5FRDA

Structure of a thermophilic esterase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
256
structure length
256
Chain Sequence
MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVEVNSVDEYAYYASESLKKTVGKAVVVGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLPEILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRNGKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELVVIPGASHMVMLEKHVEFNEALEKFLKKVGVAEVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE (EST-2)
publication title Structural and Biochemical Characterisation of Archaeoglobus Fulgidus Esterase Reveals a Bound Coa Molecule in the Vicinity of the Active Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 107
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5frdA00
2HFKA 3KDAA 2HA2A 3PUHA 4NMWA 2WG0A 2OXEA 5C8ZA 4BP8A 2CMFA 1OILA 2PSEA 2E3JA 3H0CA 3HZOA 3I2HA 4MXDA 3DQZA 4U2CA 4X94A 2V9ZA 1YB6A 3CCBA 1XZKA 4FHZA 4X71A 5DYYA 3WJ1A 4UBJA 2JEZA 3FVTA 3C8HA 4RGYA 3W06A 1DTEA 1ZOIA 5K3EA 5CXUA 4PSCA 2OAGA 1CUIA 5LZ4A 3T4UA 2WG1A 2HFJA 2V97A 1YSCA 1CUWA 2G4LA 3QPDA 2HM7A 4ZV7A 4CG2A 2Z5GA 4X93A 1AMNA 4HXGA 2JGKA 2H7YA 1F6WA 1XRPA 1GGVA 5JZBA 2QKYA 2ECFA 2WJ4A 1XQWA 2C5FA 2ORYA 1PV1A 4YPVA 3V1MA 5CH8A 3UUFA 1SCKA 3STTA 1T4MA 2DQZA 1J2EA 1UZAA 2XUHA 4X6UA 1QIKA 2XUAA 1X2EA 4KAJA 2GYWA 5CMLA 3WI7A 3D0KA 3QM1A 3GZJA 4FTWA 3L1IA 4GI1A 1BS9A 3WWDA 4QDUA 1Q83A 4FFVA 4CFSA 5AOCA 3W04A 2BKLA 2Z8ZA 3I6MA 1AURA 2QXUA 1H22A 4NVRA 1YS1X 5A7HA 2ES4A 5HF6A 5C81A 2PU5A 1VZ3A 5ALLA 1JKMA 3ICVA 1WB4A 5K3FB 2XT0A 1VA5A 2X8BA 5HQ3A 6YASA 2WLSA 4H7DA 1VE6A 2WFZA 3LS2A 2O7RA 4ARBA 5FOQA 1RYYA 3ZWQA 5FPQA 2G5TA 1QOZA 1ZD2P 2QOEA 5F4ZA 2YASA 3KWJA 4Y2XA 3QPAA 1LLFA 4MQMA 3I1IA 1VOTA 4RNCA 4K5QA 2YH2A 1K4YA 4QDOA 1ETHA 1JI3A 1R88A 4YASA 1GQRA 3AIMA 4GDMA 2FUKA 2OAEA 2DQYA 1T2NA 4J03A 2HIHA 1M33A 4EY8A 1WPRA 3S2ZA 3DNMA 4QEKA 3RLIA 1UWCA 1JMKC 5CT6A 2D5LA 1CQZA 3WYDA 1JJIA 1CUJA 2BUAA 3O4HA 4HVTA 4X85A 2JGMA 1CUCA 1LPPA 5JANA 3K2IA 4Q1VA 5T4EA 1XZAA 4Y2QA 2QM0A 5ALVA 4P93A 3TGLA 2CKMA 4OU5A 1IMJA 3TRDA 1TKRA 3WK8A 4HRYA 4KAFA 5FUMA 1GQSA 5HKAA 1BU8A 3G0DA 2GYVA 4B84A 2YXPX 5EI5A 4F21A 4X91A 1CUVA 2QXTA 5AIAA 1G5FA 3LLCA 4UBKA 5AHXA 4XVCA 1UK8A 1DINA 1TCBA 3K6KA 4UBMA 2HA6A 1L7QA 5A6VA 2R11A 5HK9A 4DSAA 1DT5A 3FSGA 4W1RA 1FFEA 4UFPA 3E4DA 3HSSA 3WWCA 4C4XA 2VEOA 1ACLA 4YK7A 1S8OA 3ED1A 2PL5A 2WG2A 2BUCA 2ACKA 1P0QA 3FWHA 5DYTA 3IUJA 2VTVA 3FAKA 1UXOA 3GROA 1R1DA 2VJCA 4C4YA 4UUQA 2QMQA 3DEAA 2OQIA 1IZ8A 4GECA 4XJVA 1ZJ4A 4L0CA 1CQWA 1OXMA 5EFZA 3WKCA 2RIPA 3O4IA 2JBWA 2B9VA 4ITVA 4KAAA 4BAUA 4EZIA 1MT3A 4F0JA 3TEJA 2JF0A 5BWBA 4KRXA 1HLGA 1MX1A 1QGED 4DM7A 3ZPXA 5AO9A 2HRQA 3WLAA 3DL4A 4Q3OA 3W2TA 3RK4A 1AUOA 2QTBA 3G9ZA 2VJAA 2XB6A 3QBJA 3M83A 4QDTA 5K3CA 4FKBA 4FBLA 1ZGCA 3GA7A 1J07A 3KXPA 1LPSA 4BC1A 3O9VA 2XQKA 2VT6A 2G63A 4D9JA 1E66A 3I2KA 2XQFA 3KSRA 1XRLA 3WA6A 4AO7A 3O4JA 4LYDA 2RHWA 3OPMA 4UHHA 1G4HA 2IITA 5C8XA 1YB7A 3PFCA 2PM8A 4FLEA 2WJ6A 3E1GA 1H2YA 1MX9A 1GZ7A 3D3NA 1GPLA 1CUFA 1WHTA 4WY8A 2Q0XA 3V1LA 5AKGA 3YASA 3KWFA 4L72A 3E3AA 1HKHA 1TK3A 1H2XA 3HRHA 4L9AA 4UHBA 5FP0A 5AI0A 3BDVA 2EDCA 3F97A 2HHAA 4P9NA 2HADA 2AJDA 4N8DA 1WCYA 5BWCA 3O95A 3WWPA 5ALRA 3X3HA 4XX1A 2QJWA 3FYUC 1AZWA 4KJXA 1KEZA 5A2GA 5K3FA 1WM1A 4P92A 3Q8WA 1ZD3A 3VISA 2ZYIA 1UK7A 3N0TA 4LYEA 3G0CA 2ZSIA 4BCCA 1EVEA 4ZV9A 1RWQA 1HQDA 1ACJA 1GKLA 2B20A 3ESCA 4H7FA 1ORWA 3E0XA 1EA5A 2XMZA 1QIGA 4AXBA 3GFFA 1G66A 4BCBA 5HQ3B 2PSHA 4FDMA 4OSEA 2OLEA 1MO2A 4Y2UA 3IIIA 5AKXA 3AINA 4DYHA 5JZ9A 1QTRA 1U8EA 2RHTA 3PICA 4JUIA 5CH5A 2Y6UA 5JARA 3QMVA 4AB1A 1VZ2A 4BATA 4Y2JA 1XZBA 3QH4A 3H18A 2WUGA 1QO9A 5AH0A 1CLEA 3WZMA 4H7HA 5CT4A 1LPAB 2VAXA 4LXIA 4DMFA 5AK4A 1YR2A 5H3HA 1VJ5A 2WFLB 2XUKA 4ZREA 3P2MA 4W9RA 2ZJ7A 2I3DA 4X92A 4LXHA 4UHCA 5LIPA 1R3DA 3C5VA 2OGSA 4Q05A 4BAGA 5DTIA 3I2JA 1W75A 4K6KA 3PE6A 3M81A 4B80A 2WUDA 3BJMA 1O6FA 4PNZA 2GZSA 2EEPA 1NU8A 3I28A 3QZUA 3WJ2A 2C4HA 4HRXA 4IH9A 5AI9A 1ZD5A 3L1JA 5LKAA 4J0HA 1AC5A 3A2MA 5LZ2A 3IURA 3QITA 3QYJA 3RKSA 3C6XA 4C89A 1ZIYA 3SK0A 1VXRA 2JGIA 4BE4A 1NU6A 3C43A 1LZKA 5CH3A 1XZJA 5K3AA 3ZLUA 1K6EA 3I2GA 5KWJA 4RE5A 4U2DA 5T4HA 3H19A 1O6GA 5AI6A 2HU5A 5D3KA 1JU3A 3G0IA 2XQIA 2OGTA 1FFCA 4DMKA 3QVMA 4BZWA 1JFRA 1ODCA 3OTQA 5A71A 4EHBA 2JIDA 2WM2A 4G1FA 4H77A 4MJ3A 4OB8A 1HBJA 4X3CA 4IO0A 2OCLA 1QIEA 1CVLA 1BEEA 5CBKA 1HL7A 4B6GA 3NOXA 5JD6A 3D2BA 4LHEA 3AIOA 5IVIA 3AZPA 2NW6A 2GBFA 4CG1A 1C7JA 1VA4A 2BCEA 4FMPA 2DHDA 1B41A 1BE0A 2XMSA 1WB6A 3LCRA 2DCMA 5EGNA 4DLNA 3HACA 1QFMA 1X70A 3EQ7A 2XI4A 1BCSA 3IULA 3C8DA 1QTIA 1UOOA 1XFDA 1VXOA 4C87A 1ORVA 3AILA 5HF9A 2B61A 2VAVA 1CUXA 4UHEA 1YAJA 4DIUA 5A7FA 1F0NA 4QA9A 3ILSA 1DQZA 2XUIA 3LP5A 5FDFA 3GUUA 5AKZA 2Y2UA 4OYLA 4DGQA 3OG9A 4KE7A 3ANSA 1UOQA 4HXEB 1JMYA 3OURA 5K3BA 4EBBA 5ALGA 3STVA 3STUA 4ETWA 1DU4A 4KE9A 2W22A 1ISPA 3M3DA 2OPHA 3K9BA 1UK6A 1D07A 1H23A 2PU7A 5JAHA 1ZI6A 3C5WP 1CUSA 1E8NA 3F67A 2ZSHA 1XRRA 1XRQA 1H2WA 4BTLA 4U2EA 4MEBA 4H7IA 4UBIA 3S8YA 1YS2X 1W52X 4C01A 1XRMA 1VLQA 1L7AA 2WFMA 1CIJA 5AKKA 2XUGA 1GPNA 2QS9A 3AFIA 3IUQA 2I78A 3B5EA 4QDZA 1GT6A 4DMHA 2ROQA 1EH5A 3ZLTA 5EHQA 1AX9A 2PX6A 3H2IA 5DNWA 4KE6A 5AI8A 5K3DA 1X2BA 4ZWNA 1MNQA 4MWTA 4EY7A 1MJ5A 5AOAA 3SWWA 4GWLA 3F96A 1XKLA 4FLMA 4LKOA 2PBLA 3GBSA 2IIVA 5DLPA 3IDAA 3OC0A 5HZGA 1ZI9A 1Y7HA 4TVKA 2WFLA 1UKBA 1SCIA 4KR0A 4J3JA 3MGAA 5ALFA 2QRUA 2ZYSA 5JIBA 4UFOA 1QIDA 3SC2A 4HXFB 1N8SA 5ALOA 2AXEA 3MUOA 3H17A 5HFAA 5KREA 5EIEA 3HLKA 1TQHA 2JEYA 3HXKA 2XUFA 5JASA 4UFNA 2QVBA 2BGNA 5AKEA 2X76A 1A7UA 4C4ZA 3FCYA 5EIAA 2XMRA 4AZ3A 4CIAA 3AIKA 4PQEA 1XLUA 2G5PA 3PUIA 5HF5A 3BIWA 4NS4A 3DYVA 1LPNA 1LNSA 2PUHA 4OPMA 4BYMA 1UOPA 4BCDA 1ZD4A 3I2FA 2QUBA 2WIDA 1LGYA 4DNPA 4Y2YA 4J0IA 1DWPA 1E8DA 5AI4A 2FJ0A 4PO3X 3R41A 1PFQA 3VJKA 1AQLA 4J0CA 5ALKA 4BVLA 3SX4A 3R0VA 3AJAA 4HZGA 3WK6A 4WFJA 1W1IA 1IZ7A 2Z3WA 1SOMA 4ZI5A 4JNCA 4AMYA 1LPOA 1XLWA 1JJFA 3WK7A 4BP9A 1EDEA 3G8YA 1UT6A 4B85A 4X00A 1Q84A 2EDAA 3DYIA 2HRRA 5AKJA 3U0VA 5LZ7A 1XZMA 4HS9A 3T52A 1LBTA 3VJLA 3RARA 3WKBA 4EA6A 2WU3A 1DX6A 3IB3A 2VATA 3WMRA 3BXPA 3D7RA 3NWOA 1U65A 5CW2A 2BJHA 5IVHA 3A2NA 3OM8A 4LXGA 2ZYHA 5EIHA 1MPXA 3G0BA 4GLBA 2HA0A 2DHCA 4Z49A 2J3QA 1QONA 2C58A 4FWBA 3FBWA 2FX5A 1QJ4A 1CUDA 4Y2VA 3G7NA 2JGFA 1EVQA 2BFNA 3H1AA 3C6ZA 1BN6A 3WL5A 3WK5A 4GEGA 1CUYA 5ALXA 1WPXA 1EK1A 5DNVA 2RI6A 3LIIA 1THTA 5LZ9A 3D59A 4WCVA 3R3XA 5JAOA 4AMZA 3AZOA 2O2GA 2VSQA 5SYMA 5ALSA 1LBSA 1CUUA 5I9IA 3RM3A 5ALPA 4WDRA 3PF9A 5DWDA 5IVDA 4J0JA 5BV7A 2HA4A 5KBYA 4DSZA 2VJDA 3FLEA 3BF7A 4N8SA 2DR0A 5ISMA 4YX9A 1ZGBA 1P0MA 4UHFA 2AJLI 4RE6A 1I6WA 5AM4A 5ALEA 1CFJA 4Y9SA 5T4FA 4IQ4A 2RONA 2GZRA 2VJBA 1QFSA 1R9MA 1ZI8A 2WIFA 1J1IA 1EX9A 5AKYA 2Z8XA 3H04A 3BWXA 5ALJA 3JYHA 3H2KA 4G8CA 4GXNA 4I19A 5CT8A 3WKDA 4AN1A 1E8MA 3I6YA 4B9AA 5DJ5A 5JD5A 3EQ8A 2QZPA 5CT5A 3M82A 5AI5A 1WHSA 5JD4A 2XMBA 4MEAA 2BUBA 4E15A 3R3UA 4X97A 5LLSA 1SFRA 1QIFA 5CTAA 3B3QA 4OCZA 1MTZA 2WU4A 1FSSA 2WIKA 1QIMA 3EF3A 5JZSA 1Q0ZA 5CT9A 4P08A 5AK3A 5D3ZA 2O7VA 1A88A 1LPMA 4OYYA 4QE3A 4F5ZA 3ICWA 4B83A 4I3FA 4H18A 3FYTA 4XWGA 2BAGA 4WFIA 2VF2A 5D7BA 2OCGA 4U2FA 2H9YA 5A62A 4G9EA 3C45A 4HAIA 3BF8A 5HCUA 3HC7A 4M0MA 4A16A 5AM3A 5IVKA 2WUFA 4OB7A 3ZI7A 3PF8A 5LZ8A 2CEKA 4ARAA 3IA2A 2WUEA 3AUKA 4U2GA 4QLAA 5AKHA 4FNGA 1UK9A 1QIIA 3G0GA 4MYSA 3DKKA 4Y2TA 1H2ZA 4W1QA 4PSUA 2OCIA 1FJ2A 1FFBA 4J0KA 3O9MA 3F8SA 5LYYA 3JW8A 3NUZA 2OG1A 1R9NA 1DWQA 3LIPA 1P0IA 1AGYA 5AP9A 2V98A 3GELA 3H2GA 4WY5A 3R3ZA 4UBNA 2QJRA 4H7KA 5EHXA 4CI9A 2DFPA 4FLFA 4B82A 1YAHA 3ESBA 1MX5A 1C7IA 2CBGA 3CCCA 1R50A 1XROA 3WZLA 3D4LA 1EHYA 4J0DA 5DNUA 4BDTA 3Q0TA 1CUZA 4DNQA 5E4TA 1YCDA 4A23A 2RGUA 4DNFA 2PSDA 1SC9A 3DS8A 4IH1A 1TCAA 4KACA 5SYNA 5ALMA 4BC0A 5HF8A 1EB9A 2Y6VA 3VVMA 4EY4A 4RPCA 4WJLA 1CUAA 2J3DA 4QWWA 2O2IA 1CPYA 4FFWA 1THGA 4S0XA 2AJ8A 4J0GA 4G8BA 3HABA 3R40A 3G9UA 4G9GA 4JH0A 5FLKA 4KRYA 2WIJA 3IUMA 1CUGA 2B4KA 1ODTC 5ALWA 3I2IA 4UPDA 3WK9A 1VE7A 2C0PA 4I4CA 3WL6A 3HI4A 2AJCA 3WKEA 1QO7A 3ZV7A 4W1SA 5A7GA 2GYUA 4ZGBA 3IBTA 2P8SA 3KOOA 2J4CA 4BE9A 4UHDA 1N1MA 4ZXFA 2JGLA 3FLAA 2XLBA 3BL8A 1QIJA 4B7ZA 1Y7IA 4E46A 3NGMA 2H7XA 1EDBA 2XUJA 1LPBB 1CV2A 1BEZA 4BRSA 3B12A 4EUSA 1UKAA 5HKBA 1USWA 3HJUA 4V2IA 2D0DA 1C4XA 4A5SA 5AM1A 2R8BA 3FOBA 3CXUA 1GKKA 5AKIA 5T4BA 4BRZA 3C87A 2ACEA 7YASA 3KD2A 4M0EA 2DHEA 5EHZA 1YA4A 4N8EA 5ALDA 1U4NA 1TCCA 5DTJA 4OB6A 4OD0A 4PV7A 5IKXA 4Y7DA 5HFNA 4K6HA 1ZIXA 5EHNA 1EINA 3DJYA 4MYDA 1QLWA 4QLOA 1WOMA 4L3WA 2PPLA 5YASA 5I8PA 3O0DA 3CN7A 4PF1A 2HU7A 3BDIA 1F8UA 5ALNA 1Z68A 5CRIA 3PDCA 2Z3ZA 1DQYA 1XZLA 4O08A 1QIHA 5JALA 3R3YA 5AKLA 4AO6A 1XZDA 2XMGA 4Y2SA 4Y2PA 3PI6A 2H7CA 3FYUA 4OU4A 2ZJFA 5CXXA 3C6YA 3WKAA 4M0FA 5LKRA 3DOIA 2HDWA 2PSFA 4G8DA 1A8QA 4BBZA 1TAHA 1JJBA 3U1TA 3FLBA 3F98A 2XUPA 3EIOA 4TPKA 2W6CX 5D6OA 2I3ZA 2O2HA 5ALIA 1BRTA 4B9EA 1EI9A 5FKJA 3V1NA 4KEAA 4MQLA 5AICA 4MWSA 1EB8A 1XZFA 3WL7A 1XZIA 5HK8A 2DSNA 2YYSA 2WHRA 5JYCA 2VQ6A 4BVJA 1A8SA 3QMMA 1UFOA 4U2BA 4X6XA 1XQVA 3STWA 3W9UA 4DTCA 2RAUA 1XZCA 4N5HX 3H2JA 2FJPA 2IX9A 4CCYB 5JATA 1KU6A 1AKNA 4H0CA 5AM2A 4ZRDA 3UUEA 4GW3A 1HPLA 2Y2VA 2ZYRA 1IUNA 5AM5A 4FNMA 3FNBA 1FFDA 1IVYA 4BTVA 5ALZA 4X7BA 4CCWA 1TIBA 3ESAA 4KE8A 4BDSA 1G42A 5FV4A 2HU8A 3WQHA 2V96A 4K6GA 1MU0A 3DKRA 1N5RA 4G4IA 3A2LA 5ALYA 3WWEA 2XUDA 3VVLA 1XLVA 4BZZA 3HYSA 2PUJA 3HEAA 1IUPA 2GBCA 1MAHA 5ESRA 4W63A 5JAPA 4BB0A 4Q34A 1U2EA 1JT2A 2PSJA 3BJRA 4FBMA 4ROTA 2XUOA 1CEXA 2WIGA 3MVEA 4J7AA 3DOHA 1SCQA 4QDXA 5FXMA 4AQDA 2JGEA 1R4ZA 1BN7A 5LZ5A 3QPCA 3VXKA 1K63A 2ZVDA 3H2HA 4XIIA 4INZA 4LIPD 1N5MA 4C6HA 5C7YA 3WL8A 3VJMA 2ONCA 1RP1A 3ANTA 5AM0A 2XUQA 1EK2A 2WHPB 1PJAA 4X95A 5FPPA 1MN6A 3R3VA 1CUBA 3W9BA 2HL6A 1GPKA 3UMJA 3JWEA 4B81A 2PVSA 3D2CA 3FCXA 2XMCA 3G02A 4B0PA 1ZJ5A 2CJPA 3R3WA 4IHAA 4X90A 3AZQA 2CB9A 4H35A 3C70A 1BCRA 1E5TA 1YASA 3D5EA 4DNOA 1DX4A 4C88A 4X6YA 5J3JA 3V9AA 2ZJ6A 1K8QA 2VT7A 3WK4A 4NZZA 4JYPA 1VKHA 5ALUA 3D2AA 2HA7A 3A6ZA 4PSDA 3WIBA 3OOSA 4W1PA 2HA5A 4E11A 2WTNA 3C6BA 3W05A 4EY5A 3G9TA 1XZHA 1XRNA 1XZGA 1XZEA 3DCNA 3BIXA 1XQXA 5FRDA 2XE4A 1E89A 4CIBA 1L7RA 2WHQA 3G9XA 4DMCA 3ESDA 1J06A 2X5XA 5ALTA 3FSGD 1CR6A 3V48A 1A8UA 1E3QA 2WQZA 2AJBA 1WB5A 4G5XA 2XMDA 1F0PA 4UBLA 3WA7A 5ALHA 5IH7A 4QZVA 1QE3A 4JEIA 4F60A 2CUTA 4BAZA 5LP1A 1DT3A 5AIBA 3N2ZB 5E2IA 3ZLVA 3CN9A 3QMWA 4G4GA 1QZ3A 2LIPA 1CUEA 4PW0A 2GBIA 1W4LA 4K2AA 3DLTA 3PFBA 3WWOA 4BVKA 1IUOA 4GHWA 3V1KA 1KU0A 3IUNA 5AK6A 4AZ0A 1XQYA 1JU4A 1W6RA 2GBGA 2WTMA 3FYUB 4OUKX 4H7EA 1ODSA 2K2QB 1P0PA 3STYA 3DD5A 1TRHA 5AK5A 4Q3KA 5KWIA 4EY6A 2CZQA 1XKTA 2C7BA 2QR5A 3VDXA 3I1YA 1FFAA 1W76A 3MUNA 1B6GA 2WILA 2UZ0A 4HTAA 4AO8A 2OCKA 3BE8A 2XQGA 4E14A 2C0QA 1EDDA 2QT9A 4AN0A 5CURA 3STXA 4IH4A 1ZICA 4KYVA 4CCYA 3DL7A 5I7UA 2H1IA 2BGRA 4EB0A 3FVRA 5E4JA 5DYWA 2C5GA 4QNNA 2Y1KA 2I03A 4Y2RA 3VKFA 2XDWA 4G4JA 1Y37A 4N5IX 2XLCA 2OGZA 1LZLA 4UBOA 1YA8A 3I6ZA 2XQJA 5ALQA 1DWOA 2PKYX 3EBLA 2XMQA 1EXWA 3WIOA 5E4YA 5K5EA 2HA3A 3TJMA 5JAUA 1CRLA 1K5PA 2J4FA 3WYNA 1BROA 3O4GA 1MAAA 2WSLA 3IVMA 5AJHA 3DDUA 4GBGA 4FOLA 4TGLA 2QUAA 3EQ9A 2WJ3A 1GXSA 4Q82A 4B0OA 1UKCA 1CUHA 4QWMA 4AX4A 1Q0RA 5AOBA 3A70A 4H7JA 2VA9A 3H1BA 2OQVA 5C8VA 1HDEA 1OCEA 2JGJA 3F9CA 4WDQA 5BOVA 1MNAA 1NX9A 4JYMA 4CG3A 2WHPA 5JADA 4Q3LA 2WKWA 3L1HA 4WFKA
chains in the Genus database with same CATH superfamily
3K09A 2DCUA 2O2SA 1ODFA 2Y68A 2NACA 3EXIB 4NG4A 4NMWA 2ZBEA 2OXEA 4J4HA 3KPYA 5E8JA 3ZCQA 4E5NA 3THRA 5H4GA 5M04A 1L4HA 4B45A 4ZVVA 1STOA 3ESXA 4BTEA 3DE4X 3GUHA 4J94A 1PG2A 1QH1B 2IYFA 1EWVA 2PSEA 2G70A 2X41A 1YRHA 2ZRGA 3DBRB 3EDRA 4ID3A 4OHRA 3A6EA 4Q3EA 3QUTA 4WZAA 4A73A 5I48A 5FT9A 4P3YA 4L0MA 1REQA 3UANA 4EI8A 4RTMA 4X94A 1MQ8B 2V9ZA 3NW9A 3O1IC 4HEJA 3DR3A 2HSEA 3CCBA 5DYYA 4X71A 2CF5A 2XJ9A 2GAAA 3NJ8A 2X8WA 1Z4LA 1U3DA 1A4RA 4UBJA 2ZSJA 1E5QA 3EGXB 3KEQA 5KSOA 2ZYUX 3BBPA 3L40A 3W06A 4DV0B 4IXDA 5C1OA 1DTEA 4TWZA 4PSCA 4P58A 1YBMA 2O8DB 1DIRA 4QXMA 1KO7A 1QAOA 1QQ6A 1AKEA 2MOKA 4V38A 5FNVB 3CQ9A 2CYCA 4C5BA 4R3NA 1H4TA 5JSZA 3IT1A 5BNFA 1C1YA 1U11A 3DFKA 3QNWA 1E6MA 4NHEA 5LZ4A 3AL0C 1GNLA 1WUIS 5EJMA 4AK9A 3V8PA 1A7JA 2H16A 3FFWA 3ZI4A 1G5PA 1PK8A 2HAEA 1TL7C 3FFBA 1IZ0A 4S35A 1D2CA 4RH3A 2KWIA 2WI8A 3UAZA 1LV8A 4C7VA 1CUWA 1Q7TA 4TVSA 5AWFC 2ZT7A 1NUSA 3DL2A 4ZV7A 2VO1A 2Q1TA 2V8OA 3FDFA 3QHQA 5CA1A 4O2RA 1W0KD 2Z5GA 5HM8A 5L8VA 3EG9B 2PX8A 3PLRA 5FYQA 1U3CA 2NV2B 4FD2A 4LCEA 5DASA 5HNKA 1SWWA 3WNDA 5TQ0A 5H3LA 4QX6A 4TQGA 5A1TA 4HUJA 2ECFA 1JXMA 1Y1PA 1P1BA 2JAUA 3FPFA 4E08A 4LY6A 1E7QA 5REQB 1SH7A 4II7A 1ARZA 3I12A 3Q1LA 4A10A 2WJ4A 4XX0A 2ZRDA 3ED5A 3HB1A 3K9CA 3SIPA 4XWKA 3PFKA 5JWOA 2HKIA 4F9GA 1C0EA 2IODA 3ENWA 2ORYA 1PV1A 4YPVA 3SJAA 2F64A 1DTWA 4ZAFA 1IM8A 3UUFA 1AHHA 1SCKA 2XTNA 3PA6A 2Q0QA 1XVTA 4N40A 4E0BA 3STTA 4GP9A 1FUUA 2CMHA 1HORA 2DQZA 2UYQA 3A06A 1F4PA 1QYCA 1SD5A 2R7MA 2SICE 4XIYA 1CSEE 1IXYA 4HADA 3TCKA 4EG1A 2BCGY 1XLTC 1U0FA 1IN1A 2CNOA 1KAGA 3KVYA 3F5DA 3QVXA 4DE5A 2FPGB 4WLUA 5KDOA 1TPZA 1QIKA 4RDCA 4JYAB 1Z6GA 2OBMA 3EGEA 5BY2A 3BE4A 4IX1A 3QXXA 3D0KA 3QKSA 1KZYC 1CC1S 3SDBA 1M1XB 3B2NA 4PONA 1ZH4A 3QM1A 4J3NA 3GZJA 3MCZA 1AG9A 1BS2A 1X1TA 3KXIA 3VPBA 4PIPA 3A6PC 4IVPA 2QRKA 3DWGA 4HBZA 5AVRA 1EIWA 2NV0A 2QMEA 4HG2A 4GPEA 1HWYA 3I6MA 4H17A 3W04A 4E5YA 1UAGA 3FFTA 4HPWA 3TDNA 3FHCB 3COYA 3DOUA 2QXUA 3ER6A 3RIYA 5SZHB 5DK6A 5HTKA 1KEVA 1PL8A 2ZG6A 3LHSA 5C81A 3ON5A 4OL9A 1TMOA 4HHEA 2QQ5A 1GAJA 2LKDA 3UJHA 2XT0A 3F0TA 1Y4UA 3EDOA 4P54A 1FYDA 4R6XA 5EWMB 5DBEX 1X42A 3RWOA 3V80A 3ZD6A 1WABA 2ZSUA 4LJKA 1ONNA 3NFRA 6YASA 3KM0A 3DVLA 4QNMA 4UHKA 2NUAA 1HMYA 3ZHCA 1PJRA 2X8JA 3QV2A 2DBQA 4ZEOA 3KQLA 1KOFA 1DXHA 1KAOA 3W5BA 3TLZA 1XCGB 5SICE 1KH2A 2UZIR 1VE6A 2C4WA 2VAPA 4RULA 1PG0A 3IMKA 4HDKB 1HDZA 4AURA 4B6FA 3EK2A 5FOQA 3HXQA 2XYHA 4KVFA 1RYYA 2NG1A 3R0XA 5FPQA 2QOEA 1QOZA 1T0PA 3JSAA 5FUVA 5JH7B 1HE1C 5KI6A 1S5PA 5IWAB 3BILA 1ZMTA 1B8OA 3LUBA 3CT6A 3QPAA 4Y2XA 1Z3IX 5F7XA 4ASUD 1IY9A 3N8NA 4RHXA 4AD8A 4E5KA 4BNZA 3HU2A 4I4IA 1L4YA 3FOEC 1JIXA 1VOTA 1IFXA 1WLYA 1WKBA 2JAHA 2O2JA 1LRJA 3N6RA 3ZYZA 2ZB4A 3U37A 4J43A 1PR9A 2C7OA 4BRWA 1RS0A 3TOXA 1JI3A 5BYBA 4AT1A 2O2ZA 1WSBA 3ONWA 2XCUA 1BVYF 1A72A 1DUVG 3MS2A 1GR0A 1OI2A 1BH2A 4P84A 5LUAA 2P1ZA 4JLBA 2PFSA 5G1PA 2DUWA 4AWXA 4LK2A 5GZ3A 3GYBA 1FUEA 1KP9A 1T2NA 2HIHA 3DXFA 2J7KA 3PXCX 1YGPA 3RANA 2IHZA 3TSYA 3UV6A 3Q87B 2PX5A 5FAKA 2WJVA 3IP5A 2O2EA 3NDRA 4FEYA 3VQTA 4DM3A 1NBIA 2GEUA 3S99A 2NTEA 3ELDA 5G0UA 3OZGA 5IK2D 5B58T 3L93A 3PSAA 2OZVA 3MWFA 5L3VA 1JJIA 4G07A 4FN4A 4DA6A 2BUAA 4XDGA 1HYBA 3AFNA 3N0XA 4TKUB 5AW7A 3PEUA 3EVZA 5BSRA 3IMGA 1CEYA 4BNDB 3LBNA 2JGMA 1EZ1A 2H2AA 2TECE 1AS2A 3K6JA 1Q1BA 2E82A 5JSYA 2VF4X 3N28A 3L7CA 1ZN2A 3B6KA 2R00A 3AF4A 3C14C 4JENA 5KCMA 5JANA 1OH8A 2Q2OA 2VYCA 4OQEA 1ZA2A 3BMQB 2IXDA 1NF2A 2BMVA 3PNVA 4KQGA 3W2EA 1KXZA 1CDEA 1H6CA 4YCDA 1WL8A 5T4EA 5BVGA 3BD6A 2GK4A 4DUYB 3KU1A 3WS7A 2PZJA 3RAJA 4O59O 4C76A 4OX9B 1UDWA 1DVRA 1Q91A 4P93A 1SUIA 4R1NA 3TVTA 4EBFA 2OV3A 3HR4A 4LOHA 5HUQA 4GM4A 1GQOA 1K5GA 2HMAA 3TRDA 3WLHA 4BNIA 3GAMA 1YOBA 1F6BA 1WZIA 1FYEA 3LA8A 3SIRA 3SD7A 5TV2A 4KAFA 5JAMA 5FUMA 1EK6A 5AJYA 4QZVA 5HKAA 1IHUA 3R5KA 4ARSA 3PFIA 3VSCA 3E3MA 2DHRA 1OE0A 1GY8A 1GGFA 2DFKB 3ICCA 4IRUB 4LDNA 4WZAE 2VOEA 5EI5A 1ZH0A 1JECA 3T3HA 5J63A 3ZE6A 1ZH2A 5IYZF 5D87A 1G5FA 3PNKA 5FI5A 4ZVUA 1SB9A 2WKRA 1XMIA 4DLUA 1RYFA 3PNLA 1QANA 1EUZA 1H0HA 3ZK9A 4HPXB 4AJNA 5A5VA 2FY8A 4OKIA 1TPYA 3DZBA 4B6QA 1DINA 1Z2CA 3K6KA 4GI3A 4LV8B 1TF5A 2FPIA 3DM9B 3M3PA 2HO4A 1EE9A 3GEGA 2GSDA 4ZU6X 5A6VA 3BD9A 2R11A 2L0XA 5LMCA 2X5OA 1WOYA 2P1RA 2P30A 1GPMA 5IJ0A 3T3PB 4CLXA 4KDEA 4JIMA 4W1RA 3AEKA 2XRMA 2GFIA 4Z7JA 4GG1A 4UFPA 1MDFA 5B3JC 4PXAA 2VOJA 2F4VB 3AUTA 4N18A 5ITSA 3ORQA 1T2FA 4PZ0A 4W8OA 2VEOA 3GRYA 2AN9A 3V4FA 5CPBA 4ZYYA 1LDBA 1PSDA 3SX2A 4MGHA 1A50B 3Q2KA 1EE2A 5IUKC 4QULA 3LWBA 3S2GA 3OHSX 5DYTA 5FV7A 1MOPA 4EVRA 4XUEA 2N42A 3K09C 2YFQA 3FAKA 1UXOA 2ZJYA 3AR5A 3I6QA 1PZEA 3P97A 2DBRA 4HAXA 3A9RA 2F3RA 3GROA 3HKCB 4WXHA 6PFKA 3BHJA 4I36A 2VJCA 1ISRA 1NKVA 3HYRA 1QX4A 3Q3IA 2ZIEA 3L4SO 1QV6A 1QH9A 2QMQA 1YRWA 3ZUPA 4DBLE 5B30A 3MWEB 2AE2A 4HB4A 3GQVA 1SKMA 1YZGA 3EXIA 4V0RA 4ZT4A 2XCSB 1B14A 2X9LA 1ORTA 3JYLA 2C1EA 1PV4A 4R9RA 4X20B 3WKCA 1V95A 4EI7A 1J49A 4FMDF 1OX6A 2JBWA 1EFRA 4BGEA 4KAAA 4I8XA 2M9MA 1MT3A 2RKOA 3HV0A 1QHHB 4OQFA 4CIXA 1R5BA 4GI7A 3WQRA 2ZTLA 4N47A 3JATB 3QEMB 4W4TA 1V5GA 4HLQB 5HZHA 2GD1O 2VP6A 3AEXA 3ZPXA 5AO9A 5J2TB 1UXHA 1Z37A 5JCJD 4QUKA 5FR2A 4EO7A 2JLXA 3K0EA 1FB5A 4HDOB 4RXTA 2C4KA 4MICA 5ADUS 3EGXA 3QV1A 2QTBA 2J3KA 1EP2B 5B6IA 2B30A 2D2XA 2SKDA 5K3OA 1JV2B 3L8GA 5EJ7A 4HRVA 4RD1A 3WE7A 4JJ8A 5BMVF 5JUWA 4ITUA 4UU0A 5CFNA 1QOQB 3QBJA 5FNVA 1KYTA 3EZNA 5DT9A 4ZFNA 4I55B 1GGEA 3OJWA 2H1CA 2NTNA 3OEEA 1U1DA 5B1YA 3QFCA 1RI4A 1PFVA 2HK9A 3JQ9C 1QVZA 3LGAA 2AD5A 4HO1X 4BKOA 3S40A 1KMCA 3MWJA 3DPIA 4FKBA 3FPEA 1ZGCA 3IDSA 4HMOA 3UATA 1Q2XA 4NOJA 1E3TA 1LPSA 1RQXA 1XALA 3JVUA 3KXPA 3BA6A 2W58A 1G19A 3O4RA 3ZIAA 5EKUA 2EJVA 2QAJA 3RYTC 4BC1A 3JQAB 4F6RA 3KJNA 2J3LA 3DD1A 1FDOA 2JAXA 3A14A 3LUHA 5JT1A 5E1OA 5GV8A 3I5YA 1Z34A 2HN9A 1TT5B 3EG9A 4ZQIA 4LDQA 2JANA 4MUEA 4P3KA 3F47A 2DGDA 5KDDA 1JHUA 1TDJA 1YGYA 2JCSA 3DAGA 4PG8A 1CYEA 4X7PA 1X7GA 4DTIA 3RU2A 4DPLA 1F1BA 5REQA 1NV8A 2REOA 1G21B 4WTOA 2X4DA 1L9KA 1YB7A 4GMDA 4W5JA 3MUEA 5I4KA 2G7MC 4G5SA 4KI7A 1G7SA 2FUEA 1IY8A 3ZDAA 1XMPA 2O14A 3G23A 2P5YA 3QU5A 3E1GA 2MHCA 4RC9A 2PMCA 4E5VA 3KLMX 4ZIRB 1YL6A 2H63A 1K7YA 2XXAB 2Q6LA 3QNUA 4WY8A 3ZY4A 3C24A 2Q0XA 4I9UA 3K92A 3WNBA 5CITA 1IOZA 4E7OA 1KZ6A 2WWVD 2AXPA 2C77A 5IUNC 4QT0A 1DC7A 1JZQA 3D3EA 4PAMA 4MK4A 1P3DA 4QGGA 3Q15C 4BUZA 2AVDA 2FPGA 5IEBA 4C3VA 2J0QA 2OFOA 1V8ZA 3O2JA 3TS1A 1J7JA 4RMIA 1ABBA 1Y6RA 4LFCB 1SKQA 2VNHA 2XADA 1N1EA 1JHQA 4JL8A 1VL6A 4KWCA 4KKVA 1J2YA 1R6VA 4HWOA 5TEWA 3N2EA 3TM5A 3S2FA 1SOAA 4ESEA 2I7CA 2EDCA 2QL7A 2HHAA 2FQWA 2WAYA 3D0RA 1FFWA 4YONB 2OSVA 4QU8A 4X1KA 2PHZA 3B8EA 5NLLA 4ISBA 4UZFA 1NT4A 1PS8A 3WWPA 3FJ1A 1Y63A 3IYLW 4XX1A 1ND5A 1NNSA 1ZKMA 2RGEA 3FUCA 1AZWA 3V00A 2DFTA 5BN5B 1C81A 4KJXA 3RTGA 1B8NA 3ZCUA 1P6XA 4NCIA 7GPBA 1QU3A 5G41A 1WM1A 3A4YA 4G41A 5EWMA 1C80A 1C4KA 2ZPTX 4U3JA 1NSYA 1RR6A 2WKSA 1WXXA 3FCAA 2YN4A 1JWLA 4KR7A 1G5QA 1QX3A 2AFIA 3ZU6A 4G5YA 2ZJ8A 1UL1X 2ZYIA 2I2AA 2XYGA 4LYEA 4GWGA 4MRSA 3ZXYA 5JNTA 5FOTA 2Q0SA 2ZSIA 5KYUB 5IT0A 4M9UA 4PC2A 4ZV9A 5LLDA 2CN1A 1U04A 1EUCB 4M7PA 4HOYA 4AJIA 2B20A 1R0KA 4HDKA 1FRVA 3TOSA 1WW3A 3TVDA 4G0VA 2BFBB 3E0XA 4F71A 1RRKA 2BDTA 4YMTA 4DDVA 1Q77A 4XD7D 5LP6B 5KTOA 3B9QA 4BXOB 3KV3O 2L17A 4AXBA 1G66A 1ZJZA 5K0EA 3EB9A 1GNPA 4NDNE 4OSEA 4GMHA 4JHLA 3ESYA 3QQ5A 1E2PA 2I5PO 2V9CA 1GG2A 4G5FA 2WBLC 2CL6X 3W8RA 4LSMA 4J8PA 1RBZA 3W3AD 2OHIA 1GITA 1NLYA 2HHJA 4JOSA 2IP4A 5BT9A 3ABIA 1XN4A 3ZBTA 5KTRA 1Z6XA 5L95A 2REBA 1JAXA 4QFDA 1LS1A 4NP6A 3VC1A 2X5KO 3B1WA 4CM7A 3V7WA 2VI5A 4FGZA 4DYHA 1QTRA 4QARA 2VT3A 3OQIB 3ZE2B 1U9IC 1U8EA 2DPYA 2JFQA 2ATVA 2XCRB 4YMIA 2RHTA 3RI3A 4IIHA 3W6UA 5E1MA 1F6DA 3IXMA 1T6YA 4KH0A 4XIJA 2IOQA 2BYTA 1T29A 3JD0A 1P4GA 1UBFA 2VSOA 4H60A 4YRKA 4EGSA 3SAJA 4V0QA 2ZZNA 2QQFA 3SYNA 2GK7A 3L8CA 5G0TA 2GVDC 5CB6A 3D8UA 2ZYAA 3P2JA 1M6WA 4NPHA 4MP6A 3F9IA 4OXKA 4ECAA 3MD0A 2YFKA 3P9ZA 4QYTA 1NM5A 3GVHA 4JKIA 1PZGA 3LT1A 1XZBA 2AN1A 4MUXA 5LCXA 2JFBA 4RY2A 1KK2A 3PXXA 5AH0A 2HSWA 1NRIA 5JNLA 1PSZA 2OGWA 2YCBA 4PZUA 4TKUA 2AHOA 1TM3E 3U5ZB 2R00C 1CWUA 4P33A 5IAEA 5ARBA 4BNDA 2XKKA 2VAXA 1FNDA 2ZOSA 1YR2A 2GXSA 3C3BA 4F9FA 2QVYX 4B17A 1LSJA 5GINE 2K7FA 1C3XA 1M7HA 2IC5A 4BFUA 4GNKA 4EYKA 3I5MA 4OXRA 4IKEA 5HMMA 3H87A 1XKXA 4FSDA 4HLDA 1MG5A 1M75A 2GASA 3FZYA 4L2IB 2QVXX 3B9PA 4UHCA 1PF7E 1SKAA 2BMEA 4IIDA 4R7ZA 5JCXA 1IVSA 5E0KB 2ZUCA 5B58C 1NASA 4PCUA 2Q2QA 1HLPA 1WQ1R 2JD0A 3LFUA 4RY9A 5HUJA 2JD2A 3HKEB 5GM1A 3LD9A 4FDAA 1W75A 1NQVA 3HDGA 1V4NA 1J0AA 3PE6A 4CL8A 5LA6A 3VTAA 4AG6A 1LX7A 4MJXA 5BQ5A 3CZQA 1Q0HA 2PZBA 3UB4A 3HLTA 3QSGA 1XKQA 2Y8EA 3MWKA 4LYJA 2WUDA 4B74A 2ZKLA 1O6FA 4FWIB 4JBHA 3H9QA 4MPDA 5H02A 2GZSA 4LWOA 3SNKA 3F5FA 4HNTA 5B7PA 3GGSA 1UBKS 2QWXA 4C20A 1CZOA 5BO5A 2EKPA 1KY4A 3QZUA 4JX9A 1RFGE 4A8JC 3WJ2A 1WDWB 2C4HA 2CBZA 3PNMA 3P19A 2I8LA 3G1UA 3KELA 4OIMA 3UJAA 4X66B 3BAFA 3X1ZA 3WMGA 3WB9A 4EMTA 4G0ZA 1IWBB 2B5WA 5AT1A 1ZD5A 1BD3A 1E2EA 1C9DB 1G291 1JS1X 2POCA 3L1JA 5KSYA 1A1VA 2O2XA 4PTZA 3WLQA 3A2MA 1OXVA 5C37A 1JKJB 5J2UB 1I1OA 1WXWA 3KBOA 5I7SA 3WSTA 5JAIA 2ZU0C 1JIQA 3AHFA 3C6XA 2W48A 3FGNA 3R4VA 1FTYA 1UXKA 2ZTMA 4DLTA 2ZJBA 2CFIA 4AY2A 2HDNB 5CH3A 3OUUA 5F1PA 3D3JA 5K3AA 3MS7A 2BFFB 3ZS9A 5ICCA 1NWCA 4L76A 4C08A 3L77A 4WK2B 1HNZB 1K6EA 4F8EA 4Z9XA 4JJ4A 3ZWNA 3MW8A 1M2EA 3TRJA 2SKCA 1BMFD 3GAAA 2X3YA 3V33A 4BLTA 5AVVA 4MR7B 3HJGA 3RUHA 2WSSD 1JDNA 3CIFA 4PM4A 2AWOA 1NYQA 3H19A 1JSRA 5T4HA 2KMLA 4AJ2A 4BFZA 4D81A 2O8EB 2D00A 3DZGA 3TL3A 3O1LA 4BOYA 4H27A 1V3TA 4YP6A 4JWTA 3HKCA 1FFCA 2VH2A 3NBMA 1CU1A 1E61A 2XTZA 4AMUA 2EBHX 3VAYA 1VJRA 1XJ5A 1Y3HA 1O8CA 1JFRA 1FZTA 3MWEA 4CIWA 3ONDA 1YZFA 4KR3A 3L01A 4WOCA 4GBJA 3A28A 3MIZA 5FBWB 2BEUB 4BHTA 4E31A 4X20A 4IV5A 1R8XA 4HKTA 4RTKA 2LZ0A 4LFBB 4R69A 4G1FA 3AYZB 3VBEA 4QG3A 2FWAA 3KV1A 4MJ3A 2CHFA 5JC8A 4AXXA 3FRIA 1K6MA 2Q50A 4IINA 1QHHA 2BFOA 1PT9A 4EPTA 4TRJA 2RBKA 1S7GA 1XWFA 2IS6A 1T9GS 3FNIA 2RAFA 1QIEA 1ZZGA 3JATA 4KQCA 2O6LA 5EMJA 1PJTA 1FF9A 3PFFA 3A4TA 5CBKA 1HL7A 4CHGA 3VH3A 5KJFA 3SYTA 4C7OB 3NOXA 1EP1B 3UW1A 2VJNA 3VPXA 5KYXB 3BQMB 4LHEA 1POWA 1RNLA 4CMHA 3RJ9A 2VF5X 1XPOA 4XUDA 5LQSA 2ZQYA 3RC1A 3AZPA 2NO9A 4BU1A 3IT2A 3E2IA 4B40A 2I33A 4LN1A 4R2WA 1C7JA 5EQTA 2ZB3A 1FNNA 1JA1A 1G3RA 3FUTA 2JDID 1D0VA 1JTVA 3E0QA 3I6IA 1U8UA 1UFQA 4HYQA 3OP1A 4I55A 4JBIA 4D0LB 3GQBB 1WZ2A 1OAOC 5JVDB 1YNSA 1XHFA 1RE0A 2QRZA 2W0MA 4FMPA 1X1BA 3OHPA 1TZCA 1Z16A 4MZDA 1BE0A 3BG5A 3ODPA 3NT4A 1Y3CE 1O58A 1BMDA 3ST7A 1TC1A 1HYQA 5DHUA 4O0LA 4ENSA 2IYTA 3JQAA 1DADA 4MIOA 4DLNA 1IBCA 4P38A 1WQ4A 4X8HA 1U99A 3U1BA 2AFIE 2ET6A 1LJLA 1X70A 3EQ7A 1JWAB 3VGJA 1IUKA 1GTG1 4K8RB 3V4SA 1UBEA 1HTTA 5K4AA 1N77A 2BBOA 3OA0A 1VXOA 4P6VF 4PICA 5TXGA 4BMSA 3GPLA 3INTA 1PW5A 1SQ0A 4LVOA 4MQBA 3H8JA 1WVIA 2MSKA 4OM7A 1VFNA 2H4HA 2CUNA 2F1RA 1E3JA 4RMGA 1YAJA 5GJCA 2RHMA 5JS2A 1BW9B 4DCUA 5A7FA 3R5TA 4TS9A 4CDGA 4E7PA 2X0JA 2VTKA 2X23A 3ZWMA 5T8KA 1T5DX 3K8YA 5CFOA 1T8TA 4UTRA 3VR6D 1VE9A 4AUNA 1O96A 3KYJB 4ZIRA 4RIIA 3RFCA 3BE6A 1DBSA 3CBGA 5FDFA 1BYIA 1G6Q1 2D0PB 2XXAA 4MA5A 2C84A 3TN7A 1EIZA 4ER7A 1GLNA 1C3VA 1SU7A 4YJ2F 1XEXA 3CVXA 4YHBA 3T35A 4FX5A 4ERNA 4JV5B 3OPXA 1WJGA 2GJ9A 1SC1A 4Y3UA 5F2KA 2PFGA 1QYRA 2WPDD 3AM4A 1JL3A 3BFPA 3OG9A 4KQFA 4MTLA 4DMGA 3ANSA 4H3HB 1L9XA 2CDCA 3IAAA 3JASB 4XQEA 2P4UA 3NXKA 4ZAYA 1HT1E 2VNSA 3DMDA 4KNWA 5FFNA 4IKOA 4JA0A 4PG7A 2W8BB 2OCBA 2R7AA 1JMYA 2CD9A 1DI0A 3EEFA 2BFMA 3EWAA 3FNEA 3OURA 5EWLB 1HE4A 2QSYA 2ZJ4A 5ALGA 3STUA 3STVA 4ETWA 1EK5A 5JZVA 2ZUBA 3Q7EA 1HTBA 4CMJA 2IEDA 2W22A 4LQLA 4J90A 221PA 3CC8A 3NLLA 3RROA 1TO2E 4GR5A 2H18A 4R0NA 5DDIP 2GKSA 3IVXA 5BN5A 1PTJA 1NMEA 5TMBA 5EZYF 4I3HA 4TTQA 1H23A 2PU7A 4O2AA 3B1YA 3SE7A 1Z7YA 5CVEA 6ABPA 3QELB 4I50A 4LRUA 4Z2AA 1WCWA 2WJGA 1IBMB 1QCZA 3PHLA 3KB1A 1NDUA 1KDPA 1FBTA 2O8NA 3WDSA 1VB5A 3RD5A 2ZSHA 3FBGA 4G0MA 1XRRA 1MH9A 4WESB 4YVFA 3SE0A 1NG9A 3ZJYA 2XUZA 1SVOA 1CDOA 2H3EA 2OV1A 4FCTA 4MEBA 1NFFA 4UBIA 5KYUA 4DV3B 1M2VB 3O8LA 1DKMA 1W52X 1UODA 4UVIA 4RAQA 2W6ID 3NOVA 3AR2A 1EUCA 3U13A 3GJ4A 3LCMA 1XRMA 2JIBA 4HATA 3EPKA 3OMLA 3EZ2A 2BFBA 1NL3A 4R31A 1L3BA 5BT8A 1L7AA 4BXOA 2WFMA 1V5EA 3CNOA 4E4RA 1SELA 1CIJA 4MCJA 3GK3A 3FXAA 5AKKA 3WMFA 4WXPA 5IT4A 2MSWA 1UJ2A 2XUGA 4HR7A 3QBDA 3I72A 4TWRA 1A69A 1ZK1A 5E2AA 1K7EB 3TEMA 4EYOA 4F12A 3RYCA 4CG0A 3KPUA 4WBSA 4KW7A 4PC1A 1VPDA 3FB1A 1CZUA 1SBQA 1Q7BA 2XDQA 1A2OA 1NXOA 2G09A 4GM0A 3ZLTA 3I62A 2PX6A 4FZVA 4QYIB 2CJYA 2QNRA 5IJXA 2PIDA 2WUVA 5A3RA 3OOEA 5DNWA 2ZSDA 5K8CA 4E51A 1CF4A 1PLJA 3KKKA 4H59A 4EKIA 4KE6A 3QKTA 4UOEA 2IPNA 3PDUA 5EQJB 4S1VA 1Z5ZA 3LZCA 4ID9A 5CUQA 4CTKA 1X2BA 2ISSD 2HRCA 3HHPA 2GFQA 4ZWNA 2ZT8A 1MNQA 4MWTA 4A2CA 1MJ5A 1Y1LA 1RXUA 2A0FA 3GIDA 1U3TA 4GWLA 4Z4CA 4CF6A 5BSKA 4LHZA 3NPMA 4ZGWA 5TJ9A 3USES 4D41A 4RL6A 2PBLA 4DQDA 2A9FA 4B6PA 2CHEA 3L7DA 1WIWA 2JJ2D 1SD1A 2H1OA 4W7SA 2PX3A 4G56A 5D86A 1HE3A 5G3ZA 1UJNA 4V0NA 1SCIA 4KR0A 4ZAWA 3TZEA 3DEYX 1M1YB 1PJQA 4CW7A 3B7WA 4Q48A 5BV1A 2R5NA 3KZKA 4DJTA 1L5WA 3KE8A 1SCJA 4L2IA 3EMBA 1VPLA 3ZHYA 1TA0A 4ZRMA 4D45A 5HHTA 4NI5A 3CW2A 4HY3A 2EF1A 2YRXA 4DRYA 1M3SA 1QIDA 3HKEA 3DVSX 1P7VA 5HE8A 4JUAA 4W5HA 4Q7LA 5IAKA 4C7JA 5CFPA 1ZHOA 1PT6A 2C2GA 1N8SA 5ALOA 2AXEA 1R0WA 4QU0A 4DPMA 1RRCA 1HLDA 2PE5A 1SG6A 5TT0A 4BQNA 2K6GA 5FEMA 2FUG1 1UJBA 3QWIA 4RTNA 5BPFA 1KERA 3HXKA 3QWFA 1U28C 1TJ5A 2HZ7A 5JASA 4MITA 3KQWA 1SOUA 3T1OA 4RCYA 4YT2A 4MS1B 2HMVA 5FH9A 5IHPA 3LDFA 2RHGB 1Y5MA 5FO0A 2CXOA 2OESA 2UZ3A 2DR2A 3X2FA 1N3YA 2DWPA 4GYJA 4NBSA 2NO6A 5LQUA 1T9AA 1ZW6A 1P8AA 2N3ZA 4LCJA 3V6LA 4RDXA 4BX8A 3F6BX 1YQUA 4OK6A 1WZUA 5F2EA 4OQXA 4KSBA 2I1LA 3IB6A 1JKJA 5J2UA 3OU6A 3MTQA 1D2RA 3UHPA 4P4UA 4PQEA 1RJDA 3DF9A 2FSFA 3WV4A 3ENNA 5HF5A 3S6JA 4ZEVA 4BLUA 1A8IA 3A9TA 3C41J 2GNOA 5GVSA 1SHKA 4I6EA 3AY7A 4NZYA 2HWKA 3WLJA 2F2TA 5KJ1A 4NJEB 1NVGA 3MMPA 4KPUB 1LNSA 4U00A 3AL2A 4JQOA 4HN9A 3SBOA 4EEXA 2BFFA 3FPBA 1G9XA 2PUHA 5F51A 4M1WA 1UOPA 1LI4A 2GZ1A 5FTMA 1ZD4A 4MR7A 3A4NA 2A5GA 2QUBA 4M89A 2WIDA 1OF1A 4WBNF 1AO0A 1W36B 4LJSA 4I5GA 1JDSA 1V8BA 2FFHA 4NBWA 1JT9A 3D1JA 5CD9A 1G2OA 4RTSA 1J8MF 1E8DA 1JP7A 1PEKE 3QMPA 4QOFA 3U62A 3VU9B 1OLXB 1L5NA 1R18A 4M37A 3G82C 4CUKA 1OFGA 2ECQA 4UTOA 4BJHB 5F4BA 5ALKA 3QVGB 3LX4A 4ZHQB 3SX4A 3Q8KA 3NUGA 3BB3A 2OXTA 3RTBA 2Q5JA 5FOSA 2BEUA 3WK6A 4P81A 4IGFA 1W1IA 2CCJA 4KSYA 3IPAA 4TT3D 1IZ7A 3DDOA 1RTKA 1PR0A 1UC9A 3ES9A 2Z3WA 1IDN1 3P2OA 1E9CA 3SMVA 4KRFA 1XRSB 1YCFA 1ZWLA 3UFBA 4YCMA 1IRIA 3CG0A 4QXAA 3ZGXA 1XLWA 2H2DA 2RE8A 1CJMA 1JJFA 2P9ZA 2VLIA 2X14A 3TVYA 1VLMA 2FZ4A 3IP6A 3V34A 3WK7A 1N0UA 1PQPA 3K0HA 1EDEA 3G8YA 4C7OA 3KTDA 2GLUA 1NUQA 1NVFA 1OGIA 3N8HA 4FOTA 4L22A 5J59A 1Q84A 3OIGA 4DY6A 3G2JA 3ZD9A 3HEBA 4DADA 2WE7A 4ZI7B 4AMGA 4BFVA 4ZYWA 3KC2A 3GX1A 5KVVA 1XZMA 1URPA 1LLCA 3BFXA 4I5IA 1P29A 1H4QA 4E5SA 3JAKB 1RQ2A 1WUJS 5E1BA 1V39A 2GRUA 1LBTA 1AY0A 3EGVA 4D8TA 4DQLA 1AMUA 1B0AA 1YIAA 5LQCA 1DX6A 3IB3A 4MIKA 5FUBA 2NXWA 1HE5A 5IT9A 1ULSA 3GQBA 1Y1QA 2AUNA 3K96A 5JVDA 3NWOA 3N07A 4YACA 5FFFA 5I4CA 1FLNA 4FXPA 3ZWAA 3AFMA 5IVHA 3A2NA 3OO0A 4ZO9A 5EIHA 4URUR 4DN6A 3ECCA 4GLBA 1AV6A 5HJ2A 3HCAA 5KYVA 2E1PA 1KHHA 3AF3A 4C1NA 4IIVA 3CH4B 2C58A 3CXRA 4GH5A 5AXBA 4QSMA 1UAAA 3RSZA 4NYIQ 1KSHA 1OWNA 1R66A 1FDSA 2YYZA 4JP3A 4RKQA 4Y2VA 8AT1A 3HTXA 4LY3A 5KU1A 2QD2A 3JVDA 3M1LA 2WWHA 2WICA 3G7NA 3O8CA 1FRZA 2Q6TA 4RQAA 1UBMS 4C22A 2GHTA 1DTSA 2VXCA 1K2VN 1LD3A 4CMGA 3C6ZA 3T5GA 3U4IA 3WL5A 2CNKA 2FW7A 2OCYC 5T8KC 1Z3CA 4M36A 4RHCA 3DEJA 4PYRA 2C57A 1OBFO 1Z88A 5ICFA 3H6GA 4EFKA 1BW9A 3GRKA 4RWZA 5D8DA 5BRNA 3MAAC 3T9CA 2PXCA 1B8PA 4L6IA 3VUEA 3VZBA 1Q5PA 1JRLA 3LIIA 4S1NA 1J9GA 3ZGOA 5DXFA 5IC4A 3JQ7B 1VI6A 4Y0AA 1M74A 1OASA 5ARCA 2O19A 1KZ7B 2WYIA 2JJMA 5T64A 4LMAA 4V1CB 1HNXB 4DCCA 4JR2A 1RM4A 4NYJQ 1IU9A 2DWCA 1OWOA 4HH4A 3R6DA 3A6DA 2VPIA 4DV7B 2ZE8A 3AUAA 3OZBA 2PUAA 2VBGA 1OZHA 3EH2A 4RFVA 3U39A 3GLUA 4P36A 3PFGA 4NS1A 1KJJA 3JASA 3ZGNA 3BWYA 1T9ZA 3C6KA 2FW8A 1Z0JA 4NAVA 4RIFA 5ALSA 3ZV4A 3EIWA 4RF4A 1CUUA 5CYPA 1OAAA 3E9YA 4TTPA 1T1JA 3ECAA 3LLSA 3CTMA 4L9WA 5TGZA 2YMPA 1M67A 2YHAA 1SY7A 3HLYA 4WDRA 5TSDA 1ZK0A 3RC7A 3DV9A 3IR5A 4QBHA 3KT6A 4H3VA 4LPKA 1W5AA 1YC5A 1VB3A 121PA 2DPXA 4KQ9A 2JI8A 2QTAA 5IG2A 1DZIA 1Q2UA 2V6BA 3LOPA 1TLTA 2XCTB 9GPBA 2PTHA 3QELA 4BEJA 4WKNA 3C3PA 5DI3B 5AW4A 4JR0A 2YMLA 4EVQA 2JVKA 2B6HA 4XXHA 3TLKA 5IKEA 1E1RA 1GFWA 2CWDA 4JAVC 4WESA 5EXPA 4YBRA 1N6OA 1XCOA 2XYQA 2X1VA 3OMXA 4KSCA 4DEXA 4XM0A 3HO8A 5LP6C 1DL5A 2YWDA 3DZIA 4N8SA 4GNRA 4PC3A 2Z98A 2FK8A 3MGCA 2CGEA 1XA4A 3R24A 2G80A 5ADVA 3O26A 4U5QA 4IIFA 3RVDA 2QBYB 3U7EB 5JRZA 3FPCA 1N8KA 4W6QA 1FTQA 4UAUA 1ULAA 3UPDA 4D8YA 1H3NA 1K06A 2RK6A 2VRNA 2YUIA 3BFJA 4POAA 5E6SA 2OYRA 4YXFA 4Y9SA 1EEHA 1THMA 4LHYA 1KVUA 4OREX 2H00A 4Y1GA 2EF0A 3GEBA 4JITA 3P4XA 3U48A 2RONA 5ES4B 2F00A 1YHYA 1WUKS 2GZAA 2DLDA 2NNWB 3HFJA 1P9WA 4J0EA 5E7JA 2Y99A 3W9YA 2YYYA 4QODA 4WLFA 1RCFA 2PNJA 2NYVA 4G09A 2ZW9A 3GEPA 1P5ZB 1QHNA 5JTUA 3SEFA 3RWMB 3MIIA 4ZI3A 3Q9LA 4QYIA 3TZKA 3K1ZA 4KWTA 2NAFA 2B3DA 5ALJA 3VSEA 4DMRA 2BCJQ 4EPRA 4JVOA 3FOFC 1XTRA 4BWFB 2X3UA 3ZHBA 5JNWA 4HWRA 4N48A 2F9FA 5CT8A 1K75A 1U1FA 4NV3A 4QXOA 4ALIA 1E8MA 4S1PA 3ROTA 4EFDA 2QN9A 2YOGA 3QEAZ 4II2A 5K20A 4QD3A 3AWIA 4YI3A 4I9GA 4DJAA 4FJ0A 4ZYLA 5JD5A 5BUQA 2X4LA 1YQTA 3M82A 3THOA 5AI5A 5AVJA 3OJLA 4L5BA 2WNIA 2L69A 4ZAZA 1JDUA 1EFCA 1OFUA 4RVNA 1KQNA 3MAGA 3HRIA 4E15A 3KNZA 1MEJA 3PDJA 1C3OB 2V5UA 1IXRC 3UFXA 2QE6A 3QTTA 4B3HA 5K99A 4MWOA 5CTAA 1U7ZA 2O2CA 3FWKA 3R5XA 2VHJA 5EXXA 4OHOA 3RRBA 2CEAA 5FB3A 1QRSA 2QRHA 4IIJB 4DKJA 4TT8A 1NURA 1OA0A 5LDDC 3GPDG 5I3ZA 3T1TA 1QMPA 1HEIA 1YR1A 4XW2A 1ONBA 3EF3A 3F46A 4TLLB 3TCXB 4PSKA 4DIDA 4BLOA 5AK3A 1G20E 4E2XA 4ES6A 3VMFA 2UVDA 3L49A 4BKQA 4JGGA 1T3TA 5BNIA 3HFRA 1N9KA 1IHOA 1Z06A 4ZA2A 5HS4A 4HZIA 3TGPA 2WDPA 3GRUA 4AMVA 1MQAA 4TV9B 3WISA 3ZGZA 4IGIA 5CJPA 2BMDA 2RBEA 3I45A 4HH0A 1QCCA 3UB2A 3U7QB 4B83A 1WA5A 3EXFA 2FETA 3FYTA 2EFGA 1OXTA 4H18A 4XWGA 4BX9A 2R44A 4LV6A 1CY1A 3I9JA 3UJ6A 2A6PA 2VF2A 2BC9A 5G1OA 3SF8B 1HYHA 3WHLA 4DG8A 3BXXA 1I7SB 3WDLA 4Q00A 1VKZA 1WKVA 3L0SA 2D7CA 3SR0A 3D4PA 1I7NA 3VO8A 1I4EB 4CF4A 1CDZA 1EP3B 2JLCA 2G40A 4G9EA 4D0RA 1UM9B 3L84A 2Q1WA 1EXNA 2ZEJA 4ZDJA 1Q1NA 3E9CA 4ZZ1A 5IDWA 4IDCA 1KF0A 2OFWA 3HC7A 4M0MA 4DLPA 1JYEA 3S68A 1J2RA 2PT5A 3ZI7A 2VDKB 3KRTA 1D2MA 2NYUA 4YP7A 3DV2A 4DRZA 5B4TA 2YWEA 3QKWA 2FR8A 4U6SA 3FWZA 1NUPA 1J8DA 1UADA 1VI5A 2ZPAA 4G0QA 4QYMA 2QGFA 4YJKA 5AHRA 5B57C 1J8QA 3ANLA 2QX6A 4U2GA 5BR4A 4G0OA 1XJWA 2QRJA 1IRXA 4HGOA 1G3QA 4ZODA 2ZXFA 5FTJA 2R25B 5FJIA 4JLVA 1UK9A 3ESQA 4MYSA 4CIDA 2QGNA 3DKKA 2EL7A 2P4SA 1YFZA 3A1VA 4F2PA 2WR8A 1PUXA 3NM6B 4NJEA 4KPUA 4P4SB 3RUPA 5E3HA 1SIOA 3B6JA 3MB5A 1ZM9A 5AR1A 1MW9X 1BMTA 2QV0A 5U4XA 4UOQA 4YQZA 4F3KA 1U5CA 2I34A 3F8SA 3O5AA 2XNDA 3HRKA 5FIUA 3OZVA 1YBHA 4N3GA 4OI2A 2VXOA 1FRQA 4CKWB 1HQYE 2KHZA 3FMOB 3HU5A 1XA0A 2DQKA 1H1TA 2E9SA 2PZGA 3AQIA 3HDQA 2FWRA 3C5EA 2EX4A 2QJRA 1DV1A 1WF3A 3USZA 2DFPA 1RC0A 1OLXA 1XP5A 2KBFA 4BV3A 4MW6A 4WLNA 1YAHA 3EE6A 3SP1A 2F55A 4MGEA 2CLKB 3K94A 3QVGA 4RADA 3U4GA 1R50A 1J0DA 1FQJA 3H42B 5BUCA 3TG8A 2FAXA 4UUNA 4LDAA 3COZA 3D8RA 5FOVA 2EBUA 3PGKA 4F4HA 1WDLA 1SHUX 4J0DA 2RGGA 3C5HA 4FYWA 1Y0BA 3ABZA 2C1ZA 5I8WA 1YRLA 5K45A 5IS2A 2PL3A 4JZKA 5DLYA 1PE0A 2Y0PA 1U9JA 3RIHA 4QHTA 2QX7A 1P2FA 4BDTA 2QYOA 3D8SA 3DE0X 4IBOA 4DNQA 2WHEA 1KI4A 2F3SA 3KDPA 4XFKA 4MV7A 2OAQ1 1E79A 2AI1A 5P21A 4AJLA 2MSDB 3E4CA 4CR8A 4BX3A 3RYIB 1SUAA 2RGUA 2AQ8A 4DLVA 1JQ5A 3IILA 1T1EA 5KTKA 4ZQCB 2JATA 5SY4A 3SKYA 4R51A 4KUEA 2TS1A 2VH1A 1SJ9A 2PVCA 1B8VA 2QAGB 1DAEA 1E1KA 1YUMA 3DS8A 3R5HA 4FMDB 4C4OA 1CQIB 4ZI7A 2IXTA 2CXPA 4YP0A 4KACA 1ZVJA 2H9IA 2DXIA 3CPHA 3W5VA 3CF6R 5ENDA 3RASA 3A4IA 4QUGA 5IARA 1W4ZA 4KIJA 2IYZA 3NYQA 1D9ZA 2HZBA 3R44A 5DCLA 4UD6A 3QJ5A 4FOSA 4OJMX 4EY4A 4FDVA 3R75A 3HCOA 1YFLA 5FI3A 3M6MD 3MBIA 1APBA 1XOIA 2ZBRA 3LQ1A 4QWWA 5I4IA 2O2IA 1HQCA 1ISGA 3IBYA 3JU3A 4DCGA 3H9UA 1X7YB 1C7RA 3G8DA 2IS2A 2Q99A 2JH3A 4S0XA 5CIWA 5HG0A 3L05A 3WWYA 3ZEAA 3HQ4O 4CCAA 4O25A 3S8EA 1PSWA 4V0MA 1E5LA 4M49A 1X87A 4MROA 1W94A 4JL5A 4RF3A 7MDHA 2VAMA 4JH0A 5FLKA 4BQOA 1ZVVA 1I2MA 4FW8A 3FOCA 4UUAA 3PHHA 3QI2A 2IHTA 3NNSA 1CUGA 4B4WA 1GAXA 2PL9A 4GXQA 2G07A 1ODTC 1Y4SA 1XDBA 2CNNA 3KPWA 4IP0A 4QICA 2JB9A 2VJOA 5KO2A 2QTVB 3PLAE 3AY3A 1O8BA 4RMJA 1VE7A 2EHJA 3BUSA 3GC6A 3WK9A 3B3AA 3U44B 3IBSA 4TYQA 2BTQB 2GBLA 3FZEA 3GHHA 4I4CA 3HM9A 3OBBA 4G2TA 1FSPA 3HI4A 1GVHA 2QB5A 5A9RA 2AJCA 4IZOA 3UXYA 4EK9A 1DXQA 3R9WA 1UH5A 3GT0A 5F64A 1DKNA 3DW3X 5KPDA 3WX0A 2FR1A 4YCCA 3G3EA 4W1SA 3PVSA 2GYUA 4PIMA 5A7GA 3ZV7A 1L5OA 3WGNA 4DCOA 1JFFB 1GO2A 4IJVA 4Y0VA 1I3LA 3IUPA 3KOOA 4Z8YA 4B3CA 4D6YA 2UYHA 1T3ZA 1DG3A 4KXYA 3TW4A 1N6NA 1TKCA 2SCUB 1N7IA 4QHSA 5EHGA 2QMOA 4AKSA 5EJEA 2QMYA 1DFGA 1XTTA 2JGLA 5DBHX 1MTOA 1IHYA 3OP4A 3ROKA 4DV6B 4UE6A 1QIJA 2XTAA 3J7TA 3WRXC 3ZGYA 4B7ZA 1KWKA 5ICEA 5FR1A 3PR2B 2EZ8A 3G7SA 3NGMA 1I32A 2WNHA 4MARA 2X0DA 4Q3NA 2W6QA 4B7XA 1U5BB 3G7UA 4PN7A 1CV2A 2MWMA 4PWYA 4ND2A 5M3BA 2W71A 4OBXA 5IN5A 4ARIA 3H1EA 2ZWMA 4M0CA 4BRSA 2WWWA 2VAWA 3KJIA 3U61B 5EXSA 4R2IA 3CF2A 5IULC 1UKAA 3JQ8B 3AETB 2H1VA 1DELA 1V3VA 2DE0X 3ANMA 2H2GA 2XZTA 3CMMA 2D0DA 4HB3A 4A5SA 3LGSA 2J32A 2GJ8A 4GZ3A 1GU1A 3FOBA 3CXUA 4IDBA 2EP5A 4MDEA 1JX6A 1V9CA 3UJPA 4MKZA 1Z22A 1F20A 3C87A 3EVDA 3GUCA 1E1QA 5E1DA 1YRAA 4NRDA 2VQEB 5DI3A 1O0BA 4NFYA 4FD3A 3DDNA 3PJRA 1YA4A 2FFAA 3LQFA 4XYBA 1Y89A 5ALDA 1Z35A 3V46A 2FG5A 1JZTA 3FWPA 3R3SA 4YRPA 1WXQA 2OK8A 3AM3A 1P0CA 4LOIA 1KSGA 3RYFB 4B8YA 4BO5A 1SUBA 1TVKB 1U31A 3BMOB 3K30A 1P17A 4L50A 4PFKA 3TMYA 3PL5A 4EDHA 2C94A 1T2VA 4LJ5A 1TCCA 2ZIVB 2QN1A 3LUFA 4BO0A 2QBYA 2O06A 2VRCA 2Q9CA 3D7NA 4Y7DA 4WUVA 1RLIA 1QS0A 1SK9A 4RK4A 2X1LA 1ZIXA 2E2WA 1I4TD 3NGLA 3RSSA 5KTPA 2BJVA 2ISCA 2WMNB 4TS4A 1BHQ1 3EHEA 4C4TA 3ILHA 2W0SA 3PNSA 4D98A 2CNWD 1WOMA 4MO2A 3CZ5A 5EMKA 3K4PA 3PGLA 1G8FA 1TECE 3M6FA 4TN1A 2L19A 3NG1A 5LXTF 1VFPA 2C4TA 2FW0A 4I5EA 1QR2A 2POQX 4MVJP 4LZZA 1XHEA 2OQRA 2P9FA 3R3JA 3IAEA 3LC7O 3PFNA 3BDIA 3AESB 2J41A 2ONYA 3CJRA 1D4ZA 1SG9A 2CZCA 1FYWA 1HM5A 1IG3A 3CNNA 3KFLA 3K6SB 3K70C 2BI8A 3NWJA 3PDCA 4LBWA 5P8WA 1LC0A 4EL0A 3ZE7A 3GFQA 1MPTA 5JZMA 2I2BA 1DQYA 3K6RA 3WNVA 3IQWA 2O57A 3DAHA 1BS1A 2AUMA 5JALA 1D7AA 3AY0A 3IAXA 1JLLB 1DO2A 1ICIA 4F4DA 3IPLA 1NE2A 3SR3A 2VBCA 1JU9A 1DPFA 2UXCB 3W34A 5BWMA 3IEIA 1G16A 3PI6A 2ZTUA 3MXOA 3AOEA 5IUJC 3FYUA 3NI2A 1PZMA 4F93B 2G8LA 1BAPA 1P7PA 2WKQA 2GILA 1J9ZA 4M0FA 4L8VA 3VR4A 4BO1A 2O0HA 3DOIA 4BMZA 1S9HA 2CHVA 1Y7PA 2PSFA 4G8DA 2V7EA 4N3BA 3P7MA 4GKKB 4RVGA 1P81A 1B6RA 4IIJA 4IQGA 1T8UA 5CM2Z 5HVNA 3UF0A 5FD8A 2HXGA 2QZSA 4YIHA 1RPNA 4LOAA 3FLBA 1U1EA 1NMSA 3SFZA 4I1SA 1UDCA 5GIOE 1H65A 4GI5A 2O2DA 1KPGA 1J8VA 2RB4A 2W6CX 4U9HS 2I3ZA 4UNPA 5K51A 3BD8A 3S44A 3C3XA 3HB5X 5JNRA 1K86A 2G77B 3T1HB 3D6TB 3KEFA 2WTEA 3I0NA 3CURA 3P4YA 3FROA 4TV9A 3U26A 3MBOA 3U7QA 3T4PA 2PT9A 3U1VA 1C9MA 2AQHA 4KEAA 4BS9A 4UVHA 4W7HA 3GWZA 4JBNA 4P5EA 4MYUA 3E9DA 4ZU1X 3SF8A 4YDSA 4LHXA 4QUAA 3N8GA 5TX7A 1W19A 4Z4GA 1ISJA 1N2GA 2LNDA 2WSYB 2IT1A 3DGFC 1UM9A 3ELYA 1OPXA 1TGYA 5TR9A 4IOMA 1X1AA 3V32A 2ZE5A 4AJ4A 3TUIC 5JJIA 3N5CA 1OHHD 3GV0A 5BSMA 1ILWA 1RQ7A 5C31A 3RB8A 4CMKA 5K6RA 2ZSAA 2XRZA 3DAFA 4KLZA 5ECWA 5BXQC 3I1JA 3U7GA 5ETJA 1KETA 4HQ0A 5B55A 1NMYA 1T6XA 2NVBA 3TINA 4EWLA 4U2BA 3P0HA 1VG0B 1ZO8A 3G2IA 3STWA 1M5RA 1X7ZB 2NZJA 4BP3A 4FB4A 1HGXA 4N5HX 2R79A 3U40A 1G0OA 1KBZA 4JASB 3AF6A 1XO1A 1AKWA 3H7IA 1QG6A 5CA0A 4HNUA 2A0UA 2DJIA 3QI7A 4JFAA 2R48A 2ZWPA 1KMMA 5AM2A 2ORED 3ZVKA 4P4SA 4ZI2A 4KVGA 3LXMA 3I4CA 3UUEA 1QK3A 3AFGA 1W36C 4JP1A 2ZANA 4V0ME 4PG5A 3QE2A 3AUSA 4RGBA 2Q28A 5CLFA 1Y9ZA 4DUZB 1G4UR 3H5TA 2B21A 5DM0A 4R8SA 3UQYS 1X0VA 5KYYB 5GAJA 2Z6AA 2ZP1A 4CKWA 4X7BA 1K6IA 3W2GA 4CCWA 5A4AA 2H2WA 2J7PA 4HTFA 4TWAA 2HLDA 4HAVA 3J7AC 3A26A 5K0TA 1PJLA 2QTLA 5LQKA 4MVJH 2WWFA 4WLEA 3UV3A 5C8YF 1WAMA 2G0AA 2G06A 1U7PA 2DUJA 2IUSA 1ZOPA 3H2YA 3HG7A 2ZJ1A 1ZMRA 1G42A 1I4LD 2O5VA 2B4QA 4J0QA 3UK2A 3LI2A 4DV4B 4R9NA 1IJFA 2P65A 3L02A 2CLDX 4I1IA 3GRCA 3ETJA 1I36A 5HOEA 2HU8A 1Y3BE 4BLRA 4OEHA 3JQBA 1A9ZA 3ND5A 2CFSA 2V96A 4K6GA 1Z8DA 4MS3B 1DQPA 3W2IA 3T1QA 3SHTA 4R2XA 3T3DA 4YCBA 4G4IA 3S0JA 2CFTA 2Q6VA 1C3JA 1G4AE 2PDAA 3E9QA 5ALYA 3KSBC 1QQBA 3JRNA 4Y18A 1HE8B 1XLVA 4RS4A 1CXZA 1F8FA 1XTJA 1ZA1A 3HEAA 3DZCA 1YK0A 1COWA 3PFHA 4RW0A 5B5SA 2Z2IA 1VJCA 1D6JA 1JHYA 3U81A 1J33A 2QX4A 3RRZA 3WRVA 4MI6A 1P1KA 3VSAA 3MHPA 2VFAA 2J5QA 4YMGA 2OCDA 1FNSA 2LE0A 2HBRA 2YNMA 1JT2A 1TO6A 4J4TA 3ZIDA 1B42A 1PX0A 4ZKDA 4ND7A 3OCVA 1CQIA 4UQLA 4Y1RB 2EGUA 2XUOA 4Q9LA 4QXQA 1YQGA 4R1TA 4X3OA 2PZEA 1J8FA 2OFFA 3RC9A 1PV2A 2WD8A 3MAJA 3TSAA 1CEXA 1ULUA 4JWKA 2WIGA 4B75A 5L6LB 4TMTA 1VCOA 3LC1O 1I01A 1YJCA 4LZJA 4REQB 1FQKA 5EP1A 4MH0R 1P9LA 3W5UA 3Q40A 1U0RA 2SBTA 2BT4A 4R3UC 3OC6A 4KMSA 4Z9FA 1UBHS 1YRQA 2BF4A 4OY3A 1JG6A 4RAOA 4JY7A 1Y33E 1SCQA 3DOHA 4QDXA 3WAGA 2FMKA 1GXSB 3DEKA 3RDPA 3RSQA 2YJTD 2BE9A 1ADBA 3C3MA 4C14A 1KPIA 4XAQA 3AKZA 1Y7LA 4BBAA 4RD4A 1PQWA 3OIUA 3KWMA 3N8DA 4ZVLA 3C4VA 4D0GA 2ZVQX 2XR1A 1BDJA 1IWOA 2I2CA 3GLIB 2G9ZA 3ETHA 4WLVA 3F5MA 1UPTA 1XN1A 5E0OA 8ADHA 4PYQA 2GPWA 2AA3A 3GVCA 3SHFA 1Y80A 2J6HA 2CHQA 4KREA 1HK7A 4LV5B 2QRPA 3LT0A 2OM6A 4ZC8A 3PPYA 4TYPA 1N5MA 2VC2B 5ITZA 4FKMA 2G17A 1E69A 2QTVA 2YVLA 4LI3X 3PP8A 2VEDA 1GYPA 1WUHS 4HNRA 4NHOA 4UAJA 1N9GA 5DTQA 1RP1A 5ULLA 4MUIA 3RTDA 3UKDA 4B3MB 1HURA 1M76A 1MH1A 1RJEA 4IS3A 1SXIA 1MVLA 2WHPB 4LJ6A 4XJTA 1NP6A 1H0KA 2FSIA 5DK4A 3R3VA 3A0UA 1ZD9A 2EFDB 3LLMA 3ORSA 5EPUA 5EYPB 4ZVTA 4PLTA 4CQNA 3ZOKA 4RTJA 2RCYA 5CLIA 3TIXB 3UMJA 3MEQA 3WYGA 4MWCA 1WTCA 1SKYE 4FOOA 1VPEA 2FV8A 1J56A 4O1IA 4G5QA 1NLZA 2D0IA 1GPBA 2IDZA 4QPZA 3FCXA 4OKSA 1SN7A 3H83A 1RM5A 4QOGA 4AIRA 1R6XA 2G1KA 4G6ZA 3G02A 1RLUA 3Q7QA 5AQEA 3CJTA 2K87A 4HVAA 4K40A 3NWBA 4TZTA 4YREA 4ZVNA 3ZLBA 1R15A 4JJGA 4F9TA 2H92A 3ENZA 3R3WA 1DC4A 1XVVA 1I2DA 4F6RB 1T4DA 2XBMA 2X1HA 4MCIA 4BO9A 3IOMA 4H35A 4GF5A 2FGKA 4LOKA 3QYFA 1Z2PX 1U5BA 3C70A 5IM4A 2FN4A 2FDCA 1NBMD 3CLVA 3D5EA 3GJ6A 1DX4A 1LLQA 3H5RA 4X6YA 1GPH1 4X8LA 4BPBA 3LQRA 3V9AA 4TXMA 1Q95A 1YDHA 1MAUA 1J25A 3OZ7A 1VYHA 2G88A 3JQ8A 1CVRA 1NJ1A 3INYA 4GGMX 4DUGD 1Y42X 2AI3A 1BXGA 1Z0AA 1ZONA 1T5SA 3F7OA 3JVVA 3LL7A 4MNTA 5FUWA 1UZNA 3D2AA 4FE7A 2HA7A 1G98A 1S2NA 1TGVA 4QOJA 3QE4A 2DFLA 3N05A 2ZBPA 2NYRA 4RVFA 1VCHA 2BGKA 3LYAA 2BM0A 2OBXA 2WIBA 4M0UA 4ND8A 3UPUA 2PZKA 3HN2A 1SQGA 5D1HA 3SGLA 1Y4ZA 2Z08A 1C30A 1TUGA 3VHRA 3W05A 1RZ3A 1IULA 1S1MA 4UTZA 3DE5X 4DPKA 4EY5A 3BRQA 3G9TA 3DH0A 5EWJB 2D0OB 2AX3A 1TTHA 1FVHA 1XZEA 3HBFA 5HPYB 2PRYA 3BIXA 3BMOA 3BREA 3WGTA 1TAUA 4NOKA 1XQXA 4HQLA 3QHPA 1HDCA 2ZRQA 3FX2A 3GGOA 1E89A 1AKVA 4QGFA 5EZYB 3LPDA 1IN6A 1I9CA 1L5QA 4AYXA 2IF2A 4JC5A 3ZCVA 2FZEA 1X1SA 4L07A 3VH1A 5LNK1 2BDUA 2WHQA 3CGWA 4KQEA 3F73A 4DMCA 4L1KA 2CXNA 1JXAA 2AYZA 4DL9A 1ZU5A 5ALTA 2WYWA 3DOOA 3GN2A 1E3QA 5U9CA 2OKCA 1IXKA 3BHIA 3KQSA 2QPTA 3JSXA 4FHEA 3ROMA 2OWDA 2R2GA 2KW5A 3CEPB 3UBTA 2BLNA 2X6TA 4GI2A 2KE5A 2CLEB 1NPTO 2PJDA 3DE3X 1DV2A 3GCXA 5KNLA 2NXNA 2WVAA 2XMDA 3FKJA 3KJZA 2PS0A 4NBKA 3TI7A 3VZPA 5JV5A 1TRKA 1F0PA 1R4MB 3BCRA 1L5GB 4P83A 4JI8B 3K6SA 2X5NA 3ZZMA 3TI9A 2XGJA 3KG2A 1QE3A 2JH9A 3G8BA 5FAXA 3DULA 3MYRA 2PGLA 3MTDA 4OGLA 2C9CA 4F60A 2P6RA 4IIYA 1R5OA 1NJ6A 1KC3A 4N5NA 2GKOA 2HQBA 4JUBA 2Q2VA 1IQ0A 3THXB 4FYHA 4LXXA 4Q7MB 1I80A 2QPLA 1JLLA 1NXXA 3QPVA 4G4GA 3OLXA 1QZ3A 4KWIA 4R41A 1FYVA 1LW7A 3UNXA 1T13A 4NXNB 4BGUA 1E4OA 2PBFA 1ISFA 2ZIZA 4NKRA 4PW0A 2JW5A 3U31A 4C7KA 1CP3A 2GBIA 1C9KA 3L7YA 3M6UA 2BTOA 3NVDA 1UJMA 3B51X 5CVVA 2DPMA 1ENYA 5EAIA 3PS9A 4C7MA 3H9JA 4GIBA 4K2AA 4NTZA 4E2WA 1M2NA 3HCRA 4M86A 1TMYA 1GFZA 3UK7A 4BVKA 2RG7A 3NVMB 1JHXA 1SQFA 7ABPA 3NYIA 4RDIA 3R0IA 5LPNA 3VI4B 3W5DA 2R5FA 1FNBA 3IUNA 4AS3A 1UP6A 2BHLA 4Z1OA 3EPJA 3CEMA 1KBOA 3VA7A 1U8YA 3DTVB 1W6RA 4I9FA 3ZCRA 5H68A 2BGWA 1FP7A 2OILA 5TVKA 3KZCA 1WD5A 4V0OA 4O0MA 5JAZA 2ZI4A 3BGWA 1UZUA 4YQEA 3IEMA 4KQ2A 2CF6A 4PSVA 3DD5A 3FDXA 3OJXA 4DOMA 4K6FA 4B46A 3C7TA 3HADA 3ZHRA 4GO1A 5SY9A 3UOWA 1Z38A 1Q74A 1PJCA 2BW0A 1XKTA 3MTJA 4D74A 3SVLA 2QR5A 3U7RA 3VDXA 4L8GA 3O3OB 2IYWA 3MUNA 1NDHA 2UVPB 4CDNA 4QPCA 2VDVE 2H1FA 3PD0A 2ZBQA 1GG8A 3V5NA 1C3EA 2PA3A 2ZYGA 1N3BA 5DPMA 2DUMA 2FSVC 3TXYA 3CYFA 4FYIA 3GJYA 5IT5A 2CD7A 3E53A 4OFXA 1H8ED 3UMVA 2A7QA 3KXDA 4FI3F 1DBVO 3GH3A 4NCNA 2XQGA 3GUZA 2A30A 3SU8A 3KQKA 2W6JA 1V47A 2YWCA 4FU0A 2AKYA 3VVCA 2GAJA 2A0XA 2OC9A 1OQAA 1ZR4A 1NY6A 4NE7A 2W2MA 3ITDA 1X86B 1X7ZA 2Q8PA 4IO1A 2P35A 2IU6A 4HGZA 4P98A 5T6MA 1U0NA 4JBGA 1YCHA 1OROA 3LC2O 1M6HA 4PRYA 4EHHA 4EHNA 5KHLB 3ZHUA 2PT6A 5HEKA 1AJEA 1X7DA 4X1YB 1JR3A 1G3UA 1VLVA 2INGX 3K15A 4U1RA 4AY4A 2AZTA 3LL4A 2AE1A 2WB2A 2VS1A 1GV0A 3P2KA 5DULA 1Y81A 4PX9A 4AM8A 4U7PB 3KAQA 1H9CA 1RHMA 2V6JA 2D6FA 1JEJA 3ECSA 2Q9UA 2C5GA 1WE2A 4Q5IA 1QRDA 2VP5A 5KYYA 3FG9A 3ANNA 1XZNA 5MHTA 3IC5A 4DRXB 1C0IA 1GG5A 3VKFA 2XDWA 1ZMOA 1GA1A 1IHPA 3E9MA 3L4BA 2BV3A 1KHTA 2JFWA 4PGFA 3WBKA 3BRWD 3HN6A 3ONVA 3JQBC 4U7DA 4MCAA 5CM9C 4Q7KA 3FNHA 1CRQA 2ISQA 2QM7A 3LBIA 3M3HA 3C3WA 3TLCA 1E7MA 1JKXA 3WGJA 3T5TA 3QE0A 3CHYA 4QATA 1I5RA 3QLVC 2QNBA 2J1LA 5E6RB 1RYHA 3TUJC 4MB2A 4NNOA 4MS3A 3RBZA 3KLPX 3NRCA 4WBNB 2HLNA 3AXSA 2BVNA 4P0PB 4KFSA 4MQ5A 3VX4A 4B4VA 3MT9A 2NUPB 4F5EA 2JGDB 4BNWA 3FUUA 5ALQA 1DWOA 4NEGA 3OLVA 3TF5A 1LI7A 2PKYX 1ZD8A 4MR8A 5CCEA 2A92A 2J0SA 1CNFA 2QAGC 3F6YA 3W5HA 1MB3A 2C3OA 2XMQA 4DR1B 3IHWA 3AJ8A 3MSXA 4EO4A 2I6QA 1LDGA 3WIOA 1KJWA 1X92A 2IV2X 4TVBA 5AUOB 5K5EA 1MR3F 3LW7A 3MRXA 4MQFA 2HA3A 4OHFA 1G63A 2G04A 3DMNA 2GNPA