5FROA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz446 (compound 4f)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5froA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5froA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5froA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5froA03
3SQ2A 4Z4CA 3MP6A 1W0HA 5T7BA 3WNEA 1RT1A 4CF0A 4UC4A 4E7KA 3PY8A 3WNHA 5HBMA 1C0MA 1S9EA 5KGXA 2FBTA 3FEOA 4C8OA 2YKMA 3AO5A 2YNFA 3F70A 3TAEA 1TKTA 3U3GA 4CFCA 4Z4IA 3OQ5A 3NGYA 4OLBA 1S1TA 2OA8A 3L2VA 3OYAA 2LRQA 4DLEA 5HROA 2KZZA 2L8DA 1OI1A 4M3UA 3MEAA 3DB3A 3T19A 3MXIA 4DTNA 4C8KA 5K14A 3L2QA 2E6LA 2E6MA 2IGIA 1A5VA 2JTFA 2FC0A 4KKOA 3V9XA 4J2EA 1XHXA 4CGJA 4NYNA 4FK4A 1BQNA 3RMBA 4IG3A 3KLFA 4IFYA 4B9MA 3SUOA 5CY4A 1TAQA 4HVJA 2KW4A 3RMCA 2HB5A 2X78A 1TL3A 4NZGA 4BD3A 1SSFA 3AO1A 4NYFA 4CCHA 4Y1CA 3AVGA 1U48A 4FVMA 3U3YA 4GY5A 3OYJA 4OVLA 4NCAA 4FLWA 2FHDA 1RDAA 4IKFA 4CK3A 1WSGA 1RDDA 3AO4A 2KZMA 3VQCA 5HRPA 1JLEA 1BI4B 4JS4A 1UWBA 3UWNA 2FBVA 2KTQA 4ELUA 3TAPA 4ICLA 1J53A 3NTIA 4DF4A 1RTHA 4N56A 3OB9A 2RHYA 2W42A 1MU2A 2OPPA 3K5MA 2XY5A 3MXJA 2O4XA 3I0RA 3OMGA 1J9AA 1RBSA 4IUQA 1C6VA 4CK2A 2MWPA 2GUIA 2QKBA 3DLHA 5SWMA 2LCCA 3OS2A 4J2AA 2JGUA 4CJPA 3FC3A 3QJ6A 4B8CA 1EKEA 3NE6A 2OZSA 2OPQA 3JSMA 3SPZA 4ZHRA 3IS9A 4OPJA 1T8EA 2K3YA 1KVAA 4OKJA 1CZBA 1HQUA 3ZSZA 4YNQA 3DRRA 2VYTA 3SQ4A 1KLMA 3RR7A 1B9FA 1BL3A 4HCBA 1IG9A 3DRPA 4LSNA 4DU1A 4HHTA 4BE1A 1U47A 3LX7A 4FYDA 1EX4A 1X9WA 1FKPA 1Z26A 3SQ0A 4M3YA 3PMIA 2PYJA 3FDRA 5C0MA 3HVTA 1JL1A 3AVHA 1S6PA 1NKEA 2RJFA 2EKOA 4O4GA 4RW9A 4GVMA 3LAMA 4M41A 1IKVA 3LP1A 2YHBA 2D9TA 4AHSA 4H8KA 1IKYA 4PQUA 4B9NA 5CIUA 4BWJA 2P51A 3OYCA 1MHNA 1DTTA 4C5GA 2DTUA 1LW0A 1YTUA 2L3RA 3KTQA 2HVIA 1BIZA 4KTWA 3KUFA 1FXXA 1CZ9A 4M3WA 2WACA 4ZTFA 2XK0A 3NF8A 4O5BA 2DY4A 3EY1A 3AA4A 2Z1IA 3OVNA 3TAFA 4KI6A 2HHSA 4I2PA 2A1SA 1KVBA 4CGFA 4OPKA 4KB0A 2RI5A 1SKSA 1RBRA 2F8SA 4YFUA 2PYLA 2QQRA 1WAJA 2VG7A 2X4WA 4MQ3A 1NK8A 1VK0A 4PLLA 1OYXA 3CYMA 4N47A 1IO2A 1ASVA 1L3SA 3PX4A 4CJ3A 1JLBA 1U45A 2G8WA 3O8VA 4L59A 3O4QA 1C0TA 1TK5A 5DMRA 4Y1DA 5FRNA 4FJ7A 4DLGA 3NTKA 4OKEA 2IC3A 1TKDA 3DOKA 3RRGA 3H8ZA 4N76A 2Z1JA 5J2NA 2X4XA 1D9FA 4RW6A 3ZCMA 3OY9A 4LD0A 2YNIA 2M1HA 1ZBUA 4O55A 4HUEA 3LP3A 3OYFA 1HNVA 1TV6A 3CFPA 4N5SA 4M3TA 4BE2A 1JLFA 1UA0A 2RI2A 3M8PA 2VWJA 3AO3A 1HYZA 3QEPA 1NJWA 4DS5A 1WJSA 3HK2A 1NJXA 4PLIA 5D6YA 5KE3A 3PMTA 2HHWA 4F3TA 3K5NA 4E19A 4QQGA 4B9XA 4KPYA 3EAEA 4BWMA 2HHXA 2MWOA 4CEOA 3LGFA 3TI0A 3MEGA 3TAQA 4DSFA 4FU6A 3KKSA 4IUUA 4FLXA 1G5VA 1C1AA 4LH5A 1WAFA 3G10A 5C6SA 1L3UA 2HHTA 2DFFA 4CHPA 4FM2A 3AVMA 3KLIA 4AH9A 3M8QA 3S3NA 4Z4EA 4JS5A 3HYFA 2LVMA 4G1QA 4N4GA 4EZ6A 4CF2A 4HTUA 3KIOA 1ZBLA 5EU7A 1DLOA 3G0ZA 4CJUA 3KLGA 2BE2A 4QQDA 1NJZA 5HLFA 2DFHA 2HNZA 1UAXA 1ZBFA 3DI6A 3F9KA 3SUNA 5KGWA 4TSXA 1SKWA 3AVIA 3FLGA 3AVKA 1UOCA 4DTPA 4CJSA 1U49A 1A5XA 3V1OA 1WN7A 1RDCA 4FJKA 4DSLA 3SYZA 3KLHA 1OZ3A 3V81A 4CGDA 5KRSA 2BUDA 1KRPA 4A4GA 3QNOA 3LZJA 3KKRA 1GOBA 4II1A 5JS1A 5J2MA 3PNWC 2RN2A 1J54A 4FXDA 4CJFA 1NKBA 4N4IA 5SZTA 1HJRA 1S1WA 1VSEA 3OYKA 1J5OA 1RCHA 4HUGA 3QERA 3PO5A 3F73A 1RDBA 3MECA 1RT7A 1QSLA 1NK7A 1S9GA 5KI6A 3D45A 4IUTA 1LW2A 2YNGA 2DFEA 3ASKA 3PX0A 3V9UA 3ZSQA 3L2RA 4PWDA 1S1XA 1N27A 3DB4A 4E1NA 2CKKA 3SI6A 3ISNC 2GFUA 3META 2OZMA 2B8AA 1JXBA 4BACA 1ZBIA 1VSLA 5FDLA 3H08A 2LDMA 1I39A 3K5LA 3RTVA 4A4HA 4ID5A 2RO0A 3MEDA 2KFZA 3GOXA 1QHTA 3TWHA 2RHUA 1RT2A 5KCOA 3KD5E 3NH2A 2HQEA 2ETJA 4BDPA 2D5RA 3BDLA 4C5HA 1ASWA 4DSEA 3V4IA 3THVA 4FJ8A 1KCFA 2XHBA 3ZEHA 4RW4A 4M3XA 4ZTJA 2B6AA 4A4FA 1CXUA 2O4XB 3DMJA 1S5JA 3TARA 2PQWA 2Y1IA 1NOYA 2EQJA 4FK0A 3EYZA 2VG6A 4CHOA 1XC9A 3S3MA 4E89A 3K59A 4FW2A 2FBYA 4CEDA 1XNIA 2XO7A 3OMCA 5IN1A 1IH7A 1BIUA 1TGOA 4OJRA 1D5AA 4GMJB 4LD6A 2HVHA 4CEZA 4KB1A 2G8FA 3ZSRA 3O3GA 4A4EA 3ME9A 1NK0A 2Y1JA 5KE2A 1LWCA 3PX6A 1LWEA 3NBPA 4KTZA 3QLHA 5E41A 1KHCA 3QKJA 3BDPA 4CJRA 4C5IA 1C0UA 2B5JA 2X6NA 3I8DA 4DSKA 2ZD1A 2ZQBA 4CEEA 2F5KA 3OYDA 3I0SA 4AILC 4B8AB 2GV9A 2RHXA 3KLEA 5CYQA 3VA0A 3NDKA 4CK1A 4DTSA 3LLRA 4CJEA 4E7IA 4MFBA 1RT3A 3WNFA 2OYQA 4W5OA 2G8IA 4N4HA 2E5QA 5C42A 3RR8A 3LAKA 3MXMA 4KV8A 1ZBHA 4OGCA 3K5OA 4FJ9A 3SV4A 1WSJA 4I9QA 4RG8A 4KO0A 1G15A 1WSIA 3NH1A 1RI0A 3AVNA 3MEUA 2BDPA 3SV3A 2OPRA 3TANA 2LSNA 4JLHA 3ASMA 4CJVA 2NUBA 4KI4A 3NGIA 2EHGA 5J39A 4E7LA 1TAUA 3S9HA 3MEWA 1REVA 3P5JA 2YV0X 1L3TA 3QEWA 3ITHA 1TL1A 1XHZA 2KFNA 4I7FA 3E9FA 2GF7A 4FJXA 4DTOA 1BCOA 3AVCA 4B9UA 1L5UA 3NFAA 4FJHA 4NCGA 4O0IA 4FLTA 4BDZA 2YKNA 5KH6A 1ZYQA 4F2RA 1DTQA 3MP8A 4EZ9A 4PY5A 4RW7A 2Q3SA 4B9WA 2IDOA 4NCBA 4DU3A 2IG0A 3IRXA 5D6WA 1RBTA 4O44A 3VQ8A 3H6ZA 2O4IA 1A5WA 3OYIA 1I3AA 1Q9XA 1WLJA 1NK4A 4NS5A 3NF7A 3ULDA 1SL0A 4OVAA 4CHYA 2EFIA 3DLRA 4CGGA 3V9WA 1Q8IA 4CFBA 3SNNA 3FFIA 4N41A 3CFOA 3AVFA 4KHWA 5DK5A 2X4YA 3AVBA 4WE1A 3LH0A 1VSIA 3M8SA 1C1CA 3DOLA 1H3ZA 2RJEA 2WONA 3TAMA 5C24A 4IG0A 3HL8A 1BQMA 3OS0A 3QNNA 4FZZA 4B08A 3LPUA 4CEQA 4LH4A 4DQRA 3LGLA 4CGIA 1XWLA 1QQCA 4DSJA 1WGSA 5JS2A 2DIQA 5KTQA 5KRTA 1KFSA 3L3VA 4FJLA 3HVRA 3P83D 4Q5VA 4FJNA 4FLZA 4QQ6A 3S3OA 1BGXT 3AO2A 4CIFA 4IUPA 1RILA 4CHNA 1IKXA 1VSJA 2XRIA 4ID1A 3VQ4A 2AJQA 3ZSXA 3E01A 3QEVA 1D9DA 3OYNA 3AA5X 2WOMA 5HP1A 3BGRA 1RBUA 4FW1A 3C6TA 2PY5A 1D8YA 2RJCA 1X9MA 1NK9A 2QQSA 3ZSVA 3DLEA 2HQXA 4IURA 4X34A 3CM5A 3VQ7A 1SL2A 4LSLA 3P8HA 3RMDA 5CYMA 2YHAA 5I42A 2E6NA 4FJJA 2GFAA 1JLGA 4QVZA 3PV8A 1S1UA 2GBZA 1TVRA 1T7PA 3LPTA 4Z4HA 4M42A 3Q1JA 3NF9A 4E7JA 4M3ZA 3V6DA 1U4BA 4CJKA 1GOCA 1HPZA 3DLBA 3V1QA 4Q0BA 3NCIA 1LV5A 2A1RA 3LDSA 1HYVA 3V9ZA 4CEFA 5J26A 1S1VA 4UQGA 4FM1A 3PO4A 3PFSA 3DLMA 1IKWA 1TKZA 1QSYA 4O0JA 3LP0A 3TAGA 4KHUA 2QKKA 2D0AA 1NOZA 1YT3A 2R5MA 5J2QA 3K58A 3L2UA 3LANA 3MO8A 2P1JA 4H4MA 3L8BA 4CFDA 4M45A 2P5OA 1HRHA 1BISA 3WNGA 4IDKA 3HJFA 1BCMA 5CZ1A 1RTIA 4DU4A 4EP5A 4FZXC 2HMIA 3P8DA 4KFBA 1W9HA 2RPIA 3B6OA 4AHVA 4CECA 4B9LA 3CQ8A 3OJUA 4CGHA 2R58A 3VQ9A 3DRSA 4K8XA 3IG1A 4FJMA 3TABA 3AVLA 4C8NA 4FJ5A 4IBNA 3ZT4A 1RBVA 2K3XA 1N5YA 4DTJA 4Q5WA 4FZYA 4CJQA 3HSTB 4C8MA 4J2DA 3K2PA 4ELTA 4BDYA 4CERA 2YRVA 2X74A 2LTOA 2QXFA 2BGGA 1ITGA 4Z0UA 1OZ2A 3VN5A 3LZIA 1KTQA 2IAJA 2D0CA 3QIPA 2O4GA 3LP2A 3C94A 3D0PA 1RT6A 1EP4A 1NJYA 4F4KA 5HRRA 3ZT2A 1LAWA 4B9VA 2RHIA 4DG1A 3ZT3A 1VRUA 1LAVA 1N6QA 4DQSA 4J2BA 2ZE2A 4QW2A 1TK0A 3KK1A 4CF1A 1YVUA 4W5QA 3OYHA 4XIUA 3HXMA 5D3GA 1QE1A 3VQ6A 1SUQA 4E1MA 3OYMA 1SKRA 3S6WA 1KLNA 3JYTA 2ITGA 1BHLA 1GOAA 3DLKA 2NLUA 3AVJA 4B9TA 2X35A 3LWLA 2E4LA 3HP6A 3O3HA 2G8VA 3HPGA 4CJWA 4CF8A 1R0AA 1JLAA 1B92A 3NTHA 3VQBA 3OYBA 3QBYA 3HPHA 4KHQA 2P0KA 4JRPA 4FLYA 4DFKA 2Z1GA 4DWIA 4HUFA 4L8RB 3KD1E 2G8HA 5J2PA 2XY7A 1WNSA 4ELVA 4W5TA 4E0DA 3SPYA 3SD4A 4CRIA 3LALA 4DTXA 3QEXA 3ZSYA 2Z1HA 2I5JA 3VQAA 3AA2A 4DTUA 1FK9A 4PUOA 4DQIA 1BI4A 4CF9A 3SCXA 3IAYA 3RWUA 2HHUA 1RTJA 1VSDA 2HNYA 3OYGA 1L3VA 3OYLA 1HNIA 1XI1A 4KHSA 3C4SA 4C5EA 2HHVA 3L2WA 1WJRA 4OKKA 5CZ2A 2XY8A 4F8RA 1CLQA 4FLVA 1X1PA 3LYIA 1KVCA 4DSIA 4QOZB 4FCYA 3VQEA 2JZ2A 4CEBA 3LWMA 2G3RA 3SUQA 3VQQA 2R7YA 3UIQA 1RNHA 2EQUA 5FROA 4LY7A 4IUVA 4FLUA 2EQKA 1Q9YA 3OS1A 4F2SA 2F8TA 5FRMA 3M8RA 2G8KA 3QO9A 3MAQA 1YTAA 4CJTA 4PL6A 1VSFA 2XDPA 3V9SA 2BANA 2IOCA 1EETA 4FJIA 4CHZA 3A2FA 1JXEA 4R5PA 3CM6A 1LWFA 4DFJA 3ZSOA 3O4NA 1Y97A 4K8ZA 4PA1A 2OPSA 2DIGA 4E7HA 1VSMA 3V1RA 1KSPA 3SUPA 4EP4A 4DTMA 4JRQA 5KCHA 4EDUA 1JLCA 2KQ2A 3K57A 3ZSWA 5IAYA 3L3UA 4I9LA 4KHYA 2X6SA 3QIIA 1VSKA 1TK8A 4HCCA 2R57A 4W5NA 4CE9A 1T05A 5I3UA 3HT3A 4CESA 5C25A 4RW8A 4AHTA 1QTMA 4CEAA 4FK2A 1HYSA 2QK9A 4CJ5A 1RTDA 1B9DA 3TR8A 3OYEA 3DM2A 3B6PA 2RJDA 3DLGA 4E3SA 4DQQA 3CG7A 4FL6A 4KRFA 4DMNA 1VRTA 1SV5A 2RI3A 3DYAA 1NK6A 4B3OA 2B4JA 1WSEA 3MP1A 4QAGA 3QINA 4KREA 4H4OA 3QETA 1FKOA 2D0BA 4AHCA 4CIEA 3QIOA 1Z25A 1EXQA 2BIVA 1JLQA 3OA6A 3ALYA 4AHUA 1X9SA 4Z4GA 3T3FA 2HHQA 2FBXA 3OJSA 4GW6A 3NH0A 4I2QA 3SQ1A 1K6YA 3RRHA 1JKHA 3SJJA 1O1WA 3QEIA 4DF8A 3VA3A 3VQPA 1CXQA 2EX3A 4B9SA 1NKCA 4HCZA 4OLAA 1HQEA 3CEYA 2YNHA 2M0OA 1QS4A 3NHGA 2F96A 5HRNA 2R5AA 2M16A 1KFDA 4CFAA 2HNDA 3C95A 3HP9A 2PZSA 4KHNA 3KJVA 2IS3A 3M9QA 4BE0A 4DTRA 3MEVA 3ZT0A 3PUFA 2RF2A 4DFPA 3QESA 1C1BA 2EQMA 5M9OA 1T03A 3EZ5A 3AVAA 4CJ4A 2ATQA 3P1GA 2G8UA 4KAZA 3E9GA 1UA1A 3HO1A 3NF6A 3U6FA 2HW3A 2RKIA 3NNQA 1SL1A 2RHZA 4RG2A 1QSSA 4DS4A 1JL2A 3AV9A 4Z02A 4CJLA 3O3FA 1TKXA 1ASUA 2BKDN 1RT4A 2XY6A 3KK2A 5HRSA 3NAEA 2P5GA 1RT5A 3VQDA 3ZT1A 4KTQA 5D6XA 1WSHA 4IFVA 2VWKA 3L42A 3C6UA 3AA3A 3HM9A 2VG5A 1NK5A 4OGEA 4FM0A 1F21A 3MEEA 3NGZA 4C8LA 4F3OA 4CHQA 1WJQA 3RMAA 3SZ2A 1WSFA 4Z4FA 1S6QA 2DAQA 2JLEA 4W5RA 4DFMA 3UT1A 3HPOA 1VSHA 4DQPA 1U04A 4FJGA 4AHRA 1HMVA 3KK3A 5J1EA 2L89A 3VQ5A 3CFRA 4M3RA 4QCLA 3T1AA 4CIGA
chains in the Genus database with same CATH superfamily
1YCSB 1BL0A 3MP6A 2HCKA 3WNEA 5CLSA 1BDGA 2P9PB 4CF0A 2XAQA 3GTLJ 5AQLA 2CZ1B 4EA5A 3WNHA 2DRMA 2I7PA 5JFRA 1C0MA 1S9EA 5KGXA 4CI0C 3FEOA 5HK3A 2MW8A 2O8BB 2YNFA 4ZZDA 3RSEB 3P9CA 1K9MO 3CLOA 4F7UA 1DKGD 1K0SA 3K4JA 2OA8A 4OAZA 5GAN3 3C7NA 4BVOA 1OU8A 2LRQA 4DLEA 3WHCA 3EG3A 2QWLA 4D5FA 2KZZA 2VE9A 1BR1A 2K4BA 1BYMA 3MEAA 3T19A 5IXBA 4B1UB 3CUQB 2DFIA 1XN7A 4C8KA 3HOYJ 3ZQLA 4PNOA 1A5VA 1WA7A 4ELYC 1R22A 2IGMA 4KKOA 2RQTA 3V9XA 4LITA 5IYCJ 1Q82R 2D0PA 4ZGEB 5JLHA 4B9MA 4A3IJ 3M1FA 5F0FA 1IF1A 4M78C 3CCVQ 4QT7A 1NGJA 4Y91A 3R9PA 3OR1C 1K76A 4E7ZA 1VQ4N 4J9EA 1YITQ 3RMCA 2FJ1A 1B8IA 4N4OB 4KGXB 1VQ7A 4F14A 3D5SC 2XF5A 2K4JA 3B02A 4NYFA 2OUMA 2NUTA 3C12A 4D5CA 3AVGA 1TWFJ 3UNGC 1FJLA 2QBYA 2CSQA 1IC8A 4GY5A 3NMUA 2L4MA 2K57A 2VBZA 3DXMB 1WHLA 2XF6A 2AS5F 1RDAA 4CK3A 1RDDA 3AO4A 4RLFA 2GQQA 1TC3C 5HRPA 1JLEA 4FWQA 1UWBA 3F5TA 3VUZA 4N9HA 4ELUA 4Y15A 2IXSA 1BOTO 1IBMK 4DF4A 1N8RR 3TO6A 2AKKA 2RHYA 1Q7YO 1LCKA 5IP9J 1X9JA 1UG2A 4OIPF 3BUZB 3D1NI 3OMGA 2W04A 1ZHFA 4MZPA 3H5AA 2IP2A 3VFZA 5FKKA 1E6GA 2VVKA 4XSZF 2HZYA 4FWLA 3EO3A 2Z5UA 1X4PA 1D1BA 2LCCA 3KCCA 5GAN8 3ECHA 5C2DA 4J2AA 1TWHJ 1A04A 5LHHA 5J8CA 4KJZA 5KYUB 3BG9A 3HRTA 4BKXA 4RGXA 4J9BA 2OZSA 3P9IA 2NUZA 5JHUA 3SPZA 3GBQA 5LHGA 3IS9A 2QM1A 5J4VA 2LNHB 3R60A 2LF7A 4PKGA 1T8EA 3H0HA 1YYVA 2JJ7A 1T38A 4YNQA 2MAMA 2VYTA 1KLMA 5JICA 2E1MC 1QW1A 3W3CA 1G2HA 5DM7F 3SAHA 2W41A 4K0KK 2O8FA 2QTVA 4RB2C 4HHTA 4BE1A 3LX7A 4B47A 1RUWA 5GJVB 1RADB 2DKGA 3SQ0A 4M3YA 2GIVA 2O6GE 1MWMA 3MD2A 3HVTA 3EFRA 4PKHA 1JL1A 4JYKA 1P6RA 1C0FA 3AVHA 1WI9A 2DAOA 2XPVA 3KZBA 2EKOA 4AFUC 3H0GJ 1UFFA 2OAZA 4JI2K 4B44A 3LAMA 1VQOA 2E1OA 3TSQA 4M41A 2K3PA 5K7HA 2D9TA 2E10A 1X69A 2M8GX 4DKWA 1HKCA 5EZHA 2LMDA 1AKHA 3F9MA 4XH5A 1R36A 1TYQA 4TV7A 3EFSA 4WCEL 1VQLT 4ENNA 1T3VA 4ITVA 3KTQA 2CDTA 3H9JA 3NVKA 1D09B 5CR2A 1YF5L 2KYBA 1FXXA 1PSEA 2M3AA 4ZTFA 3UKRB 1JJ2M 2QQ9A 2XAJA 1EH7A 2FRHA 2IS6A 3OVNA 4IHWA 2LC2A 1WSUA 3CESA 4R55A 1X2NA 5DD8A 5GAMh 2A1SA 2QGUA 3GMEA 1KVBA 3IRRA 4XONA 3V8KA 4QS7A 2RC4A 2O8DB 2O8EA 1W7PD 2RI5A 3M0RA 5M1QA 1K4TA 4YFUA 5KYXA 1ZQ3P 2QQRA 2DMQA 2SEMA 2P4WA 3EYYA 2E6ZA 2H3EB 1J3TA 1P2FA 4N47A 1IO2A 3ZETA 1L3SA 2Y9YA 4WF2A 1U45A 4OOIA 4V2SA 3KPHA 3TGNA 4IVNA 2IS1A 1N36K 3JCMW 2Q8KA 4Y1DA 5LGTA 4HT9A 3M3ZA 1FC3A 1G6NA 1X3UA 4BRGA 4DLGA 3MN2A 2FUG2 4LMYA 3QP5A 2IC3A 1TKDA 3RRGA 3H8ZA 4N76A 1VOMA 1EH8A 4BRNA 3IHOA 4M75F 2ED0A 4XLHA 2YNIA 4OFAA 1ZBUA 3FM5A 1A6QA 1MJAA 1YBYA 1T44A 3EUKL 1GCQC 3ZOBA 4AC0A 1FP1D 3BCBA 2LKPA 4M3TA 4IDHA 3ZQFA 1UA0A 2PLYA 1FOXA 2RI2A 3M8PA 1Y56A 1ZREA 4IHYA 1U1TA 2EJGA 1HYZA 1P59A 1E6HA 4ORZA 5CJ9A 3I3LA 5GAHP 1T08B 4JDSA 5KE3A 5GAMd 3UKGA 4JRIA 4ZYEA 5GAMj 4F3TA 4H5VA 3KP3A 3K5NA 5AQGA 1DT9A 4QQGA 1IN4A 2ZJQF 4KPYA 1WB9A 1USSA 4A12A 5E3LA 3CF2A 3A01B 1V5GA 3MWMA 2H3GX 3ZX0A 3A2KA 3G6EN 2V26A 1MBKA 3S14J 3VGKA 3HUGB 4FU6A 4FLXA 4M75D 1D3YA 1WAFA 4RAFA 2I5WA 5C6SA 1L3UA 3OH6A 2DFFA 3TCJA 4C92G 3AVMA 4KT6A 4EJOA 3M8QA 3HYFA 2NNYA 3TVTA 2ZFUA 4CO8A 1YI2A 4ABZA 4HTUA 2W6LA 1ZBLA 3RCOA 1XGSA 4CJUA 1RUNA 1Q1VA 4QQDA 5HLFA 3LA2A 1LE8B 3BR0A 4CJ7A 3F8MA 1K9MR 3DI6A 5LJ3h 1WZOA 5KGWA 4GYIA 2R0QC 1EWRA 1R5HA 1K83J 1K4SA 2P81A 1W36C 1YJNQ 3J80O 3VB2A 3RQ4A 3AVKA 4A2UA 2QM3A 3IRQA 3ATVA 1RDCA 4DR2K 3SYZA 1OV3A 5ELZA 4CGDA 4XMYA 5KRSA 1ZR4A 4BB7A 3DBLB 5GP9A 2CUEA 1KRPA 3BY6A 4J9CA 3I58A 4H0PA 1MSFC 2DMNA 3BR1A 5CE3A 4FHTA 2DPNA 5JS1A 3ZQHA 2BV6A 3NEUA 4ZYHA 2MC4A 3ZX3A 1QMCA 4FXDA 4CJFA 2HVSA 2DZCA 1K8KB 1EWQA 5GAOq 4MHGA 4EFHA 3VS2A 3HYIA 3J7YP 3I9QA 2MG4A 2NOBA 4E6KG 2OTLA 3AL0B 1RDBA 4YOQA 1RT7A 3LSMA 2MYSA 1WNLA 2LJ3A 3D45A 5AFUH 3V9UA 4NO7A 2E5NA 4AF1A 1S8NA 4UUSA 4KMFA 1JGSA 3C0CA 2CKKA 1K8KA 2JXBA 1VQ7N 4JKCA 1B59A 2W57A 5IT9O 1Z9CA 5DM6F 4J9IA 1K73C 2HQAA 5LJ3j 2I10A 2RNGA 2HTSA 4L9VA 3CCSA 2FD5A 5GAMe 1ULYA 1Q7YR 1BB9A 2VUMJ 2AZSA 4XU2A 3GOXA 4HNTA 2VJIA 5FPDA 4C92A 3KD5E 4ANJA 3NH2A 1I5LA 3DP7A 3QMLA 2D5RA 2YT6A 3BDLA 2Y9ZA 3HHHA 3AFHA 2JVVA 3THVA 1KQSA 1S72A 1GVJA 4FJ8A 3H45C 3HKZA 3TP0A 2PJRB 1OCZH 1H0MA 1CXUA 2O4XB 3HRUA 3H3NO 1MMDA 2XROA 1W2BM 2NOJB 4Y92A 2YHXA 3I59B 2XB0X 2VT3A 4RTWA 3J7AY 3WXIA 2IVPA 1NOYA 3EYZA 2XAGA 3DBRB 5J47A 1VQ7T 2IRFG 2A5XA 4FW2A 2KPMA 1Y1VJ 2MLKA 3RUXA 2ETHA 4PFOA 2XO7A 1TSFA 1PP7U 1BIUA 3E9PA 1TGOA 5FKMA 3PJRA 2WAQA 1UGSB 3C18A 2FF6A 1IZ1A 4RMNA 3O4WA 1U84A 5CVIA 2ZMEA 4MDBA 1ZR2A 2HVHA 3IWFA 3WVDB 1F1BB 3K4NA 3FXMA 3HFNA 3F6VA 4A4EA 1KG7A 4ASNA 3ME9A 4CW7B 2YLBA 5KE2A 1LWCA 3PX6A 3NBPA 3QWXX 4KTZA 1QU3A 3WTYC 3QLHA 1IB8A 3BDPA 4M7XA 2VXZA 4PJMA 5E3MA 1RL2A 4M7AE 2GA2A 2OJ2A 1VQON 4KT5C 4JD2B 1KO9A 4CEEA 5CVUA 3DXKB 1Y57A 3I0SA 1AT1B 1F5TA 1BKBA 3CCRI 2W85A 3H0IA 3NPFA 2CH6A 2BE7D 3MKDA 1M9SA 3M0SA 3TW7A 3VU3C 2JM8A 3BPXA 3L0QA 1RLPC 3CLQA 3OA9A 4DTSA 4C0FA 1KEAA 4E7IA 3FXLA 2ZPFB 2G0EA 1UHCA 1TH7A 2CSIA 2JSCA 1KYZA 2G8IA 1LKXA 2AXLA 3MXMA 2ZC2A 4DBQA 1KC8O 3M56A 4CH7A 4H5TA 4I6ZA 3K5OA 3ZRGA 4FJ9A 4GXOA 4CZCA 5DDGA 3ENBA 2IA1A 4RB1A 3F2KA 4I9QA 4RG8A 3Q7CA 5CKTA 8ATCB 3I4MJ 2F7TA 1ZELA 4UNOA 1WSIA 4X62K 2FOWA 4A54A 1RI0A 3THYA 3X25B 2Z0WA 4ZGJB 2V1UA 4RBOA 3H1CA 2OPRA 1GFDA 4CCJA 2M0CA 2FNAA 3BTLA 3HTUA 4JKGA 1QVGA 2LSOA 5I11A 2KJCA 4Y7NJ 1H8KA 1TAUA 1VQOT 3S9HA 2FX0A 1N77A 3M1CA 1A0NB 1L3TA 3QO3A 3BROA 1KD1C 2EWSA 2HEOA 2QQBA 3ITHA 1DP3A 1Q82U 2BW3B 1TL1A 1T6SA 4I7FA 2GF7A 4KH4A 1BCOA 3JB9I 2LX7A 4XRFA 3CCUQ 5ICGA 1TWBA 1IBKK 4HLYA 1P7IA 3VPZA 1ATSA 1MBHA 2WUSA 4NCGA 4FJHA 2DK3A 4FLTA 4PHTX 4HOBA 1OPCA 1BC8C 2CP3A 3HZ6A 1OMIA 4XKCA 1DTQA 3MP8A 1M8VA 2ABLA 1BI2A 4NQWB 5BRDA 4XH4A 2DK8A 1WJEA 2Z9OA 4C0DB 4DU3A 2H1LA 3H6ZA 1ARKA 2DQRA 3V8LA 3WUHA 5CYVA 1KSWA 2E5KA 4YHHK 4KN7X 3QYGB 2NS7A 2JWLA 1EF4A 3TU5A 2HQRA 2MPXC 4DHYA 3NF7A 3HBLA 4CGGA 2FSWA 1BC7C 1K79A 1N8RU 4CFBA 4N41A 3QSUA 3CFOA 1RKWA 3AVFA 4HA8A 4LUDA 5DK5A 1JRIA 1BOBA 5B5EC 1HK9A 1H9GA 4M78E 2PG4A 2JK3A 3CF5L 3DXJF 2J4RA 2GA1A 2VBXA 4FWNA 3CP2A 3CC7Q 3TAMA 4IQ4A 4IG0A 2OV7A 2FPEA 4XNFA 2M51A 3T5XA 1UJYA 2XDDA 1PUEE 3LPUA 4G6DA 3CMAI 5FO5A 5GAEP 5B66C 2EIFA 1YIJI 4C0ZA 2XPWA 2ZXWH 3FMQA 1YIOA 1TS9A 5GMKl 4ON0A 1MKMA 2DIQA 4F04B 4MO4A 4BQOA 2JA6J 3QBXA 4A6DA 3OWTA 1G3SA 3O6BB 1KFSA 1UGQB 2KNBB 3L3VA 4M7DG 2LCLA 3P83D 4Q5VA 1KYWA 2M4KA 2F5CA 4QQ6A 3QODA 5E8GA 3TO7A 4XR6A 3SMPA 3AO2A 3I55Q 1RILA 4FWMA 2YUSA 1IKXA 4PJJA 4KNYA 1FBQA 2E88A 3FZLA 3ZN1A 3ZSXA 4F7UE 2LDUA 2P9NB 1D0XA 3THXB 1YQRA 2LFBA 2EBPA 4BRFA 2AT1B 4EJWA 2Y0MA 5HP1A 2GWKA 4PKIA 3SEQA 2DXTA 1RBUA 4FW1A 1PP8F 2PY5A 4M6YA 2STTA 2V75A 4JI0K 1WRJA 3SDGA 3S15J 2HBMA 1NK9A 3IUOA 3O1BA 1ZQ1A 5FU6C 2M0MA 4BVPA 3QOEA 1QVFS 5AQQA 4EM0B 2FZKB 1M2VB 3INZA 4LF6K 3WGGA 3AAPA 1D1AA 2PMUA 3HBTA 2YHAA 1UB4A 2RK2A 1WXTA 3E3VA 4C1NI 4XKWA 2R7XA 3D5RC 4FOIA 4C0DC 2Y90A 2KLAA 1AA7A 3SB2A 5IH2A 3I33A 2X48A 1JLGA 4A2AA 4LFBK 1YI2T 2KRMA 4JLIA 3BEXA 2GXAA 1O7FA 2OANA 3M0UA 2OTLN 1IREB 4V19S 3DLAA 2VC0A 2Q36A 3Q1JA 2LKSA 2YUNA 4M3ZA 1U4BA 4CJKA 2NXNB 5FFXA 3V1QA 1T2KA 4Q0BA 1LV5A 3V8JA 4FM4B 4UQGA 3FBIB 3PO4A 5KYYB 5J1RA 2A07F 1Y96B 3LP0A 4OMLA 2DCEA 1M1FA 1X6OA 1VQNI 2PTKA 3CCSN 2DLLA 3SXYA 3BR3A 4KITB 3K58A 3WXLA 1LOJA 2CQ7A 4O3MA 4QPQA 1WH5A 2EYXA 1VQ8A 1HRHA 1QQIA 2MI6A 4IDKA 1JXOA 2XICA 1R5GA 1BCMA 2DMPA 4DU4A 4HEA2 1IG8A 2CP7A 2COWA 3HKZN 1NHAA 3DRSA 2A6HF 4K8XA 1NWKA 5JMVA 4M7DA 3LSGA 3AVLA 1HUXA 3ZN0A 2OTLT 4FJ5A 4IBNA 2VKVA 3RKXA 1YAGA 3TMOA 1N34K 1RBVA 4DTJA 1AOYA 4BJTA 1YFNA 3A5NC 1GV2A 2D1KA 3E9LA 3HSTB 4C8MA 3BC8A 4FOEA 2QXFA 4JZ3A 1R0BG 2ZCWA 1KJWA 3CBPA 3J7AF 2CQXA 4HF1A 3QIPA 1YWOA 2X3WD 4LIVA 2EYQA 2PFBA 1RT6A 1EP4A 2VUBA 1NJYA 1J75A 1LAWA 1XC3A 1YHQA 3CCST 1Q81O 4B9VA 2WAQN 3EPZA 1KU3A 2PMZA 3ZT3A 4DG1A 3SDZA 4JQFA 1N6QA 4A0XA 2IPQX 1R8OB 4KIFA 1SD7A 4CF1A 5CQXA 4E9HA 2Y31A 4F52A 3HXMA 1R9TJ 1VQ5I 5D3GA 1M8MA 3VQ6A 4E1MA 1MIJA 3QU6A 1S72T 3ECOA 3OYMA 3H3ZA 1EV7A 2ME0A 3S6WA 3S6IA 3JYTA 2ZGYA 3CJ1A 1VQ6A 3H3OB 1BHLA 4A4KA 2O31A 3DLKA 3TSZA 3CVTA 1YJ9N 4JI3K 2Q1ZB 3LWLA 1HW1A 1OCCH 3DPTA 3CMAQ 2BTTA 3MN9A 1T0JA 2UXXA 3CMEI 1KC8C 5KYNA 1YIJQ 2CP2A 4DV5K 5A2QE 4C8QG 3IH4A 4BHPA 1KC8R 3G0QA 3OW2A 1K9MU 5LRRA 4JRPA 2YSRA 4FLYA 4A5AA 4A2BA 2Z1GA 2YXYA 4L8RB 3KD1E 2JUGA 3FBNB 2HDDA 4M7DC 5J2PA 3A1YA 3FK6A 4CC4B 1WNSA 4YOTA 4E0DA 1HKTA 4CRIA 1OCOH 4I0BA 5TKWA 2W84A 4BS9A 3CC2I 2CP0A 4G8XA 2R7WA 5JVTA 2YWWA 2UUBK 4PUOA 1BI4A 4CF9A 5KN9A 3DTIA 3SCXA 3TL4X 4ZZLA 3MQ0A 2E2NA 3OYGA 4PK4A 3HTRA 3O9RA 1XI1A 2HL5C 5HLTA 3G71A 3L2WA 1VQMI 2J7IA 3CQZJ 4Y3OA 1G83A 4DSIA 1UMQA 4WCIA 1NLVA 4CZLA 1U06A 4FCYA 3VQEA 4B1ZA 3IMXA 1H3HA 2FXUA 3ISPA 4RTVA 1HSJA 2V6EA 2GTDA 5CKDA 3SUQA 5LEJA 1KAZA 1S5LC 2HHHK 2M45A 4K11A 4XK4A 2VOOA 3AT1B 4CI6A 1IHVA 4R1HA 3KZZA 2V4JC 3I5UA 3H1QA 1W7PB 3PIOF 4BJ5C 3F23A 4F2SA 2F8TA 3B6CA 4EHUA 3CP8A 4DZJA 4MO5A 2NOFA 4DQ8A 2DMUA 2B9SA 4ZN1A 3MAQA 4LOCA 3G4SN 1YTAA 3RPQA 4CJTA 4RB3C 3GPLA 3VS3A 4ILHA 1JXEA 4R5PA 2UUCK 3K2AA 1LWFA 1Q7YU 4ESFA 1Y97A 2PN6A 1BG3A 2ISZA 4OMPA 5IYDJ 2DIGA 1VSMA 7AT1B 1M2OA 3A0IX 2KK4A 3L4IA 2WB1A 1VQ9Q 4IRIA 1QLYA 5KCHA 4B09A 1HJDA 1KG5A 3K57A 3FHFA 2UXCK 3IC7A 4Q5SF 4DK9A 2E36A 4IEIA 3EH2A 1YI2I 4J6XA 3CXCA 1VSKA 2COZA 3QJYA 4EVIA 2X6OA 2RHKA 2JPBA 4C8QA 5C25A 3KEQA 1XNQK 5BPDA 5TISC 1QTMA 5GPCA 4CEAA 1MV3A 3D7SB 2BXYA 3NRVA 2QEXA 2O9SA 1GBRA 3O6WA 1A31A 3GEZA 5AZJB 1NG2A 2A42A 2XPUA 3CPEA 4CYCB 2ROLA 4FL6A 1HR0K 2RI3A 3MX2A 1KQSP 3LA3A 1S6LA 1MZBA 5B1AH 4NC7A 2BUPA 1U6GA 3K4LA 4M75B 3MP1A 2F69A 3CD6Q 1MUNA 1SFXA 2DFUA 3CMMA 3SAGA 4PJOF 4H4OA 4AHCA 2GWRA 2M30A 4Y13A 1Z25A 3UA6A 1EXQA 1FPQA 1GLBG 3FRNA 1WBDA 1T3SA 1RR7A 1X3WB 2A08A 4U67L 1VHXA 4I2QA 4L0YB 1HYOA 3HFOA 4BY1J 2D0OA 1K6YA 4DR5K 3VYTB 4WWCA 4M77F 2KZVA 5EG2A 4DF8A 1U0JA 3ULRB 1WPKA 2VKNA 2MC3A 1YNZA 3NMZC 5BS6A 2YNHA 3SWNB 3QB0A 4JKEA 3I9V2 1R58A 5F27A 1R0CB 2FZGB 4BG9A 3F8CA 4WXDA 5ICCA 1KQ1A 1QS4A 4KH5A 3SHFA 4E7SA 5F64A 4BQAA 1VQ5Q 1XMXA 3CCLI 2XG8D 1CKAA 3CZ6A 3GLXA 4GVEA 3C95A 1KAXA 4L6V5 1U2VB 2EW3A 1AHJB 3M9QA 1VQPQ 5KYWB 1WHKA 4DTRA 3E5UA 4G6QA 3TSPA 2FBKA 3SJMA 2FBIA 1T03A 1V76A 5FU7B 5K5QA 4HRIA 3CMEQ 2J05A 4CJ4A 3TEDA 4X6AJ 2ATQA 3P1GA 1P4AA 3HSRA 2CW7A 1OH7A 1RETA 4CZFA 3REOA 1WHGA 3U6FA 2KJBA 2RD1A 4GYGA 2RKIA 4B3AA 2QGFB 2JTEA 1FYMA 4M77D 3E1YA 5AQZA 4DS4A 3REAB 4YG2F 5FWCA 3O3FA 1MMGA 4GV6A 3KP7A 2BKDN 1RT4A 3WVEB 2P9UA 3IFRA 3A4CA 4JBAA 1MBJA 3U1KA 1S72I 3CCMI 1SEUA 1Y39A 3HOTA 5HRSA 5B1BH 1I5ZA 2P5GA 4GFBA 3S32A 4Y33A 2E5LK 4MIMA 3CC4Q 2BY2A 3CCVA 1VQ8N 3AA3A 3OIPA 4FWRA 4B3XA 1NK5A 3JRBA 4JKHA 1YITA 4F3OA 3FISA 3SZ2A 1ETYA 1ABOA 1WIEA 1S6QA 2F9TA 3UT1A 5FFZA 2VJ4A 3ZR8X 2DO7A 1VSHA 1ZGWA 1U04A 3K4CA 1D3BA 4BBRJ 4LE9A 2RREA 3MMYB 1W1FA 4YOVA 3CCJI 4M75C 3ULEA 4P1WA 2L89A 2JRMA 3VQ5A 5C2FA 2F6CA 2CWEA 4M3RA 3CPFA 1QQNA 1QVGP 4I6MB 1QCFA 1M1KC 1Q81C 1X3NA 4A57A 2F5VA 4AYBA 4W97A 1Q81R 1PUFA 3HXLA 3SQ2A 4Z4CA 2XV4S 4G6TB 3S93A 2LNVA 4A59A 1PC0A 5T7BA 5LJ5h 2R7FA 1ERDA 2L7ZA 1E4GT 4ISFA 1I6HJ 4E7KA 3ENHA 3DBHB 2KSSA 5HBMA 5BPNA 1TQMA 4C8OA 2YG8A 2KRSA 4U7DA 4AMCA 3F70A 2CH4W 3TAEA 3U3GA 1YHQN 4CFCA 3A1PA 2LY2A 1V54H 1PKTA 1YJWN 1PRMC 1DPUA 3GNFB 1VQ8T 3L2VA 5F1JA 1W4MA 3OYAA 3SEZA 2LKXA 3CWAA 3SBTA 3FXRA 2X1CA 3AG3H 3THWA 2R5ZA 1OI1A 3DPLC 1VA7A 4M3UA 1MBFA 3U9ZA 4AIJA 5GMKh 5K14A 2DK5A 1C0WA 3L2QA 2FRYA 4EJVA 2F5TX 1LDKB 4IZZA 1KU7A 2IGIA 1VQ6N 3EG9B 2FC0A 5J8FA 2WSFE 3E0JB 1ATRA 1XHXA 1S7AA 2ISYA 4FK4A 1DGWY 2H56A 3RMBA 4IG3A 3KLFA 4B6MA 3VYUB 1XPXA 1MD0A 4KYWA 4LF9K 4BY9C 1TAQA 2GZWA 4HVJA 1PVEA 5F0CA 1BK2A 1KG4A 3QDKA 2G9WA 4NC6A 2ZNZA 2GAUA 4HVVA 3I56A 1G99A 4BQZA 3WT0A 5EEAA 4CCLA 2CGJA 3MKLA 5FB2A 3D5LA 4CCHA 3GOIA 2BY1A 1YHQT 5A2QZ 1GLDG 4FVMA 3RR6A 2HSPA 5FPNA 3Q0WA 5GJWB 2W24A 4IF4A 3X20B 4A5MA 2HXOA 4HXJA 4RTXA 4FLWA 3O9QA 1RAGB 5E26A 2JPCA 2FHDA 4HF2A 3CHWA 2RVCA 1WSGA 2E2JJ 4L5JA 2ZBKA 2KZMA 4JS4A 2KTQA 3K69A 3G71N 4EGYA 3KXTA 3TAPA 3J80E 3OW2M 2O8XA 1MU2A 1ETWA 5TJJA 3FXQA 1VQ6T 2XY5A 4V19K 4BRKA 3I0RA 4OF1A 1J9AA 1JCEA 3RI4A 4KH1B 3H0FA 5IP6A 2XHIA 3OSSC 1I8FA 3V42A 4RCCA 1XX5A 4XN0A 2QKBA 5GMKj 4EJTA 1JTYA 3PSIA 2V8JA 3HHTB 2GXGA 2CQNA 4CYDA 2OA4A 3KWGA 1MUYA 1NMDA 1Q95G 3QJ6A 5BR8K 1AWJA 1EKEA 3CJNA 2OPQA 5GPAA 2R7VA 5TGTA 1BU1A 2GLOA 4OPJA 3EFOB 2F4IA 1KQSS 3TU4K 4CZGA 2DO3A 4K42A 2EZLA 3IL2A 3CQXA 4K25A 3SEMA 3ZSZA 2XGEA 3P39A 5C0YA 3CCEI 2FSNA 2L3DA 3FJ5A 3NARA 3WTZA 1NGIA 1MDMA 1VIEA 4HCBA 1BL3A 1LEBA 2EJ9A 1LCUA 3DRPA 4LSNA 1U47A 4FYDA 1EX4A 3G71T 4OO1J 4O5FA 4F93B 4DB3A 3F10A 3JCMf 3MMVA 3P4IA 2W1OA 2V9VA 1E3OC 2HPIA 1CGPA 2LBFB 4CZEA 2RJFA 2VKDA 1USTA 4O4GA 2K27A 3JSCA 3M8EA 3A98A 3N05A 4XQFA 2JWKA 2Y4YA 1IKYA 1ZUKA 3R3LA 3BQYA 4B9NA 3CPWA 2VC8A 4R0KA 1SSHA 2A68F 4C5GA 2FQ4A 2QEXN 5D5WB 1VQ4Q 4XAXB 4N4NB 1ZBXA 1N32K 2Q2EB 3OS5A 1AZEA 2V52B 1ESVA 3VEPA 1YW9A 4IIMA 4BR2A 4M3WA 2QVOA 1W97L 3CO7C 3PFYA 3NF8A 1RAEB 2DY4A 2KQRA 5TRDA 3EY1A 1NH3A 4B1YB 3VGMA 4KI6A 1LFPA 3L7WA 2ZFWA 2OCCH 1LEAA 3CJRB 1M3HA 4A5NA 2DT6A 2HSTA 1TZLA 1FT9A 5LJ5f 3LSIA 3OSFA 2XDBA 1OJLA 4UVAA 2PZ1A 2HNHA 5I21A 2VT2A 3E5QA 3PUBA 1WAJA 3Q7BA 3BTCA 2VG7A 3U9DA 3GFIA 2X4WA 4MQ3A 2KQWA 2AQEA 1VK0A 3FZFA 5LMNK 3CYMA 3EGDB 3RQIA 3PX4A 3FZMA 4CJ3A 1JLBA 1A36A 4D9JA 5I9EB 1YOVB 2KKZA 3IH3A 4BC4A 2E1CA 3A8HB 2K7LA 5DMRA 4LNPA 1R5ID 1O3TA 3L1AA 3OBWA 5GMKe 2FXAA 2QEXT 3NTKA 2QA4I 4OKEA 4BEHB 2LC4A 4EPCA 5FKNA 5J2NA 1D9FA 4ZYDA 1QVGS 4UOBA 4JNEA 3ZCMA 4LD0A 4E6RA 2M1HA 2QASA 4HCKA 3RYRA 5DCFA 1HNVA 1SRMA 4BE2A 2B63J 3CMYA 1AU7A 2R92J 3G1MA 4HG2A 4DYQA 4D0PA 2Z33A 3C6AA 3AO3A 1NJWA 2MSYA 4DS5A 4NXMK 2P9IB 1N75A 5D6YA 2JUFA 2JG6A 2HHWA 3OIQA 4HYEA 4BRLA 1LWWA 3OW2P 4BROA 3UKUB 2WTEA 4J8OA 3QYHB 2MWOA 3QYFA 3M4YA 4MEXF 2P0PA 5DCMB 2A28A 1ABQA 2YDLA 3KKSA 5LEKA 1G5VA 1C1AA 4LH5A 2CGKA 3G10A 2P9KA 5K7FA 3WE3A 2YUOA 2L2OA 3I5RA 4M7DE 4FM2A 4J00A 3L9FA 2MA3A 1RI7A 1O3QA 3K4BA 1A6IA 4MFDA 1MA9B 1XGOA 3S17J 4Z4EA 2KRHA 3I54A 3M1EA 3Q5FA 4LD5A 4EZ6A 3O5ZA 3TPQA 3JCUC 2FZCB 4E4HA 2M87A 3FZVA 4ESRA 2ID3A 3AG4H 5EU7A 4UXNA 2ZJRL 2BE2A 2NRHA 2V1RA 4EQQA 1XD7A 4AIDA 4YOUA 2HNZA 4BC5A 1ZBFA 3BF3A 4QLCU 3OHRA 3KEYA 1OYYA 3F9KA 4H5WA 4EJUA 1CSKA 1SKWA 3AVIA 3LM2A 2OFIA 4FL9A 3EG0A 3WTTC 1UOCA 4DTPA 5K5RA 2IT0A 4OMYA 3V1OA 3WQTA 4KULA 4A5BA 3CJAA 3V81A 2E2OA 1VQKI 3E6BA 3CCVT 5AQRA 3VPRA 3VGLA 4AVZA 3HIFA 4G7ZF 3KKRA 1GOBA 5AZIB 5D6FA 1APLC 1YITT 3HM5A 3ZEUB 2ZGWA 4JHDB 3M4GA 1WBBA 3MN6A 2ZSHB 1I5OB 4JJCA 3DWLE 1J5OA 2EINH 3O8GA 3GUDA 1RCHA 3QYEA 4YOWA 4CZIA 2M4GA 3F73A 3ULQB 1D0YA 5J3BA 2IA0A 1BWFO 2HF4A 2M1BA 2YNGA 3ASKA 4FWPA 3CXCP 4PWDA 5EG0B 3SK3A 3HGYA 1LFUP 3DB4A 4X9DA 3I56N 2L7KA 3SI6A 4Z2YA 1JXMA 3META 2MD5A 2OZMA 2KFDA 1YVNA 4EEFG 2DDBA 1JXBA 2VC1A 1ZBIA 1A5JA 1WDXA 4D8KA 2RKHA 4OINF 2RQVA 3RNJA 3K5LA 3RTVA 2VXDA 4A4HA 2YRCA 4ID5A 1HLUA 1G59A 1YQLA 3TW6A 3MEDA 2VL8A 3VW4A 4JKBA 3G6EQ 4JJNK 2YSQA 1MMAA 2EFWA 1FBUA 3HHGA 5LY3A 1RT2A 5FKOA 4EMHA 2XASA 1XGMA 5BPLA 4CA0A 1WCMJ 5AIQA 2XKOA 3CWSA 1J7KA 4FTHA 1NGFA 2BE9B 4DR7K 1SG5A 3ZEHA 4MLEA 4DV4K 2LYCA 1E3PA 3T8TA 2B6AA 2X1EA 3DMJA 1S5JA 3J80Z 1TNTA 5AQMA 2XSDC 1NPPA 2VG6A 3R1XA 3HSFA 2L7FP 3I56T 5ED4A 3S3MA 2GNCA 2PX9A 2GELA 2VQEK 1HKSA 4CEDA 4FO0A 2VQGA 2RGVA 4BRIA 2COMA 1XNIA 4LDYA 3SFMA 4PL8A 5IN1A 2IGKA 4FE7A 2HKQB 4KIGA 3EYIA 1MNDA 2DBMA 2LY9A 1KG1A 2CSOA 2IJLA 2YUPA 1BI0A 2QAZA 4OJRA 4VUBA 1IN7A 1D5AA 4GMJB 2E1NA 1IDZA 4XTWA 3O80A 1ONVA 2G8FA 3BDDA 2OCEA 3CCUA 4L0ZB 2E3HA 2K9GA 4M63C 1RRJA 3O3GA 1DGRM 3PVLA 1BA5A 2HYGD 1T0FA 1UGPB 4LDUA 3FSPA 3J8AA 2GQVA 5JLXA 1BA0A 3SMSA 2EQRA 2KT8A 4CJRA 1HPMA 1SMYF 3EGXB 1C0UA 1B34B 3ZMDA 4ENJA 3I8DA 5ECAA 2Y4XA 2EYZA 4UY8I 2KAFA 3HPWA 4RM2A 1FJGK 1EA3A 2XIDA 4DSKA 5IT9Z 2RMOA 2L0KA 5GAN6 1FMWA 1RIOH 5BRHA 4B8AB 1Y1WJ 1IV0A 3QPSA 2XKOC 3CF5F 2D45A 1ZLJA 1GLEG 3C1DA 2C06A 3NDKA 2MMPA 3U4LA 3RZOJ 3WEEA 3ZXSA 5LFAA 2NS0A 1VQ7Q 4CJEA 1W70A 4MFBA 1E17A 2PUKB 3R6MA 3J7ZO 1RT3A 2VWBA 2GTOA 4N4HA 3PIPA 4HX7A 4OMZA 4DQ2A 5E1WA 1R7JA 1E0EA 1D4XA 4UHTA 1JI8A 4QVCA 4N0AA 1FOWA 1M3QA 2EBIA 3S2DJ 4YOXA 2R7QA 4KO0A 2CRGA 2ZSIB 1STZA 3Q9VA 1K4US 3NH1A 1QRYA 3AVNA 1OX8A 3MEUA 4R8HA 3GTOJ 4M75E 3SV3A 4CZHA 3GBTA 2LSNA 1NEBA 3FF5A 5EGOA 3ASMA 5H6RA 2RN7A 4DNCA 3GF5A 4DV2K 3R0AA 4EMKB 3RTRA 1AZGB 1NM7A 2E5ZA 2X9DA 4M9ZA 2L3SA 5F6FA 2GBYA 2Q97A 2XAFA 3JB9G 4M3EA 1XHZA 1YTYA 3I0TA 2KFNA 1FTZA 5D5VB 3RKQA 1JEGA 1U8RA 3QHSA 1T0FC 4NB5A 1IUFA 4P5OA 4LF8K 5C4XJ 2EYWA 1V4SA 3GTPJ 1UE9A 2BH1A 4HSRA 1XMOK 1FIPA 1W5CC 1N78A 5JI6A 4RKUE 4OMFB 2OTJN 2WWYA 1PRLC 2P7VB 3VS6A 3KX2A 3E6DA 2GIZA 2B7EA 2IG0A 2ASPA 2QYOA 5D6WA 4O44A 5CCAA 4A3KJ 2EVRA 1HSQA 1GL5A 1IV6A 4ZGDB 2RQQA 2EPDA 4M78G 2K3BA 4Y17A 4EA4A 5HNHA 2ZPHB 1Z91A 1PU6A 1SL0A 4OVAA 4CHYA 3DLRA 1TUUA 1AWWA 4LFCK 3SNNA 3FFIA 4XU3A 4IFEA 4M7AD 2UZKA 4KHWA 2NVUB 1QVFA 3TTDA 1VSIA 3FKIJ 4N0AC 1RR8C 3JREA 3CCRA 3MZ8A 2EZIA 4UV8A 2RJEA 2CUJA 5C24A 3VS4A 2GTJA 4TVRA 1VQOQ 5HLIA 3QNNA 3O3KA 4FZZA 1D8KA 2DQLA 5DUIA 2KBTA 4LH4A 2CGPA 3LGLA 4BHCA 1DGKN 1LQ1A 2YJEA 2GOMA 5LGNA 1TBXA 1Z0XA 4PJOA 1M1GA 2VN2A 2EZKA 2GBQA 5HDGA 2NS8A 1YRNA 1ZUYA 3WTXC 4C30A 2NNNA 5KTQA 4BL0B 3GO5A 2V7YA 1F43A 2IVMA 1RRQA 1R00A 2KMUA 3R8EA 4BGAA 3EH1A 4FJNA 5IXFA 3CXCS 4M77A 4BC2A 2EGEA 1BI3A 1W0TA 3AY9A 2LQWA 4L9NA 4IUPA 3THKA 1B6AA 5EEGA 4RGSA 3VSLA 4M71A 1VSJA 1NLPC 4BRAA 3MVPA 2FL7A 3WU1B 4ID1A 2AJQA 3GCMA 3OV8A 1W6XA 4BI4A 4EMKC 3DTEA 4IO8A 1WHMA 3OYNA 1R1VA 3CCQN 1YO5C 4XTZA 2E70A 1VZ0A 1NPRA 2IA2A 2DJIA 4HDUA 1NK2P 3BGRA 2E19A 3I4NJ 3QQAA 1FYKA 5GANg 1IJWC 1GXQA 2HBJA 2RJCA 3C6TA 2ELKA 1HKBA 3TREA 2VB6A 3W3DA 3ZSVA 1AWCA 5AT1B 1EQYA 1X3MA 1WHHA 5KVRA 2P9SB 3MK6A 3ID6A 4X34A 4C2MJ 4HT8A 4UB6C 3L1PA 5E79C 3DLLA 3WG7H 3RMDA 1UJ0A 2LVSA 5I42A 2E6NA 4FJJA 2YS9A 3KE2A 2MH2A 3BR6A 2FF4A 2VBWA 2NUPB 5LD2C 4GCVA 5ILSA 3UE5A 4JEPA 1QBJA 1SRLA 5CQYA 4JLGA 2XI9A 1S1UA 4XLCA 4F3QA 2GBZA 4HW0A 1KFZA 3LFKA 4M6XA 2CV1A 3JS6A 3LPTA 1IHWA 2KXDA 4IHXA 4Z4HA 4M42A 4R56A 2LOOA 3H3UA 3NF9A 1R4MB 1T56A 2CG4A 3FX3A 4PJOC 1QWEA 1GOCA 1HPZA 5CR4A 1G4DA 3QPHA 3S41A 1WGXA 1B72B 3VODA 3LDSA 2VJ5A 1HYVA 4LG0A 3WE2A 3LL3A 5A0DA 1JJ6C 3I71A 1S1VA 3JTGA 4C3IJ 4A3BJ 4FM1A 3CPWP 3E1SA 1IV8A 2O8KA 3BFMA 4M78D 1IKWA 1M90O 4O0JA 3TAGA 4B9QA 4Z88A 4F7UF 4M77C 4B1VA 1NOZA 2R7ZJ 5J1UA 3CMAA 2Q0UA 5KK1A 5D8LB 1YIJA 3M0QA 4B23A 3QDRB 5M5YJ 4CHUA 2DNUA 1YJ9I 3O2PE 3ERED 1PHTA 3HJFA 3JCMd 4WQ5C 3DEUA 1XQPA 1RTIA 2WY7Q 1R77A 3VUBA 1XQOA 4U87A 2AHQA 2HMIA 1X3ZB 4L9TA 4OFHA 3B6OA 4AHVA 2VE8A 3OJUA 2FOKA 3VQ9A 5DUKA 2JWTA 1HD3A 4FJMA 4WTOB 2YHTA 3E7LA 4DYRA 3ZBDA 1SS6A 3ABUA 2RQPA 2K02A 3OSGA 2K3XA 1N5YA 3R4KA 5L3EA 2HGCA 1VAZA 4FZYA 1NNEA 4M72A 4BDYA 2E2IJ 2MLGA 2LT4A 5IHIA 3BR5A 2LTOA 2P9PA 4OPAA 2NOGA 3LZIA 3TBIA 1KTQA 1OPLA 2O8BA 1Q82C 2IAJA 3RSEA 3LSHA 1Z9QA 2RB6A 1ZSGA 3MHXA 3C94A 1RUOA 2DODA 2LK2A 5HRRA 3EKSA 1WOQA 3LWIA 5D6EA 2DA5A 4PUSA 1OVQA 3PNTA 4DQSA 1OLTA 4MMLA 5C4JJ 4GY2B 2LR8A 2DVEA 1TK0A 1RC9A 3KK1A 2A5WA 1BN5A 3K0SA 2MOXA 3L4QA 3L2CA 3BPVA 3CUQA 4AI4A 3D2FB 3KP5A 1JHHA 1YVUA 4W5QA 4WFNL 2DOAA 1TL8A 2KXCA 1FEXA 1QE1A 2QWOA 1SUQA 2E41A 1POGA 2DL7A 1BU6O 2EFNA 4KBMB 1HC8A 4OIQF 2FG0A 2K5FA 1WVRA 3N5NX 3QUIA 4RCHA 5GAN7 1IG7A 4P9FA 2EV6A 3MCZA 3M3YJ 4B9TA 3BG6A 4MGRA 4A3JJ 2G6FX 4YOYA 1MMNA 3O3HA 3WTWC 3HPGA 1N8RC 1U9NA 4X0GA 4FSXA 4FYVB 3G4SI 1JLAA 3FIFA 2OTLQ 3OYBA 3AARA 2KDSA 3M5RA 5F04A 4KHQA 4AM3A 2DDAA 1FY7A 1SANA 3KLOA 1TTYA 5FD5A 4DFKA 2CUZA 2RQWA 4D1QA 3T69A 1JTXA 3W2VA 1VQNA 4HWIA 1HJOA 3GTJJ 1C6VX 3DXMA 3QEXA 3ZSYA 2Z1HA 2H3JA 3PL8A 2I5JA 3J81E 2HWVA 2L4AA 2A6TA 3K0LA 4BRMA 3KVGA 2FEZA 3KYCB 5EJCA 4IHTA 3CCSQ 2HHUA 1X01A 2J5OA 3GYHX 5M1KA 4CCOA 1KU2A 1B4AA 3PFIA 1N33K 5F1RA 2IIMA 1HNIA 3PO3J 4AVPA 4KHSA 2CMPA 2HHVA 2PUOB 4U0VA 3RERA 3K9KA 1WI3A 5CZ2A 1VQLN 5AQSA 2JNGA 1IRZA 2DTZA 1AWXA 3HOWJ 3B8AX 2JZ2A 3JCMe 1YJNI 3QZ9B 4CEBA 4C2TA 5E8IA 4H0EA 4IOAL 4RCBA 2G3RA 5CHIA 1PCXA 4Z94A 3VQQA 2VCPA 2R7YA 3CDIA 2P4TA 2E3IA 1K9AA 1FLIA 5KYUA 3E97A 3CUQC 5BNGA 3CD6A 3MAJA 5FROA 1D0ZA 3D0SA 2QWWA 2BGCA 3B6AA 1U3OA 2WV1A 3CDHA 4PL7A 2FE3A 4FX0A 1Q9YA 5HOOA 1U1SA 2BVLA 2JVHA 5FRMA 1EJ9A 2CH4A 4EVVA 3ZMVA 1YXQA 4F7ZA 1G3YA 4M9XA 4PL6A 1XUPO 2QYZA 3V9SA 4CHZA 2VKHA 1GCQA 1IGQA 1NMNA 2XVCA 1JBMA 1IRFA 2JTMA 3JCMJ 2YJFA 3MKZA 2XD0A 1VQ5A 3O4NA 1P4WA 4YTLA 4PA1A 2A3SA 2XRNA 2ZGZA 4JX6A 3SUPA 5FLVA 1V5FA 4DTMA 1IO6A 3EKUA 4JRQA 1N9SA 2D8HA 5DV5A 2G7UA 3ZSWA 5GANf 5AQXA 2EK5A 1UG0A 2ECCA 1QHAA 1Z7LA 3CMEA 1BJZA 4MDXA 4MMKA 1W7AA 5FLXE 3HKSA 1I27A 1TW2A 4XQ3A 1TTHB 3CCRN 3ZL7C 1YJ9Q 1XOVA 1G8XA 3HJEA 3DKYA 1WUAA 1XMQK 2MK5A 4AHTA 1PWTA 4OU0A 3D2EB 4HV6A 1HYSA 2QK9A 5LMUK 1RTDA 5D5XB 1UAAA 4Q47A 5BN8A 1NBWA 3UKRA 1NGAA 3GW2A 4H4KC 5K7ZA 1QZ6A 3B6PA 3CC2A 3DLGA 1TLHB 4DW6A 2QKMB 3TSWA 3CIPA 5BR9A 4JAXA 4M7YA 1FIAA 2I2LA 2DBKA 3CERA 1SV5A 4X1VA 3DYAA 1NK6A 1QVFM 4RGRA 2X3XD 1VQMA 3CC4A 4YFXF 5M1OA 1PJRA 1WSEA 3PE0A 3QINA 1ATNA 1HBXG 2O8DA 2LQ8A 2EV5A 3CPWS 2KEAA 2LTPA 1JLQA 2QZ8A 2HD0A 2KMTA 3ALYA 1R59O 2R7RA 1X9SA 4Z4GA 2HHQA 2FBXA 1IXRC 2STWA 3BJAA 4GW6A 3HC7A 2E7WA 1Y71A 3NH0A 1G3WA 3RIRA 1JO8A 1LMZA 2HBKA 4DV3K 2WAEA 1JKHA 3EG1A 4ILGB 3EEQA 1WJCA 2CP6A 6AT1B 3K6GA 5GINA 2YX7A 3VA3A 1NLOC 3VQPA 2HDCA 3CCRT 2EX3A 4JK1X 2HZTA 2H94A 4OLAA 4HF0A 4KUDK 1HQEA 5LJ3g 1NEGA 3LFUA 4YELA 2QLZA 1N25A 3NHGA 4IRHA 4QWQA 4MDWA 5HS9A 1I81A 1Q86U 1KFDA 3I5SA 2LJ1A 2HNDA 4KHNA 1RDWX 3KJVA 2IS3A 2R7UA 1ZHIA 5GAN4 3ZCOA 1ON1A 1KGSA 4DFPA 3UR3C 2J6KA 3EZ5A 3RKWA 3G4SQ 2N8GA 2DL5A 2LF8A 3ABKH 4KAZA 4YDUC 3QRFF 2NNWA 3NF6A 3TDUC 4Q4ZF 1M90R 4E9EA 2HW3A 5EZGA 3NNQA 2ESHA 2V8KA 1KIKA 1R1UA 3HZJA 1QSSA 3FHNA 1JL2A 2NRWA 3Q3SA 3GFJA 3PLAA 2J06A 2IBDA 1YJWI 2CZ6B 4CJLA 3JR9A 5IHKA 3VESA 4L5EA 5MLCQ 2XY6A 3GTGJ 3M5AA 1PD1A 3ER0A 5EXWA 3A01A 4DUYK 2V7FA 1KG6A 3SHWA 1WHUA 3GFMA 3MKWB 3BQZA 4AFSC 3CETA 3HUGA 1K9MC 2XRLA 1UEBA 4H0YB 2B0LA 2PVOB 4OPHA 3CMAN 4KTQA 1KHIA 1YX3A 2R7TA 2E64A 4O8UA 2FYKA 1X19A 2DX1A 1P92A 5J6XA 2KHOA 2VWKA 3HM9A 1ZLKA 4FM0A 1F21A 4IRGA 2HOTA 3MEEA 4C8LA 2M7BA 5DY9A 1WJQA 1WSFA 1VFCA 4Z4FA 4BR0A 4FPBA 2P6SA 5GAOn 4AUXA 2O5RA 1AWOA 2NRXA 1ZKGA 1HMVA 3NAUA 1GT0C 3M54A 3H5NA 1LE8A 2HR3A 5AQHA 4IO9L 2Y75A 4EW0A 3JB9H 4DBHA 3JRGA 1SF9A 2E65A 5FPMA 4U88A 4JZ4A 4CIGA 4Y4RA 3CCUI 2D1VA 3QPLA 2O2OA 2LG4A 1RT1A 1QZZA 2X6XA 4KN4X 4EHTA 1MSEC 4UC4A 2L0AA 1RPWA 3VEXA 1KQ2A 2FBTA 2I7NA 4I99C 2YKMA 3C7JA 3TO9A 1TKTA 1F9NA 5CVJA 3REBB 2Y69H 2W40A 3EE9A 2DTIA 2QGGA 4L18B 3CCLA 3CMAT 4XL9A 3OQ5A 3KYLA 1I1JA 3H9NA 1D8JA 4OLBA 2PBDA 2ZPGB 1GLNA 4HNUA 1YIJT 1OEBA 5GAN2 3VF2A 4C92F 3I4PA 5KAIC 3BY5A 2OI3A 2KVQG 1I07A 1WKMA 1UB9A 3QAHA 1IJJA 3RPUA 1N3AA 4J6YA 1Q7YC 1KZHA 2E6LA 2E6MA 3BLYA 2JTFA 4CGJA 5CPRB 3VYGA 5GAMf 3VMFB 4RTZA 1YFHA 4CGZA 3FHGA 4NYNA 2VBYA 3FWEA 1K8AO 2L7MP 4AWXB 3SUOA 2DJZA 4JRKA 3CC7I 2QCOA 3FDYA 3BDUA 1QVFP 2KW4A 5IWAK 2QWQA 5L3BA 3KFVA 3OIOA 1U5SA 2ECBA 2HB5A 2X6YA 1IDYA 2BZTA 3CCMA 4B1WB 5DTDA 2X78A 4HZFA 3OL4A 1RI9A 1UG1A 1TL3A 1CF7B 4NZGA 4I98B 4BD3A 2NRRA 2I5UA 1SSFA 2OBPA 4C92D 3AO1A 1VQNN 4Y1CA 1U5TB 1U48A 2DYRH 2JT1A 2XSJC 3PNVA 2KKOA 4NCAA 3A0BC 4HSBA 4OB0B 1GRIA 1J2XA 2CP5A 4CZJA 4WK8F 2MGQA 3GXOA 1IUYA 4AQYK 1UHWA 1KG2A 2HBWA 1VQ8Q 3I55I 3J81Z 1K7AA 4UNFA 3JRCA 3CCJA 1VQ4A 1RTHA 4N56A 1LB2A 3OB9A 1E2XA 2PJRA 1OCRH 4NL2A 1NTCA 2Y48A 4MQVA 2O4XA 4F16A 3MXJA 2XKPA 1RBSA 2DOFA 4GV9A 2H27A 1C6VA 1PDNC 5BPMA 3I59A 1QZ5A 2KL4A 3BY7A 2KZGA 4DR6K 3CO6C 3EE8A 3DLHA 3OS2A 1QKXA 2GXBA 2ELHA 3W0LA 3KBGA 3HDDA 4FYXB 1ZSZB 1RZ4A 5HLGA 2JGUA 3FC3A 1NGHA 2LREA 4B8CA 4EJYA 4ZHRA 5H6QA 4JJBA 1VQNT 2CH0A 3AL0C 1BBZA 2K3YA 2KGTA 1KVAA 4OKJA 2AZVA 2HKOA 2ED1A 1IXDA 1OISA 4FWKA 5BN9A 4II2A 5C44J 2CQKA 3SQ4A 1LJOA 3RR7A 1Z1DA 2CW0F 1YHQQ 2OD5A 1B9FA 2JT4A 3QZ5B 1JJ8C 1IG9A 1YJWQ 2L9SA 1VUBA 1GV5A 1HSTA 6PAXA 4BI3A 2K5IA 1W0UA 2C6YA 2EGCA 1X9WA 1ZG3A 4FVUA 2FO0A 2E60A 4BC3A 3PMIA 2HDWA 3FDRA 5C0MA 2QTDA 2P9LB 2PQ8A 4L9JA 4BXXJ 1BR4A 2COBA 5F08A 2D8JA 2DYBA 4RWTA 4P9UA 4JD2A 1TU0B 2E2QA 2K2MA 2EJFA 3A8YA 1VQ6Q 3DXKA 4RW9A 1M3BA 5I2MA 2EA4A 3WTSC 4A3GJ 4O8KA 3H92A 4PJOE 1NGBA 4W1UA 5LJ3f 3CD6T 4XIDA 3RDIA 2HBPA 5GAOp 4B1XB 3M6GA 4AHSA 2HMPA 4DOWA 3GF2A 4PQUA 1I1GA 5I22A 4BWJA 1VYUA 1UJ8A 5BOXA 2XAUA 3VRYA 3LAPA 2W10A 1MHNA 5FLXZ 1DTTA 3JAME 2DTUA 1XC5A 1LW0A 4KUMA 1YTUA 3T7ZA 2L3RA 1U5TC 4CBXA 2HVIA 1QVUA 4M77E 4A93J 2VODA 4M7AB 3LDPA 3IAM2 4KTWA 2O8CB 3KUFA 1CZ9A 2WACA 3CC2N 3TEEA 4U0YA 1LPLA 1JJ2A 1HW2A 5H2FC 1ZG5A 3GIBA 2Z1IA 1LNWA 1V4RA 5D8KB 2X51A 5TKYA 5FKLA 2EIMH 2DRKA 1V4TA 3TTFA 3TAFA 2WSCE 1VQMN 2HHSA 1HQCA 3VF6A 1VQ5T 4I2PA 2KROA 1N5ZA 4I02A 4KB0A 2KE9A 4PSXA 3E2UA 3G71Q 2F8SA 1T33A 2ZXIA 2QW9A 1O13A 2ZJRF 2RF0A 1XMKA 3FXUA 1M4ZA 1NGDA 1NK8A 5HK0A 2PBIA 1AHDP 1OYXA 3CMET 2Q0OA 1BW5A 4MZMA 4LC9B 2BW3A 2CQQA 1WYXA 2JOYA 3OYYA 2BOLA 1ZSZC 4F92B 3O8VA 3O4QA 4B48A 2E8AA 3CQTA 1RFQA 4BU2A 3JRZA 3WODF 1OX9A 3PIPL 2K9MA 5JLFA 3DPUA 1PKSA 5KAFC 1RABB 1TP4A 4NQWA 3DOKA 3HI0A 3ROUA 3CCEA 2Z1JA 3CC2T 3PQKA 3RESA 1K0XA 2M5WA 4FT4A 3OY9A 4O55A 4QS8A 4HUEA 3LP3A 3E5XA 4A3MJ 1Z9ZA 4G7OF 3G2BA 1VQMT 3CC4T 3F6OA 4KGVB 1TV6A 3CFPA 4OFEA 4N5SA 4RTFD 4A0ZA 1QVPA 2CH5A 1JLFA 4IX7A 3AHUA 3M0TA 5GAHJ 4G9ZA 3QEPA 5FD6A 4F55A 2VOPA 3HSBA 3HK2A 4AG2C 1HNZK 1BBYA 4PLIA 1TXQA 1S3XA 3PMTA 2HQHA 1YI2N 4E19A 3KZIC 2A37A 1NZ9A 3MFKA 4B9XA 2Z16A 1QWFA 2HKNA 4CEOA 2BEOA 3MZYA 4MZTA 3MEGA 1UTIA 3O8MA 2ZJPL 1P4XA 2JMCA 1H8AC 3R6NA 2HHTA 5ERIA 4ZNXA 3VS0A 1SAZA 4PFPA 2ROTA 5D4RA 1FX7A 1OU9A 2RQUA 3PQJA 2A0FB 1HCRA 5CVRA 4HNVA 2HSEB 1IRXA 5GAOl 3BG7A 3KLIA 4AH9A 1YS7A 4M78B 3N4PA 4JS5A 4LGWA 4DYCA 3NFCA 2QEXQ 2V6CA 4N4GA 2RV8A 2P84A 3V7CA 4CF2A 2E2PA 4LF4K 3O8HA 2HAXA 4BQLA 1JCGA 2E34A 3LMMA 2XHCA 4DV7K 1DLOA 3KLGA 4M74A 2V1NA 1NGNA 3G6EA 1NJZA 5AFUA 2HOAA 1SD4A 1V1CA 2UUZA 2P9NA 3BW1A 4JI6K 1I0CA 3THXA 3IH7A 4PZJA 3SUNA 1PM3A 5A2QO 3VDXA 3BZKA 1OOTA 1VTNC 4J9HA 3WGHA 4CJSA 4ESBA 4HX4A 1HOMA 1A5XA 1WH7A 1WN7A 3TSUA 4FJKA 5IHNA 3KLHA 4D8DA 1M2VA 3M8FA 2A6AA 3IV5A 3CCLN 3CUOA 4ZDPA 1RAAB 1S1NA 3AAQA 1LDDA 2QA4A 3QNOA 5LL6S 4F7UB 2ACJA 1ZGAA 4LLGF 2NLXA 2L9NA 4LN2A 1JKQC 5FW9A 1SD5A 3W6JB 2OZUA 3C7NB 2GGRA 1K8AR 3HOZJ 3PNWC 3PM1A 2RN2A 1MNEA 2DW4A 3J7YJ 2WADA 1WFWA 1NKBA 2ZKZA 4N4IA 4BREA 1VQ9I 2F5DA 1S1WA 4M7DF 1XB4A 3F8NA 1WZ2A 5GIOA 1LPQA 1X75C 3QERA 1TQIA 5IPAA 4AFZC 2A36A 3GFLA 4ZJZA 1S9GA 4IUTA 3M07A 1ZRCA 2DFEA 3ZSQA 3L2RA 5KYYA 2ECZA 1S1XA 2WC9A 1N27A 2DYSH 1Y96A 2E1MB 1S72N 4IIOA 4E1NA 3CCMN 5CAIA 3ISNC 2XF7A 3KWIA 2P6TA 5E1ZB 1IN8A 1B8IB 3JCMV 3DLLL 3QP6A 2B8AA 4JKDA 4YORA 5FDLA 1F1ZA 4IHVA 3BT9A 3CCLT 2VYPA 3H08A 3JRHA 1I39A 3J81K 2NUTB 5AN4A 3BJ6A 2QBYB 4QTRA 2E1ZA 1KU9A 1RACB 4JN4A 3PSFA 4M7DD 4CC7A 1J09A 3X2QH 3CD6I 4Q48A 1QVTA 1QHTA 2RHUA 2RDPA 2ZPBB 5KCOA 4AT1B 3HM8A 3QFPA 1KQ0A 3P9KA 1WEGA 1LVAA 4BR4A 4BDPA 4BR7A 1XGNA 3OR2C 2K9NA 1EFNA 3CCJN 1X6BA 3V4IA 1KQSM 4AIHA 5GANd 5GANj 1KCFA 3QWYA 4AFQC 4RW4A 3MZHA 1J9IA 3H46O 1XG7A 2UU9K 4J5YA 1W2BA 2QK0A 1W4SA 2JTVA 2VQFK 4BRPA 2VGMA 1M90U 2O9VA 2EQJA 3DCFA 3CCMT 4MNUA 4IJAA 4JI1K 4E89A 3K59A 1RNLA 3M58A 4MDAA 2PVGB 3VF4A 5CKBA 2QG9B 1X2MA 1VQKA 1VQPI 4BGDA 1Y0NA 1IH7A 1WHJA 3RMQA 2CUBA 1K73O 1B9NA 4JI5K 4WFAL 4EMSA 4G94A 2GOXB 2XC7A 3JCMQ 3D7EO 3C0BA 5LLQA 5EVZA 4LK0F 3DWLA 1K61A 1J6ZA 4LD6A 3UF4A 1A35A 1OCPA 5DLQE 4KB1A 2W6KA 2NOZA 1FTTA 3QFUA 3JB9J 4Y0WA 2VQCA 5F0HA 3ZSRA 1XCVA 9ANTA 2O8FB 3CCJT 1VQ4T 2F1LA 5GTHC 1FN7A 2Y1JA 2KIFA 4XRSG 3FZHA 4ENKA 4EGZA 1LWEA 3H9QA 1MGTA 2VGNA 3QKJA 2ID6A 5L23A 1WQ2A 2HS5A 2B5JA 2X6NA 4A61A 1W5TA 5GMKi 2D0QB 5FLXK 1ZBSA 3IWZA 2FRWA 1ORPA 4XOTA 3OYDA 1WPYA 3CC4I 2OTJI 4B4CA 5KCMA 4AILC 4GO1A 3M55A 2OJED 4D7MA 5HDNA 2HU9A 2RHXA 2JA7J 4JK8A 3KLEA 1AKHB 1EBMA 3VA0A 4BUGA 3I56Q 1TYQB 3HRMA 4HBLA 3WNFA 4ELZC 2OYQA 4W5OA 2E5QA 5C42A 3RR8A 4KV8A 4M75G 3JAMZ 1TW3A 1ORNA 4OGCA 3F0CA 4L3QA 3SV4A 2DA4A 5E3OA 2P7CB 2CT3A 2H8HA 1HNXK 5LL6Z 3H6EA 1Z3YA 1G15A 3FR0A 4M4ZA 1MW7A 5E17F 4BRHA 3RDVA 4XLFA 2R4GA 3T1BA 2ZWHA 1JT6A 2VQHA 2BHYA 3DF8A 2AP1A 3FZKA 4JLHA 4CJVA 2COYA 1QVGM 2O8EB 2IW5A 3BOQA 1OFCX 4KI4A 5KYXB 3NGIA 4J9DA 5J39A 4E7LA 1H89C 2BZXA 1DEJA 1REVA 1V5EA 3P5JA 4QKUA 1OQYA 4XU0A 5GANe 3ZMSA 5J40A 4A3EJ 4WX9A 1Z3XA 4C8QF 1W7PA 3ZETB 3E9FA 4FJXA 4DTOA 1QKWA 3KYDB 1LFBA 5DLOA 1ZG1A 1JQQA 4CBWA 1TUGB 2FSKA 4B9UA 5E18F 1L5UA 3F22A 4EJZA 2YI1A 2DN0A 4BDZA 5KH6A 1VYVA 1C0GA 4OB1B 1ZYQA 3CCEN 1LUJB 4CCMA 4F2RA 1PU7A 2XDVA 2LZ6B 4HVUA 4CUGA 2QSHX 5HL7L 2X1DA 4AM6A 4PY5A 2MBFA 4RW7A 5IP7J 4OMNA 4NUBA 3CCQI 4B9WA 4WCGA 4XTYA 2IDOA 3VERA 4JPBW 5E3NA 3KTUA 3G73A 3IRXA 5C12A 4RTYA 4EATA 3PT9A 2O4IA 1A5WA 3AGRA 1SVLA 5E84A 1I3AA 1M1EB 1WLJA 3C6HA 1NK4A 1QHHD 2AXTC 1X1DA 4NOYA 4XRSA 4D6WA 3ZQ7A 3O08A 1FZPB 1FSEA 2CGHA 4C8QD 3ULDA 1IN6A 2EFIA 3VKIA 1RAIB 1Q8IA 3D6RA 1WJDA 4HQEA 2XHKA 2RPNA 2X4YA 5ILVA 4XU1A 1C1CA 2V1XA 1H3ZA 1KD1O 4FIBA 2ELJA 2CS3A 3V7RA 5GAEJ 1BQMA 4MTDA 2JN6A 4HSTA 5HLHA 3JCMg 4C3HJ 4CEQA 4DQRA 5AZJA 3EDPA 1ZRDA 2R7OA 1GUUA 3UPUA 4CGIA 1Z6RA 4CYCA 1HLVA 1XWLA 2VKEA 4DSJA 5C3EJ 1L0OC 4CXFA 3EG2A 2YLCA 3CCET 1K78B 1MMSA 2WY8Q 1UDLA 2JA5J 2DPPB 2IVNA 1FYLA 4M75A 5KRTA 3SDBA 1NGGA 3GTKJ 3E66A 2DA1A 1GLLO 4FLZA 4KDPA 2YU3A 5AQNA 3S3OA 1BGXT 2QWRA 4LF5K 4CHNA 2QWPA 5K1YA 3S1NJ 4H0VB 2XRIA 4BNCA 4I0AA 3O5BA 3IP4B 5LJVA 2M2EA 3QEVA 1K78A 5M1PA 2NYXA 4XLEA 1UZCA 4CZZA 1JGGA 2O9LA 3E6MA 5EDNA 4CSWA 1D8YA 3X26B 3SWNA 4IOCL 2QQSA 3LSJA 3DLEA 3VYRB 3KETA 3U21A 1GHCA 2QTXA 2AK5A 3VEWA 3S1MJ 2ME6A 2KDOA 2V1QA 1F4KA 4CZMA 3CM5A 1U2VA 2ZM6K 5LJ5g 2QA4N 2IVWA 3VQ7A 2FSJA 2ZO4A 1SL2A 5KYWA 2VJJA 1HW5A 1I4K1 4ZDLA 1AVZC 1Y7XA 3ASOH 1CZAN 2FBHA 3HOVJ 1M30A 2YU9J 3O1WA 3S16J 2ITMA 2M8EA 4UUTA 3GL1A 2BHZA 4PJLA 2OTJQ 3RJPA 2LP5A 2MCNA 2V1DA 4CBUA 3I8BA 2QUFA 4LIUA 1D1CA 1FSHA 1PYVA 3G6ET 3E9OA 2YR2A 1BIAA 3JRFA 2AO9A 4BYYA 2DXBA 1YE9A 3DLBA 1YQMA 3RYPA 1TWAJ 4J6WA 1TUDA 1VI0A 4UUSB 2CV0A 1ZARA 3DLMA 1VQ4I 1RRSA 4RAZA 1XDSA 1R6RA 2MFZA 3QG1A 1TKZA 1OCTC 3ASNH 2CZ0B 1TQPA 4M73A 2DMOA 1ZX6A 2D0AA 1YX5A 4KT0E 2R5MA 2HDAA 2I8DA 2W82A 4LF7K 3L2UA 2LX9A 3MO8A 2P1JA 4H4MA 1PSFA 3BTIA 3L8BA 4CFDA 2QA4T 5JVGL 1KAYA 1JJ2P 4JI7K 1DU6A 3Q0VA 2NOEA 4I01A 3HRSA 2J6FA 1WFXA 4E9GA 3WU2C 5CZ1A 1IW7F 1E3HA 2IGNA 4LB6B 1KG3A 3LWHA 5AQJA 4EP5A 2EH3A 4LG3A 3P8DA 1W9HA 4C92B 2FF3B 4BRCA 3SWNC 4B9LA 1VNDA 3CQ8A 4CGHA 4C3JJ 3RZDJ 1LVKA 4I6MA 2PMZN 3LL7A 2DPDA 4CC3A 1YW7A 1SFUA 4C8NA 5LJ3d 3L2ZA 2WAFA 1GBQA 3ZQQA 1W5SA 1OH6A 1K73R 3K2PA 4ELTA 4IOAF 1RKTA 5FU7C 1ITGA 4Z0UA 1OZ2A 3VN5A 2P5LC 2DBBA 3K4MA 1IBLK 2D0CA 1BOAA 1M3CA 3DKWA 3U1DA 3CCQQ 1VQKN 2LT1A 1IRGA 2HPMA 1VQLI 3ZT2A 2WV0A 3VWBA 2RHIA 4DBRA 1WI7A 4BRQA 1ZH5A 2DT5A 3C65A 2E1HA 1BIBA 3QICA 1QP2A 3LDLA 3T0YA 1H9TA 2X6WA 2ZMEB 1WEFA 3OYHA 5M3FJ 3H9GA 2F2WA 3H0DA 3EETA 2EWNA 3EG9A 3VSKA 1DDNA 1SKRA 1KLNA 4AIAA 2ITGA 1T98A 5HKCA 1AOJA 3OH9A 1H92A 1GOAA 2NLUA 1NM1A 3HL2A 2E4LA 3HP6A 4OMMA 2JS0A 4CJWA 3OOPA 3ZMTA 1B92A 3QBYA 2DXIA 1MWKA 2VONA 2L3QA 4XH1A 2ZAEA 4DWIA 2O3FA 4HUFA 1QP3A 5FJ8J 3JAMK 1ZBJA 1VQKT 2KRCA 3S2WA 2L3PA 4ESJA 3SPYA 2JW4A 4WXCA 4B43A 2JUCA 3AA2A 4CD3A 4DTUA 1WJ5A 1KQ9A 4DV6K 1YJ9A 2KHMA 3IAYA 1RTJA 1VSDA 2HNYA 1L3VA 3OYLA 1XSXA 4AM7A 4B21A 4C92C 2P5KA 4LXCA 1WJRA 3F72A 4OKKA 2W03A 4LLNA 1JKOC 3SFZA 1SKUB 1X1PA 4B1RA 1XNRK 3DKMA 3LYIA 1K8AU 1KVCA 2KISA 4QOZB 3THYB 1Q18A 4X64K 2P0WA 2UXNA 3LWMA 4KFCA 4BG8A 2LY1A 2EFPA 1YN8A 4LUEA 3WQUA 2NRAC 4B3MK 4JKGB 2D0NA 3BCAA 5J3LA 4ILJA 4NBQA 2L9VA 4LD9K 3GX4X 3UIQA 3G3ZA 2G7HA 3WTVC 2H8WA 2KIMA 1RNHA 2EQUA 1XTAA 2JS2A 4QS9A 1H641 4J7FA 4YIIA 5CKHA 5JR3A 1FYNA 5LJ3e 2QQAA 3HRGA 2HKXA 3ESWB 4JX4A 2L5QA 1D5VA 2WB1N 3EFOA 5IT9E 2RH2A 2YUQA 1U2WA 2VI6A 1PVSA 3C2BA 3U2RA 1XJWB 3FMSA 4M6VA 3HG9A 4J83A 3QO9A 4YEJA 1JCFA 1OULA 4DOVA 2W25A 1X58A 1VSFA 3VEVA 2XDPA 3RSNA 4JI4K 1EETA 4FSVA 4FJIA 2PVDB 2DXCA 4RAGA<