDA 1UK7A 1ZGBA 4AX4A 2ECFA 5IVHA 4KJXA 1U8EA 1F6WA 4X90A 2RI6A 3KWJA 3I2FA 1R50A 1U4NA 3VVMA 4N5IX 3F97A 4F60A 2CBGA 2DQZA 5JAHA 1MPXA 2C5GA 5BWBA 3BF8A 4A16A 4JNCA 2ES4A 5EHXA 3N0TA 3PE6A 5FLKA 1CVLA 5KWIA 3TEJA 1XZDA 4W1SA 5FKJA 3W05A 1R9MA 4XWGA 4UHHA 4Y2RA 1UK9A 1VXOA 3WKDA 4X92A 1YCDA 2HADA 4I3FA 2HU8A 1J2EA 3WI7A 1EHYA 3IDAA 4WCVA 2PPLA 3R40A 2X8BA 1Y7IA 4U2BA 4B9AA 5C8XA 2V98A 3V1NA 5JZSA 4N8SA 2CEKA 5A7FA 4BRSA 2XUQA 2C58A 2XT0A 5ALNA 4C4ZA 1YR2A 1GPNA 5HZGA 4B81A 4LKOA 1DWOA 1EH5A 5ALLA 3WYNA 3S2ZA 4CIBA 2HA3A 2QTBA 4KE8A 4C89A 1CUWA 4LXHA 4J0HA 1HLGA 2XMCA 1UK6A 5EFZA 4Y2XA 5JYCA 3F9CA 5HKBA 3QMVA 3RM3A 4RNCA 1Q0ZA 5AI0A 4RPCA 4ZREA 3IUMA 3FCYA 5BOVA 4KAFA 3K9BA 1ZIYA 4BZZA 1XFDA 4WY5A 5CT9A 3WA7A 1BCRA 4INZA 4L3WA 2WFLB 3FNBA 4BE9A 4WFKA 5ALWA 5AP9A 1LZLA 3DYVA 2BGNA 3OTQA 2O2GA 2G4LA 3BDIA 2VAXA 1CUFA 2Y1KA 3WQHA 4NZZA 3B5EA 5KREA 3FBWA 3GUUA 2XMGA 3C8DA 5A7HA 4QDTA 4EZIA 4EHBA 1XRMA 2XQJA 4QLAA 3LCRA 4RE6A 4GWLA 4H7IA 2WHRA 3UUFA 3M83A 4BP8A 4AXBA 4H7FA 1UXOA 2WIGA 5CXUA 2XUGA 3R3YA 2Z3WA 5LZ7A 2WQZA 4BRZA 1VZ3A 4UHFA 4CIAA 4UBIA 4G8BA 5D3ZA 1SCKA 2I3ZA 1HBJA 3G0IA 5AKZA 4FBMA 4L9AA 4BDSA 1C7IA 1QFSA 1WB6A 2LIPA 2GYUA 2WILA 5BV7A 3HJUA 4PV7A 3NGMA 1PFQA 2RONA 4HZGA 5JATA 4IQ4A 5AM3A 4U2FA 2XMQA 4BVLA 1QFMA 4CG2A 1QIMA 5LKRA 3QMWA 2GBGA 2FX5A 4ZI5A 4DMCA 4DTCA 5H3HA 5T4FA 4M0FA 2OCGA 4BB0A 7YASA 2CZQA 3K2IA 5CW2A 1MX5A 5SYNA 4OCZA 1JMYA 3QBJA 3DYIA 1FSSA 4GECA 2E3JA 4AB1A 1OCEA 3HACA 5ALXA 3FSGA 3DKKA 3KOOA 3OG9A 2K2QB 3QITA 4CI9A 4FTWA 2BAGA 5JASA 1DINA 3FWHA 4J0DA 3W9UA 5LZ4A 3BXPA 1TQHA 2YASA 4B80A 4CCWA 5JZBA 2B4KA 5FUMA 3CN9A 5AKJA 3FOBA 1AMNA 5T4HA 5C8ZA 4QLOA 3G0BA 4C6HA 4ARAA 4Q3LA 5T4EA 3ICVA 3LIIA 1N8SA 2WUGA 4W1RA 1ZD3A 4UBLA 2PKYX 5AIAA 4Y2YA 2YYSA 1ZOIA 3ZLTA 1ZI8A 5JAOA 3OPMA 2WJ4A 4AN1A 3H1BA 2EDCA 4OD0A 1WB4A 5LZ8A 3A6ZA 4W63A 4K6HA 3U0VA 5LP1A 1Y7HA 5HKAA 5T4BA 2HIHA 3WLAA 5IVKA 3AFIA 5KBYA 5CRIA 1MTZA 4X95A 4YK7A 1EA5A 1LPBB 5HK8A 3ILSA 3G8YA 3FVTA 5EIHA 2ZJFA 3EQ8A 3BIXA 1QIKA 5FPPA 5EHZA 4Y2TA 4PSCA 3AINA 2RHWA 4XJVA 5AI5A 1UFOA 1EB9A 1N1MA 3WWOA 4KAAA 3A2NA 2D5LA 5AI6A 3E3AA 1VOTA 1XRLA 2QRUA 2H9YA 1YA4A 2WU3A 1CIJA 2IIVA 4BVKA 4F5ZA 2WFLA 2Y2VA 2PUJA 3NUZA 3WK7A 3WZLA 4P08A 2AJLI 2PU7A 2JIDA 1J06A 5DNUA 3HYSA 5ALFA 4GHWA 3CXUA 1ZD4A 3WIBA 1ZIXA 3HC7A 3C87A 1F8UA 5AKIA 4J0IA 5AHXA 2AJCA 3GFFA 4U2EA 1LGYA 2WUFA 5JD4A 2QXTA 4KE9A 1ORWA 1TAHA 3M81A 1UOOA 5AJHA 5HFAA 2XUKA 2PX6A 2OCLA 4X3CA 3R3UA 2W22A 5CT4A 3D5EA 1MAAA 1XZLA 2OG1A 1A7UA 5ALPA 1VZ2A 4AN0A 3NWOA 4NVRA 3G0GA 1WCYA 4J0JA 5FOQA 4OPMA 4G8DA 1FFCA 5D7BA 1HQDA 3G0DA 2XLCA 3I2GA 1XZAA 4QE3A 3I2IA 1X70A 2CJPA 2JEZA 1QOZA 1ISPA 1KU0A 4V2IA 2PSHA 5A71A 5LZ2A 1CRLA 4U2GA 1U65A 1FFEA 4QDZA 2HA6A 2HFKA 3T52A 5AKKA 5DTJA 4LXIA 2OXEA 1P0QA 5AO9A 5AK6A 3WKEA 3O4HA 1TCAA 2QJRA 4Q1VA 3GROA 4KE6A 1CUUA 3PDCA 4E15A 4CG3A 1QLWA 4UHBA 4X6YA 3OM8A 1CR6A 2HRQA 5AK5A 1G5FA 1DX6A 2BUAA 4IO0A 2BUCA 3WJ1A 4CCYB 2ZYSA 4GW3A 4PSDA 2GYWA 5F4ZA 2OGZA 4DNFA 3GBSA 4BAUA 5HF6A 4K5QA 1LPAB 2XB6A 4FBLA 1WM1A 1MX9A 3A2LA 3AZQA 2JEYA 1AQLA 1JI3A 4FFWA 1QTRA 3C6BA 4EY8A 4C01A 3AJAA 4ROTA 5AK4A 3QYJA 3VVLA 1L7RA 3C6YA 4Y2JA 5IKXA 4JYMA 4B0PA 2ACKA 2HRRA 5EIEA 1RYYA 1BS9A 3P2MA 1WPXA 3ED1A 1JMKC 1Y37A 4HRXA 4KACA 2BFNA 5DJ5A 5ALVA 3QMMA 4GLBA 4Q82A 1GKKA 4CG1A 3ZWQA 1MT3A 1F0PA 3QPDA 4DMHA 5K3CA 3O9VA 4HXEB 4LYDA 2ZSHA 3G0CA 2DCMA 4C4XA 5DYYA 4HTAA 4X93A 4HS9A 1H2ZA 1CUVA 2XMDA 3WIOA 4OB6A 5AI9A 4Y2VA 1LZKA 4AO7A 4QWWA 3H17A 4KEAA 1K6EA 2R11A 4GBGA 3DL4A 2YH2A 1XZBA 1SOMA 3VXKA 1QJ4A 3F96A 3BDVA 1DU4A 3FYTA 2ORYA 4QDXA 2XMBA 3WKCA 1SFRA 2V96A 4BP9A 2HA0A 5I7UA 4UHDA 4WFIA 5ALKA 1R9NA 2DR0A 3FVRA 4O08A 1CEXA 5DWDA 3UUEA 1LBSA 3PF8A 4BC0A 1C4XA 1OXMA 1H2XA 3WL8A 4QZVA 4L0CA 2WG1A 4KAJA 4N8EA 2PSEA 4W1PA 2I03A 2H7CA 4G4GA 3STWA 1ZD5A 1CUHA 2XUAA 3DDUA 4Y2QA 4UBKA 3STTA 5JAPA 1MNAA 5EIAA 1WB5A 2WIKA 1JKMA 4BATA 2OGSA 3C8HA 3L1IA 4Y2SA 3ICWA 1LPPA 2DQYA 4MEAA 4X97A 1XZGA 3JWEA 1QTIA 5K3AA 5ALYA 5ALOA 4LHEA 1E8NA 4UFNA 5E4TA 5K3FB 1UK8A 4B6GA 1JJIA 5EGNA 3O9MA 4P9NA 3I6MA 3C5WP 1XZKA 2OAEA 3Q0TA 4PSUA 3MUOA 2QOEA 3H0CA 1IUNA 2WFZA 4KRXA 2ZYHA 3WMRA 4N5HX 3D59A 1LPMA 1GGVA 1XQYA 2OGTA 3DEAA 1XZCA 3H2GA 2JF0A 1ACLA 4J7AA 1PJAA 1AGYA 2VAVA 2V97A 1AC5A 5AI8A 4AZ0A 1H23A 4H35A 1YB7A 3QZUA 3FYUA 1H2YA 4FHZA 1GQRA 1UOQA 3TGLA 1BRTA 1T4MA 4HXGA 4AO6A 1RP1A 1K4YA 3QPCA 2QZPA 1C7JA 3RK4A 4FLMA 3FLAA 1XRPA 1BCSA 4YX9A 2O2IA 3C6XA 4FLFA 1J1IA 5DTIA 2WFMA 3EQ9A 4ZWNA 4FOLA 1NX9A 5ALDA 4Q3KA 2O7RA 2JBWA 1CUBA 3E0XA 2OPHA 4I4CA 3G9TA 3C45A 3ZLVA 3WL7A 1LLFA 4CCYA 3G02A 2QUAA 2WG2A 5JARA 2BUBA 1MAHA 1USWA 3T4UA 5AK3A 1E8MA 3ESDA 5CH3A 5AOAA 1JT2A 4ZV9A 2PU5A 2BGRA 2EDAA 1BU8A 2QKYA 2GYVA 1CUAA 4MXDA 4B0OA 3DOHA 2PSFA 4A5SA 3U1TA 4WY8A 4GI1A 4IH4A 5ALJA 2Y2UA 4BTVA 3C70A 3AZOA 1KU6A 3I6YA 2R8BA 4MJ3A 1QE3A 1DT5A 2ACEA 5KWJA 1TIBA 1QO9A 4BCCA 5AKXA 3H1AA 2Y6UA 5CH8A 2QT9A 2HA7A 2XQIA 3WJ2A 1UOPA 4OYLA 2ZJ6A 4X85A 3VJKA 1J07A 1W75A 2WJ3A 3L1JA 4U2CA 4AMZA 3HSSA 2QUBA 1ORVA 5J3JA 1DWQA 2JGLA 1R88A 1W6RA 3EBLA 4K6GA 1EI9A 2BCEA 2B9VA 2XUFA 3G9UA 1BN7A 4Y2UA 5AKLA 1QIDA 3V1KA 5AKGA 1CUGA 2D0DA 3LS2A 4TPKA 4Q3OA 3CCCA 5AM0A 4EB0A 2XMZA 3R3WA 3DS8A 1GZ7A 2WUEA 1XZHA 1D07A 5ALHA 1P0MA 5A6VA 4DSZA 1UT6A 2VJCA 1YASA 1FFDA 3R3ZA 4D9JA 3I1IA 3PFCA 2WUDA 4JEIA 1GPKA 1CUSA 4FNMA 2C7BA 4MQMA 4HVTA 3IULA 1T2NA 4EA6A 1CUYA 3G9ZA 5ALRA 4OSEA 4DLNA 1CFJA 1AZWA 2VJBA 4DNQA 5LZ5A 2XQGA 1TK3A 4B83A 5HQ3A 2IX9A 1N5RA 3ESBA 3B12A 1HKHA 2HA4A 1EK2A 5AOCA 2PVSA 2JGFA 5FPQA 5ESRA 2OCKA 5ALIA 1N5MA 3VISA 5K3FA 1MO2A 1E89A 4UUQA 3IURA 1CQWA 3F8SA 1YS1X 5SYMA 4UBOA 1W1IA 1LPSA 5ALQA 1QIFA 3UMJA 1L7QA 1ODCA 1KEZA 5LLSA 5AM2A 1NU8A 5CBKA 4PO3X 5JIBA 2G5PA 3WK6A 4J0CA 1DQYA 1UWCA 3RARA 4LXGA 4KR0A 5K5EA 1VKHA 1QONA 2PBLA 4P92A 4N8DA 4X00A 3OOSA 3F98A 4Q34A 2RHTA 3CN7A 1W76A 1IMJA 1DX4A 1AUOA 1B41A 3C5VA 1ZICA 1R4ZA 1QIGA 2QM0A 4BC1A 2C0PA 5CH5A 1DWPA 5ALEA 2CKMA 4JYPA 3R41A 3W04A 4FFVA 4Z49A 2VQ6A 2WHQA 2PM8A 4BVJA 4ETWA 1GT6A 1EVQA 1XRRA 2DHDA 1CUEA 1YS2X 3OC0A 1CQZA 5CXXA 2PL5A 2P8SA 3TJMA 3HLKA 4Y2PA 4G4IA 1CUZA 5C81A 1BEZA 4HRYA 1G4HA 1CUXA 2QJWA 1XRQA 1ETHA 3W9BA 4DSAA 4QWMA 3CCBA 5AOBA 5ALUA 3O0DA 1LNSA 3ANTA 2J4CA 3GZJA 5DYTA 2RAUA 1VXRA 1GPLA 3VJMA 2ZJ7A 4J0GA 4ARBA 1WPRA 2YXPX 4ZV7A 1XZIA 5ALTA 5A62A 2JGIA 3FYUC 3FYUB 3PF9A 4IH1A 3R3VA 4L72A 4WDQA 3PI6A 4UBMA 2FJ0A 1ACJA 5D3KA 1Z68A 4X6UA 4WFJA 1IUPA 1ODSA 1P0IA 4W1QA 5FXMA 2VT7A 3HI4A 2I78A 1S8OA 5AI4A 3C43A 1EDDA 4MWTA 4AO8A 1E66A 3FLEA 2QS9A 2RGUA 4H0CA 5FDFA 1MN6A 1TCBA 1JU3A 4EUSA 4EY4A 3SC2A 3SK0A 1QIIA 4H7DA 4JH0A 4XVCA 2HA2A 3D3NA 3BE8A 4BAZA 4OUKX 1CUIA 5JANA 3DL7A 2OLEA 1VA4A 4TVKA 5CTAA 3KXPA 1E5TA 4U2DA 1VE7A 4G4JA 3PUIA 4H18A 3WWDA 3V1MA 2ONCA 3IB3A 5HF9A 4B84A 4G1FA 3AIKA 5ALZA 2JGKA 2WIFA 4P93A 2AXEA 4FLEA 4X7BA 4M0MA 1R3DA 2I3DA 3O4GA 5CURA 1SCIA 4OB8A 4S0XA 2B61A 2HA5A 1G42A 2Z3ZA 5LZ9A 1XKTA 3STXA 4AQDA 1VA5A 4EY5A 2GBIA 4B82A 5A7GA 2WTMA 2JGEA 1HPLA 4QDOA 3ZPXA 3ZI7A 1MNQA 5CT5A 4W9RA 3O4JA 2GBCA 5IVDA 1CUJA 1ZJ5A 2G5TA 4UHCA 4Y9SA 3VJLA 4PF1A 3O95A 2GZSA 4H7EA 2GZRA 3M82A 4IH9A 1IZ7A 3H18A 3G7NA 3I2KA 4KE7A 3A2MA 4PW0A 3D2BA 3D2CA 3E1GA 5AICA 4BCDA 3H2KA 5YASA 4PNZA 1W52X 4BYMA 4MYDA 1HL7A 2WIJA 3WWEA 2HDWA 5FRDA 2J3DA 3I2HA 3ZLUA 1XKLA 4MQLA 1O6FA 3ZV7A 1B6GA 3BJMA 1MX1A 3BJRA 3OURA 1LPNA 2WJ6A 4PQEA 3DNMA 3IIIA 3STVA 3H2HA 2VJDA 2QR5A 3DLTA 1YSCA 4DGQA 4E14A 2CMFA 4B9EA 5ISMA 5E4YA 3V1LA 1JJBA 3WK4A 4UBJA 1XQXA 1TRHA 3WA6A 1XLVA 2WG0A 4X91A 2OCIA 2ZYRA 3ESAA 3PICA 4KRYA 4HAIA 1WOMA 5HQ3B 2VEOA 4BZWA 4I19A 5E4JA 1E3QA 1RWQA 3FSGD 1A8SA 1CPYA 1ZD2P 4DNPA 3HXKA 2H7XA 3QPAA 4J3JA 4QA9A 1UKBA 1Q83A 2O2HA 2O7VA 4UFPA 5DYWA 1DQZA 3M3DA 4J0KA 2WIDA 1GQSA 4DMFA 4BTLA 2Z8ZA 3AIMA 2BKLA 5AM5A 2JGJA 4QNNA 3IVMA 1AKNA 2RIPA 1U2EA 3TRDA 1K63A 1H22A 2UZ0A 3F67A 2XMSA 1E8DA 4EBBA 5JADA 3W2TA 5AM1A 2VSQA 1Q0RA 5K3EA 1BEEA 2VF2A 2DHCA 1ZGCA 3N2ZB 5AKYA 3Q8WA 3L1HA 2V9ZA 4OYYA 1BROA 1EXWA 4FNGA 3IUJA 2B20A 2QMQA 1AX9A 4G9EA 3DKRA 2HFJA 1GXSA 3GELA 5C8VA 5JZ9A 2J3QA 5EI5A 1A8QA 1FFBA 1JU4A 4FMPA 3MVEA 4BDTA 4LIPD 2DFPA 2OQIA 1DT3A 3HZOA 4HXFB 3JW8A 4IHAA 2WM2A 3KWFA 3WK9A 3FCXA 3VKFA 3H2IA 4H7KA 2QXUA 1UZAA 1R1DA 2XDWA 5HFNA 2X76A 5HF5A
chains in the Genus database with same CATH superfamily
1CQIA 1FX1A 1Y63A 3BPSA 3QVMA 4LCJA 5CW1A 1Y4ZA 1WHTA 4AS3A 4ZYZA 2L42A 5HOQA 3RJMA 2V3CC 1NIPA 3UT5A 3LWNA 2D62A 2H5IA 2F43B 3VJRA 2O8NA 3SWWA 4NZPA 4XX0B 3VUFA 1U98A 3PQCA 3ZVNA 1FBTA 3UGQA 1DAGA 1Q2UA 4G86A 4PFJA 4OP2A 5SV2A 1S8FA 1Z45A 4S1NA 2FGKA 3EE6A 1LI4A 3UAXA 1K5PA 3DE0X 4MYHA 3SSMA 3I37X 3HY4A 4NS4A 4BVEA 4BLWA 5BUQA 5C7YA 1E3TA 3L8CA 3TJZA 3X1XA 4UD2A 3GDWA 1GRVA 3GLIB 1PLKA 4EELA 4K9PA 4YLYA 4TTRA 4FHFA 3A32A 2AJTA 5JXGA 1KMMA 3GW8A 3GMSA 3OZ7A 4IILA 3TAXA 5C5DA 5HCNA 3UJDA 1XL1A 4WESA 1LDEA 2RGGA 3Q88A 3TMAA 3FD8A 1JYFA 2PV0A 1GDDA 4F5EA 2VYVD 2ORWA 4EHKA 4PNEA 2LKCA 5BWCA 5B1SA 2YW9A 4JQCA 3CEHA 4KYVA 1Z2AA 4PWYA 1JA9A 3EXEA 2FZGA 3U80A 3BL8A 3B3QA 5DMXA 4BGVA 4JOCA 2OOSA 2ERYA 2FPLA 3QJYA 3OBIA 3WLSA 1E3LA 5CB4F 1NN1A 1FFXA 2AFRA 3C0KA 2Z08A 4UAVA 3R77A 4UVHA 1QPGA 4AMYA 5DHQA 4AMGA 9GPBA 1MKYA 2OAP1 4Y98A 1NNSA 4JBXA 4YP1A 4FGJA 3PHBE 1RLTA 1R4MB 1M2EA 2HL6A 3R5KA 4BNDB 3FG9A 3QI7A 4M54A 3VPDA 4FINA 4C04A 5ICMA 3R6TA 1NBMA 3JARB 4GRIA 1R37A 1IVYA 1PDOA 3R3XA 5FOSA 2NZVG 3JVIA 3ORYA 2J0VA 1TFUA 1QZ3A 1RLUA 4FHDA 4GD3Q 4IO1A 4ZVOA 2FUG6 3L0PA 3VVCA 4D74A 3S8YA 1ODKA 5KTTA 1D03A 2AYYA 2BFEB 4NWIA 3RANA 4R7TA 3QE9Y 1E2LA 1JLRA 4O1IA 4AZ3B 4B17A 4QGFA 4ACAA 2A1UB 3FYCA 4NLLA 4ZVUA 4HYTA 4GDMA 1ZN2A 3U4DA 2HQRA 2AOUB 4XAQA 3LDHA 3QKRB 4R40A 4BO9A 5DBIA 4YXWD 3W2EA 4UM7A 1CFZA 3M3HA 4GSLA 4INPA 4JL8A 3UHPA 5A4JA 2X4IA 1NWHA 3IELA 4ZTBA 2W70A 3RVMA 3NTOA 1MB9A 3TNLA 1IBMB 5LWQA 2G7ZA 4Y1RA 4P2BA 1SEVA 2JGMA 1II9A 4ZOAA 3ZD6A 4IIYA 2E6UX 4CL0A 1OMOA 1KAOA 5E9QA 3WGJA 1I0ZA 3GZNA 4E70A 4A8JB 3ZCQA 5CVTA 4PG7A 2QAJA 1FYEA 2VPPA 3QVXA 4RULA 2CVZA 3JWHA 2JRCA 2YRXA 1JEOA 1H2HA 3R4CA 3H86A 4RHCA 1GA6A 1Z18A 1WMBA 4TTPA 4ZXFA 2V3VA 3IAHA 3NTUA 3ZV6A 2HXGA 5JS7A 2WKSA 2AJ8A 2EQAA 4JB8A 4GOKA 6ADHA 5GAJA 3RKSA 1IZYA 2TMGA 4LV5B 4CMCA 6AT1A 3UO8B 4AX8A 4NI5A 4B35A 1TZ2A 1KI6A 2OWDA 4X7RA 4EY7A 2CDCA 4HX9A 4UU7A 5CAEA 1BW9B 3L6UA 3YASA 3E23A 2PIDA 4GQAA 4TWJA 2G9QA 4MW4A 1M34A 4MEBA 1JEAA 1UKYA 3N86A 5TQ2A 5IKEA 1KZ4A 2GDZA 1V3TA 1XJCA 2QYOA 4FUQA 2WB4A 3SHFA 3ZCRA 3N2GB 1LBTA 3CA8A 4HMOA 2CK3A 3LP5A 3WHLA 3BEDA 1ZG3A 1WRBA 3DH0A 1Q1BA 1WXFA 3KL2A 2XBLA 1Y9JA 2PH5A 4UUNA 1UDWA 3GEIA 3BGOS 1SC4A 3DBRA 1KFCB 4GOOD 4JMPA 1AY0A 3OZDA 3OFND 1AURA 4Z0TA 1NWCA 2WU1A 4BX3A 1IZ8A 3CRQA 1XB2A 4GZ6A 3K8YA 3NS7A 4O29A 5JD5A 4PYJA 2XEXA 3OIFA 1CYDA 3P0FA 4Q93A 3LE8A 1QVWA 2HMVA 3A6DA 3FWZA 2WJAA 1GGHA 3K4PA 4F9EA 1MU0A 4IX1A 2PBZA 2R8OA 3B3AA 2FPKA 2O07A 3GFTA 5EIFA 3S99A 5LXTF 4XX1A 3LY7A 2W2LD 1K86A 2A30A 2IOQA 3BMNA 4W99A 5A5DA 1VCOA 3GJRA 3TPZA 3URMA 1L4NA 4AECA 3LPNA 1NW9B 2RARA 3V9AA 4DV3B 1RBQA 3QVGA 4EFDA 3CW9A 2WF6A 4NDNE 4V0SA 4WXHA 2Q0QA 2SNIE 2QRPA 2PSDA 2V7UA 2OUIA 2BH2A 1E5DA 3WZMA 3EPHA 1FC0A 4F46A 5D85A 3BVPA 5CLQA 2GVNA 3HN6A 1NHGA 1TU0A 4LJ6A 4N18A 4QC2A 5ECGC 2YXDA 1K2WA 5CT6A 1XCOA 3OT1A 4LHXA 1MABA 4OU5A 1AQYA 5THQA 3ZLVA 4A0FA 1BMFA 1PP4A 2PMFA 3O0TA 3W06A 3MCZA 4RCVA 2ZSJA 1A2QA 5EQFA 1KAGA 3RWOA 4G2TA 3NTRA 3K7EA 3P2JA 1XROA 2D1SA 3WGLA 2CT8A 2YWGA 1H2RS 1GRRA 3IEUA 5LQDA 3RUEA 3WK8A 4BEWA 4C2UA 1F8YA 1TMKA 2MSNA 3ITKA 4IS2A 4MCIA 3DC7A 3OZUA 4EHIA 5JAIA 2XXBA 4XDGA 2ZJAA 3PNMA 1F9EA 1WE2A 1UPAA 2YY7A 4UE6A 5LMZA 3A04A 1YGYA 3AUAA 2GTPA 1HTWA 2GJ9A 5BSFA 1M33A 3OY2A 5I7WA 1RZRD 3I4FA 3MMZA 2R60A 3U60B 3EFOB 3BZBA 1V7PC 5IF3A 3VNVA 4HNUA 3AILA 3WL6A 2B5OA 3V00A 4JZKA 1W0CA 2WUWE 2Y66A 3OLXA 4ETNA 3GNSA 3AIOA 3R6GA 3VKVA 3L46A 1IRXA 1R4NB 1GZDA 1GPBA 2BEUB 3IP9A 4D9IA 1JQ5A 5BVHB 1BWSA 2AJDA 2HPVA 2Z8XA 4MHSA 1BE6A 5LIPA 3I4LA 5KHOC 5SZJA 1X92A 3TLYA 3IOCA 3BX1A 2GCOA 5HCUA 1UBCA 2QENA 4JVMA 1EVZA 5L53A 3FTDA 1LJLA 3AKDA 4EKYA 5ILOA 2D54A 3I6QA 4X66B 1UF9A 1R2QA 4QECA 3RPEA 2I7TA 2RHHA 5BMOA 2HBZA 4XQCA 2XTAA 3QH4A 3ROGA 3MOIA 1YB6A 4I55A 1IPFA 4JIGA 3UJ9A 4YUZA 4OYHA 2R47A 3K20A 4KQMA 1U3WA 1TJ4A 5K8UA 4JA0A 4GF5A 3B70A 4HNSA 2Z4RA 1J90A 1PNVA 2EATA 2D8AA 4HCJA 4PZ9A 3WC4A 1EGMB 1OLUA 3UMRA 4D4JA 3EVEA 4X84A 1GZHB 3RREA 4RTNA 4ITVA 3P9NA 2P27A 2H16A 1G8AA 1JDBC 3AF5A 1ZY2A 1WKVA 2PKCA 3CXRA 4LDRA 3ORRA 5IMBA 5J2UB 3LSYA 3DBOB 1CF9A 1Q3TA 3QXCA 5DOVA 3VH3A 2A3NA 2I4RA 1NBEA 2AR0A 3BIWA 4RXTA 1J99A 4BGEA 3CE6A 4QQFA 2IP1A 2WLSA 1PR4A 2ZR0A 1OF1A 4DADA 2HXSA 3I2JA 3IAXA 4PSVA 1FDRA 1NW7A 3L5OA 1KY2A 3DZGA 1TLTA 2ZAMA 4LHZA 4Y9TA 4OXNA 3PENA 2QRQA 2WIAA 4GYWA 1Y33E 3GZ4A 2P1ZA 3OZGA 4IEFB 3GEMA 4RXUA 1EWQA 2QLMA 3AB8A 1G3QA 4CE6A 1ZXLA 4HKTA 2F43A 3EVAA 4UZSA 4HNTA 1JPUA 4YAGA 4YRGA 3JQPA 4I4IA 3AESA 1NL3A 3SC6A 2IIQA 2Z1NA 2R66A 3C97A 2IL1A 2TMDA 3TOZA 1QFXA 1CLEA 3D8BA 3IBTA 3Q7SA 4QVGA 2FMIA 3QEOA 1PJLA 4B4KA 3VGJA 4MQBA 3EUEA 5CVCA 3X1MA 4Z51A 3GLIA 3TUZC 2QN3A 1IHPA 4G56A 2BSQA 1U7HA 2PLNA 3FLBA 1EFPB 1M2NA 3FUXA 2X15A 5DNVA 5FBVB 4MGYR 1OYYA 1QF6A 2B0JA 1NYTA 4IDDA 2ON6A 1E2MA 3C1TA 2GN6A 5FPKA 2P4QA 2VP2A 2V7XA 2FVYA 3EWAA 5DW0A 1OU0A 5JAZA 5AW2A 4LCEA 1KJ8A 4OGKA 1ZJZA 1IULA 4EATA 3EVNA 2IPNA 2ZIFA 1PJQA 4CQMA 5JTTA 3EWIA 3QE3A 2BFPA 2ZXEA 1BFKA 1EIWA 4H77A 1P9LA 1DAIA 3KVNA 5FWAA 1FK8A 5HYVA 1WCIA 3KJGA 1SELA 1U2RA 4OXYA 1OAAA 1DEKA 3K15A 1UAGA 2NM0A 3TQSA 1X9GA 4RPGA 4XVRA 1PG5A 3EGEA 4NEHB 4HAYA 3H8VA 3AF4A 3PA6A 1GSHA 4FZJA 3I42A 4FW9A 1AT1A 1R4MA 5DU2A 1S6YA 1DAFA 2EKQA 3ELBA 4OP1A 3IPLA 2W8BA 3PV0A 3JARA 1HL3A 2ZCUA 4OH7A 5HJEA 1ZA2A 4J29A 1FRVA 3WRYC 3NOXA 2V9CA 3M6LA 3PUYA 4JP1A 4P5PA 3OEHD 2FW1A 5FTKA 3QGMA 2FPIB 3ZOZA 1QIEA 1XA3A 4AZ3A 5HPYB 3W6ZA 2XHZA 4Q05A 1T5DX 2DT5A 2W6CX 4RQTA 3VPFA 4AMVA 4Z8XA 1KFEB 4C08A 1BMTA 2IEYA 2UYYA 3LBYA 4DWJA 3QKRA 1V5WA 1L7MA 4DLZA 3T7KA 1JJFA 4A36A 1DCFA 4PG4A 4C4TA 5ALMA 5J9FA 4CKCB 1V8PA 5TJ9A 4W5WA 3DFMA 3PX2A 2ZEJA 4ZK2A 5JCJD 3B3GA 2Y0CA 2EERA 4JODA 2BEWB 4YRLA 2CXUA 1QP8A 4TGLA 4DY6A 1U6IA 5JDCC 4ZRDA 3FMPB 5HIMA 1T35A 3A6PC 1G66A 3HHPA 5DCUA 5AUOB 4M89A 1M83A 5F1PA 2OFPA 4YBZA 3AZPA 3BHIA 3GEHA 5J47A 1X2EA 1IJBA 2Z5GA 4GXNA 1G8PA 4KN6A 3SS8A 3M89A 5K0SA 3KQHA 3LNTA 4OQNA 1J21A 1O96B 4QTUB 2HJVA 4TZ6A 1WF6A 4ZDWA 4CDGA 4KUGA 2P77A 4L3VA 2PRJA 4D3DA 2B37A 1M2HA 1SCQA 2IITA 5EE5B 4C88A 1EK5A 3M2TA 4TUYF 4X94A 4E30A 2HHHB 1MJFA 4RVNA 1XAJA 1N7IA 3KJEA 4EYQA 5IJ0B 1YJBA 5JNRA 3G1UA 1R0CA 4TTAA 3MRSA 1YI8A 3OI7A 1PSDA 1GAJA 5B1HA 2DWOA 3D9QX 3N2GA 4DR7B 1UIMA 3RF7A 4F2HA 4PLPA 4IRMA 1UKAA 3BMXA 2DTDA 3QBVA 5AXBA 1UMKA 4RGYA 1CUDA 1BDJA 5CJJA 1QORA 1W87A 1UT8A 5IDYA 4LX8A 5EJ4A 4AX4A 5C2JB 1AUQA 5JS6A 2ECFA 4GVLA 5IVHA 3DTVB 4KJXA 4KMSA 4UD6A 4ESEA 4QQ8A 4MB6A 3Q41A 2VHJA 1SRQA 3VZDA 2F1HA 1U2ZA 2Q2VA 2IRWA 5TS3A 4MGIR 4DUYB 3OQVA 4HX5A 1F6WA 2FUNB 1QB8A 2XWSA 5IM4A 2XCQA 1N8TA 2FQYA 1I5EA 1TZCA 3RR2A 2GHQA 1DFGA 5ENDA 4G26A 4C20A 3LKBA 4YFYA 4FZVA 3BE6A 1L4GA 3MCUA 2OB2A 5T6BA 1IXSB 1F1JA 4J4TA 4E3ZA 1KSHA 3UAGA 5P21A 4CBVA 3C5EA 5AJVB 1GNRA 2I99A 3EPPA 4HUTA 2O8BB 4NZOA 5BSUA 1MPXA 4D45A 4Z4IA 4HDMB 3SNKA 1F20A 2HGZA 2G1PA 3LUDA 4EGJA 1Y4DE 4E5VA 3REGA 3RK0A 2CCJA 2QTWB 1CCWA 3MM4A 3RVLA 4BO8A 2X7HA 2V6IA 2NQ8A 1PFGA 4MUIA 2BDEA 3IQDB 3DLHA 2C8LA 2EBWA 3OCXA 3GFGA 2R1TB 5FLKA 1VIYA 2JCXA 8GPBA 2WDPA 2ZUFA 5K0JA 2PNFA 3O31A 3UHAA 3K0EA 1O9GA 1WLYA 4HTFB 4TTVA 3U3JA 1SC1A 3TEJA 3GVCA 4IHKA 2I22A 5EIOA 3TGPA 1EFDN 2DP4E 3E81A 2H1LA 3ROEA 4DJDC 1XZDA 4G67A 1O3YA 2EZ4A 1U9CA 3ZBQA 1CU1A 1HRDA 1M67A 5DH9A 1NQ5A 5FKJA 2QEQA 2IWRA 2VHXA 4KLNA 4LA4A 1U3TA 2Y68A 3FJYA 3A9SA 1R9MA 2C2YA 3PPVA 2QL5A 2O2JA 3EXFB 2XZPA 4JC0A 4XWGA 3TKLA 1V4NA 2E0IA 4I5EA 1VXOA 3WKDA 2AQ8A 3A1EA 1I0LA 1V96A 2HADA 3LHDA 3MT8A 1C9MA 1DOAA 1YBHA 1ZSNA 3VNRA 3EFOA 1R74A 1VGQA 2QAIA 3E8MA 3KT0A 1EHYA 2C8JA 2DOKA 3PRKE 3TZLA 1GR0A 1RHJA 2A5DA 3EOBI 4EAQA 3UMMA 1KDRA 5EAIA 1E2JA 1TB4A 1PWYE 3ZKWA 3KQKA 2AG5A 2EIHA 3C3BA 2VJQA 1E1DA 5JSUA 1JQLB 1T8WA 2B94A 2VSOA 5EQJB 2X8BA 1L7NA 1WEKA 1I33A 1GU0A 3CUEF 1R4NA 4KYIB 1QK4A 2CB0A 1NNUA 4U9IS 5DHTA 4B9AA 1XK6A 4C29A 2IKSA 4CF6A 3RB8A 4N7RA 4FFLA 2CEKA 4YIHA 3V32A 2EJCA 2G40A 1QYCA 1NUPA 2EP5A 4D6PA 5BSHA 5A7FA 4YFVA 4BRSA 2QI9C 2QD3A 3B6ZA 1SD1A 2QM3A 3AI1A 2XT0A 5ALNA 1ZISA 1RACA 2FG5A 5EYPB 1Z6AA 1L5GB 3UHFA 1HDRA 4B4VA 1GPNA 1TKBA 4EGFA 3G8CA 5HZGA 1FIUA 3W9YA 2OHFA 4B81A 1PT7A 3NHBA 3UAOA 4HUJA 2GXAA 3WYNA 3S2ZA 2HA3A 3CRNA 1L4BA 5AXAA 2WWGA 1GGFA 3CF2A 5B1DA 4W9NA 4LJYA 4IIJF 4RIFA 2J0EA 3L1UA 4NU5A 3Q6IA 3S27A 4D9KA 4PC7A 3HPRA 3EUWA 2C7OA 4M1TA 4ZKDA 3DUFB 4GR9A 5BT8A 4CODB 5SICE 4E1VA 4UOEA 1UK6A 3V4RA 1MRZA 1Y3FE 1TEZA 1Z13A 3RG8A 1CVIA 4Y2XA 3F9CA 5HKBA 4RLFA 4W5OA 3MMPA 4JUBA 3RM3A 2XDAA 1NFRA 1E64A 3BXHA 1IL0A 3QV1A 4MLZA 4O2RA 4RNCA 1L5SA 1TVMA 4G41A 1FP2A 1NW8A 1VSTA 4RPCA 3PK0A 5IYZB 3KSMA 3NYRA 4MIOA 4CTNA 2C61A 4EL0A 2JD2A 4QFCA 2PJZA 3F6RA 1F8FA 1XZNA 3GG9A 3QRWA 1F4VA 3LTEA 3N0WA 3Q5GA 1CT9A 4UCFA 2P4EA 2QMOA 1S8NA 2Y1WA 3WBBA 4BZZA 5TMPA 4OK5A 5BV2P 3L0BA 3I39X 3BRCA 3RBVA 5H82A 1ZS9A 2IHBA 3Q9UA 1YUNA 3FRHA 4IP0A 3TOXA 4INZA 4K9MA 5C3MA 2OO5C 2P7HA 4RJJA 2X41A 1T6YA 4WFKA 2R7MA 4KQIA 1LZLA 3E03A 4ZD6A 3ZDEA 1HDYA 3FR7A 1NW3A 2WMNB 1GPJA 2G4LA 3BDIA 3QEJA 1SBZA 4M60A 3FCSB 1EFPA 3NX4A 4KFTA 4TKLA 2XCIA 5CPBA 1NSFA 3OU7A 4PHHA 3NYWA 5AR1A 4BLQA 4BN0A 3B5EA 4D56A 2LGJA 3OPXA 4R8KA 1AXRA 3VR2D 1E58A 4AY4A 4TKVB 2JA2A 5I8WA 4NCIA 4IQGA 5A7HA 2P2NA 4P4NA 1DMSA 3O4RA 3DPUA 1D4ZA 4EHBA 5DLEA 4QVIA 3HVKA 1SKYE 3IRVA 4CNQA 1B6RA 1JRLA 1XRMA 5C31A 1SHZA 4M83A 4TMKA 5ERXA 1I7NA 3DWEX 3IMFA 4AUEA 2AQKA 4GWLA 2O05A 3LF2A 4H7IA 1SUSA 2X7XA 2ZB2A 4L51A 1YR6A 5EZYF 4UQOA 1YR9A 3O8DA 4RY2A 1TD1A 3U1BA 4BP8A 3BFXA 3W8EA 4JLJA 4MKFA 5BW8A 3DAFA 1AB6A 1K75A 1MO5A 3O8BA 4YJKA 3GDHA 3KZOA 1NXSA 3AL0C 3EGWA 5HIKA 3F7TA 1DFIA 4GFDA 5GM2A 4A0QA 3MLAA 3V3KA 2XUGA 1HY3A 3SIWA 5E6UB 3KX2A 3MT0A 2AC2A 4Q4CA 2VOJA 4B7CA 3GLTA 3G8DA 4CIAA 1GZUA 1Y48E 2P0EA 1UFVA 1GYRA 3EZ7A 4X0EA 2UZ4A 2FPIA 3BD9A 3S28A 4G8BA 3UAYA 1ONOA 5F21A 4DSTA 2I3ZA 3ABQB 4V0MA 5BWNA 1X15A 4HAVA 4QOEA 4YR7A 3U4CA 5AKZA 1V4BA 2A1TR 3P9QA 4UJ3A 2GUWA 4FBMA 5JZOA 3NM4A 2JASA 1CDZA 4GI5A 4BBPA 1PT5A 4BDSA 4FT4A 4BMOB 1KYTA 4AKEA 3LV8A 5DEOA 3ENZA 4LQDA 3NHMA 3GJYA 1EXMA 1EEXB 4A2WA 4MIEA 4YV7A 1R7RA 3ESXA 4JJZA 1YMVA 3QMPA 2ADFA 4P5EA 3SZGA 1WD5A 2BEWA 3EC2A 5FR2A 1MXFA 2ZJ8A 3OFVA 4DLWA 3LZDA 4IOKA 5IFLA 3F8WA 4LY0A 1ZL2A 3WBKA 4A0HA 2J6BA 2PRKA 1ZHHA 1JKJB 1RPJA 3GIDA 4QJBA 4OQDA 3RRXA 2ZR7A 2X5JO 2AIRA 4N5MA 3RUPA 1GQFA 4H6VA 1QJCA 2ZJ2A 3GLKA 4GZ5A 1ZL0A 4DF3A 3EGVA 1QIMA 5LKRA 3JAMA 3AF6A 3NASA 2Q0SA 5F1YA 5ICEA 3V2UA 2GBGA 1G0OA 3EH2A 1ZITA 4WJZA 3V6MA 1NJ8A 4DTCA 1NG9A 2GFHA 1XTBA 3ZJUA 3FBGA 5EIBD 3LW8A 5T4FA 4BO2A 1PHPA 4PHCA 5KOJB 1S96A 1ZD8A 2EFCB 4PYLA 4J9VA 3KHUA 2NV2B 3MTBA 1Z4NA 4J1QA 4ODIA 1YFKA 3CO5A 3AB3A 4TMZA 7YASA 5IJ0A 2JG3A 2C1XA 4CEHA 4OX9Y 2QM8A 5CW2A 1MX5A 2XNHA 1VKOA 2YY6A 4OCZA 1L3BA 1TUIA 3T0IA 2VZ9A 1OC4A 2YV4A 3AJ8A 4YUXA 1B73A 4YR9A 2YXLA 4D8WA 4LSZA 3HEMA 3ILXA 2O48X 4IVNA 4TS1A 1A9QA 3RG2A 3SX0A 1KI7A 1UJ2A 1ZH2A 3CGGA 3DYIA 3UNXA 4IM7A 4GECA 1E1MA 4YCAA 4Z3KA 3RVDA 2DFNA 3MWDB 2GKOA 2XWBF 1OCEA 2WPDD 3HACA 3KB1A 4JBIA 1JAZA 5ALXA 1P60A 1SU8A 1KS2A 2VRCD 2ZIGA 3EHEA 3G2NA 2EKPA 4I66A 3A4NA 2ZRDA 4KXNA 5HOEA 1IONA 3OG9A 3QITA 3UEOA 1ZCFA 1KK0A 1XAIA 3VZPA 4ZZ2A 1T1SA 3JVVA 5BW6B 1VJGA 4CI9A 2VH2A 2PGLA 2BF4A 2I65A 4UTZA 1J70A 4DWVA 1C14A 5JASA 1R6UA 3H5NA 5JRDS 3B5JA 3W9UA 1GUZA 3UK6A 3RFUA 4RLHA 5KCMA 2YFHA 4KR9A 3UB4A 4QUDA 5J5CA 1J42A 4B80A 1YZVA 3T95A 2VCEA 5U4QA 3UXHA 4LYHA 2H08A 4AN4A 2B4KA 5G40A 5FUMA 3H5VA 1FJXA 4HDMA 2WVGA 3CN9A 1P1RA 3JZMA 2JHFA 2K5UA 1Z2EA 3FOBA 4ND1A 4WKBA 4Z53A 5FPHA 3EASA 5T4HA 4OO3A 5E3HA 1PL7A 4B7XA 2XYQA 2R7LA 4BKPA 2C9MA 3FHCB 2RMKA 1AS2A 2R1TA 3BCRA 1R5BA 1IEVA 4WW0A 4ASUA 1YFZA 5ICSA 2QQ5A 1ZD3A 1CJSA 3PLAE 5BV1A 1E1KA 3DJFA 4I81A 3ZR4B 1XF1A 4EHNA 2NU9B 1KPIA 2J87A 3J7TA 3P9KA 2UYGA 2IYVA 2YVLA 2JFGA 3T5AA 4YPFA 4JBLA 1IVNA 4V1CB 4ZARA 1ESEA 3KB2A 3Q3VA 4JDUA 3CWQA 4QQKA 1NX6A 2P68A 1OLXA 3A26A 2BKUA 5KYVA 1VHLA 4ETIA 5KOYA 2OORC 4RTSA 5DXAA 2OV3A 2PFKA 3PVSA 3DDWA 1QR2A 3OPMA 3CEAA 4GBED 5JAOA 1ESCA 4PQRA 2JDIA 1E7MA 2V54A 4QUBA 3H1BA 4OD0A 3PEVA 3PPXA 1UBOS 3QLJA 3QVUA 4FYMA 4S2EA 5LZ8A 3U81A 4B3TB 4W63A 3UK2A 3A1TA 3JQGB 1BWPA 1TEHA 3SVZA 4M3NA 1NLZA 2JAPA 3IMKA 1A4IA 2IX3A 5L51A 2LPMA 1ZO8A 2I3BA 3UBMA 4B79A 1MAWA 2X2FA 4DLRA 3TFOA 4NCAA 2PRSA 4RO0A 2HIHA 4KGVA 2BFWA 1SB8A 3WLAA 4RDXA 1YCGA 3T1QA 3AFIA 4IF4A 4K9QA 1Y6QA 2WT8A 2WT9A 5ECWA 5TMDA 3CZMA 5CRIA 4ER3A 3BJZA 4KN5A 2WA1A 4OHPA 5B7QA 1XF9A 2HSDA 4ZYLA 3PITA 4LPKA 1VRCA 4XM1A 1A72A 2F8SA 1HTBA 1A7JA 2L18A 3TIIA 4L6CA 3HM9A 1LPBB 1RYFA 3H3XA 4J7UA 4MQ4A 3RYFB 1AMOA 1N5JA 3SSNA 2HYIC 4JA2A 1IZZA 5HK8A 1Z0AA 4EG3A 2GD2A 1FDUA 1A04A 5CJ2A 4F4UA 1RLIA 1XRSB 3MD0A 3QXGA 4QQNA 1UPBA 2XDYA 4Q3EA 4HC4A 4PO9A 4N9QA 2NXEA 1R0WA 3AINA 5IDXA 1VE1A 1SBCA 2AKYA 4CTOA 5IM4F 2AFHB 3OKCA 3H05A 4O0LA 4OQFA 2VTKA 1NP6A 3L4BA 1Z5WA 1EB9A 1G59A 5FOUA 2QVCA 1DPFA 1OW3B 5DYGA 1ZMRA 1Y1PA 2ATEA 5FUXA 4JITA 1WB9A 4J0EA 4KB5A 2KI5A 4JSRA 3U61B 1GFSA 2V4MA 1XYGA 2D5LA 1OLSB 1RLMA 4X5OA 3IMCA 3L40A 3DDSA 5KX5B 4YDHB 3HI6A 3ZN2A 3VYVA 1C50A 4M1YA 5KDDA 1B1CA 1IHUA 3DHYA 3T3EA 1KVUA 1DAOA 4MUJA 3S5UA 3IO5A 1AD2A 2OEPA 3D0QA 1EZ4A 3MT7A 3QSGA 3ZDBA 2Y2VA 4LX0A 1U4SA 2GFQA 2RAPA 1KMHB 2ZR8A 3HCCA 2VJNA 3OJ0A 3CVUA 4ALNA 2WHYA 3IOMA 3WK7A 4AI6A 1E3WA 1FLAA 5D87A 3TZKA 5IK2D 4G0UA 3FM9A 1PF7E 2HY7A 3L7IA 4HB4A 4B4WA 3M49A 3ESRA 4YYEA 3LFTA 1YACA 4G0NA 2KX7A 2D0IA 1SCBA 2CXXA 2VYVA 8ATCA 4JELA 4MV4A 1TQ2A 4URUR 4TKVA 3T7IA 5BSEA 4Q1BA 2CKDA 3I9JA 1KIMA 8LDHA 2FZCA 2F67A 4RK0A 1ZD1A 3FTEA 1FRFS 5ALFA 4DG9A 4JUAA 3RJ5A 2NAFA 4Q01A 1N6HA 1NBIA 2X2OA 3CXUA 3MJTA 1EXNA 5FA5A 1T29A 2DTXA 3SMVA 4M9UA 3T99A 1ZD4A 3NRJA 1TUEA 3UH0A 3WIBA 3WY9A 4XYEA 3ZUGA 4F91B 2QL6A 4LZLA 3BXFA 2GAJA 3SM9A 4WK4B 5TE9A 4JP3A 3AI2A 4PGGA 1OJ7A 2AQHA 2W6PA 3IL2A 1E79D 2EARA 4EG1A 2ZE8A 4CMEC 2REXB 4G97A 2QTAA 1WXXA 4DA7A 4RY8A 1IVSA 1ZMTA 3M5DA 1LGYA 1FUIA 4PY2A 3OHPA 2QXTA 2YS7A 5TQJA 9LDBA 3Q7EA 1CG6A 3N2KB 4FEYA 4ZQGA 5A4DA 1Z5NA 2GZAA 3U39A 1UBNA 5KYWB 2GDJA 1B6TA 2IQIA 5E6UA 3VSAA 1PFKA 2CWDA 1HNNA 2XUKA 3VDQA 5JFOA 3WFIA 2PX6A 3PQDA 4L5JA 5L3QB 4X3CA 5ER9A 3HCDA 5BRJA 4YXWA 2E1RA 4TTIA 3DE2X 1C81A 3TW0A 2GKGA 3CONA 2X2EA 3D5EA 1NAHA 4N5LA 4DDHA 1XDUA 4DBLC 1TEXA 3LC0A 5K9ZA 1ZGJA 1D1SA 1XZLA 3VHRA 4MO9A 3WMXA 2XT9A 3I04M 1P7YA 5ALPA 3AHJA 1YUBA 2HDOA 3GNTA 3PHCA 1UBEA 1V25A 3PRJA 1WCYA 3R3SA 1QYXA 2B3TA 3L7NA 3M0EA 2O2YA 4H6PA 4AUKA 5JY6A 2R6FA 4QUJA 2ZAYA 3TW4A 4CCSA 1RHQA 3K0CC 3ZNNA 2P41A 3ZQ6A 3I2GA 3HYCA 4FNOA 3T5MA 4Q4LA 1JV2B 1E4EB 3D4NA 1ECGA 2FUCA 5H5JA 5JBIA 3BSWA 3O1IC 4JI6B 2HJGA 1JKJA 2H0AA 1K9VF 4DDKA 1ZH0A 2CJPA 3INYA 3W0LB 2J5BA 2PMBA 4DABA 5B2EA 4UEKA 5HRCA 3PFGA 5C1PA 4PC1A 3MTJA 3TNJA 3BYZA 1DPGA 1RJ9A 4ZVLA 2OXCA 2CSXA 3RUAA 1XEWX 4MAMA 4ZOCA 1M10A 3RTCA 1N6RA 3GQBB 2HWUA 1G21B 1GQYA 1TYCA 1Z12A 2L2QA 5ESWA 3UYLA 4XGIA 4NBSA 3ZS9A 1YQGA 3MMSA 1GNSA 3DZ8A 4KZPA 4A2CA 1PJRA 1M7BA 3SGLA 2YVUA 4OK3A 5SY6A 3T1HB 2FMKA 3L8MA 1OA0A 4R2JA 4DB4A 1EQUA 5MN6A 2KWIA 1A4RA 4TQGA 5GOZA 1FFEA 1UDXA 1HFJA 3GVXA 4FD2A 5GVSA 4LF4B 2VDRB 4NZMA 2VPYA 3KOWA 2PUTA 3OFNA 3EUAA 1ULSA 5CGQB 4EL5A 3RVJA 2OXEA 3UAZA 4UTPA 1C7RA 1N25A 4I55F 4TT3D 1KIAA 2Z2IA 3W6OA 3MWDA 3HNOA 3R23A 3ODGA 5FV7A 1JILA 1TCAA 2PHZA 3ER6A 3N7UA 4MR8B 1PTJC 5BY2A 4KE6A 1GWNA 4MRRA 3CKYA 3PDCA 1P2UA 1VG0B 3KSUA 2VBCA 2PR7A 2QRHA 4N47A 1QLWA 1AVTA 3K4QA 4HWTA 1A76A 2A88A 2B2CA 1KJIA 3A3OA 3LGAA 4TS4A 4X6YA 3V42A 3V9PA 1PDWA 4UEOA 3LDGA 4LSWA 5GJVC 2W2LA 2Y77A 4QSHA 3TRKA 3KJNA 3FNGA 1IAQA 2QSJA 1IXZA 3IH5A 1Q7GA 1G5FA 4GM0A 4E1AA 3AEQB 4G81A 2BUAA 3SLGA 1W96A 4HAWA 5AHOA 3D5QA 3CINA 3HN7A 3OMWA 4K03A 2I87A 3RASA 1NQVA 1N2SA 2GCNA 1P1IA 3SFTA 4D4KA 1Z08A 3QBDA 5F4ZA 3TUJC 1MV5A 3UM9A 1Z63A 3DEFA 5ED0A 1H65A 4KIWA 3WLNA 4TWIA 1IRIA 4DNFA 4EUKA 5B2FA 5B4TA 2MSCB 1SA0B 2FOIA 1G16A 5HF6A 5NULA 4F8EA 2JLAA 1PWEA 3MNFA 4F6LA 1T3HA 3AJ9A 3MG9A 2VOEA 3AB7A 3FDXA 4Z1OA 1TYEB 1JP7A 5A9TA 4Z4GA 1USUA 2KBFA 3RSGA 1A27A 1DKPA 2NU9A 5A05A 3RC2A 1M2FA 3WXMA 4GPEA 3KSZO 4FFWA 4P0TA 1QTRA 3OPQA 4JT2A 1ZSVA 1LQ2A 5GGYA 2C9CA 3LO8A 4DKJA 1M2VA 3CUVA 2AMYA 3GPCA 4V1CA 2FEWB 4Q4AB 2Z9BA 1ICEA 3RGWS 4OLFA 5JU6A 1AF7A 1RKUA 2WD8A 4M76B 2IF2A 3NHRA 3BJIC 1UC8A 1XTSA 3MGBA 2A14A 1JXMA 2BM1A 4ILEA 4EJMA 1DX9A 5AXCA 2A2ZA 1MIOB 1IJKA 1YQTA 4QUAA 3ZTTA 3ZCSA 2CXTA 3A4YA 3BILA 3K72B 4OJMX 4RDHA 3JQGA 4EF6A 3C6QA 5IRCD 1BOFA 1QCDA 3HNPA 3P8ZA 1X7YB 3ZIUA 4KRFA 1C29B 2PUWA 2G71A 1TLLA 4U6QA 3F90A 1NF2A 5HNKA 4RD6A 2GPNA 1X1QA 2YHIB 3IUBA 2IS2A 2HNKA 1GPUA 1U0OC 2QL9A 4PBTA 4GLBA 1JSCA 1PFUA 2IHVA 2WTEA 2VDVE 4R8VA 5LA6B 4HWPA 1GKKA 1V9SA 1BYIA 2PX5A 4N7BA 3QPDA 4DFDA 5K3CA 2PX4A 5IT4A 4PPGA 1KVQA 2MTBA 3N8DA 2RGRA 2GZHA 4C4XA 3I45A 1N1GA 4MKRA 1MJHA 3GGSA 4BLUA 5PNTA 1XMSA 2HCRA 2JANA 1FU4A 3B1VA 1CUVA 2BMJA 621PA 2XMDA 4X62B 2B1GA 2NUPA 3RYFA 2OBMA 3JD1A 3OQJA 1F5SA 4R16A 3DDHA 4UNIA 1JHZA 1RS0A 1LRLA 3QWBA 3LX4A 3R9IA 2FPMA 3K71B 4QWWA 3O5AA 1VLMA 1QLJA 1KTVA 1RADA 3D43A 1EP3B 1D2MA 1MFPA 3GCDA 3FMFA 4LJKA 2NO9A 3M9WA 2SKDA 4ZYUA 3QX9A 3I01A 2FSSA 3CZRA 3GLGB 3QWFA 5IVPA 1GRCA 1EP2B 2AFHA 3A31A 3CM0A 2PCLA 4L4SA 3R75A 4N6OA 3OZBA 1F8XA 3QPWA 4K3VA 3NDJA 4GBGA 3DL4A 3G3EA 4C3VA 2JVJA 3CE9A 1O8BA 4NOJA 3RRZA 3QPVA 1XZBA 4S24A 4EQ6A 2AHRA 3ENWA 3M3PA 3OZFA 3IJ5A 3CF4A 3QEAZ 1OLSA 3W3ZB 3GY0A 2C42A 4KXWA 4ARZB 1JWAB 3PEFA 5DP1A 3GEEA 3IE1A 4Q7LA 4HNHA 2QGFA 3Q3HA 2B4RO 3OTIA 3ZHUA 4KYTA 1SG0A 3LC2O 1XDZA 1PVOA 2EGGA 5ES4B 2V55B 1N9GA 1NVUQ 4HEA1 4YP6A 4ID3A 3ZGXA 3TLEA 2GXSA 2J48A 4FWIB 1T36B 1JQAA 2W9XA 5FBRB 4D4LA 1NVAA 2IZ6A 1RSZA 2ZQYA 2YDXA 1LSOA 3DZDA 1X1DA 4JGBA 1KMHA 2A4KA 3KOUA 3T3PB 4RW0A 1HH4A 2ZS8A 1O08A 1CEXA 1U04A 2FCRA 1Y5IA 3FI0A 3ZD9A 3MEQA 5HUHA 5CB6A 1JMVA 3U56A 3WVNA 2O4UX 4G0OA 4TYMA 3ZU5A 1AO0A 2UKDA 3CH5A 4WT7A 1Y1SA 1OYOA 3S29A 1OXMA 2X3UA 5EPUA 3B3JA 1QV7A 2Q62A 4JJKA 4P1ZA 3WIVA 4L28A 2VNKA 4PVDA 5B6PA 1ZN7A 1JLMA 3GT7A 1LUAA 1SUEA 1LRJA 2OL4A 3M6MD 1E3EA 1QVZA 2WG1A 1P7WA 1X42A 1CEQA 3CURA 3PSHA 4L95C 1XIVA 3P2KA 2D5CA 1HYQA 2O7NA 4N8EA 3W6UA 4BBAA 4XWTA 2OKGA 4RZQA 3S7TA 4CM3A 2NMVA 5DSXA 1LQUA 2VLIA 5D8DA 4DREA 2ZQ5A 4AP6A 3H9BA 5IBPA 2I3GA 2PTHA 4AG5A 3VMMA 3O21A 4PZCA 1MDBA 3ENKA 4G84A 3VZQA 2G06A 1ZD5A 2QJTA 1C30B 3SJZA 1DBWA 1GCUA 3TD6A 1NE2A 2VXYA 2Z5FA 3DDUA 1PS0A 2REBA 3JV7A 4UBKA 4DLBA 5JAPA 5BVGB 2ZRGA 5EIAA 3F5FA 4FR2A 5LYJB 2ZIAA 3RFCA 2O6LA 1ZC4A 3BFPA 2FPPB 5F7XA 1DAHA 4Z6KA 3OZVA 3C8HA 2Y27A 3TK1A 2ICAA 3N2KA 3OEHA 5K4HA 3RYHB 2NU8B 1P17A 1XI2A 3V80A 1UJ4A 1NY6A 5KYWA 4F12A 4XB1A 1WWKA 1XJ0A 4K7JA 4YRKA 1P2DA 3O74A 4HB2A 5ALYA 4JR0A 5TS2A 3OUZA 1RYEA 2NTEA 1BX0A 3ND9A 4W8OA 3V3TA 4PPNA 5K8IA 5L3QA 2IH2A 3O1JC 3OPNA 1M75A 4ZKEA 4JDPA 3U44B 1K2VN 2VHUA 3ZHOA 3UCEA 3EY9A 5GZ6A 4TXLA 3KPVA 4R7GA 1KORA 4OLBA 5KUTA 1ZHFA 5JCJA 3ZZUA 4X24A 1K7SN 1DIHA 3O9MA 1EFUA 4P9NA 4RL4A 5WRFA 3L05A 3QXSA 3H2YA 2OAEA 3C85A 5D5HA 1GUYA 2R3SA 1FJHA 1OPXA 2C0CA 1GTVA 4U9HS 4DEYA 3MUOA 3H0CA 2X9NA 4U6NA 5CFZA 5LD2B 3DMTA 5EE3A 3LUJA 1PBTA 2WFZA 5HZMA 3NBKA 4C5BA 5A9SA 1IJFA 1I3NA 2ZYHA 5B7PA 3VI4B 1QFZA 2QTGA 1YZGA 1ULUA 3EXHB 3IQHX 3PPIA 4HLNA 4OOFA 4XB6B 3GDOA 3WLRA 3ROXA 2H4JA 5KJ6A 3O2NA 2R48A 4WEQA 4BWVA 3OLVA 1XJQA 2PQ2A 1JHXA 5KYKA 1DRJA 3U2QA 5CP8A 3A8TA 3GLHE 1W2WB 1YUMA 4O2AB 1FXWA 1U2GA 3GQBA 1ACLA 1NLUA 3N05A 3FY4A 4HJXA 5HIAA 4B3SB 2PDAA 3EFHA 4YAIA 2GTHA 1Y5MA 4IDAA 5JYEA 1BX3A 2FMUA 4IOLA 1AC5A 1NJ1A 1D04A 4Z4FA 1TA4A 2NSJA 3HN2A 1L3IA 5EFOA 1ECBA 3ETHA 1H2YA 1IB0A 5H3LA 3QNWA 2XJ9A 5JJCA 3G2QA 1BRTA 1KEUA 1WF3A 3GFBA 4RZ2A 5DM1A 2GS9A 1T4MA 2QVYX 4HXGA 4IOMA 3ZK9A 5CLJA 721PA 3T1NA 1MC8A 2FQQA 2C4VA 4OTZA 1WU8A 1C7JA 1A9RA 1O5TA 5K2MA 3A1NA 3VR4A 2G67A 2CZCA 4PTZA 3TECE 2J31A 2O23A 2W93A 1D3AA 4QRIA 1BCSA 1OFTA 2XTZA 5CEEA 1M1UA 3VSBA 4BJ5A 3EDOA 5IC4A 5D1HA 4QXPA 3ZLJA 3KYCB 2WFMA 3WWYA 4HOYA 5GQSA 2B25A 2N46A 3EQ9A 4WKNA 2BI8A 4XASA 1JLSA 1E6WA 2ZYUX 4ZWNA 4B73A 1NX9A 2VHVA 3NC0C 4NPCA 4MA0A 1TO2E 2LXNA 4I6GA 4Y6SA 5ALDA 2O7RA 2BM8A 3FI9A 3AERA 4F2GA 1FNNA 1SU6A 4XYGA 3OWHA 3QU2A 4I4CA 4GT1A 4QULA 4YQEA 3AEQA 3C45A 1OVGA 4B3MB 3NWJA 5KEIA 3ENNA 1RR6A 5HHTA 4D80A 5T57A 1CF2O 3OEWA 2R6AA 3K0AB 2AEJA 1QRDA 4CHTA 2UYCA 4JU9A 2JFYA 1COZA 5LP6C 4JLKA 2BUBA 4H31A 2HNAA 3FPFA 2O5EA 5C35A 1U7WA 1MAHA 2R8PA 1USWA 1GO2A 3I5UA 2R6JA 2Y9PB 4LI3X 3T4UA 1URPA 4GPIB 2W42A 1FBNA 3JQRA 3E18A 1SA0A 2ZBDA 3GRFA 2K2WA 3CNHA 2D8MA 1NVWQ 2P3LA 2NTJA 3ESDA 4D8UA 2IU3A 3FR8A 1FMFA 4E22A 5AOAA 5K3SA 3NP7A 1FVHA 3FPCA 3H4MA 4KVZA 1JT2A 1GM5A 3O94A 3JSXA 5F5NA 1BU8A 2A0XA 4DR6B 5DLYA 4UVGA 4Q4AA 1IBCA 4ABTA 3DOHA 1P7ZA 4IQFA 1Q21A 4RWEA 5IT0A 3QLTA 3SEFA 1XZQA 4N03A 4YWHA 1V71A 1HDXA 2NYRA 3WLEA 1YI0A 1JGTA 4FJ1A 4HSEA 1HQKA 2Y2UA 5ALJA 3RBXA 4BVHA 1SHLA 3L07A 1NF8A 2ECOA 3I6YA 2OZPA 3AJDA 4RF5A 4EJ0A 4YT2A 3GL9A 2R8BA 3A6KA 4DMRA 4MJ3A 2QG6A 5BQ3A 3KFLA 1RMTA 1QE3A 4GKVA 3N8KA 4S2UA 1MG5A 1X7YA 1CBUA 3O3MB 4QGAA 1ZUD1 2ZTVA 3CNQS 3KXIA 3PEEA 4UNSA 3DT9A 1ZYUA 5DCLA 2YHIA 4G37A 5AVWA 1L4FA 3FMVA 5I51A 2RBEA 4R2HA 1IY2A 5LA6A 2XKKA 3JAWB 2PGNA 4MVJA 5C5EA 1GUDA 3UK0A 3ZI4A 1B26A 3IBYA 5BYKA 2OBFA 2C00A 2QT9A 2HA7A 2XQIA 1TF5A 1YU6A 5JWHA 1P7PA 5E38A 1ISFA 2P9ZA 1REQB 1UOPA 4JJEA 2MINA 3L8YA 3R5SA 5EMNA 3SF8B 5C1IA 2OYSA 3O8OB 2FTKE 1L7DA 2AFIB 4X85A 5COAA 3VJKA 4CR8A 2G1AA 1W75A 4I14A 4O4JB 3FFBA 3E7DA 2JHAA 5TNXA 1GUBA 2A5FA 2WJ3A 3RKUA 4O25A 3TSZA 1YRYE 1PI3A 3AHCA 3MS7A 3VR1A 1P7VA 1EE9A 2EBHX 2QUBA 3Q3EA 2NT3A 3S7ZA 1NT4A 1TC2A 1HOTA 4M9RA 1OT3A 1EX1A 2B2XA 4GXQA 5J3JA 1DWQA 1I3LA 1JEQA 2CFSA 3GLGA 1IPHA 1ZK0A 2ZM6B 1J0DA 1W6RA 4N5NA 4NXNB 1UP7A 4KIGA 4K6GA 2GK6A 5DGTA 4X41A 5TIIA 13PKA 1MGOA 3PB3A 4YLEA 1Q95A 1G6KA 2NIPA 1F2TB 1WQ3A 3D0OA 4LRYA 4DJEC 4N0MA 1TJYA 3FSRA 3A10A 3E70C 3V1KA 4ARZA 2POCA 5ARBA 3DVAA 3LZ6A 4JU8A 1HM5A 4XA8A 3LS2A 4BKUA 4BQPA 2OK7A 1E60A 1VLVA 2P1RA 3O26A 1GU1A 4MV5A 1C3OB 4N0QA 2O06A 1WSBA 2B9EA 4GXTA 1CY1A 4DYVA 3CCCA 5AM0A 4EB0A 3LYUA 3ZNQA 3CX8A 2P5SA 1T36A 1GZ7A 3GGCA 4F6RA 2BI7A 1DRVA 4QU5A 5AW7A 3FCAA 5BUSA 2H1HA 1Z2CA 5KJCA 3NHAA 4XYLA 2F64A 3D8UA 2C29D 4W9MC 1BWRA 2JLYA 4IL5A 3VR2A 4BKRA 4DSZA 3WO1A 2YWFA 3BXXA 1IJEA 2VJCA 2MCFA 1VC2A 5C5IA 1YASA 1MW8X 2BMAA 5C51B 2RHGB 5D3QA 2Q9CA 3I1IA 3K09A 3KSDO 2WP0A 2WUDA 2H85A 1FP4A 1XYVA 3NAZA 4JEIA 2HD4A 2XVXA 1CUSA 3I2YX 3QU7A 5H9VA 4PIMA 1A98A 121PA 4Q37A 5EGSA 3VSDA 3GJ7A 2PIAA 4K86A 4R1LA 4HVTA 1JR4A 2JK0A 1PW5A 3MELA 5HS4A 1HMYA 2WYHA 4R8SA 2D3WA 1D7OA 1GL7A 1DBRA 3KCQA 3CH4B 4EPXA 1T8TA 1CFJA 1AZWA 1E5XA 2V1XA 2VRNA 2FZEA 2VJBA 4P38A 1KSFX 4Q3DA 1NPDA 1QHGA 2HLNA 3TCNA 3NBYC 1DP4A 1W4AA 1SKAA 4C7VA 3KAKA 8AT1A 1M0WA 5LYJA 2YN4A 5IZCA 4COKA 1TAUA 2FPPA 3FHLA 4DV4B 1XPOA 4IIEA 3UC9A 3WRXC 1KYZA 1L7OA 3B12A 1Y6RA 4L75A 5CNKA 2CFIA 2HA4A 1S9HA 3LC1O 3TR5A 3TSCA 1ZNXA 2C2KA 2EBUA 3KVOA 4CGZA 1YWGO 4HH0A 4RJKA 1IBKB 4MRSA 5D5QA 2HK8A 1ISMA 1DCMA 1ESMA 1LVHA 1I4LD 2PVSA 1RTTA 2OCKA 1N5MA 2ZK7A 3R24A 2O8FB 1T2VA 2I67A 4A1OA 3W5UA 3U44A 2D5IA 1PLJA 2JAHA 2WEKA 2X0NA 3F5MA 4HZUB 1ECCA 3ZBPA 3ZHBA 1QWSA 1GTL1 4M88A 3OZXA 4CM9A 3WFZA 1JHVA 5SYMA 5K0LA 1UC5B 3PX7A 2F1OA 1MUUA 2FSVA 1FDWA 2Y71A 4H1HA 4FB5A 1ZH4A 4X54A 4YRZA 3SYNA 3X43A 1OWPA 4WZAE 3KKZA 1OI3A 4YCCA 2RHLA 5J4VA 2WDZA 4Y30A 2ACWA 4EG8A 3SMQA 1UWLA 2R7KA 4PO3X 2NV0A 1UPTA 5JIBA 2Z58A 5HBGA 1E0KA 5BQFA 2YOGA 1FUEA 3ECAA 3WK6A 2HCBA 4J0CA 3ZCPA 5EMLA 3DDNA 2P9CA 4IKOA 2VEDA 3RARA 3QVOA 4W5NA 1T4CB 3D4BA 3MJRA 1QHIA 4GX2A 4P33A 1GPDG 3EJWA 4PBRA 4OBWA 4D9MA 3G2LA 3K30A 4NH4A 5AW9A 1O8CA 3G2IA 4R1MA 1V1RA 1FLNA 1GV1A 3LX6A 4O2AA 3IAM1 4G0XA 4IINA 4JI5B 2PBLA 4P92A 4CKZA 3KR9A 4Q9JA 4PS1A 4F71A 3ROPA 3OX3A 1USKA 1ZW1A 4GAEA 4AWAA 3OOSA 2PT6A 1P4JA 4KXQA 3F98A 1OBVA 4IIDA 5KYYB 2RGDA 3LMKA 1Z28A 4M8IA 4YN3A 1W76A 2VHZA 2FK7A 1FNCA 1SQ0A 2ZRQA 3EIEA 3OTWA 3L4JA 1A5TA 1NQTA 5CG2A 1U28C 4KHZA 2WPDA 3HGTA 4GI7A 4RPLA 1Z7WA 1Y98A 2QRMA 1R4ZA 3R6DA 1P61B 1QIGA 2NZXA 3LW7A 4O4LB 3DEIA 4PZPA 2VRCA 4ZN6A 5JCXA 2JK1A 3NNDA 1JIIA 4ZDIA 5F2EA 5CH5A 1DEHA 2FYTA 5I8ZA 3GARA 3H5TA 4A8TA 1G2IA 4RZ3A 3AVVA 2AKEA 3R41A 4XR4A 2FLVA 3B9BA 4DV7B 5FNVB 5FI1B 4Z9XA 1DKLA 3KYCA 2CD9A 4LJ5A 4LHVA 4D8VA 3PGA1 3K31A 1QAQA 2HSJA 4LBYA 2J3JA 2ZBUA 4V0NA 1E2QA 3E6AA 4R1UA 1KZGB 1OHHA 3OC0A 2JJ2A 4K6FA 4NBLA 4NU8X 2NZ8A 2VDLB 4YCDA 2PL5A 1KI8A 3RVOA 4HEJA 4U7DA 1Y82A 3O47A 2B83A 4Y2PA 1UMBA 1JDBB 1CUZA 5C81A 3K5WA 1FYDA 1A97A 1BEZA 2Q6IA 4FR5A 3OO0A 1WSDA 3GLRA 3Q0EA 2D2EA 4JCOA 3CVOA 3GLQA 4M6WB 3FOAA 3SS7X 2LRHA 3KUXA 4TMWA 3UAWA 3WQQA 2TS1A 3ZY3A 1YD7A 4JI7B 2J67A 4MLCA 5J2TB 3WNBA 5DM2A 2VZLA 5IKPA 3V7FA 3JPYA 4V0KA 5ALUA 2PD6A 2WF8A 1LNSA 3O0DA 3F4LA 3ANTA 4MI3A 2XT6A 2EX1A 3AI7A 4L8VA 2XE8A 1UZNA 4QDKA 3DQQA 1U7UA 4FFBB 1RI1A 2Z5LA 4LG1A 2OQRA 1RWWA 2H2AA 2JKZA 5REQB 3TN7A 2ZTSA 4GRDA 5H81A 2BHNA 2RGAA 4FMCB 1LEHA 4CPDA 4ARBA 4D0GA 5B4VA 4EI2A 1Y89A 1M2KA 3QVTA 2ADOA 1RW4A 3BXGA 5BNWA 4A03A 2OD7A 1D2GA 5A62A 1MQ8B 2JGIA 2OC9A 3FYUB 2GZ2A 2LV8A 3KZ1E 4KO2S 4RJ2A 2H51A 3N76A 3TB4A 3TB6A 4D8XA 2O1EA 4IBOA 3CRZA 3CLVA 5AUNB 2XDQB 3NHWA 2QT1A 2BMVA 2QL7A 3K5PA 3IA7A 3PI6A 1I1HA 4TMYA 1WXGA 1TZBA 3K9CA 1CTQA 1Z68A 2BDUA 2BR3A 5D3KA 3TDKA 2WABA 1WNTA 5AVZA 1MQAA 2XXAA 1XPUA 3MCTA 4UNRA 1IUPA 2Y05A 1YJ8A 3DV2A 1P0IA 4HUQB 5FX2A 1NMEA 3K9LA 4CFYA 1I2ZA 1Q0PA 3KB6A 2B8WA 4HAZA 1GGKA 5FXMA 3G13A 4E09A 3PL5A 3VX4A 3QV2A 4EYKA 3V4LA 3IEVA 2HHJA 4DRXB 3Q98A 4NF2A 2IW1A 1REQA 4C6RA 3ME5A 1TO6A 4OHFA 1A9OA 2OZVA 3SF8A 2I8AA 4F1WA 3O8OA 4O2BB 2JLZA 4C0KA 4RF2A 1S2LA 1UBMS 4W8HA 4M1EA 1MP0A 1SCNE 3HV0A 3P4UA 4O4JA 2NO0A 2IYWA 1P9OA 2YMMA 4IDPA 3V8EA 4H0CA 4B5LA 3AR3A 5A4KA 2QAGC 3R0JA 4INJA 4C4OA 3R9WA 5G2OA 4BX0A 1EDOA 1X13A 2Y8EA 3EZNA 1J8YF 2E37A 1J2UA 1USGA 2WYOA 3IKTA 2GO1A 3TFWA 4KWHA 3DAOA 1HZZC 4P0PB 5C80A 5DM70 4KZKA 1HX7A 4CU5A 3F7OA 1KOJA 1Y8QA 3F1KA 4LCBA 4EY4A 5I4KA 4KH1A 3O3NB 3FZEA 1QDLB 3O84A 4LWQA 3RIHA 4XVCA 3IR7A 1XXHE 2HA2A 5ECDA 3D3NA 1BHSA 1DV2A 2Z2JA 3ZGLA 4GBJA 4OUKX 1X7DA 4HADA 2Z4SA 3HA3A 2OHIA 2ZKLA 2NTNA 1MB4A 4JJFA 5JJLA 1WTCA 5IT9A 1I2DA 2I1VB 3FUCA 5DVZA 1V48A 1V5GA 2J3KA 4TVKA 3ZGNA 3CT4A 1P9RA 4MVWA 5I7FA 3KXPA 3MWYW 1AZLA 4U2DA 3NBQA 2BKAA 4IIXA 3GWGA 3OQBA 1CXZA 4LGYA 4BV3A 3PUIA 1VBNA 3B1ZA 4N39A 4AYWA 4C7OA 2CXRA 3QU4A 4J94A 4HQOA 3ENVA 5KMGA 3DCIA 4EAAA 1ZGGA 2BJWA 5SY9A 3V1MA 4FEEA 2VIIA 1D4AA 2ONCA 1M3SA 3HCBA 3GMTA 4XDZA 5F78A 1KSGA 2GBLC 5ALZA 3IUPA 4DRZA 3DLCA 5CVEA 4M49A 3C7CB 2GAAA 4UMFA 5ALVA 2F17A 2BGKA 2GPWA 2X14A 3H4IA 2NSYA 1X87A 3L0CA 4MP8A 1WZUA 3S2UA 3ZXIA 4A26A 4FMDF 3ADPA 1KEPA 3G2KA 3O4GA 4AKHA 1JXAA 1W93A 2B61A 4AJPA 2ZRBA 1WJGA 1NQAO 3VZBA 1UEXC 3LCJA 3MJEA 3EYWA 3OEED 5HR5A 1U0GA 1MG0A 1XKTA 2E4AA 2ZWVA 3EMDA 1PD0A 3FROA 1LBEA 2XHEA 3QFFA 1YIOA 1K08A 5KNDH 1HE1C 1SBTA 2CLFB 2ZXFA 2KE5A 4NYMR 1E79A 1RHRA 3OUUA 4MUKA 4YB8A 5A7GA 4JXXA 1B16A 1HPLA 5CITA 4AY2A 4NCHA 1TQ4A 2OFOA 1YS6A 4F5YA 3IBCA 1NRJB 1IN8A 2E55A 4Z2AA 3NT2A 3KG2A 1KSJA 3C3CA 4BL5A 5CT5A 1LH0A 2OGWA 3CYFA 3KJFA 4GIBA 1ID8A 1YIDA 4QXQA 3WP0A 4R0MA 1F2UB 1QZZA 3HR7A 4GU5A 3VAYA 4NQRA 3SYRA 3TQRA 1ZWLA 1V5EA 3NOOA 4UHCA 4CI0B 4ZYXA 5I7EA 3JASA 1NRXA 1FQWA 1PR9A 3W90A 4HYEA 2QW8A 1TE2A 1NYQA 2EWVA 2GZRA 4TROA 5IDWA 1POXA 4IFIA 4XM0A 5E2AA 1YR7A 3PDJA 4CT5A 3T3NA 2BTOA 3DOCA 1NJFA 4HZIA 4TTTS 1BDBA 1IZ7A 1GRQA 1RQNA 2O8FA 2PLRA 4HZUA 4PW0A 1TTPB 4TN5A 3GGPA 4KYUA 1MRSA 2X1MA 2GEFA 2ZQZA 1FUYB 3PZBA 2JLCA 2ARKA 3VTKA 1IWBB 1WHSB 3E1GA 1MC5A 3IQEA 4CTKA 2YIDA 5BRAA 1H8EA 5YASA 2N9UA 3IS3A 1TU3A 4Q7MB 4EYGA 1C3XA 3UY4A 1C9YA 4FOPA 1W4CA 2OV1A 4BFLA 1XR3A 4JI3B 1WSWA 1Q15A 3JZAA 4MJXA 2R2AA 2ACVA 4ZK6A 1VL5A 1O4WA 2WK1A 2J08A 3MIZA 4M0CA 3GUVA 4TLMB 2JCSA 3L2OB 4LF7B 2A5YB 2P30A 3RVPA 3G2PA 1X94A 2ZIXB 3PIDA 3N75A 3LA6A 4WCDA 4ZYWA 2K7FA 2I2WA 3KOZA 1O6FA 1T4CA 4PN3A 4HL6A 4YYZA 1C41A 1B6GA 3CR8A 4E4YA 4LWOA 3LLVA 1LPNA 3IQWA 2IZOA 4BFTA 2G82A 1SXQA 1R6DA 3DNMA 3I34X 3IIIA 2Q5EA 3STVA 2AOTB 2V5AA 4TZ0A 4LE2A 2QP3A 4E14A 3Q3CA 1GN8A 2E89A 1QWOA 1K3TA 3D2LA 1A8PA 4FX2A 4GWKA 5KYYA 1YL7A 4OJKA 2BP7B 3D7LA 2YMQA 4K40A 4QREA 1GNQA 1TCUA 3MJDA 4DMLA 5B30A 3ZH9B 4LMBA 3I58A 2WG0A 3CNNA 4TT3A 3F5QA 4DANA 5B57C 5L3SB 4YAEA 1F0YA 1IWPB 3PICA 4L2IA 4KRYA 4CLDA 3GAAA 1U3VA 1GGMA 4HAXA 4L8LA 1PR0A 5F2KA 1JFFB 1I51A 2DKFA 2WWVD 1GTRA 3JD0A 3OF3A 2AC7A 2NUAB 5DNCA 4M21A 4E5NA 2V7QD 3R9KA 4JS0A 4BZWA 2M2IA 2ZOSA 1PJSA 2YKGA 1JTVA 3AR8A 3FSGD 5FQOA 1U3CA 2ZJYA 3NFYA 3H11B 4RELA 1PU2A 3NJ4A 2QX6A 1TJ5A 5I4CA 4DNPA 4TMTA 2PKQP 2FPWA 4BEVA 3T9DA 5A1TA 1RCFA 2CVHA 2HK6A 4MKXA 5TQ0B 4QA9A 1YQEA 1RI5A 1UKBA 5KQRA 4M9XA 1PIWA 4QRDA 4N01A 2O7VA 4NENA 2NQ2C 2QNBA 2DJ5A 3H1FA 3LY8A 3WJAA 2UZAA 3KIPA 4FZ3A 3CF6R 4LK3A 4ON9A 1YVUA 1DQZA 5DYWA 3K16A 1P6XA 3MAAC 3OZAA 3WTBA 5GADl 3IC5A 2FW9A 4PONA 1UAYA 1K8ZB 4IW3B 2JFWA 6ABPA 1W5TA 5D3MB 2WC1A 2Z8ZA 3LNCA 4WEOA 5I45A 1FLDA 5T8KC 4FEAA 2ZANA 1N2CE 3EIUA 4KWTA 4HLQB 5EKSA 4ENTA 1I2CA 5HE9A 3WGOA 1GYPA 2PWPA 3KOYA 4QNNA 2J0UB 3IVMA 4XUDA 5DX0A 1U2EA 5JNLA 2KS6A 2O1XA 2E21A 3KYDA 4KLZA 3TH5A 3B9RA 5JSFA 2PFGA 1XUOA 5H9WA 3NWEA 1O4VA 2XVYA 3QTTA 2XMSA 1E8DA 1I3CA 4FFBA 1O94C 4EBBA 2FE1A 3C6KA 3RAFC 1H69A 1QZTA 1QHSA 4OLHA 2Q50A 5REQA 4E2ZA 3U1VA 3MTGA 3G7UA 4FYWA 1LDMA 4J6EA 2WNSA 2VSQA 1T6XA 3COPA 4OHBA 3HUFA 1M34E 3IODA 3PQ7A 3AX6A 4LC9A 4CM7A 5K3EA 3NFRA 3GMDA 4Q9HA 4MMZB 1ZGCA 3N2ZB 3O1LA 4R9RA 1DIGA 4QJ5A 1FW6A 3ISTA 3Q8WA 3SU8A 2V9ZA 1TVCA 3QKWA 1BROA 1G2QA 1N4AA 4FNGA 4ZO8A 1U6KA 2FRDC 2ZBGA 2QMQA 2XDQA 5CX4A 4NU6A 4RTJA 4CT4B 3VO2A 4O8CA 2HO5A 3EDYA 4IWXA 3DKRA 1OLOA 2R00C 4Q3CA 3DP9A 3EAFA 1JIUA 1KOLA 1GXSA 1LRKA 1LSSA 3SBXA 3TCKA 4EDFA 5KJ1A 1YC2A 3AEZA 1XTJA 2ESRA 4TL7A