5FRDA

Structure of a thermophilic esterase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
256
structure length
256
Chain Sequence
MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVEVNSVDEYAYYASESLKKTVGKAVVVGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLPEILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRNGKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELVVIPGASHMVMLEKHVEFNEALEKFLKKVGVAEVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterisation of Archaeoglobus Fulgidus Esterase Reveals a Bound Coa Molecule in the Vicinity of the Active Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE (EST-2)
total genus 107
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5frdA00
3RKSA 4RE6A 2WG1A 4OSEA 1YS1X 3STTA 3WWEA 4AN1A 1CUHA 1XKLA 1JKMA 1PFQA 3WK6A 4CG1A 4XVCA 3I2FA 1XZBA 4J0HA 1BRTA 1JJBA 1DWQA 2VT7A 1VZ3A 4EUSA 3QPAA 3UUFA 3WK9A 3EBLA 4OPMA 3G9TA 4KAFA 3QMMA 2FJ0A 4B82A 3PUHA 4UHFA 4BDSA 1MX5A 1WPXA 4OYYA 2V97A 4G4JA 4TGLA 4QDXA 1BU8A 5D3KA 5EIHA 1GZ7A 4J0GA 3D5EA 4Y2XA 4BCDA 2WLSA 5AK6A 1THTA 4FFWA 1NX9A 1QTRA 5SYNA 4X71A 3DL7A 3BF7A 1WB4A 1TIBA 3A2MA 4J0KA 3WLAA 1LPAB 3H2JA 4QWMA 2HU5A 4W1QA 4LYDA 4CI9A 5K5EA 1TRHA 2LIPA 4O08A 1Q0ZA 1FSSA 3V1MA 4DTCA 3KXPA 2WU4A 5C7YA 3JW8A 3M81A 2P8SA 2PUHA 1ZOIA 3FNBA 4RGYA 5I7UA 3D0KA 3VDXA 1YCDA 1EI9A 2ROQA 1QIHA 3AJAA 1WHTA 3ZI7A 2PU7A 2VAVA 5K3BA 3VXKA 2K2QB 4M0FA 2WIFA 2ZYHA 4AO8A 1F6WA 1CFJA 3WJ2A 2HDWA 2XMSA 2EDCA 2DQZA 4U2CA 1NU8A 4X95A 1MU0A 3WA6A 5HCUA 2FUKA 1DX4A 2QXTA 2PX6A 3FYUC 1A8SA 4P9NA 1QJ4A 4BRZA 5ALVA 4DSZA 1IUNA 4PF1A 4A5SA 1I6WA 3Q8WA 5ALSA 4Q1VA 3ESCA 3WI7A 3G0DA 1AC5A 2G4LA 3AIOA 4ZWNA 1KU0A 4X94A 3EIOA 3M82A 4KE7A 4C88A 2HRRA 3IB3A 2ONCA 5LKAA 1RP1A 4DMKA 4MYDA 5ALNA 5HQ3A 2G63A 2XT0A 2PUJA 2ZVDA 1CUXA 2G5TA 3DLTA 4J7AA 4AX4A 2DHCA 5LKRA 3FVRA 4GHWA 4AXBA 5D6OA 3MGAA 3K2IA 3H04A 4P08A 1OILA 5JD6A 1X2EA 4Y2JA 3KWJA 1AX9A 5AKJA 2WIGA 4IHAA 5ALRA 2QUAA 1ZI9A 5EHQA 1H23A 2JGLA 5JD5A 1UK8A 2ZJ7A 2H7XA 4B83A 1E5TA 3LCRA 3WK4A 3QZUA 2R8BA 1XQXA 3GUUA 4MJ3A 4X85A 3FYUB 3HZOA 2OQIA 3C8DA 2WUEA 2VAXA 3OM8A 4PNZA 2C5GA 5CBKA 2GYWA 5CH3A 1WOMA 4N5IX 1QIDA 5AM4A 4Y9SA 4J3JA 4W9RA 4IO0A 4X6XA 3NWOA 4BB0A 1QFSA 1R9MA 1Q0RA 3O4HA 1GPKA 5E2IA 1B41A 1DT3A 5AOAA 5ALMA 2OCLA 4I3FA 3RM3A 3IA2A 1LPNA 3PICA 2QKYA 3AZOA 4UUQA 2BGRA 1CR6A 2AJLI 5ALGA 4V2IA 4ZV7A 5T4BA 3FLEA 2XUDA 1O6GA 1DQZA 3L1IA 4MQMA 2WFZA 4X6YA 4UFPA 5D3ZA 2AJBA 3E0XA 3W2TA 4BC1A 1EB8A 1XLUA 4QLOA 5A2GA 5JANA 5KREA 2XUFA 3Q0TA 1K63A 3PF8A 1EH5A 4G8DA 3BDIA 3D4LA 4XWGA 3OTQA 3BDVA 3HXKA 2HU8A 4UFOA 4OCZA 4UBIA 3ZV7A 4FNMA 2Y6UA 2GYVA 1Z68A 4BAUA 3F97A 1CUBA 2GZSA 2GBGA 4YK7A 4EHBA 2PVSA 3O4GA 1CUUA 4MQLA 3OG9A 3I2KA 5AI0A 4BTLA 3ZLTA 2X5XA 2PSJA 5AM2A 1E8MA 2PL5A 3FVTA 5LZ7A 4JNCA 3I6YA 1MX9A 1DTEA 1ZICA 2XMCA 4LHEA 2BCEA 4N8DA 4A23A 3V9AA 3G0GA 2CEKA 2HA3A 1UFOA 1IMJA 5D7BA 1QE3A 3AZQA 1T4MA 3WZLA 4XIIA 4F21A 5ALWA 3LP5A 5DWDA 5H3HA 1ODCA 1XQVA 4GLBA 5LZ2A 3STWA 4FLFA 5K3EA 1BEZA 4H0CA 4N5HX 1QIEA 4E14A 3EF3A 5JIBA 3K9BA 5J3JA 2PSHA 2JGJA 1FFEA 5LZ9A 1C7IA 2VJAA 2JEYA 5EIAA 1ZD5A 2Y2VA 5ALJA 1HDEA 4WFJA 5AKGA 3K6KA 3T52A 2O2HA 3W9UA 4KYVA 1LZKA 4OB8A 1QONA 3O0DA 2VJCA 1MO2A 1WCYA 1EDBA 3DS8A 1GXSA 3WZMA 1BCSA 4G4GA 1BROA 3WL8A 1EK2A 5CT5A 1R1DA 3V48A 2WKWA 4MWTA 4NS4A 1EDEA 3R3WA 4QLAA 4UHEA 5A7GA 1YS2X 3HC7A 3W04A 3N0TA 4H7KA 5ALOA 4X7BA 2OQVA 1TK3A 5C81A 2EEPA 2WG0A 3PE6A 4EB0A 3DCNA 3G0IA 1QIJA 1UKBA 3G7NA 1X2BA 4FHZA 4KE6A 1XRMA 1YASA 2DSNA 3N2ZB 3IVMA 3G9XA 2Q0XA 5A71A 2ZYRA 1CUSA 1Y7IA 3VVMA 5BWBA 2RI6A 3G9UA 5ALUA 1XZHA 5IKXA 4QE3A 2W22A 1MT3A 2YYSA 2Z5GA 5CTAA 4J0CA 1SCKA 4FDMA 4QDOA 5FOQA 2HA5A 4Q82A 3U1TA 1DT5A 5AK5A 2CKMA 2OCIA 4OB6A 4UBOA 5JASA 3G9ZA 4BZWA 4EBBA 4X93A 4WCVA 3DNMA 2WTMA 4IH1A 2WHRA 3C70A 1BN6A 1LLFA 1CUCA 1EX9A 5CXUA 3R3XA 1XRPA 1MAAA 2XUOA 5DJ5A 4BCBA 4FOLA 3I28A 4AMZA 3WK7A 4DNPA 2JIDA 5BV7A 3WK8A 2QVBA 1HQDA 3O4JA 2BGNA 2WFMA 1QIMA 1CQWA 3I2HA 4ZXFA 1L7RA 1EA5A 3NUZA 2X8BA 1CVLA 4GEGA 1R9NA 3WKAA 3SK0A 1GKKA 4H7IA 1ZD3A 3OURA 4QWWA 2CB9A 4B85A 4BBZA 1G4HA 1WPRA 3VJMA 1OXMA 2PPLA 4HXFB 5AICA 4Y2RA 1VE7A 4IH4A 2OCGA 5HKBA 5CXXA 3BIXA 1LNSA 1VKHA 2XMRA 4KJXA 3O4IA 2HA2A 4U2GA 2O2IA 4S0XA 4B84A 5LZ4A 4B81A 1AURA 1K5PA 3WKBA 1MN6A 2ZJFA 2EDAA 1GPNA 2I3ZA 5JARA 2WTNA 4DLNA 1XZJA 4DNFA 4JYMA 1JMYA 4H7JA 4AO7A 2JBWA 4C89A 4H77A 1N5RA 4C4ZA 2HFJA 4RPCA 3R3UA 4D9JA 1R88A 4BVJA 3L1HA 2HA4A 2OGZA 5DYWA 3A2NA 1MTZA 1QGED 2VSQA 4G4IA 2DHEA 1LPOA 4X91A 4BVKA 4P92A 1F0PA 1CUZA 2WFLB 4IQ4A 1LZLA 3IDAA 2PSEA 4Y2UA 3NGMA 2GYUA 5A6VA 2DHDA 3B3QA 3R3VA 3R0VA 1XZMA 1AGYA 2WFLA 4H7HA 3RLIA 5AKEA 4PSUA 1JU4A 1VA4A 4GW3A 3FBWA 4GXNA 4ITVA 3OC0A 4EA6A 3DEAA 2ORYA 1YSCA 4QDUA 5AO9A 2XUJA 3MVEA 3W06A 4X90A 4CIAA 5AIBA 5AKIA 1K8QA 5CT6A 2OAGA 5T4EA 2WIDA 1CIJA 5EHNA 2IIVA 4C6HA 3E4DA 2QRUA 4PQEA 2XLCA 2VA9A 4PW0A 4CCWA 5T4HA 1F0NA 5BOVA 3GFFA 4CG2A 3LS2A 5HFAA 2QT9A 4KR0A 1ODTC 5C8VA 2VEOA 1P0PA 1C7JA 4UBMA 5HQ3B 1L7AA 1PV1A 1CRLA 5HF9A 3ESBA 2XMQA 5K3CA 1FFDA 1YAHA 3AZPA 3F98A 2UZ0A 3GROA 4MWSA 5AKKA 3YASA 2DCMA 4BE4A 1D07A 2VJDA 4H18A 5ALIA 3SC2A 2PSDA 4GBGA 2WQZA 2WIJA 1XRLA 3MUNA 5AHXA 3WWDA 3SWWA 1KU6A 1AUOA 1J1IA 4BAGA 1VZ2A 4LXHA 1RYYA 2JEZA 1E3QA 1X70A 3F8SA 1VOTA 3ANSA 3PUIA 3O9MA 2HM7A 4WDRA 1JMKC 3M3DA 2GZRA 3WYDA 4EY4A 4OUKX 4J0DA 2WU3A 1YB6A 3FCXA 1QIKA 5IVHA 2HA7A 1ZD4A 4BAZA 4H7EA 2VF2A 3R3ZA 4MXDA 4BTVA 4OB7A 2RHWA 5FV4A 2HRQA 4BZZA 3GELA 4Y2SA 3X3HA 4QEKA 2XUKA 1LPBB 2XLBA 2CJPA 1TCBA 3H18A 4OU4A 1YB7A 5HK9A 1TKRA 4UBNA 5AJHA 1THGA 3B5EA 1XROA 1CUDA 4K6KA 3HJUA 3C87A 1ZI6A 1XLVA 1SOMA 2B9VA 5FPPA 3ESAA 5IH7A 4W1SA 5SYMA 2QJWA 4EY6A 2CZQA 1W6RA 2AXEA 4UBJA 3BL8A 4Y2QA 1XZGA 5AP9A 1ZIXA 1P0IA 3PFBA 4Y2VA 4U2BA 1GGVA 4OD0A 4RE5A 4Q05A 4CCYA 4GDMA 3C6YA 2J4CA 1UXOA 1XZLA 4JH0A 1XZFA 5JADA 3DOIA 2WHPB 4LXGA 2H7CA 1HL7A 1UZAA 3OOSA 4RNCA 5JAUA 3WWCA 1QO9A 5AI5A 1A7UA 1ZJ5A 2HHAA 1ACJA 4KE9A 4J03A 4LKOA 3EQ8A 1ACLA 4WFIA 4QDTA 2WUGA 5CW2A 4HXEB 1W76A 1W4LA 4X3CA 1UWCA 1SCQA 5CH5A 3C45A 3HI4A 1LPSA 1P0QA 4B80A 2XUPA 3QYJA 5DNVA 3D7RA 3FSGD 5AKLA 3ZLVA 1WB5A 4G8CA 4W1PA 5AKYA 3RK4A 2XQGA 5LIPA 3DOHA 3BXPA 3LIPA 3STUA 2ZYSA 5BWCA 3STYA 3C6ZA 3HSSA 3F96A 4BP9A 1BE0A 1UOPA 3WKEA 3E1GA 1UOQA 6YASA 2QMQA 2PM8A 2VATA 2J3QA 3QITA 3BIWA 3WIOA 3U0VA 5CMLA 4TPKA 2ACKA 3WL5A 1EINA 1MAHA 4PSCA 1XRRA 3VJKA 4UHBA 1JJIA 5JATA 2H1IA 4AB1A 5AM3A 1XZEA 1UKAA 4Q3KA 3QVMA 5ALLA 3AINA 1AZWA 3FSGA 5HF8A 4G8BA 4EY8A 5DNUA 1XQWA 4B9AA 5ALZA 4K6GA 4PSDA 3R41A 5AK4A 1J2EA 2IITA 3RARA 2C58A 3KWFA 1N1MA 5FXMA 4EY7A 1JFRA 5YASA 3W9BA 2E3JA 1E89A 3WL7A 4QDZA 1W52X 3WQHA 3I6MA 2Y1KA 1VXRA 2OAEA 5ALYA 1SFRA 4UHDA 4FMPA 3FAKA 3BWXA 5HFNA 5FP0A 3BJRA 3V1LA 3DYIA 5IVDA 4Y2TA 1N8SA 1UOOA 2CMFA 1CUGA 4U2FA 3P2MA 5LZ5A 3PI6A 3QM1A 3L1JA 2V98A 1EB9A 3I1IA 5ALQA 1W1IA 5A62A 3QPDA 2WG2A 1A8QA 1DWPA 1VLQA 4GWLA 4Q34A 5CH8A 1DINA 3H19A 4K2AA 3H0CA 5ALTA 5ALXA 5HK8A 1DQYA 2DFPA 4FFVA 4DIUA 2BUBA 4E15A 5HZGA 3QBJA 5ESRA 5K3FA 4UBKA 4UPDA 1MNAA 5JZBA 3QMWA 4JYPA 4OYLA 3MUOA 2AJ8A 1QOZA 5IVKA 5KWJA 5CURA 5FDFA 2JF0A 4E46A 2GBCA 1YAJA 1EXWA 1E8DA 3EQ9A 5AKXA 5DYYA 2XDWA 1AMNA 5EHXA 4UBLA 4DM7A 3STVA 4FBMA 4C01A 2OG1A 2OXEA 5EIEA 2ACEA 2Y6VA 4PV7A 2J4FA 5ALHA 1W75A 3A6ZA 2YASA 1ORVA 1QO7A 2B20A 3IBTA 3ICWA 3IURA 4FNGA 4NMWA 5AKHA 2BFNA 1CUIA 1ZIYA 4QZVA 4MEBA 4X6UA 4Y2PA 3IUMA 3IUJA 1FFCA 2XUQA 2OGSA 4BRSA 1G42A 3S2ZA 4U2EA 1BS9A 2PSFA 1HLGA 2PU5A 1XZDA 3E3AA 4YX9A 1JU3A 3AIKA 3F9CA 4Q3OA 3KOOA 4JEIA 3ESDA 5K3DA 3DJYA 2QJRA 1VXOA 3IIIA 1QIGA 1CLEA 4X97A 3F67A 1ZGCA 1UT6A 4G9GA 5JAOA 3DKRA 3M83A 1MNQA 3C6XA 1HKHA 3DQZA 5A7HA 5AM0A 5CRIA 4ARBA 3FCYA 2WIKA 3D3NA 2VT6A 4ZI5A 1TAHA 1USWA 2OLEA 4N8SA 2G5PA 1G66A 1TCAA 1A8UA 1P0MA 4JUIA 4OU5A 4J0IA 5ALDA 5DLPA 3V1KA 4QNNA 1MPXA 3G8YA 1CUAA 2HIHA 1LPMA 3H2IA 4A16A 3D2AA 1CUFA 3A70A 1T2NA 4I19A 4KEAA 3ANTA 1QIFA 5A7FA 2RGUA 3CXUA 3VVLA 4AZ0A 1EVQA 2O7RA 3STXA 2JGEA 3WYNA 4YPVA 4MEAA 3R40A 5AH0A 5E4YA 2WJ6A 1IUPA 1WB6A 3CN7A 5AM5A 2Z8XA 2RAUA 4FWBA 3WMRA 1SC9A 3R3YA 2WILA 1QFMA 1CV2A 1TCCA 2C0QA 4DNQA 1BCRA 3A2LA 4XJVA 4F0JA 3G0CA 4KAAA 3LIIA 4Q3LA 1R3DA 2O7VA 4GECA 4H35A 4AN0A 4LYEA 3D2BA 2QS9A 5E4JA 1J06A 2BUAA 1UK9A 4DMCA 1FFBA 5FUMA 1JT2A 2OCKA 4LIPD 4AMYA 2VJBA 4Z49A 2XMGA 4L0CA 1EDDA 3FWHA 1GT6A 4L72A 1WM1A 5K3FB 3ZLUA 3PF9A 1Q84A 3CN9A 4DGQA 2HL6A 4DMHA 4NVRA 1XQYA 1ODSA 1Y7HA 1GQSA 4I4CA 3SX4A 5FRDA 4U2DA 5AI8A 3I2GA 4C87A 1K4YA 2V9ZA 3JYHA 2D5LA 1CUYA 2BKLA 4IH9A 5AI4A 4L9AA 4FLEA 1G5FA 2ECFA 2JGMA 5JZ9A 1H2WA 3KSRA 1B6GA 2ZYIA 2XQKA 3GA7A 3D59A 2HA6A 3D2CA 2AJCA 1XRQA 2NW6A 1U8EA 3S8YA 1AKNA 5JAHA 3VKFA 4WJLA 1AQLA 3OPMA 1H2XA 1M33A 1QZ3A 4FLMA 3UUEA 3CCCA 2W6CX 3I2JA 5F4ZA 5KBYA 1OCEA 2HA0A 5T4FA 1R4ZA 1EVEA 2RONA 4WY5A 4W1RA 2XQFA 2XMDA 1LPPA 1L7QA 5AOBA 3IUNA 2WHPA 3HLKA 1CUWA 5FPQA 1J07A 1LGYA 1BEEA 1XFDA 2Z3WA 5FKJA 1GPLA 4KACA 4BCCA 5JZSA 3AIMA 5CT4A 1MJ5A 4FBLA 1VJ5A 5DYTA 2BJHA 3TJMA 4HXGA 1CUJA 3DD5A 5JALA 4ZGBA 5HF5A 1DWOA 3BE8A 4LXIA 2VTVA 2DR0A 2RIPA 3LLCA 5EHZA 1H2YA 1CUEA 3B12A 2WHQA 2ZSIA 2CBGA 1FFAA 2OPHA 4G5XA 3AFIA 3H2GA 2I03A 1HPLA 3VISA 1PJAA 5AKZA 5AK3A 4E11A 4CIBA 4FTWA 4WDQA 2FJPA 3C43A 3WKCA 4B0OA 4AQDA 2WUFA 1A88A 3C6BA 1XLWA 4H7FA 1ETHA 4Y7DA 3KDAA 4TVKA 2JGIA 4ROTA 3TGLA 4KRYA 1XKTA 4UFNA 4NZZA 2ZSHA 2C5FA 4HTAA 4C4XA 5AOCA 5JD4A 5AIAA 3NOXA 1XZIA 3WK5A 4B6GA 1U2EA 3ICVA 2XE4A 5CT8A 4B9EA 3ED1A 1JI3A 1LBSA 2QZPA 1XZCA 2WUDA 2FX5A 5JAPA 3C5VA 4J0JA 1ZJ4A 4HRYA 4HVTA 1UK6A 4H7DA 5FLKA 3H1AA 3PFCA 1QTIA 1ZI8A 2OGTA 4DYHA 2XMZA 3WL6A 4BP8A 2RHTA 2XUIA 5ISMA 2H9YA 2O2GA 2WJ3A 3JWEA 1RWQA 2BUCA 2YXPX 5JYCA 4WY8A 4BVLA 4UHCA 4F60A 2QOEA 2XUGA 1YA8A 2ZJ6A 3DL4A 1UKCA 1JJFA 3C5WP 2QUBA 2C7BA 4CCYB 4YASA 3GZJA 3ZPXA 2C4HA 2J3DA 5HF6A 3H2KA 1QIIA 5ALPA 3TRDA 5E4TA 3GBSA 1YA4A 1UK7A 2XUHA 4HAIA 1IZ8A 3WWPA 1IVYA 2QXUA 1Q83A 2XI4A 2XQIA 4KE8A 1ZGBA 1TQHA 2XMBA 3DKKA 2PBLA 1H2ZA 5HKAA 4ZRDA 2Y2UA 4ETWA 3WIBA 2Z8ZA 1EHYA 4L3WA 1FJ2A 3ILSA 4X00A 4X92A 3HACA 5DNWA 1R50A 5KWIA 3FYUA 5AM1A 2I78A 2XQJA 3DYVA 5EGNA 4INZA 1U65A 1WHSA 4GI1A 3G02A 2WJ4A 4M0MA 5IVIA 3FLBA 2R11A 4QA9A 3AUKA 1GQRA 3WJ1A 2JGFA 1YR2A 2AJDA 2PKYX 4HRXA 1F8UA 4DSAA 5C8ZA 2B61A 5DTJA 1QLWA 1VE6A 2H7YA 2VQ6A 4G9EA 2YH2A 2D0DA 3PDCA 5ALKA 2GBFA 1ORWA 4BDTA 3WWOA 4KAJA 3I6ZA 3O9VA 3QMVA 3ZWQA 4AZ3A 4DMFA 3WKDA 1GKLA 4N8EA 3CCBA 5AI9A 1DX6A 3I1YA 1MX1A 2DQYA 1ISPA 5DTIA 3FLAA 1H22A 1N5MA 4KRXA 4EZIA 1KEZA 5LZ8A 1SCIA 5C8XA 4K6HA 5CT9A 1E8NA 4ARAA 2ES4A 3TEJA 3C8HA 3W05A 2BAGA 3HRHA 4K5QA 3G0BA 4B7ZA 1O6FA 4CG3A 1ZD2P 1Y37A 1LBTA 5ALFA 4BC0A 4F5ZA 2HADA 5EI5A 4P93A 1XZKA 3QPCA 1NU6A 4W63A 1C4XA 3I2IA 5K3AA 4FKBA 5LP1A 4C4YA 2HFKA 5ALEA 2X76A 4DNOA 1CEXA 1IUOA 1IZ7A 4BATA 2I3DA 3QH4A 1VA5A 3IUQA 2WM2A 3FYTA 5I8PA 3KD2A 3WA7A 4EY5A 5LLSA 3H17A 5I9IA 1E66A 3BF8A 4BYMA 2QTBA 3HABA 1CPYA 5EFZA 2C0PA 4CFSA 3HYSA 4XX1A 3H1BA 4HS9A 1U4NA 2B4KA 1S8OA 5AI6A 4PO3X 2Z3ZA 3VJLA 1EK1A 3HEAA 2QM0A 2QR5A 2XB6A 3O95A 4WFKA 3H2HA 3V1NA 3IULA 4G1FA 4AO6A 2CUTA 1XZAA 4BE9A 2HU7A 5LYYA 3EQ7A 4ZV9A 4MYSA 4M0EA 1BN7A 4HZGA 1K6EA 3T4UA 1XRNA 2V96A 3DDUA 1DU4A 2WSLA 4UHHA 3AILA 1CQZA 3FOBA 4ZREA 4B0PA 2GBIA 2JGKA 3BJMA 4Y2YA 2IX9A 1CUVA 1HBJA 3UMJA 2XUAA 7YASA
chains in the Genus database with same CATH superfamily
3IALA 2HO4A 1WCIA 4ZEWA 4AY2A 3JQQA 1ZINA 1Y5LA 1SVNA 3KELA 5MGBA 3IHKA 3EC2A 3RKSA 3WIUA 4F4JA 3PD0A 4B6PA 2FPIB 3ZZTA 1YDGA 1ZN9A 2C04A 1CB0A 3ETJA 4OSEA 3EXHC 3STTA 3R9XB 2ODBA 3H2BA 4TVOA 5LQNA 3E5NA 1ZKMA 3RVBA 2AMFA 2DYKA 1GZUA 1KIFA 1O94D 1Z6PA 1WY7A 2N42A 1VYHA 3WK6A 1T9AA 3HXPA 3AVTA 1U28C 3G1TA 5A2QA 3GMSA 4DBZA 1E98A 1SQ6A 1S9HA 4G09A 2ZAMA 4CMJA 4ZODA 1DKUA 3QUTA 3FNEA 1E1RD 5J4LA 4F9FA 1W1UA 2B82A 4Q9KA 5DP2A 2GBLA 1XP8A 3D3WA 4D82A 5ERGB 3RIXA 1V8ZA 3WK9A 3BCSA 3PWKA 4OPMA 2WB2A 4MI1A 3MCZA 1SAYA 1Z0IA 1ST3A 1TF2A 3BMNB 3FE2A 1UH5A 4DS3A 4BJ3A 2OZVA 3LWZA 4DV4B 1GR0A 1IJFA 3UO8B 2XCLA 2CLMB 3TMKA 4L2IB 4Q1AA 4JQYA 1WPXA 4OYYA 4LBVA 4BLRA 4BMSA 4YJFB 3TR5A 1XVTA 5KYWA 3DKIA 2YS6A 4G0YA 4TLBA 1Q1BA 2R1UA 5EJMA 4GP7A 4GVXA 2AWNA 3QHAA 5J58A 4FW9A 3IDSA 1HT3A 2FQYA 1WMDA 1EFTA 3AO0B 2Z6UA 1RRPA 5EIHA 4RYDA 1D1PA 2YHAA 3NIGB 4AZTA 1OI4A 3LLSA 4E5MA 5IAEA 3KVYA 3AB3A 4Y2XA 3ZDZB 4PAWA 2P9YA 3UAZA 3DC7A 3TX6A 2WLSA 1NOIA 4BCDA 4DLBA 3JU3A 1JL3A 3FZQA 4K3UA 4A73A 4LFCB 4FFWA 3BIFA 1QTRA 2RJ3A 3EB9A 5CVVA 1TM1E 3A9WA 5SYNA 4CGYA 5JI3E 2IYNA 1ZVVA 5KQSA 1TUEA 4XAQA 2PJUA 2OB2A 5DGXA 3VDRA 1V8FA 2HY7A 4LQDA 2A3NA 4B3BA 1SUCA 4FDVA 4QBGB 2VHQA 5K3OA 1E7YA 3UAXA 2OP0A 1TIBA 3I4FA 4N7RA 4EB8A 2YWGA 3UHAA 1HOXA 2IDMA 2W48A 4W1QA 1OC4A 2I9PA 3AFGA 2JD2A 3BJEA 1YBHA 4OG2A 3EOBI 1Z0DA 3PU6A 2I2FA 3UAWA 2LIPA 3RLFA 2REOA 3UWKA 3QE4A 2CVPA 4YA6A 1W5FA 2QSZA 1SHZA 2CYAA 2V0CA 2WU4A 2ZCVA 3BGIA 4IYJA 4B2LA 4DTCA 4EYEA 1I7SB 3WGIA 3JW8A 3TTUA 2G6BA 1SQSA 2ACVA 4CR7A 4QYIB 4OX9Y 2P8SA 1RNLA 3FNBA 2PRYA 4YDHB 2DWQA 1NSTA 3MFYA 4MITA 3S8MA 5I7UA 2FKNA 3EWAA 3GRCA 3D0KA 3I5UA 1OXVA 3A9SA 1PG5A 4I50A 1ECJA 2X41A 3VH1A 2BSAA 1UM8A 1WHTA 3ND9A 5GJBA 5JZMA 4Y6GB 5MGNA 2X86A 5KKCA 2BI7A 1NF3A 3O21A 3S7ZA 4TV9B 4GQIA 2PU7A 5KI6A 3C1AA 1RAEA 3ABQB 4L8YA 1A2QA 4PR3A 2Z5VA 3ZKAA 3HKCB 1HM5A 3JD2A 1OI2A 4GMFA 3HXOA 2DR3A 3TFOA 4K9SA 1NZDA 3W77A 4AO8A 4CIWA 1F6WA 5EJ5A 1Z5OA 2HDWA 2B35A 3I9NA 3IV9A 4M9UA 4XUDA 5TR9A 1S5PA 4ABYA 2Z2JA 4BEVA 3D6JA 1H2AS 2PUWA 1QH1A 4GXTA 4EFKA 3DMRA 1JZQA 4X95A 5I7RA 3ZJUA 4RL4A 3R0JA 1F0KA 5A0FA 1MU0A 3AJDA 4GPIB 1QPZA 2DBRA 5DYIA 3WA6A 3RW9A 4R68A 3N5KA 2DEUA 2B4RO 3VZSA 2XD9A 4ZOQI 1DX4A 1EX6A 4V0NA 2A86A 4ND1A 4MSUA 4D98A 2Q3LA 1IDN1 2FEPA 2XD4A 1PT6A 4Q00A 4P9NA 3ZN2A 1BWSA 3C5HA 1Z4IA 5C8YB 2J9ZB 3PCXA 1JSLA 4RF3A 4ENPA 4AURA 1MZPA 4L7QA 1QGOA 4WSOA 5ARCA 1RLTA 1CKEA 2OGUA 2J08A 1BX3A 1N6HA 1Q0PA 4TV8A 4HOYA 3RFFA 1EGHA 3ESCA 1OROA 2PRIA 4PG6A 3LQYA 4MRNA 1AC5A 4EG6A 1CJUC 2WWFA 3RV3A 4FZ3A 3SYRA 4FBGA 1GKUB 3JQCA 4RD0A 5G0WA 4ZWNA 5EJ7A 3VKHA 1HV8A 1YE3A 3BILA 3Q9SA 3LFHA 1NYQA 4IDOA 3DL2A 3BCRA 5HE9A 5C35A 1OT5A 5CXQA 1JJ7A 4MEJA 2HRRA 3EZNA 3SKVA 3W4JA 5DRYA 1HSZA 3V42A 2C3MA 4AD8A 2PGLA 1PCXA 1E2KA 2ZBGA 4NENA 1V8PA 4RCZA 4DMKA 4WKPA 1I32A 2Q6LA 5ALNA 4WBNB 1PJ8A 1JVNA 1THZA 1GAQA 1NFRA 1QYVA 1PDVA 3AUAA 3EG9B 3SD7A 5CCEA 4FFLA 4Q93A 2BGWA 1JAYA 2CNLA 1GTMA 2ZVDA 5G3ZA 1N57A 5JWOA 5KS2A 5FV7A 1U3WA 3U40A 1GVNB 4DXDA 2LCQA 4X64B 1OH5A 1AQUA 2AFVA 3IFSA 4YRBA 4K9QA 4F9TA 4N5NA 1JS1X 2O5VA 4L1KA 1M54A 3IAUA 1TJ5A 4JBHA 2PLNA 4IOJA 3DLTA 4J7AA 3OPQA 3CZQA 4AX4A 4WCFB 4KFTA 4MPTA 3ASVA 1AN0A 1CW2B 1UDAA 4TTQA 5KQPA 3HSKA 3P20A 5GZ6A 3W5JA 2UUCB 4B45A 3DEKA 4AXBA 4CQNA 3LUAA 5D6OA 1B0AA 1ZUNB 5KTTA 3K2IA 3C6QA 3LJKA 1A8HA 2ERXA 4HNHA 5EY5B 4PC3A 1BA2A 1ZCAA 3F78A 5JD6A 3T9AA 1A72A 1XCMA 1RHRA 3D9QX 3AVPA 4R8LA 4XYEA 3QRWA 3QVGA 3R75A 2XA9A 4CUJA 3D6HA 2Q0QA 4NAVA 3KK0A 3KWJA 4UDOA 5AT1A 3O3CA 1IB0A 4E21A 2H92A 1JFSA 4IHAA 1LS6A 2QUAA 5ALRA 2AMJA 4AY5A 4MHTA 2JGLA 4J7CA 2FPXA 4OL9A 1UK8A 5DW0A 1UJMA 3ZDEA 5JEEA 4U7WA 3UG6A 5I4CA 5CIYA 1TM5E 1GV0A 2A6PA 2PWZA 4B83A 1E5TA 3LCRA 2IPXA 4QLBA 1VRCA 4HP8A 2AOTA 1GG9A 4FEEA 3GUUA 4MJ3A 2JEOA 4X85A 1UJNA 3LT4A 1GZ4A 4BMZA 5CPFA 2P9FA 4WLVA 3U4CA 4II3A 4RAQA 3HUTA 1RKXA 2WTEA 3GRKA 4PHTA 2KPOA 2IXAA 4IQFA 2BHNA 3C8DA 2WUEA 2GCIA 5EFOA 4CN8A 1Z56C 3DMNA 3RU9A 3ELUA 4AAYA 3NHJA 1UPTA 1XNHA 4B6EA 5JW6A 4P4TA 2H5JA 1AKTA 1J2JA 1GGKA 1BXRB 3HY6A 3NTUA 4HH0A 5M3BA 4N5IX 1ZAYA 2NSYA 3GJ4A 1W581 5ELLA 2BEJA 1V5EA 4GOND 4Y9SA 2PGDA 3P27A 3DPSA 4NAHA 5F7ZA 3IRUA 1T0BA 3SF8A 2P4HX 3NWOA 4PY2A 2BZSA 2DCUA 1B8UA 2AWOA 2IU0A 1L4LA 1VCMA 4UEQA 2WWVD 1RACA 3SXJA 3UEOA 2CLDX 1CHNA 1Q14A 3ML1A 4KKVA 1C4KA 4OYRA 4WXYB 3AY3A 5AXCA 2JVKA 3LPNA 1NI3A 4EG4A 2OCLA 4A9AA 2DJ5A 2SNIE 4LF7B 1PQYA 1PDWA 1ODLA 2BZGA 3QOFA 1H42A 3HY3A 4J9VA 3OTOB 4Y1EA 1HNZB 3UFXA 3PEYA 2XCSB 3ZKWA 2D2IA 4UE2A 1X1SA 1TTTA 4YRMA 4Q9JA 2IFTA 4TT8A 2WWIA 5E9AA 1ZY2A 2RAFA 5IJ0A 4BBAA 3BQ9A 4G9BA 1QDUA 9GPBA 3W2EA 2WSIA 5LQDA 5DSTA 4ZV7A 2W2VA 4G67A 4AJKA 4EUHA 1RIIA 3V2HA 1ZONA 1QRUA 3FLEA 5CFOA 3UB2A 1NNI1 1W29A 2VZEA 3AT1A 2HMYB 1O6GA 4B3HA 5ITWA 1PL6A 3H4IA 3P2OA 4JS0A 5A4JA 1FRQA 2HDNB 1L1EA 3HCRA 2H4ZA 4OQQA 5FBZA 4N7MA 4DA9A 1JHXA 1XCJA 1B15A 4MTLA 2ODWA 4XFDA 3DTNA 4FYMA 2PQ0A 4M9QA 2ZU0C 2GXSA 1ADCA 1XLUA 4WOBA 4NOKA 2N9UA 5E0OA 5JANA 4B3RB 4HAZA 1W96A 1JSRA 1Z62A 3ORSA 3BDAA 4NV1A 2C1XA 2R1VB 3Q0TA 2C4VA 3EISA 4NCJA 1IBMB 2YZGA 1E9FA 3BDIA 4NQRA 2DC1A 5DXAA 3DCIA 4MWGA 4WZAB 3ZW9A 1Q1EA 2NV2B 1YUMA 5EPUA 5HIJA 4DA7A 1PR0A 4J29A 4HY3A 3R5SA 1RI2A 2JIBA 3RIEA 3UA3A 4HB0A 1RRGA 3KQOA 4EGSA 6PFKA 3UNXA 1KTVA 1EFDN 4MK4A 3Q9UA 3B1KA 4I1VA 4I1OA 3KP1A 4NIMA 1R0ZA 4DSOA 4UFOA 3OOWA 1LDBA 3N2IA 2A67A 4M2LA 4EDFA 4UTRA 4UBIA 4ZQHA 1QCZA 2R6JA 1E2JA 1RW4A 1GG5A 2VQFB 1Z68A 1H9CA 1O96A 3ZYCA 3NORA 8GPBA 1Q57A 4FOSA 1CUBA 1M8FA 1QVAA 3LC0A 4YK7A 3KETA 2HLNA 1SVUA 1JVSA 3ITDA 2V54A 2IHTA 4MO9A 5ILQA 4BFVA 4ZCPA 5KJEA 2QJFA 2EP7A 3PNPA 4ODIA 5KSWB 3THWB 4M3NA 2EQBA 4EHAA 2C7PA 4ZKEA 4LQLA 2X5XA 1VHWA 1L5VA 3IPYA 2JJ8A 2C8KA 3I53A 3RYIB 3DT9A 3PWSA 2B99A 2CNWA 4HL6A 4F11A 1EYZA 1UXJA 2H1CA 2V3VA 5LZ7A 2JBAA 2RK4A 1MX9A 4ZOLB 5LMZA 1DZ3A 1VL1A 2C2ZA 3L7LA 1L4KA 1QNFA 3MTDA 2XMCA 4LHEA 3R9IA 3RJZA 1JTVA 3LPAA 3K15A 4ZU1X 4OGFA 2C59A 4A23A 2EF1A 1R6UA 1E2PA 1RWVA 2FWPA 3AM5A 3G0GA 3GRUA 4PLPA 2HA3A 1RKQA 2QAGB 4RVFA 4F86A 4RABA 2O5CA 1A4XA 3OMLA 3OJLA 3JTEA 4DZTA 1OB5A 5JQGA 2YZMA 3VVCA 2ATVA 5K8JB 4BEBA 1SMKA 1U0JA 1X9IA 1ZGZA 3AU9A 5HBRA 3JZMA 1JDBC 1IY8A 3FIJA 4OATA 1OBOA 1XK7A 2IEZA 3IEUA 4D3FA 1Y1TA 3AYZB 2GXAA 1IVNA 2JGDA 1AE1A 5BUQA 2CDAA 1KFJB 4LZLA 5LWQA 4GLBA 3OQ6A 5DTMA 4L8LA 4FLFA 3CPHA 1E2IA 3OEEA 3IAFA 2O50A 3EULA 3K1AB 1R8XA 2MSWA 4N5DA 4UMDA 1V1RB 3D6UA 1Y33E 2CXQA 3VR1A 3T7SA 1L3IA 1NX6A 3TQRA 4BKRA 4MUEA 5BN3A 4QC2A 1V43A 5DYNA 1ONNA 1RVV1 2HV8A 1U81A 1F2DA 1GQQA 1P1HA 4NEQA 5EXSA 3RTAA 2G9ZA 3AG6A 4CEIB 3HZZA 5JVDB 1HYHA 2WABA 1T8TA 2OK7A 2R8PA 3F3KA 1KQNA 1C0IA 2JGJA 3TIIA 4AY3A 4I1SA 5LZ9A 4M9XA 4O2AA 4N40A 4LY9A 5EIAA 3GEGA 5TT0A 4BLQA 4O4IF 5FUQA 4PNHA 3HR8A 2WF7A 4X7RA 3K0FA 1W4CA 2EBHX 2VHUA 3AI7A 1SWWA 3RFTA 1DCFA 1GO2A 4KYVA 3SLRA 4OVKA 2W70A 3M6WA 2JD1A 4MVJP 4G5GA 1QH0A 4MMYB 5HUHA 2IP4A 4KMOA 5K6AA 1NJ8A 1H2BA 2QNBA 1IOVA 3NNNA 5EKDA 4X7PA 1SD5A 3TVTA 3L43A 3MGGA 1EDBA 2F8LA 1HT1E 2WDPA 3WGUA 4AKGA 4FHDA 2HLDD 4MRAA 3B7WA 4RWEA 3VOSA 4A1OA 5H59A 1TNDA 1DJMA 1FYFA 3ZVKA 3PXGA 4G4GA 2Z8YM 3FPCA 4YDQA 3SJCA 3R20A 3O3NB 4DUYB 2HSGA 5CT5A 4EKIA 5JCXA 2WKWA 1DAFA 3KEMA 3H1FA 3PHIA 4M89A 4MV3A 4EZBA 1GRVA 3LL4A 2OWEA 4RJLA 2GN9A 4I2NA 3OD1A 3HYRA 3UKDA 1RI5A 4HDOB 5KJ1A 1XNGA 3HC7A 1WVMA 3P9NA 3N0TA 3W04A 3BS4A 3MCTA 1K7SN 3QPVA 1GPMA 2ZAOA 5ALOA 2OQVA 3GLGA 1FP7A 4KYIB 1YKSA 1TK3A 1YC5A 2IHNA 2WG0A 4DCSA 5KMGA 3DCNA 5IYZA 4MW5A 2UYHA 1QIJA 4WZBE 5GJWC 4MWOA 3HKBB 1NBEA 1IMOA 3K73O 4LF8B 3ZW7A 5G3YA 3G7NA 1YIAA 4GMXA 3ZGNA 5DM60 1XRMA 2DLCX 4AROA 2O2CA 1OU0A 2EW1A 3L8EA 3M9WA 2WAMA 3BEDA 3EBOA 2I4IA 4LHZA 1BVYF 3M6MD 4YY3B 5BVGB 4XW2A 3UGJA 5K9ZA 5A71A 4R8RA 3BX1A 5FLYA 5C1BA 1JEYA 1DEXA 4AUEA 2MMGA 3CUWA 3RYFB 4EF6A 2PAFA 4IIJA 1QCYA 2NSDA 4TYPA 3R24A 5ALUA 1E77A 3FUWA 3UB4A 2X4IA 3KV1A 4D0NA 2H18A 1E0DA 4B9EA 4RV9A 3QLJA 5JZVA 3PFHA 4BO2A 4WTOA 4B5KA 1MC8A 4XVHA 3GNTA 2AR9A 4E08A 4DY4A 4O3MA 2YYSA 3B36A 2YYAA 2XVMA 1DKQA 5U1PA 3L1VA 5EJ2A 3ZY2A 3JD4A 3TD9A 2EZTA 3P9IA 3G2NA 3PKZA 3GZNB 2QRVB 4FDMA 1MO3A 4Q82A 1WP9A 1BXZA 4WMLA 5FOQA 4EI8A 1DT5A 3NAGA 3A4NA 1AUQA 1RVDA 2BHRA 3S2EA 4IQ0A 2Q6VA 1TC1A 2Z8YA 4N3CA 4Z7NB 5DU2A 4I6GA 3RRJA 2FZEA 5B7NA 5JASA 1PV4A 1PW7A 3G9ZA 2WWXA 1P91A 3EGWA 1XLTC 3Q3CA 1PP4A 3F90A 4YRAA 4C6RA 4XGKA 1EGMB 4BNYA 3MFQA 3DTVB 2J09A 2JIZD 1JAHA 3DEHA 4FDTA 1LLFA 3EA0A 1R6TA 5IJAA 5IZ4A 5A5GA 1SD2A 1I33A 1XMQB 1DMRA 3U60B 1N33B 3RC3A 1JALA 2PZGA 2F00A 3OKPA 2B8WA 2QGNA 3JQGB 4OY3A 5IKOA 2XCTB 3AR2A 3GPCA 4JLMA 2QN2A 1LTHR 3KFVA 4LJ4A 1L5GB 4F7WA 1PFKA 4FOLA 3I28A 3RS7A 2BLNA 1DLJA 3QY9A 2PZFA 3CLUD 4M0LA 2QAIA 1OBVA 1UC4B 1QO0A 4DNPA 3EY9A 2O6HA 1U8FO 1F17A 3CZRA 2A88A 3LHFA 3OU2A 1YZFA 4NDAA 5DN6D 5KYWB 2C2MA 4GS5A 4R16A 4FGKA 4FNOA 2IY9A 3HS3A 1W35A 4WBSA 3ESRA 4RPLA 1M1NB 4QREA 3DOUA 2GZ2A 2IEIA 2W4QA 4S1OA 4ZALA 4UTNA 2AW3A 2JLRA 1DBPA 3NUZA 1ZN2A 2I8CA 1J56A 4JI5B 1D9ZA 1ZDMA 3CYFA 3ONEA 3WP1B 5LR6A 2IX3A 4D5GA 3RC1A 1WL8A 1O0SA 3OURA 2CB9A 3PNQA 5BRNA 1KE2A 3P0RA 3VOBA 3ZGXA 5BYBA 3C3KA 4FILA 1TM2A 4KIFA 3CO0S 3TSZA 1NMXA 5AICA 1OTXA 3D6MA 3G2LA 2C84A 3QF4A 1UBHS 1VE7A 2OO7A 4IH4A 5T8KA 1UBKS 3L0CA 1L5HA 3WHPA 3T5AA 4M1SA 1PBTA 1M76A 2OCGA 3CSSA 5HKBA 3K05A 1A9ZA 4BNXA 1AY0A 1E2LA 1FTQA 1VKHA 4MNTA 2XMRA 4M8NE 3SJUA 2BKEA 1XJWA 3EZFA 4I5DA 3ZNOA 5C2JB 5C31A 4KSCA 2HA2A 4U2GA 1VL6A 5A02A 3DR5A 2OYRA 1ES9A 2O2IA 5FTWA 3CIFA 4EO9A 3ZHBA 1WVIA 2Z5FA 2V5VA 3T7EA 4BO3A 4C03A 1UBTS 5L4NA 2E0IA 4UNRA 2HCTA 2R00C 3Q10A 3DDZX 5FBQB 2HQRA 1TQ4A 2IXGA 3OQHA 4HDNB 4PZYA 5E6SA 4M7RA 1EVYA 1AURA 3I0MA 2N1MA 5J4KA 1E2BA 1ENOA 4XTCS 1SHTX 4YUVA 2VUIB 3PNLA 3R0ZA 2LPMA 3W5VA 1JDSA 1XXHA 3A4TA 1PQUA 4A8HA 1MOZA 3TM4A 1JMVA 2EFCB 3OEWA 4R05A 3VR3D 2UYCA 2XCQA 1L8OA 3DE1X 4DLNA 2P77A 1G2PA 2A5GA 1U8CB 5IVPA 1DIGA 4MTCA 5EQDA 1W88A 1YBFA 2FYTA 3IBSA 4JBNA 3GJRA 1W85B 3VHRA 2JBWA 4F4HA 4H77A 1PK9A 1U2ZA 3TNDA 1V3UA 3COWA 4RPCA 1F14A 1DXQA 2VJKA 4YHHB 1KH2A 4MVYA 3BE6A 3RT7A 1XMPA 2VSXA 4BVJA 3L7MA 3QKIA 2ZT8A 1SUPA 1OHHD 1ZOPA 4Z0PA 1XNQB 1XPRA 5C9ZA 1YJ5A 2QM8A 4N0QA 2OGZA 1JEDA 3BBLA 4L16A 4M8KA 5DYWA 3SHFA 4E4YA 5IHPA 2BR3A 3A2NA 2QQEA 3FI0A 1Z6AA 3H8VA 3OWOA 4Y1RA 3W4KA 2FPSA 1MTZA 1QGED 4H4DA 4C7OA 1OJLA 1A95A 2DHEA 3NATA 1BG6A 2GJKA 4KIUA 1H0SA 1GYPA 2WYHA 1VL0A 4EUKA 3DFKA 1LPOA 3PC4A 2I80A 2SKDA 3WGQA 3UOWA 1N6KA 1GL3A 4KQHA 1KBZA 5EA2A 3AYXB 1RWNA 3DLIA 3G1UA 1M8PA 5LDDC 3KPYA 2NYAA 3TCKA 3ZD9A 3DHVA 4Q4AA 5CDYA 3KPUA 5CB4F 3OTWA 2CFCA 2XGSA 1I0IA 4ER0A 1U3TA 4PXYA 2J9FB 1P7WA 1XA4A 4D79A 1L7DA 2IC5A 3TDNA 1OY1A 3NGMA 2FN3A 3D64A 1H5NA 2Z9BA 3DEFA 3LTEA 4RA6A 5DCWA 1E5QA 1G17A 2SCUB 5LOVB 3B3QA 4HXYA 3NDRA 3RLIA 4PSUA 1JU4A 3FBWA 4GG1A 1AIPA 5B2EA 5B57C 1O77A 1HEUA 4W5HA 4QPJC 1DBQA 2OD9A 1FZTA 1P4GA 2IXTA 4Z0NA 3K32A 3FJOA 1SVIA 4A0HA 1E4EA 1PD0A 1PT5A 2DB3A 1A0OA 1JF8A 2R97A 3HDHA 1EVKA 2ON6A 2HWYA 4GMDA 3GLKA 1T2UA 3Q7TA 5CNIA 4CIAA 1TD9A 5AKIA 5AIBA 1LWOA 4D8TA 1K8QA 4LTMA 3ELWA 4M86A 5C34B 3E9CA 3P5SA 4I81A 4H59A 5CT6A 2IW3A 3PIRA 3WGHA 4UEJA 5AJTA 1TKBA 4EABA 2WT4A 4FFRA 4GP6A 4MRMB 4TQAA 2BL4A 3U4GA 2PXCA 3KUDA 4C6HA 4CLDA 4UTPA 2VYQA 3A3NA 2QV7A 3E4DA 4MQEB 3ND8A 3PVZA 3VHQA 5K8IA 3RVMA 3A1FA 1LLQA 1RQPA 4PW0A 3DTYA 2XXJA 4QUDA 3PFIA 3B1WA 1JAXA 1YBMA 3F8TA 1F0NA 3PI7A 3MJFA 1YF3A 3QU7A 2JFGA 3BFPA 3GGSA 1N6OA 2QT9A 4QJ5A 3RYCB 3ZIDA 1I1QB 2WJIA 5I47A 1GL9B 2XDQB 3E81A 5AJZA 1L7XA 5IULC 3TL3A 2Q07A 1S02A 3LBIA 5FOSA 1U3DA 1VG1A 1W1WA 2ZIAA 1FS5A 3ZBTA 4R40A 4US0R 5KYGA 3KZCA 4NYJQ 1PV1A 2XA1A 3E1KA 3LPCA 3NBKA 4P2GA 4XD7D 4RMNA 2UZ1A 1S9DA 2D1YA 2ZT5A 4GYKA 4ZA2A 2XMQA 1VBNA 3EOAI 1FFDA 1YAHA 4P81A 5L3SA 2DY1A 1TZCA 4P80A 3HN7A 1A5BB 2VP0A 4V3CA 3GPDG 4AWXA 2OENG 2VJDA 4H18A 4TL8A 4BEJA 2JLAA 3T5DA 4CMHA 1DAEA 1MC1A 3CJTA 3SC2A 4DQ0A 4N48A 2EFYA 1FMCA 1CY0A 1XRLA 4UVEA 3BGOS 5IBRA 2UZ1B 3ZQUA 1KU6A 4AF6A 4EB6A 1J1IA 5CYPA 3VPGA 5F7JA 5C5EA 4CEHA 2DPMA 2J3IA 2IUSA 1MG0A 2QE7D 2GAIA 2JEZA 5EZYA 1Z16A 1Q74A 4M55A 1E3QA 5LNK6 1D7AA 1JDUA 4IZIA 5F64A 3H97A 2O4CA 2JIQA 3VU0A 4HGPA 3M5WA 4Y6LA 4L5YA 4EGCB 4R2JA 3PXUA 4IP0A 4QRIA 5KHLB 1WRBA 2FPLA 2JLWA 1DIOB 5CB0A 5B58T 3T1VA 4MR9A 1NI5A 1CEEA 2F9MA 4WX2B 3EK2A 5AWFC 4Z4HA 1BYUA 4WDRA 3RUDA 2ETXA 2NXNA 2AOUB 1E94E 4DCVA 2Q1TA 2W90A 3MTBA 4YT5A 4OUKX 2JFBA 1VPEA 4J0DA 4BB9A 3GO4A 1G3QA 1YB6A 2CCKA 3A4MA 3BFJA 3FCXA 3L18A 4UKDA 1PTKA 5KYUA 4PYJA 2C7VA 4FSHA 5C1IA 3T7AA 2QF7A 5JWRA 5LSAA 5CVDA 1K6MA 5TMBA 4KN9S 2CE2X 3UJAA 2BELA 3FVWA 1E2GA 3IDZA 4JELA 3U6KA 1LRLA 2HHHB 1YBAA 5KWSA 3C3BA 4YRDA 4BTVA 4XTRA 3T1HB 1EAMA 5LB2A 1Z4OA 2OXIA 5HUJA 2H57A 2O3SA 4HHEA 4AS3A 3SQXA 2HRQA 1VIAA 3GELA 1USVA 3RIMA 5FHQA 3GPBA 2ZQ5A 1QDEA 4FMDB 5KVSA 2NSJA 5HCNA 1P17A 4MA0A 4BB5A 1Y8CA 2QVGA 3PGKA 5JEDA 4L74A 4HAOA 2EP5A 1TYEB 2G3YA 3FPHA 4Q9IA 1PNTA 4ZEOA 3VZPA 4EPRA 2FOIA 4OUDA 5THQA 4DDTA 1GDDA 3OH8A 1YTUA 2QNRA 4LWZA 4H08A 2C98A 4TMKA 4UBNA 3RGWS 1GPDG 5I8WA 3N8NA 1V3QE 3E3NA 1HE1C 1TE2A 4RESA 2JAUA 4GOJA 3B5EA 3NHSA 3LOQA 1Z0JA 2R6ZA 4ALNA 3V4SA 2PV0A 3AERB 4PX9A 2O2EA 1KSGA 2JFZA 2R6CA 1Q1GA 3ROZA 1ZI6A 4OOEA 1YKFA 4PZUA 2XF2A 4EPTA 1F2VA 1DKRA 3RU7A 3HKEA 2GM4A 5GJCA 3IOCA 5C3UA 1J09A 3T34A 1Z35A 4BAZA 1TQ6A 4MYUA 3DDWA 4DM3A 1IY9A 4W1SA 4AS1A 1NHGA 2O2JA 4HLDA 1A50B 4RHYA 4I08A 1NMEA 1T5DX 1UDXA 1B74A 3LYLA 1HEIA 4ZCQA 1R0SA 3QBDA 2AFIB 1TCVA 1WY5A 1G5HA 4E32A 3TQIA 2PX5A 4EW6A 3I9KA 2OA0A 3ZV5A 4UBJA 4MKRA 2MCFA 3QJGA 1IWPB 1XXHE 2MSCB 4GGPA 1HWYA 1OAOC 2C61A 5BNTA 5K4GA 4QTTB 3ZGYA 5THXA 3T35A 3L0PA 1R4MA 2CE7A 4ZMBA 1XU7A 1ZIXA 4F9EA 1L6IA 2OEPA 1P0IA 2Y99A 3ZK9A 2AG1A 3VZRA 2O57A 1F7VA 1NY6A 1Q1QA 4Y2VA 1P4AA 2W2XA 3MXTA 1TCUA 3MT9A 4TWIA 2ZBPA 4WAUA 1PNRA 3L93A 2QPOA 5JJ5A 4U2BA 1UANA 1GGVA 3ZHTA 4N01A 1E32A 1M0TA 2R79A 4RE5A 4O4JA 3K71B 1NAIA 5IAOA 4I2VA 2RAVA 3HXTA 4JL5A 4JH0A 2ECKA 2QIOA 2IYLD 5J2TA 3EVBA 1XVVA 1A71A 3DOIA 5CLQA 4JUBA 4TXMA 4M1TA 4R1TA 1G1MA 4A8PA 2D5BA 4RNCA 1HL7A 1ATZA 1UZAA 1VDMA 2UZIR 3G79A 4KRGA 4PYKA 3UYLA 4BVHA 1FTNA 5JAUA 1N9KA 4BFUA 1N77A 5JRJA 2HIAA 1JZSA 1Z2CA 2NV0A 4M1OA 2JFUA 4KE9A 3EGXB 2ZSAA 4LKOA 3NO4A 4HS4A 4QJBA 4HFJA 5EIFA 2B98A 2GFQA 1IOWA 3Q7IA 4HR7A 2O0MA 3GEEA 3HJRA 4TKVB 1ACLA 1ESMA 3SICE 4CR8A 4HMOA 4WFIA 1GGJA 2QMUA 3LC1O 1FEZA 4GMHA 4HTFB 5F1KA 1PZEA 2Z2ZA 2OK8A 1MHTA 4QDTA 3NETA 3AJ8A 2VR1A 5CW2A 1B7GO 4QELA 4N49A 5ER9A 4HX5A 1LTQA 4F9GA 1H1LB 1Z37A 4NZMA 2OAP1 1CJCA 2YICA 3SBXA 2XH8A 3SZUA 1YJAA 4R7ZA 4PLWA 3SS8A 2QTHA 3BEOA 2IP1A 3MJRA 4C0QC 4G1UC 4BQOA 5BQFA 1M7HA 2WHYA 3A14A 3L01A 2L2QA 1HK7A 2IZ7A 4QUAA 5DNVA 3RSSA 3RBZA 1ICEA 1Y1PA 4D9IA 3E9QA 1P2FA 1DEKA 3F5SA 2WSSD 1JHYA 3K8YA 3E7FA 3F6SA 1E5LA 2NV6A 3P4UA 3ECSA 4NF2A 4MVJI 1LQUA 1MEEA 1AKRA 3ANMA 3CVXA 2D3TA 4BO7A 3AF2A 3BXPA 4CU2A 5AJVB 2AZ4A 4L3OA 4NU6A 3KR2A 4WXMA 2JATA 2WR8A 2Y1DA 3T9DA 3DHWC 1GITA 1CS0B 1YHYA 3PWTA 3VFDA 5EUQB 3QUSA 4URUR 1YGYA 4F8YA 3L06A 1JECA 4HWSA 4A2PA 3IT0A 4JX8A 3L7YA 2R6R1 5AQEA 3F96A 3DMDA 3E48A 1BE0A 2WHXA 3F7MA 4HQ0A 2W2KA 1QUFA 2BT4A 2FPUA 4M7PA 2XX3A 4RGVA 3OEYA 1UOQA 2QTMA 3KB1A 5CA0A 1RADA 2A3RA 4JZYA 1KH3A 2QMQA 2QD2A 4Q7KA 3V6LA 4AZ0B 1I3KA 4BS9A 2I2DA 4IRUB 1UKVY 2WAYA 2H16A 2JHPA 3OZIA 3OPVA 2YVLA 4QPPA 3WIOA 3V8BA 2J6IA 2Q1WA 4TPKA 4U7TB 3LSYA 3OLQA 1OGJA 3BBPA 5PNTA 2OLJA 3KKPA 4HNGA 3U4MA 3U44B 3SXUA 1MAHA 2FSVA 3FMPB 4PSCA 3HVKA 3WIVA 1AKMA 1RU3A 3O38A 1FRFS 1FXUA 1VG0B 3CXRA 3V4FA 4BO0A 4CM9A 1QX4A 4UHBA 3U3MA 3W78A 2BM1A 1Z34A 3I37X 5KAMA 4HQKA 3FBGA 1HYGA 2A78A 2WZCA 4GP9A 4OIMA 2GPYA 2A1UA 3VR5H 5HKKA 2BRUA 3GZNA 4NQZA 1RWKA 2RJOA 1OJ7A 1RYZA 1DARA 2B2XA 3ABOB 4H27A 4S1NA 1BMFA 5NLLA 3LP8A 5AVZA 2F43A 5K0TA 3EMKA 1PZHA 3K09A 4J7UA 1XZEA 5A9SB 4M1QA 4EQZA 4IGFA 4CW7A 2DRIA 5ALLA 1AZWA 2R1ZA 4TT3A 3D3QA 2IIPA 3RO7A 1WZCA 1I7DA 4XWKA 1E5DA 1DG3A 3ZE2B 1E0KA 2Y1XA 1Z22A 2BJVA 4OBBA 1H2FA 3VR6H 1AJEA 5L6LB 1K2VN 4JY7A 4RV4A 5E9WA 3M4JA 2G67A 4G8BA 4L95C 4INAA 3TECE 4GU5A 2YWXA 1SU6A 3ADBA 1XTTA 1DFGA 3JVEA 4QVGA 4RVNA 2RARA 4Z8XA 2ZTSA 4F7DA 3WNQA 1L1QA 3CKKA 3WL3A 3GJ6A 3W8NA 2X6RA 3L8FA 2AX3A 2YXBA 3M6FA 3R41A 4D44A 1TAGA 2OR3A 4RV5A 3ZCUA 3OQVA 2H6EA 3K1ZA 1C7RA 4IEFB 3X1MA 1J2EA 5C37A 1SXQA 2P2DA 3F49S 3RARA 1Z6YA 1ZNXA 1MAUA 2FQQA 3NKFA 4MV8A 3L8MA 4I1PA 2XGJA 3CNHA 3KWFA 3L07A 4HMPA 5CB8A 3MQ4A 5F5NA 3PHHA 5FXMA 3B6MA 4MVJF 4C3VA 5BVGA 1JFRA 2X1VA 4PAOA 5KMGB 3W9BA 2E3JA 1PZMA 2I2AA 3PC3A 3TTTA 3R0XA 3SY8A 1E89A 4KMMA 5SZHB 1UBJS 3FTNA 4S12A 1KI6A 1SD1A 4V1CA 1RAIA 2V7UA 3QU2A 2POCA 4Q12A 2BDTA 4QDZA 1GTJ1 4RA9B 3V7FA 4FMDF 5C3MA 5DM2A 2ZPUA 1SKMA 1ZH4A 2RCNA 3HKEB 4X45A 1UMKA 1L5FA 2Q27A 3CIOA 4DSTA 3QE9Y 1U4OA 5MN5A 3WOHA 4LJRA 2B8EA 3TBKA 3BWXA 3QE3A 1H69A 1TK2A 3R7WA 4EA9A 2G0AA 1P81A 2VF7A 2XHZA 4TWJA 3LRPA 1XDBA 1UOOA 2F8MA 2OVFA 3Q5DA 3HCEA 1NN5A 3T4XA 2CMFA 1CUGA 3H5WA 1UXKA 3CO5A 2LBPA 1E62A 3OE5A 1FZQA 3CUVA 4JLKA 4BO5A 5JC8A 2HF9A 1WOYA 5F7OA 1ENYA 4KFRA 2PV7A 2C29D 2SECE 3WE7A 3ZHYA 2V98A 3TRHA 1IN4A 1OQAA 1C50A 3NXKA 3P9YA 2MSEB 4KQFA 1DQNA 1PFYA 3KZMA 5DM1A 1G7CA 2P91A 3I1IA 1XXLA 3CF2A 1W1IA 4S2UA 5A62A 1L5WA 1CNFA 3FHOA 1TZBA 1EUDB 1JQLB 1P0CA 2JD0A 1IHPA 2RG7A 2WG2A 1B76A 2NLOA 3B89A 4LECA 4YLYA 2AZMA 3PP8A 1JH9A 4FNAA 5AOVA 4GWLA 1QM5A 4L51A 1A3CA 3E3OA 3H13A 4G1BA 3WRWA 2H59A 3B7PA 1ZMBA 1ONOA 4Y2HA 2X0NA 4OMDA 2OXTA 2F3QA 1L6RA 1K8ZB 2YZ7A 2CVOA 3P45A 3PNKA 4IWNA 1ZSVA 4L4SA 8LDHA 3PPYA 4KQMA 4Y98A 4PBTA 5E3HA 1IDOA 1FMFA 3GFPA 1DHRA 4COKA 5CFPA 5EJ6A 5DHTA 3FA2A 4C78A 4JJKA 3AVYA 3N2NA 1YR8A 2WJVA 5ALXA 1M2GA 1UJCA 1D03A 4MKZA 5JS6A 5FYDA 3I1FA 5I01A 1E1CA 1Z36A 2J67A 4DIUA 2GAAA 4DQUA 3FDJA 2ZSBA 1JR6A 3VKGA 2RGGA 3GWGA 3IMEA 2DJIA 4GM1A 5IDVA 4YRNA 1LDEA 1ZD1A 3D7KA 2M1ZA 2R66A 1F3LA 1WLYA 4IG9A 2B83A 4UBKA 4FU0A 3FGZA 2VJYA 3A6KA 1QAMA 4F56A 1JR3E 1DJPA 3JYNA 5DLDA 3KQMA 3QMWA 4M98A 1C81A 1Y48E 2B94A 3D8SA 3MB5A 4N65A 3OFJA 4OYLA 5TB5A 4F1JA 3BCHA 2UVPA 5KWJA 3J81k 1X92A 1ZXXA 3GT3A 5CIQA 4E22A 3QPWA 5KX5F 2QVCA 1VB3A 4YYZA 2EAUA 4Q1FA 3SZRA 4DQXA 5JFTA 2TRSB 5CD9A 2BM9A 5JNLA 1KJ9A 5CYOA 3VV3A 2O1SA 1Y7LA 3EQ9A 4CV1A 2XZOA 5AKXA 3RYIA 2XDWA 2YRXA 2FSIA 3HMKA 4JX9A 1F38A 2DKOA 4GX0A 4ZOEA 1GNTA 4FBMA 4C01A 5KNBH 3GRPA 2J5RA 2HJHA 1UBOS 4YC7A 2AE2A 2Y0DA 3B51X 3LQ4A 2O7QA 2C1EA 2CVHA 5ESWA 1E79D 2YHSA 2J4FA 4A6EA 1E9SA 2YASA 4LSGA 5ITVA 1ORVA 4G4SP 1I13A 2B20A 3TM5A 4ALJA 3ICWA 3IIEA 3IURA 4FDUA 1T8PA 2GBLC 2X2OA 1E79A 4XEUA 4OGWA 4OO3A 1ZIPA 3K96A 2VK4A 5AKHA 3ZY5A 4A8JB 2XRYA 3HM2A 1ZVJA 4OXKA 4IV5A 4AZ3B 1JKXA 4MRRA 3RCBA 1D5WA 2WAOA 4RJKA 3U7RA 4MEBA 3UVEA 1VMDA 2YINC 2BOVA 4JUCA 4JU9A 4Y2PA 3RKRA 3IUMA 5B6PA 5CEFA 2EKBA 3IUJA 3MMNA 1T6ZA 3PT9A 1UP6A 3R3JA 4TTSA 5SICE 2WP0A 1P6QA 1JLHA 1G42A 3TRKA 3F6BX 3S2ZA 4U2EA 2YV5A 3EH2A 3TLAA 2PU5A 4D4GA 4UM8B 4C29A 2HJGA 4IVRA 1BH2A 5F5LA 4CL0A 3LX4A 2LKCA 3AF4A 7AT1A 3GFOA 2CHGA 2Q9CA 1JU3A 1G98A 1QQTA 1M6EX 1UEXC 2NGRA 3KSDO 3AIKA 4K1XA 1TUBA 3F9CA 2H9IA 3A05A 4V0QA 4KR9A 3HBFA 4JEIA 1GCOA 2G1PA 1FC0A 2IYYA 3V3TA 1KI9A 4FC7A 1XEXB 4JITA 4UQOA 2QJRA 4MB6A 1P72A 3T95A 3EFOB 2UXBB 4MV5A 3IIIA 1I3CA 1KZHA 3Q8XB 3O31A 4MQUA 2X5OA 5GADl 4CQMD 3OIDA 1TZKA 3O73A 4IUCS 3V4LA 2O0LA 4CTOA 3KQYA 3WY9A 4MDHA 4RY9A 5BORA 3NBMA 5F3DA 5BSWA 3HVRA 2GS9A 1CJKC 3AUTA 4ZOCA 5C8YF 1US8B 2R8YA 1F12A 1V96A 4IVQA 3ZCQA 4I5FA 1IJKA 3BE5A 3LQQA 4D9CA 1YE8A 3AV3A 5DCYA 1JPVA 3UJ6A 1GUDA 3RRFA 4FR5A 2QN9A 2HK9A 4CRWB 3PNVA 2AQIA 3PSAA 1HKHA 1RM5A 2RG1A 3DQZA 5A7HA 4IJVA 5CRIA 1RJ9B 1VI5A 4UVGA 1K8RA 3LHDA 4WWHA 4ARBA 3E2IA 2MMCA 2WIKA 2PXXA 1QVZA 2VT6A 1AD2A 3D3NA 1TAHA 2GKGA 3E3MA 4JR2A 4EJFA 3D7SA 4N8SA 4ER5A 3ONFA 1ZMXA 3RSQA 1G66A 4FFOA 5MF6A 3AEZA 2OD7A 1P0MA 2F1HA 3HCPA 3HBLA 4ZJPA 5CDUA 3HHPA 2D4HA 2JJ1D 3VNRA 1M0SA 1KVUA 4AJEA 3N2EA 2O48X 4YHBA 2P1DA 1W7AA 4ND5A 1A69A 4TV9F 5K8CA 5D5QA 4EWLA 2WNHA 3FPFA 2BYTA 2H17A 5A5VA 3V4OA 1CUFA 2NO4A 3A70A 4S1PA 4ZHSA 5JO0A 2JHCA 2YZNA 3NAZA 3NWJA 1QH9A 1UJ6A 1GTSA 5A5DA 1P9WA 5D1HA 2GPTA 3GZTB 3ANTA 3QPDA 1LBEA 2RGUA 3FUCA 4ND7A 4Q4HA 5CX4A 4GR5A 3CXUA 2KMLA 1QS0A 4MGIR 4F2WA 1EVQA 3WO1A 3B6EA 2MDTA 2YYZA 2QY9A 5IAKA 5TGTA 3CWZA 2D7CA 3U81A 4NKRA 4RF2A 4K9PA 4B4DA 1JHOA 1IJBA 2Y9MB 4ZVTA 2O59A 2QLJA 3B9QA 3FTPA 2FR0A 5E4YA 5B36A 2WJ6A 1C3JA 3T15A 4FEYA 1M8KA 1LSOA 1PL7A 4B7XA 2GCOB 4UEWA 3O8BA 3QE2A 3AL3A 4JJIA 2ONYA 4ZVKA 2CW5A 1TPYA 2ZRAA 3V55A 1JEOA 5HGJA 5C5IA 3GLUA 4FWBA 3WMRA 1TD1A 3UH1A 2NU7A 2NZJA 2VP9A 3KU4A 3TKLA 1JSZA 4EG0A 4X54A 3CPEA 3D8RA 1QYIA 3LZCA 1VSUA 5KYXB 3R3YA 5CLHA 1K68A 3DO8A 1EE9A 1C9DB 1WTCA 3HY4A 1WZIA 1AQIA 4NSNA 2HPHA 3F6RA 3VPXA 1RMTA 4CDRA 3VSCA 5A9SA 3GDHA 1KK3A 3A2LA 3MWKA 5G0UA 1Y7TA 1VJ0A 2TYSB 1RE0A 4F0JA 4O4LB 3HU2A 3S1SA 2O7NA 4ZMSA 4WVFA 4V0RA 4Q3LA 3CTMA 1R3DA 2WJWA 3JVUA 1NP6A 1TYDE 1ZUWA 3H99A 1FP2A 1F3OA 3JY6A 4AN0A 2G04A 1ESDA 3REGA 2QX4A 2Q0SA 3D2BA 5E8RA 4CWAA 2QS9A 2GDJA 2GJ9A 3HA5A 2HXYA 2I62A 3ELBA 3LCMA 4KPUB 5IUKC 3ZJ5A 4DMCA 4M38A 5TX7A 1WS6A 4C4AA 5LU8A 4YXWD 3AI1A 3NOVA 1N36B 4W9MC 4Y6QA 2AOUA 3FCOA 3UY4A 4L0CA 4Z7JA 2QZ4A 1UC9A 4C0BA 1OBHA 2GA9A 2V6IA 2QT1A 3AW9A 4I7EA 5I6DA 3U44A 3U4QB 1VSBA 2OXFA 4RGQA 2GOYA 3BA6A 5KSYA 3LXMA 3Q6MA 1KR2A 1XRJA 1G19A 3RRNA 3ZLUA 5F9FA 1LTKA 2HPAA 4YO8A 3ZQJA 3HE3A 1TJ4A 5EJIA 1XIVA 3A9CA 1N1EA 1IYZA 3F7NA 4IDQA 1SNYA 3UM9A 3J81A 1I94B 2QTTA 2ZSEA 1ODSA 1Y7HA 4TL7A 4P36A 1Z4JA 1JQJC 1KYIA 4I4CA 3SX4A 2FPWA 5AI8A 3SSAA 3UK6A 4QPDA 2YXEA 3I2GA 3G68A 5J5AA 2XCUA 1J8DA 3G5LA 3DWEX 3UMBA 5LP6F 2G76A 2QHXA 3AUFA 1IHYA 1XF9A 2DVMA 3L8GA 1H3FA 3NNSA 3PX2A 5A3RA 1CSEE 1G20A 5BN1A 3ZHQA 4L5JA 2JCGA 5AI4A 1ENZA 3GHYA 1PEYA 2V7TA 1Y3IA 4L9AA 1SM4A 1L3CA 1ZC4A 3C14C 3F5QA 3E9RA 4FLEA 1A5AB 5EXXA 5DBIA 2OPBA 2R6FA 4PXSA 1QGUB 1CERA 1SXIA 2GLTA 4L5BA 1Q6YA 3OVMA 3KSRA 4LTNA 3ZHOA 1DUVG 2WD7A 4YCBA 4E4RA 2K2WA 3WYGA 2ANBA 2EF0A 2ST1A 1X8LA 5K6AC 4UAGA 3JAMA 2VUHB 4HUQA 3EFEA 2HA6A 3QPBA 1RXYA 4OEHA 4WCFC 3HCWA 4U0KA 4UU1A 1DXOA 3PNSA 4NC9A 3I23A 1OTHA 5JTUA 1FUKA 4D4IA 4JN6B 4BQNA 1O4WA 1KJYA 2AJCA 2V0NA 4PGMA 1TQDA 4HKTA 4KXWA 4Q0MA 3S8YA 2CHVA 2D7DA 5EAIA 1AKNA 2CUNA 2RC6A 1Z6QA 1M1UA 3CV3A 3RUHA 2ZZNA 2VN8A 2YDXA 3GP3A 3UCEA 3VKFA 4EBFA 5C46F 3H2ZA 1PJ2A 3CR7A 1AQLA 3A2KA 2VC2B 4PYIA 2C4WA 3IXQA 4FLMA 2CXNA 1A04A 3ZV6A 3PG5A 4RULA 2HYIC 4OXYA 4YXWA 3WV5A 3I2JA 2H00A 4JYAB 5KBYA 3SFZA 3W6ZA 1OCEA 3IOBA 4XWYA 1BGWA 4M60A 3GIDA 3T3HA 3QEMA 4L5CA 3U4DA 3U3OA 3UN1A 4BXOA 4DUGD 3JAKB 1NBIA 4TLCA 3O4RA 5BVHB 3T3NA 2HO5A 4U7GA 1OVMA 4GX2A 1POXA 2IK8A 1IXZA 3C3WA 3HYNA 3P32A 4GX1A 1W5AA 2W0SA 1CUWA 2PR2A 1SG9A 5FPQA 1OV6A 1J07A 4ZCIA 3R74A 1Y82A 4AJ2A 1IQ0A 4DLUA 3L4SO 3PDIA 4WZZA 1JIVA 2FPGB 3E61A 1ZBDA 3TSYA 1GPLA 2A58A 3S5JA 4HEHA 1L4YA 3DOCA 3OSUA 4EB3A 4HVLA 1W0CA 2F62A 1NP3A 3CX3A 1RPJA 4GBJA 3TE6A 2HMAA 4IJ6A 3ZUPA 1QR2A 3C4QA 4D4HA 4MIYA 4J7XA 1MJ5A 4KVAA 2GEJA 4ZICA 3MUFA 3OP4A 1W8DA 5EMMA 4OH1A 5GZ1A 2QJTA 2CHUA 2HGZA 5HE8A 3ZWBA 1UP4A 3PRKE 5ICFA 5I4BA 3DD5A 1Z07A 4YMLA 4O2LA 1PYGA 2X77A 3OQBA 3RS3A 1EUQA 4G56A 2L19A 3DOEA 3AM1A 2V03A 3IJPA 3U3DA 3NH9A 3SC4A 2M2IA 1UC5B 2VTVA 4EA8A 2CXTA 3NP9A 5KCZA 4Z4FA 3LYUA 4OM8A 3IQHX 2RIPA 4LMPA 4ZI3A 2VK1A 2JAPA 3BH6A 4B3GA 2P9TA 4OM7A 3UJCA 4C7OB 3SQNA 2IHKA 1K8YB 2I34A 1VJRA 1XKXA 3I9V6 3NUGA 4CMIA 2WHQA 2ZSIA 4O2AB 5H82A 2PZKA 4RMHA 1D8TA 2P79A 3MYRA 3IT2A 2YWCA 3CNOA 1RRVA 3JATB 1DRVA 1UFVA 1Y1QA 1HPLA 1Z5PA 2I03A 4BIIA 4RTNA 3SYKA 2DQSA 3QVWA 1NY5A 2D1FA 4E11A 1SURA 1FYWA 3J7TA 4NESA 4IIHA 4UM5A 5A3VA 2PIDA 4CIBA 2PRJA 3GLIB 1BC5A 5JXWA 1K86A 1PHRA 1O9BA 4YB8A 4L6IA 1Q19A 1YRLA 2ETVA 1PW5A 5L3RA 1XLWA 4H16A 4IY1A 2QQ5A 4I46A 3LUBA 3SMVA 4E2WA 4Y7DA 3I76A 3WDMA 4EKYA 4NPAA 1R6XA 1EX7A 4D8UA 4BWGA 2JFWA 4DLVA 1SCNE 4ROTA 2PAAA 4OKNA 1II8A 2RC5A 1NVVR 4UFNA 5F51A 5I7WA 4MQBA 5B4TA 8MHTA 1GPJA 2EERA 5CDGA 5AXBA 5HKKD 4BPBA 1YK1A 3P71T 2NUAA 3K9LA 2C5FA 4Y3UA 2VLIA 1JRLA 5K4AA 1DRWA 2JGNA 5JMOA 5JD4A 2CT8A 4MAFA 4PCLA 3KOMA 4UD6A 5LUAA 4RD3A 4CM7A 4DR6B 3D1VA 3NIFB 5CITA 1XVLA 4B4OA 5DBGA 1OW3B 3PWZA 3GB9A 3JWJA 2XE4A 3AUUA 3GGDA 3RU3A 4G5OA 3ZVLA 5IUNC 1R6DA 2W2PA 4F4FA 3MOSA 5K7SA 1P45A 1QG4A 3ED1A 1A8PA 4QNRA 2XGOA 2XF8A 1M34E 1M6HA 1HA3A 2NZVG 3Q2OA 5IK2A 3ZXUB 3L05A 2P9QA 5K0FA 4RHTA 1KAQA 2NQTA 3Q1KA 1UJ2A 4IDFA 4Q3BA 2AMLA 2FX5A 2QA5A 3HADA 4DADA 4UOQA 3L7IA 4PYNA 5BNFA 1UP7A 4N3AA 2WWHA 1UAYA 4FSDA 3I0ZA 4YWHA 4KWTA 3PGA1 4CMIB 3N70A 3UTCA 2NTJA 4A27A 4L9RA 5AESA 6REQA 3HL4A 1TDJA 2FWJA 1TMGE 1ZUIA 3D6FA 1CRWG 1T4CA 3EEIA 1O94A 2A4MA 2PWAA 5B1DA 2M6LA 4G23A 4A2CA 4ERNA 5A1TA 4JB8A 2C9DA 1BW9B 1JQAA 1M7BA 1QTIA 3VTKA 1M0EA 1H05A 2BTQA 4B2IA 2GBPA 4RANA 4RDIA 3O92A 3M5CA 4DWWA 4F12A 4KI7A 3BAZA 5IAGA 1NVGA 2L0XA 4LI0A 3W5SA 2XMZA 3DGFC 4J8PA 4J76A 3G5TA 4TQ9A 2X6TA 3DE3X 2XUIA 3O93A 4HK4A 3BHIA 4PHFA 1R4AA 3IA7A 1O8CA 2VTKA 4MRSA 2PYZA 2DWOA 3CLRD 5GIPE 1VPVA 2O2GA 3IKLA 3OU6A 3UFBA 5KWVA 1RWQA 3VR5D 5G1NA 2G7MC 2BUCA 1NUPA 2P2LA 1LDGA 4O6VA 1P44A 1M6YA 1F2UB 3PXEA 1GOTA 3QELA 2A9OA 1QH8B 4UJ3A 5K51A 5CCDA 3L04A 1FX1A 3GJYA 2H1OA 1KZ7B 4Z9AA 3L3BA 1ODIA 2XUGA 5F1YA 5FA5A 4R9UC 1BCRB 1JHQA 1FUIA 1YA8A 2ZJ6A 3EQ6A 3NDPA 3SKYA 3DEZA 3VNBA 1JJFA 3IDQA 1IHDA 2Q7XA 3NIDB 4WLFA 3HLYA 5ETJA 1KTIA 5F4BA 1U8XX 3UBTA 1EJ0A 4MRMA 3B7GA 1EK5A 4JXZA 2QUBA 2Z2XA 1GFIA 3N7AA 4HFNA 2HSWA 4QUKA 4W9NC 1MZVA 4IUDS 2WUVA 3EGCA 1M34B 2O8VA 4JT2A 2FJUA 2VFAA 2YYYA 3MMXA 2I6GA 2NTEA 4EUNA 5I9TA 1XX6A 1N3LA 3EWSA 1SCBA 4MWEA 4ZYWA 1YE5A 5JMTA 5IEJA 1ISHA 1Y9ZA 2J3DA 3AJEA 5IJ0B 4L5AA 2WA1A 3OIUA 1A9OA 3GGJA 1V1MA 3JYOA 4U02A 5TARA 5JV5A 4IIJF 5CFZA 3PJRA 2WIAA 4PLGA 3T99A 10MHA 4ED9A 3I39X 4E33A 2IXEA 3ETDA 1WJGA 4J16C 3GCXA 1UK7A 3UKJA 3VKVA 5IN4A 2UYGA 2A9VA 1OLSA 4KDEA 5K99A 4AUKA 2PS3A 7ABPA 2Y77A 5F98A 4AKTA 1UJ5A 2OOSA 3B6KA 4E2FA 2HTFA 1VCHA 3JPYA 3LUHA 2QXUA 1IXRC 2XI4A 1V1MB 2WAXA 4K86A 1XMIA 1ECBA 3DM5A 4ER7A 2ZRGA 1HDZA 1ODKA 1U0RA 1T5HX 4IV8A 5KSPA 3KFXA 1LNZA 3EIQA 5JNSA 4HQNA 3LYHA 2SBTA 4HBZA 4FFSA 1L5RA 2FSHA 2V7PA 4KGVA 2P9JA 3JQ9C 3PFGA 2A5LA 3UAVA 1HDYA 4ZVPA 5HKAA 2AVNA 2FNAA 5FI5A 1OFUX 1VKNA 3M1AA 1ZNYA 1I51A 4H6XA 4HT3B 2UAGA 4D9KA 5KNCD 1EHYA 3TO5A 4K1LA 4CCSA 2H8GA 3MPUA 5E7QA 4NY1A 1Y7PA 1I36A 2ZT7A 2C78A 5LA6F 1GSHA 3HDYA 2XB9A 2HWXA 1YULA 2HQ1A 1M0WA 2HCRA 2GHRA 2ZANA 3FPSA 4FKMA 4MW6A 4YCMA 1X9GA 3D1LA 1C0KA 2Z83A 3QHQA 5J40A 4OXXA 4PZAA 1XV5A 2ZVQX 5AM1A 4B09A 1M1YE 2I78A 3IPCA 4MA4A 5DP1A 3DYVA 5AVOA 5HUQA 3EFHA 1PJSA 2OFOA 2JPDA 4HC4A 4KZKA 3WK7A 4INZA 1U65A 3L0ZA 4I4IA 3G02A 3HGQA 2WJ4A 1BD3A 3FLBA 1EDZA 1UMCA 5JCPA 2CFIA 2D8MA 3GAAA 1VPLA 3KOZA 3DHEA 4IX1A 4LC1A 5AVUA 4LRYA 1QORA 2WT8A 3FTDA 4LOHA 3CZPA 4QYXA 1O0BA 5K0EA 4AULA 3NUQA 1D4FA 2OP1A 4BBPA 2XR1A 2NXEA 1PFVA 1N6NA 4FINA 1RRKA 2BGIA 4REMA 2BFDB 1PUXA 3GFQA 1LQTA 3EVCA 1AKYA 1KI7A 2HIMA 2X22A 2X5KO 2P9CA 5ICSA 4Q39A 5KYYA 3G5MA 4MQEA 5DLEA 5DTQA 1TM7E 1ZH2A 4O4LA 2XNDD 4IHJB 1UPCA 4NARA 1M6NA 4HNSA 2IYZA 2JFYA 4RUKA 5DZSA 4DQKA 4F96A 1QLWA 3REOA 1M9NA 3IO5A 4R84A 5LDGA 1OH6A 1V16A 4IKOA 1ZA2A 1JIIA 1PRYA 16PKA 3GLFE 1HGXA 1KMQA 3AFNA 3NKVA 3E4CA 4MJLA 4V39A 1ZM9A 2WWYA 1QP7A 4HH3C 4FYKA 4ZANA 3DMTC 4S35A 2RHBA 1KJ8A 1ORWA 2C99A 2GJSA 5ECWA 5TY0A 3NWBA 3SKXA 2WV9A 3U49A 1Y5RA 4I1IA 2NUPB 4QUEA 4R1QA 3GG2A 1DJOA 1WP4A 4MAAA 3ENVA 4DMFA 1UBUS 1RMQA 2NVOA 3L1KA 4HDAA 5AHKA 1N0HA 1REQB 5KYKA 3ZVMA 1H8ED 5J23A 3N74A 3CUTA 3QF4B 5JT1A 2H65A 1W2GA 1YZ3A 4PFQA 3TZLA 3UPDA 4JHLA 1JEEA 4Q01A 3HP1A 3BQMB 3QA3E 1JWLA 4JA2A 4EYSA 4YMUA 4HQOA 1TMYA 5EZYF 2WJGA 3S3TA 1CF2O 1YO6A 4L4RA 3DV0B 4TRNA 3FLAA 3UGQA 2AUMA 5HJEA 2WLTA 2OCBA 3H83A 5JQGB 4F3TA 5LLTA 2QAGA 2GO7A 1KEZA 4MV1A 4JC4A 4LZNA 1SCIA 3PXBA 1NRWA 4K6HA 4DXAA 2BSXA 5C8XA 4LDAA 3HO1A 3IP7A 2ES4A 2G25A 1A7JA 3ECCA 3TEJA 2VDKB 2WINI 3C8HA 3SP1A 3B3FA 2VHWA 1E0AA 2AYZA 4B3DA 4FEAA 1JLRA 1ONPA 4OQDA 3G0BA 1ST2A 3D31A 4BX2A 2D2EA 4CG3A 5AJYA 1LBTA 3QFCA 4F5ZA 3QTLA 4DB4A 4TM8A 3MQFA 4AJJA 3IAHA 5FAKA 5EI5A 1U0BB 1N3YA 3TUIC 3ENQA 1H1DA 3R5TA 1XZKA 4NBRA 1CF9A 3THWA 2OAQ1 3DZDA 1U2GC 4W63A 1HC7A 1YRWA 1AV7A 3KKNA 3WVNA 1C4XA 1DIAA 2H4HA 2YRFA 1H0HA 3CPJB 5K3AA 4CTJA 3RQSA 4CV3A 1JEJA 4TTRA 3ZCSA 1TLFA 3JQ6A 2BMAA 3O1LA 3WLHA 2HFKA 3H3JA 3K1TA 4LW8A 3OSZA 4EQ6A 4CM4A 3G2KA 2GETA 3K0KA 1XVUA 1B3RA 2DY0A 4P4UA 4WESA 3K8QA 1P7YA 3KJEA 4DNOA 1OB2A 1IZ7A 3WGOA 2A35A 1W73A 4JBIA 3FR8A 4YH1A 1YR7A 3G2IA 3PC2A 1H94A 4BATA 2WTUA 1X8XA 1PYOA 4ZC1A 4YUXA 1JWBB 4RVOA 3X0DA 1S8AA 1VBKA 4INPA 3PKJA 3Q4GA 4NZ9A 3Q88A 2Q5OA 2I7CA 2QRGA 3WLNA 3B9BA 4Q47A 3SAJA 3SS9X 4EY5A 1XXHB 3LX6A 121PA 1QZTA 2GASA 3DD1A 1T9GR 4O4IB 4XDZA 1NNLA 3GLSA 1XZNA 2F64A 3PXDA 1N0WA 3IYLW 2XTZA 3QE0A 3E9EA 1K7EB 1BYIA 1E66A 1ZN7A 4QU8A 4FE3A 3A4IA 4BYMA 3LT5A 3LD9A 3Q7SA 3FNQA 4OQFA 3PYLA 1U2SA 1DKMA 1GU1A 4D41A 1TJPB 1GCGA 4GWGA 2OC4A 3R6GA 3T54A 5E2AA 3X2EA 1XPUA 3ITEA 2C94A 1ZG3A 2QT0A 4KN5A 1Z0AA 3MJCA 2ENWA 4RKWA 2ZJ8A 1UEIA 5TGDA 2QRPA 5WRFA 3GEHA 4JUDX 2D74A 2B4KA 2ZS9A 3TCNA 3JV7A 1LI7A 3KVOA 3IQDB 1GAWA 2FZLA 2P9ZA 4QJIA 5CVCA 2H2AA 5GGXA 3REFA 3ZD7A 4D9HA 4JOCA 1GZ3A 1SRRA 1A97A 3SQWA 3RUIA 3HU1A 5JNRA 1U6IA 2GTIA 2Z3ZA 3OA0A 5DULA 1ISGA 2BPOA 3VGPA 3BMCB 4YRKA 1SELA 1V3TA 3HEAA 1UBFA 4JP2A 4WN9B 4ZVLA 3IS3A 2IODA 2OECA 2QR5A 3ANXA 3R09A 2JVIA 2AFHE 1VSQA 4GR9A 1YVDA 1EFVA 2PXAA 4PO9A 3V1NA 3HKBA 1XO1A 5L6MB 4LZWA 3I6IA 1QMPA 3M3PA 1SXJA 3LUCA 4FX5A 1JHUA 3ZV3A 5JBNA 3I64A 4BE9A 5LYYA 3RTGA 3DULA 1PS9A 1IQPA 4KPYA 3A26A 2VYCA 4DPLA 4LY3A 1XHLA 3O1IC 1GNPA 4YWJA 5JPDA 3KKZA 1OAAA 3GEIA 4LDNA 5FD8A 1PQWA 1L5NA 1K6EA 3MRVA 1C8LA 1XRNA 1LDMA 4J6EA 4DLXA 3JWGA 3ESXA 5LP6A 2DERA 3T5MA 1F9EA 5DM0A 1J2TA 4WECA 5A3JA 3HM9A