5FROA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz446 (compound 4f)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
molecule keywords PFV INTEGRASE
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5froA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5froA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5froA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5froA03
3VQAA 4QQGA 3LGLA 2ETJA 3DB4A 4K8XA 3KK2A 3QJ6A 1BL3A 1WGSA 4HTUA 1LV5A 4BD3A 3DOKA 5D6XA 1S1WA 4ZTFA 1XNIA 1RILA 1VSIA 3H08A 3ZSRA 3PX0A 2MWOA 2F8SA 2HHXA 3AVIA 4CHQA 3ISNC 3LZJA 4GW6A 1FXXA 1TK0A 1GOAA 1NK0A 3RR7A 4DF8A 4OPKA 4JRQA 3G10A 3L2QA 1RTIA 2X6NA 3SNNA 3LPUA 1HQUA 1WAJA 5FDLA 1NJXA 3QIPA 4CIFA 2Z1JA 4DSFA 2QQSA 2OPSA 4CRIA 4O0JA 4Q5VA 3ALYA 1QSYA 2PYJA 3IRXA 4C8LA 1RT1A 3QINA 4PY5A 4CK2A 3V1OA 1KCFA 2I5JA 4W5OA 3NHGA 4N4GA 5KCOA 4CGIA 2HVHA 3AVAA 1EKEA 4JRPA 4AH9A 4PUOA 1QSSA 3HP9A 3NF9A 4O0IA 3V9XA 3TARA 3AA5X 3U3YA 1B9DA 3LAMA 2YV0X 4DQIA 3OJSA 3P1GA 2WOMA 1QTMA 4ID1A 2DFHA 4FLVA 2F96A 5K14A 4CJSA 4JLHA 1L5UA 4B9LA 4N4HA 1RTJA 1KTQA 1U04A 3FFIA 3TR8A 3QNNA 2RJEA 4AHTA 2O4XB 3DOLA 1SKSA 3ZSVA 4M45A 3M8QA 1OZ3A 5J2NA 1OZ2A 3B6PA 4DF4A 3OYLA 4IDKA 4CESA 2YHBA 3QETA 3VQ6A 3IG1A 3QBYA 1DTQA 3CFPA 3QO9A 3S3OA 3TAQA 4F2RA 1IKVA 3DLRA 2E6LA 2L89A 3HSTB 4W5RA 4CF0A 2XDPA 3LZIA 1Q9XA 5CY4A 4LH5A 3LYIA 3C95A 4IUUA 1WAFA 4NCGA 3VQQA 4CHPA 4M3XA 3RMCA 2BIVA 3TAPA 1U45A 4CEQA 4CJKA 2R5MA 5HLFA 2HHQA 4E7IA 4OGCA 4DFMA 4Z4GA 1WJRA 4A4EA 4KO0A 2HHWA 3Q1JA 1VRTA 4CJUA 3TABA 3M8SA 1WSGA 3MEWA 1S6PA 1LAWA 3NAEA 5KE2A 4IFYA 1RDAA 4C8NA 1ASUA 4CFCA 2NUBA 1S9EA 4FM1A 3V9SA 1HYZA 3VN5A 3QESA 4B9WA 4KTWA 5D6YA 4ELUA 1RNHA 1WJQA 4KTZA 1T03A 4IUPA 4M3UA 3CG7A 4CHYA 4PWDA 4FK4A 3C94A 3FLGA 1OI1A 3KJVA 3K5LA 4HUFA 1D8YA 1JLFA 4CEEA 4FU6A 3RRHA 2B8AA 4CF9A 4B9MA 1RBRA 2BANA 3MEDA 4CJTA 2PQWA 1EXQA 4DLEA 1IKXA 3AO1A 3TI0A 4C8KA 2Y1JA 3T19A 2VG5A 3AV9A 2M1HA 2IGIA 4FJMA 2E5QA 2YNIA 3KD5E 1NOYA 4CK3A 3TAEA 3QEXA 1ZBLA 3BDLA 2D9TA 4OJRA 1ZBIA 3M8PA 3LDSA 3IS9A 1IG9A 4NYFA 3QKJA 3NH1A 1NK6A 3LPTA 3LAKA 3MXMA 1UOCA 3A2FA 4KHUA 3HT3A 1LWCA 1SV5A 5KRSA 4CJLA 4J2DA 1TK8A 4J2BA 4CGJA 3ZT4A 1LWEA 4A4GA 3LX7A 5KTQA 3O8VA 4W5TA 1OYXA 4RW8A 4BWMA 5KGXA 4O44A 5IAYA 3SV3A 4KV8A 1S9GA 4RW6A 4A4FA 4UC4A 4HCBA 2X74A 3QIOA 5SZTA 4BWJA 4M3RA 3SUNA 3VQ4A 2HHTA 1TKXA 4DS4A 2DAQA 3HL8A 4CECA 1JLGA 1A5VA 4H4MA 5KH6A 4LSNA 4AHUA 2EQJA 3K59A 4AHVA 4M3WA 1J54A 2RI3A 4FL6A 3AO4A 3KLIA 4Q5WA 4CFBA 1MU2A 3V4IA 3KLEA 3QERA 4IURA 3AO3A 1JLQA 4FZZA 3DLHA 2ZQBA 1S6QA 3LP3A 4B9SA 5J39A 3FC3A 3O4NA 3VQBA 1RBUA 3ZSOA 4KAZA 3LP1A 4NCAA 1VSDA 2BGGA 3AA3A 4Y1DA 2RHXA 4DS5A 1RCHA 3RMAA 3KKSA 1NK7A 4OKJA 4IG3A 1Q8IA 2XK0A 1NKCA 2ITGA 3HP6A 3KK3A 2BUDA 4PLLA 2Q3SA 1JKHA 3MP1A 1RTHA 1C1AA 1HNVA 2P1JA 4DTXA 1KFSA 4N76A 5C0MA 3MEUA 2X4XA 2EX3A 3VQ8A 3OYGA 3AO5A 3SJJA 2Y1IA 2FHDA 2JZ2A 1KLMA 4FJ8A 2X4YA 4AHSA 3WNEA 1TGOA 2G8KA 3OYAA 2GFUA 3T1AA 1Q9YA 4ZTJA 4DG1A 2XO7A 5HROA 5FRMA 2VWKA 3WNHA 1U48A 1I39A 4DQSA 3VA3A 1NK9A 3K5MA 2E6NA 1REVA 1N5YA 3NGZA 2OA8A 1A5WA 3E9GA 1TL1A 3AO2A 3RMBA 3SUPA 4IG0A 3NGIA 3QIIA 1WSHA 1VSKA 2BE2A 2G8IA 4FLWA 3VA0A 3DB3A 1U47A 4DQPA 2E6MA 4DU4A 4YFUA 3SQ1A 4OVLA 4DTPA 5J2PA 2R58A 2RKIA 3QEVA 3PO5A 3HM9A 2WONA 3CFOA 4FJXA 4C5IA 3LLRA 5FROA 3O4QA 4DWIA 4E19A 3CM6A 1G5VA 4Z4EA 3DLMA 4GMJB 2G8FA 4ELVA 3VQDA 2HNYA 3NF6A 3AVFA 1BCOA 1LW2A 1RI0A 4ZHRA 4CHNA 1N27A 3ZT2A 5KRTA 3KLFA 4FM0A 4KREA 5HRRA 3SCXA 4Q0BA 1HPZA 1BI4A 3NE6A 2ATQA 2LCCA 3NCIA 3ZSZA 4DTUA 3VQ9A 1ITGA 4CCHA 2YNHA 4H4OA 1IKYA 1W9HA 3M8RA 3IAYA 2GBZA 1BHLA 4QCLA 1NJWA 3LGFA 1RT7A 4B8AB 2YHAA 3ZSWA 2ZE2A 4FLYA 3WNGA 3MEVA 3T3FA 3PX4A 3DRSA 4F2SA 4B3OA 4IKFA 3MXJA 4N41A 4QOZB 4N47A 4N4IA 3F9KA 4LD0A 3ZSQA 3DLGA 2RJCA 5E41A 3HVRA 5J2MA 2HNZA 3OYCA 2LTOA 1WSEA 2OZMA 1G15A 2K3YA 3LP0A 5DK5A 3CQ8A 4CJFA 4F4KA 1U49A 4CJ3A 4OKEA 2P5GA 3HVTA 2RHIA 3MO8A 3DLBA 1KVAA 3AVGA 3ZT3A 3KIOA 4CEDA 2HQXA 3DRRA 3BDPA 1Y97A 3ZSXA 3FDRA 2EHGA 4CK1A 4RG2A 1VSLA 1TKTA 1HNIA 1ASVA 1CLQA 2B6AA 1J9AA 5JS1A 1S1XA 4FJGA 1C0TA 4DTOA 3QEWA 3V81A 4IFVA 1NK8A 3C6UA 1QS4A 3TANA 1S1TA 4FXDA 4W5NA 2M0OA 4OLBA 5J2QA 2QKBA 2G3RA 3V1QA 4FK0A 2W42A 5CYMA 1RT3A 4RW7A 4LH4A 4CJRA 3L42A 4H8KA 3AVCA 3D0PA 3KLGA 1QSLA 4B9NA 2RI2A 5C24A 3EYZA 4E3SA 1WSJA 3AVLA 1L3SA 1L3TA 2GUIA 1SL1A 2YNGA 4HUEA 1T7PA 1JXBA 3DI6A 3LWMA 3RWUA 3TAFA 3JSMA 1EP4A 4KI6A 5HRNA 4HUGA 4PL6A 2EQUA 4DSKA 4CJ5A 2EQMA 4C5HA 2FC0A 1RBSA 1SUQA 3C6TA 4FJHA 3TWHA 4OLAA 1RDBA 2FBTA 3ASKA 1TL3A 3B6OA 3DM2A 4A4HA 2IS3A 4RG8A 3EY1A 4OKKA 2R7YA 2QXFA 2Z1IA 4DSEA 4FLZA 3QNOA 2JTFA 1BQMA 3VQ7A 4BACA 5HBMA 4CE9A 3D45A 3MECA 1L3UA 3OMCA 2HB5A 1JL1A 4E89A 4W5QA 2YKNA 3PV8A 1JLAA 1CXQA 4DFPA 1SL2A 1X9MA 1RDCA 4KHSA 2RPIA 3E01A 3NH0A 2R5AA 1RT5A 1WSIA 4QW2A 3K58A 4JS5A 3SZ2A 1B9FA 1EETA 4CGGA 3SYZA 3OYMA 1MHNA 4CJQA 4B08A 4AHCA 3S3NA 1SL0A 3L2RA 2NLUA 3PNWC 1C0MA 3ZT0A 3HPOA 3QLHA 4FJ9A 3ASMA 4CHOA 3SPZA 2Z1HA 3MEGA 2XHBA 4KKOA 1VSHA 4E1MA 5C25A 4KRFA 3SPYA 2KTQA 3OYNA 3OYIA 1QHTA 2IAJA 4X34A 3OA6A 3BGRA 1D9FA 3LP2A 1TAQA 2ZD1A 2RI5A 1NJYA 4TSXA 2LVMA 4J2EA 4ID5A 4CF1A 1HYVA 2QQRA 4IUQA 2FBVA 3NF8A 1RBTA 4N56A 3OYFA 4BDPA 4FJNA 1RBVA 4DQQA 3RMDA 2EKOA 1TKZA 2VG7A 5T7BA 3V9UA 4HCZA 1NOZA 1J5OA 4CEAA 2B5JA 2XY5A 3OS0A 1S1UA 3MEEA 5HRSA 1LAVA 3I8DA 4FCYA 4DU3A 3V9WA 2D0CA 3DLKA 4FJ5A 2XY7A 3ZCMA 3O3HA 1VSMA 3PMIA 4DTJA 1JLBA 3NTHA 1W0HA 4O5BA 1LWFA 4YNQA 4MQ3A 4KFBA 3TAGA 2G8WA 2BDPA 2QK9A 1C1CA 3E9FA 1NKBA 1JLCA 4KHNA 3K5NA 2FBXA 5D3GA 3TAMA 5KCHA 1C6VA 1DLOA 2IC3A 4CGHA 2HMIA 3AVMA 3KK1A 3AVHA 3NNQA 4FJIA 3OYEA 3OYHA 2MWPA 3OMGA 2D5RA 3LWLA 4I9QA 4M42A 2RJFA 2RJDA 1UA0A 1L3VA 4O55A 3RTVA 3OYKA 3NTKA 2P0KA 4Y1CA 3GOXA 1R0AA 2HHVA 2VYTA 2OPQA 3CM5A 5KGWA 3HO1A 3HPHA 4FLUA 2LRQA 1UA1A 3SQ0A 4C5GA 1ZBFA 4E0DA 3EZ5A 4CJEA 2KZMA 3AVJA 4LY7A 3LANA 2O4XA 2GF7A 1TKDA 4RW4A 2DY4A 4OVAA 1X1PA 3PFSA 4MFBA 5DMRA 1T05A 3VQ5A 3OS2A 3L3VA 4E1NA 4KTQA 2RO0A 1O1WA 1FKPA 4FZXC 4F3TA 4DTNA 2LDMA 3OS1A 1JXEA 1N6QA 4M3ZA 1NKEA 2KFNA 1KHCA 2EQKA 3OYJA 1YT3A 4FW1A 1B92A 1KRPA 1VRUA 2HVIA 4EP5A 3WNFA 4Z4HA 1A5XA 2WACA 3P8DA 2G8VA 2L3RA 2XY8A 4CGFA 4AILC 4J2AA 1TV6A 3HK2A 1KFDA 1WN7A 3P83D 4OPJA 4XIUA 3CFRA 3S6WA 4EZ9A 1HQEA 1S5JA 1TVRA 2DIQA 4B9TA 3OYBA 1KLNA 3UIQA 3S3MA 1DTTA 4QQDA 2JLEA 4BDZA 4C8MA 2YKMA 2E4LA 4FZYA 3MXIA 4PQUA 1YVUA 3PMTA 5IN1A 3DMJA 1KVBA 4E7HA 4DMNA 1JLEA 4G1QA 3L2VA 3SQ4A 4L8RB 4M3TA 3L8BA 3LALA 4C8OA 5D6WA 3DYAA 4OGEA 1FK9A 3V9ZA 4BE2A 1YTAA 3OJUA 3EAEA 4NZGA 3AA2A 3SUQA 3CEYA 3CYMA 4CEFA 3KD1E 4EZ6A 4CEOA 3FEOA 1FKOA 4KB0A 1TAUA 4FW2A 2XRIA 4I2PA 1HMVA 3P8HA 4FK2A 2DTUA 3PX6A 4DQRA 1ASWA 1BGXT 4DFKA 3THVA 3ITHA 4PLIA 4B9UA 3NTIA 4DSIA 1SSFA 3VQCA 4CJVA 4Z4CA 4FJLA 1Z25A 2IOCA 2P51A 2KFZA 1S1VA 3KTQA 1BQNA 1CZ9A 2YNFA 3MAQA 4KHQA 2R57A 4B9XA 3NBPA 4DLGA 3QEPA 1XC9A 3RR8A 3O3GA 2AJQA 4AHRA 1D5AA 3NH2A 4IBNA 1X9SA 3HXMA 2OZSA 4HCCA 4E7JA 2GV9A 4UQGA 2RN2A 3NDKA 3K57A 1TK5A 4GY5A 3U6FA 2HHUA 5HRPA 4CF2A 4FYDA 2FBYA 4RW9A 4FLTA 1BIZA 4DFJA 3O3FA 1KVCA 2KW4A 2IG0A 1UAXA 4CFDA 1K6YA 4F8RA 1BIUA 2OPPA 2RHUA 2G8HA 4FVMA 1BCMA 3SV4A 4CERA 3S9HA 4KI4A 1YTUA 3SD4A 1KSPA 5FRNA 3H6ZA 2DFEA 3ZEHA 4HVJA 4KHYA 3DLEA 5KI6A 1VSEA 2IDOA 1RT6A 4I7FA 2F5KA 1WJSA 2X4WA 1RT4A 3SI6A 3I0SA 3F70A 4B9VA 1ZBUA 4I9LA 4FJ7A 2D0BA 1LW0A 2A1SA 3G0ZA 1NK5A 4KPYA 4NCBA 4B8CA 3JYTA 1BISA 1HRHA 2VWJA 3AVNA 1XWLA 3HYFA 3NGYA 1C0UA 4NYNA 4BDYA 3SQ2A 1XHZA 1SKRA 4FJKA 5CIUA 4Z0UA 4IUVA 4E7LA 1Z26A 3RRGA 3LH0A 4GVMA 4M41A 2A1RA 4CIGA 3M9QA 1JL2A 2RHZA 1CXUA 3OYDA 2OPRA 3V1RA 3OY9A 1VK0A 1T8EA 1WLJA 4CHZA 2O4IA 1BI4B 2HNDA 4CFAA 3P5JA 2G8UA 3OQ5A 4KHWA 4WE1A 3U3GA 2YRVA 4FJJA 2LSNA 3AVBA 5C42A 4CJ4A 5EU7A 1RDDA 2VG6A 1IKWA 5I42A 2QKKA 3HJFA 4EP4A 3AVKA 2PZSA 1NK4A 1WNSA 3MEAA 2DIGA 3UT1A 3ULDA 3ME9A 4E7KA 2Z1GA 2K3XA 3L2UA 2PY5A 2CKKA 3I0RA 1C1BA 3ZSYA 3V6DA 2EFIA 3MP6A 5CZ1A 4CGDA 4CJPA 4O4GA 4C5EA 2D0AA 1CZBA 4ELTA 5SWMA 4FM2A 4K8ZA 4KB1A 1F21A 4CEBA 1XI1A 3PY8A 4QQ6A 5CYQA 2DFFA 2RHYA 1VSFA 5CZ2A 4CEZA 4R5PA 3KUFA 5M9OA 2X78A 1XHXA 5J1EA 3QEIA 2KQ2A 5JS2A 1ZYQA 2JGUA 4DTRA 3K5OA 5KE3A 1VSJA 4Z4IA 2M16A 4NS5A 1GOCA 3F73A 4DSLA 1HYSA 3UWNA 4I2QA 5J26A 4EDUA 2GFAA 1X9WA 4HHTA 1I3AA 1QE1A 2P5OA 3OB9A 1NJZA 1HJRA 4DTMA 4F3OA 2F8TA 1EX4A 2HQEA 2B4JA 4II1A 4CIEA 3DRPA 4QAGA 4L59A 3MP8A 3ZT1A 3KKRA 3K2PA 4CJWA 3VQEA 1SKWA 2PYLA 4BE0A 3PUFA 4LSLA 3OVNA 4QVZA 1WSFA 4FLXA 1RT2A 5I3UA 1GOBA 3SUOA 1D9DA 1H3ZA 4DSJA 2OYQA 3KLHA 4JS4A 1IH7A 5HP1A 1RTDA 2BKDN 1U4BA 3H8ZA 1ZBHA 1UWBA 3VQPA 3HPGA 3AA4A 3PO4A 3META 4IUTA 4Z02A 4CF8A 1IO2A 2X6SA 3NFAA 3L3UA 2X35A 4DTSA 1QQCA 2HHSA 2KZZA 2O4GA 4N5SA 4M3YA 3C4SA 4BE1A 3L2WA 4LD6A 2RF2A 2L8DA 3NF7A 4ICLA 2XY6A 1J53A 2HW3A 4DU1A 4PA1A 5C6SA 4Z4FA
chains in the Genus database with same CATH superfamily
4FOEA 1R5HA 3T9NA 3ZETA 3DB4A 4K8XA 5AQNA 2W03A 1S1WA 5AQYA 1RILA 3M0PA 3ZSRA 3AVIA 4L0ZB 3K1NA 1SVMA 5FDLA 1IBLK 3ZN0A 2OPSA 3ZMSA 4Q5VA 1VQ5T 4OB0B 1XS9A 3DLLA 3OL4A 4O0IA 4U87A 2FPDA 2O8FA 2CWEA 2YUPA 1U5SA 2DFHA 2VIXA 4B1YB 2F96A 3L0QA 1LFPA 5F0FA 1S1NA 3IMXA 3WTXC 3KYCB 3PNTA 1L5UA 4M78E 2CDTA 3V4GA 3CCMQ 4XTYA 2QGFB 3M8QA 4BVPA 2JUCA 5FLXO 3BR3A 3HFNA 3QBYA 4AI4A 4G9ZA 2PUKB 4M71A 4CF0A 2BGCA 4UNFA 2E1ZA 1PVSA 1S9EA 3VN5A 4B9WA 1W5CC 5D6YA 3U23A 2HQAA 4B44A 4PSXA 1VQNT 2NVXJ 3HGYA 4DV4K 1UB4A 4HUFA 1JLFA 3CD6T 3J81O 2HSTA 2GELA 5FU6C 4MDXA 2VG5A 3J81K 3KD5E 3OH6A 2HTSA 3IS9A 4GY2B 2KKZA 1JJ2S 4J2BA 2V1UA 5JFRA 3LX7A 5JLWA 2DA9A 4BWMA 3CCQA 4JRIA 3LFUA 1B7TA 2F48A 4WWCA 1RRQA 4HSBA 2NOZA 2XMFA 3IAS2 1YF5L 3HL8A 5BOXA 5H1SQ 5A0DA 2LLKA 2AKKA 4KT0E 3AO4A 1Y0UA 5C15A 1PC0A 4D5CA 3LP3A 4HBLA 4LN2A 5L3BA 5FU7C 1TUCA 2FRYA 1ETOA 4J5YA 4H5WA 2E12A 4N76A 3VQ8A 2HPMA 3D2EB 5HLGA 2ZFUA 3PL8A 1ZRDA 3WNEA 1TGOA 4O5FA 3LFKA 1W2BP 1WH5A 1K0SA 3RMBA 1GLNA 2LSOA 3GFMA 4JZ4A 3AHUA 4DU4A 3P7NA 2QEXI 2A05A 5KYYA 3PO5A 1N8RR 3GFJA 4UUSA 4JKGB 3O5ZA 4UB8C 1KD1R 4WCEL 1FOXA 3UATA 3NF6A 5FFXA 3G1JA 2JMWA 1PKTA 3IAYA 4R56A 4FYVB 1T38A 2YHAA 3PX4A 5HDGA 4QOZB 1YCSB 4N47A 3ULEA 5J2MA 2OZMA 4F4KA 1HLVA 2P5GA 4FWMA 2DJZA 1K73O 3KIOA 3QU3A 4S05A 3FDRA 3N4MA 2DTOA 5K1YA 1S1XA 1C0TA 3V81A 3GYHX 2EJRA 1JJ2P 3TANA 5GAN6 5IT9E 2HZDA 5E3MA 1M3BA 2XGDA 1DIZA 1WHJA 1EA3A 5ILVA 2W00A 2M7AA 1AZGB 2QBYA 2PVDB 3R6SA 3DI6A 2MH2A 3H0FA 5KPRA 1YFNA 2KNBB 1OJLA 5J4VA 3OSVA 1KQ2A 4B1RA 2CH0A 3E97A 2LQWA 5F0HA 2PTKA 5BRHA 2ELKA 1ZG3A 4CE9A 1LVKA 4DBFA 4ZYGA 3E01A 1NG6A 2STWA 3NH0A 2V7ZA 2P9NA 4BGAA 3QLHA 3HJEA 3O80A 1YRNB 2RQRA 3FXKA 5A0GA 2NWMA 2Y30A 1AWXA 1AHDP 1HYVA 1JQQA 2F5DA 1E7OA 3H3UA 1UG0A 3M53A 2LQKA 4NXNK 2ZMEB 3CXCM 4NUBA 2HOSA 4HF1A 2F9WA 4IVNA 2V6EA 5CKBA 3AVMA 2O6GE 3NNQA 1DPUA 4I6MB 2DRMA 4CZKA 5FPEA 2M9HA 1ABQA 4IHSA 3GOXA 1IZ1A 1I81A 3LANA 1I3QJ 1JT0A 4JKHA 2EA2A 2CV2A 3HUGA 2HVIA 2HBKA 1RR8C 2LCSA 2Z3YA 2NRAC 3S6WA 5C3EJ 1KLNA 1DTTA 1B8IA 2JLEA 4BDZA 3GTQJ 1KQSA 3KLOA 5TKYA 2OTJN 4FWRA 1W7PA 2DA2A 2Y75A 4NZGA 2O8BA 1CGPA 2ADUA 3THVA 4NQWA 3H3ZA 1CQTA 4PJMA 2D6FA 1TG0A 5BPMA 5EG0A 3N0UA 4WTOB 4MFEA 3EUAA 2DPNA 1YIJI 1I1JA 4MO5A 3HG9A 4CF2A 4FYDA 1CKBA 1K6YA 4A3BJ 1WOQA 1KSPA 2DFEA 4GXOA 1RT6A 1WJSA 3P9KA 2R7OA 3G6EI 4NLBA 2E2JJ 1UGQB 1NYGA 3KYLA 3I55I 4GVMA 4RTWA 1R4MB 2EIJH 3TU4K 1VQ7N 2YRVA 3I56T 3A5MC 2VG6A 4GYIA 3WVEB 1QVTA 4IEEA 3IKTA 1T3SA 1WNSA 5J1RA 3HSEA 2HI3A 2W82A 2YHYA 1GXIE 2P9IA 3OHRA 2ISZA 2VQEK 3VYSB 2HEOA 4QQ6A 1BDGA 4II3A 3QEIA 1M9SA 3JRZA 1Y96B 1PJRA 4IHWA 1I3AA 3RJPA 3OB9A 2HVRA 4E9EA 3A1PA 3G1MA 3DRPA 5CKFA 2CFXA 2KDZA 3CMAA 3WXJA 2YDLA 1YI2N 4JEPA 2C0IA 4ZNXA 3NQOA 4CCJA 3NF7A 3QOPA 4PA1A 3TDUC 2OANA 4DUZK 3IWFA 1YCYA 3C3WA 1BL3A 3K4MA 2OTJI 5AZJB 3EQLF 3PX0A 3GLXA 2AZVA 1NMNA 2DRKA 4CHQA 2DDAA 3HFOA 2JSPA 4DF8A 4JRQA 5LJ5g 2X6NA 4L0YB 4PK4A 1VI0A 4CIFA 1IB8A 2DBMA 2PYJA 2RPNA 3IRXA 2P9LB 3DCFA 1EKEA 2OAZA 2LMDA 2F6CA 4J9DA 3JRHA 2FEZA 2KZGA 3SAHA 2QKMB 3U3YA 4AVZA 5JVHL 2YV0X 1TLHB 4J9IA 4J01A 3DEUA 3PT9A 1IXRC 1F36A 4WXHA 5DYMA 4CJSA 4C92C 3FFIA 3ZQQA 2J06A 5KYWA 1OZ3A 4LF8K 3EG9A 2FOWA 3TAQA 1DJ7B 1IKVA 3D4VA 4NCGA 4IEIA 4LD5A 2ZNZA 1A6QA 4HX4A 2LF8A 1VQ7T 1KQ8A 5GAMh 4XTWA 1WSGA 3MEWA 1U8RA 3CBMA 4M7DC 1XCVA 4I7HA 4U88A 2BY2A 2YS9A 1PP8F 4CHYA 4FK4A 1LNWA 3FXOA 1P7IA 5DM7R 1IAWA 2QQBA 2WTUA 2BBYA 1Z91A 4UV8A 1Y39A 4P9UA 1XTDA 2HAXA 3T19A 5B1BH 1XQPA 2O9LA 4MDAA 3EUKL 2H6BA 2A6EF 2IA0A 1TK8A 1U0JA 3KLNA 4MHGA 1SFEA 1SAZA 3TP3A 4A4FA 4UC4A 5GANj 4NB4A 5E3NA 2ID3A 2NRTA 2R7FA 1IGQA 2VKHA 4QWQA 3BJAA 1RFQA 2IJLA 4ESRA 4MZTA 2RM4A 1ZGAA 1C1AA 1RTHA 2ME0A 3JCUC 2AA4A 2AXTC 2Y69H 1UTIA 3K7AJ 2DMNA 1H641 4E9FA 2V1XA 1WPKA 3M57A 1DGKN 3CCUQ 4XLCA 4ZTJA 5L8RE 3VA3A 1OCOH 4HTLA 4BY6B 5KYUA 2MFZA 4EJWA 4YFUA 2CZ1B 4OVLA 1XG1A 1W2BA 1VYUA 1AHJB 3EG1A 3KP4A 3UKUA 2DT6A 1OFCX 3RMQA 4M7AG 1NJWA 2R7SA 4BI3A 4HLXA 4IKFA 4HVVA 3H3VK 3WU0A 2V8IA 3GZ5A 3ZSQA 2LJ0A 2LTOA 3HHTB 2GWJA 4OKEA 3N5BB 1D1BA 2COMA 5D5VB 3ZSXA 5DS9A 3KE2A 3LSKA 5JS1A 1SMTA 4JKEA 1WHMA 2L3PA 3V1QA 4FK0A 2X1EA 4PFPA 3MKDA 4H8KA 2DA3A 1XSDA 1N9RA 5I2SA 2M87A 5C24A 1QGPA 1L3SA 1CSKA 4YTLA 4Y0WA 1N78A 4PUSA 3IH4A 1OU8A 1ZRFA 2CGKA 2QSGX 2P9UB 4QPOA 1B9MA 5IT9O 3BTCA 2JVHA 2DF6A 3CCEA 5I9EB 3U9ZA 5GAGP 1QZ5A 3CMYA 1Z77A 6PAXA 2W0ZA 1SEMA 2NVTJ 5LMNK 4IHTA 1QQOA 3H0GJ 5IOZA 3K4CA 3OYIA 3BGRA 3DJCA 1YQLA 3CC2T 4CF1A 2F2XA 3MKZA 1IRFA 3WXKA 5DY9A 3PTAA 5HRSA 4AIKA 4UXNA 3PMIA 4O5BA 4DQ2A 3TAGA 5IP6A 2O8XA 4J9EA 3VS3A 5D3GA 1XDSA 3P9IA 3M58A 5KCHA 2RQVA 2BV6A 2KAFA 2ZBKA 3KP2A 2OQRA 3HRTA 3K1MA 4B1WB 3CM5A 3CUOA 3ZMZA 3IWZA 2HYGD 3IRRA 1T95A 5C4JJ 2VOPA 5CQGA 4E1NA 1J5YA 1R5GA 2RO0A 3BJOA 4IRHA 4WXDA 3JCMc 2WSFE 4J2AA 2PMZA 3F0ZA 5DLOA 4G7OF 5DCMA 4B9TA 5D6FA 4QQDA 3JSCA 4E7HA 1Q82O 5ADXA 1MKMA 1SQKA 2L4MA 2VASA 3PE0A 4M3BA 1ASWA 4JNEA 1K6OA 4M78G 3GP8A 2E2NA 2HDWA 4KHPK 4A93J 3K69A 1KSWA 4E7JA 2K4JA 2ZC2A 3DPUA 5KK1A 1FJLA 1XQHA 4GLKA 5HNHA 4O3MA 4HQMA 4BI4A 2A6AA 1BM9A 1UG2A 2OF7A 3FZVA 4FJ7A 3PIOA 1ATNA 2H1KA 1ETWA 1Y8QB 3R61A 1D5YA 3KEOA 2DMUA 2ZXWH 1SZ2A 3HGGA 2CGLA 1GHCA 4YOTA 4WE1A 1O9SA 2LTPA 1IBKK 1YJWT 4PJOB 3VRYA 2V9KA 2FJ1A 3M1CA 2PY5A 2FF6A 3PIPA 3W6JB 1B34A 4PJOA 2K02A 3S16J 3RPUD 4FJ5A 2EZHA 1WXBA 3OGDA 4BROA 2F69A 1KD1C 1XGNA 1DEJA 3SAFA 3T1HK 3SFIA 1XC5A 3ZEUA 4H0YB 3KZBA 3JW4A 2JZYA 2GX9A 2DTZA 2IW5A 2R3SA 4A3LJ 3PUFA 1JBMA 2EB7A 4QVZA 4E47A 1H3ZA 5GMKi 3ZQLA 3PO4A 4CF8A 1BA1A 2V4JC 1VQ9Q 4NB5A 2VV5A 2HW3A 2Q31A 4Z4FA 3LGLA 1S72A 2B63J 4M75E 1LWWA 1IN5A 2DDBA 1RL2A 1KAYA 2F4IA 1BOBA 5CKDA 1RUNA 5LJ5d 1KCFA 2E10A 5ICFA 1KIKA 3TARA 1TTHB 4M7AE 2IP2A 2P9KB 3SWNB 3VB2A 4A5MA 1MMDA 4B24A 4FWKA 3LA7A 1USSA 2CQKA 3QMLA 3Q0VA 3QO9A 3NVKA 1WEGA 4LH5A 3E5QA 2PU9B 3RMCA 2XDDA 4CJKA 5AQTA 3VKIA 3M9AA 4AU7A 3IUOA 5HLFA 4EMHA 4NBQA 4J9GA 4KAZA 4CFCA 3V9SA 2F7TA 1R23A 3C94A 1YITQ 2HF4A 1E3MA 2KIMA 3QAHA 4M7DD 4CJTA 5HK0A 4JI2K 1X69A 1QNTA 4CZMA 3M54A 3QBXA 3CCSN 4CO8A 3R0AA 2KT0A 1ZBLA 2QTXA 3TGNA 3GTOJ 3URGA 4KHUA 2EPFA 4DHYA 1M3QA 4HF0A 2K3BA 2NYXA 3MQ0A 1MDMB 4FT4A 2EYXA 2DMTA 4EATA 4P5OA 1NGIA 3K59A 2HNIA 5CKEA 2FYKA 4DV2K 4OFAA 3HOUJ 3QERA 2E7WA 2Q2EA 1DUXC 3VOVA 2HBLA 4Y1DA 2JT1A 1VQ8A 4AVPA 1ZSGA 3GF5A 2XK0A 4M77D 1Y8RB 4CCMA 4DTXA 1GFDA 2X4XA 3CI5A 1UELB 2O7OA 4A3IJ 2M4KA 3S1MJ 2PNIA 2YI1A 5CLSA 4FJ8A 1FTZA 3VA0A 2RE2A 3EPZA 1GL5A 1OYYA 2TRTA 2G0EA 4RTTA 3O4QA 4DYQA 1M2VA 5CPRB 1BCOA 4ZHRA 1FIPA 3M0SA 1LQ1A 2CH4A 2VYPA 2ATQA 5LJ3j 1VUBA 2COYA 5ECAA 3J81Z 4E70A 3LGFA 4B8AB 3T3FA 2NRWA 3WNGA 4M73A 1G83A 1C0FA 1D8KA 1WVRA 2QYZA 5FFZA 4PCQA 4C8QF 2Q1ZB 1KG4A 3MO8A 5JMVA 3TSPA 2XKOC 3MX5A 4WF2A 4RKUE 8ATCB 1X01A 3J80Z 1X1AA 4FXDA 1KQ0A 4E9HA 4C0ZA 4CGZA 9ANTA 1N39A 3R6OA 1WSJA 4BR2A 5AQQA 1SHGA 3W2VA 3BF1A 2A3SA 1BL0A 5ERIA 2EQUA 3SLCA 4JOMA 3M56A 4CYCB 3GNGA 1XGOA 4OLAA 4JK1X 4M9SA 3ASKA 1OR7A 1HKQA 4GV9A 3MECA 2J4RA 3DXMB 2QM3A 3SZPA 2FLOA 1VQ9I 1EWQA 5GP9A 3OMYA 4VUBA 2LNHB 5GPCA 4JK9A 4CW7B 4BEHA 3VS1A 5GAEP 1UB9A 2RI5A 1H88C 2D0QB 2FBVA 3FZKA 5E17F 5KN9A 2L0AA 4RTFD 2XY5A 2Q1NA 2ZB9A 5DD4A 5CVVA 2F5EA 4IWVA 5GAMd 1SFXA 5IXFA 3VS7A 3G6ET 4B43A 2IC3A 1G59A 1YJ9A 2OZ6A 2KIUA 5GAOr 5CAIA 2RJFA 4M42A 3CJ1A 3OYKA 4Y1CA 3RUXA 3SZGA 5C2DA 4N9HA 5E18F 1HKSA 3J8AA 4ISEA 2JG6A 1GCPA 4XLFA 2LD5A 3JAMK 3L3VA 1KQSP 4LF4K 1B92A 4UOBA 5FPMA 4CGFA 3CQTA 3U4LA 2M0CA 2YLCA 2ZPGB 4EJZA 1TP4A 2DXUA 1R8OB 2E4LA 4KH1B 5AFUA 4H0EA 1YVUA 4DMNA 4EMKB 3CXCS 3FDYA 1ETVA 1V3FA 3F21A 3MN9A 3EAEA 2R7RA 1TAUA 2QSFX 4CBUA 3VETA 2YG9A 3KP3A 2A6HF 4V19K 2EV5A 4RCHA 3KTQA 2VQCA 3GVAA 1H89C 4B3XA 1NH3A 3GMEA 5LEJA 2RN2A 1MV0B 1QZYA 3N05A 1PKSA 2XAQA 4DOWA 3V7SA 3VEXA 2DOFA 1E3OC 1IV0A 4XBFA 1ZBJA 3CMEQ 3MPUB 2QM1A 3F70A 2YCHA 3I33A 4OIRF 4NCBA 3ZR8X 3SMPA 2ABKA 3I5RA 3OTOK 4DR3K 4IUVA 1XTAA 3LW5E 1HK9A 5BPDA 4M41A 3GO5A 1X1CA 2QG9B 4CIGA 1CXUA 1Y1VJ 3V1RA 1T8EA 4WQ4C 5D7UA 2HFHA 5H6RA 2FXUA 4IOCL 2UUCK 2NUTA 1F43A 4MLHA 2GBQA 2IGNA 4HX8A 1QHGA 4XKCA 2QA4A 1HKCA 2ZJRF 3L6QA 4ILGB 2EFIA 2YR2A 4CGDA 2D0AA 1DQUA 4K8ZA 1XI1A 1PRMC 4KBOA 2CG4A 2NS7A 3CCQN 2KIFA 1VQ6I 1HDPA 4NS5A 3CP2A 3EEQA 3D5RC 1U8BA 2P4TA 3GEZA 2YUQA 4EDUA 4FM4B 2W6KA 1BU6O 3DAWA 4F7UB 4PL7A 5DM6L 3CDIA 4QAGA 2ECZA 1FYNA 7AT1B 3QDKA 1SC7A 3J7YP 1ZBHA 5CVIA 2DBKA 1Z21A 2CUEA 4N5SA 2JHNA 2QWLA 4R55A 1RBTA 4BKXA 2YSQA 3EG0A 2RNGA 3KK2A 4LF7K 1VQLQ 3F8CA 3CC4I 4ELUA 2XRNA 3H08A 2DJQA 4GFBA 2MWOA 4GW6A 5EEHA 1OISA 1NK0A 2KDSA 2BTFA 4OFEA 3W2WA 3S1RJ 1KYZA 5FKOA 2QQSA 1IXCA 5LGUA 4WXCA 1NLPC 4N4GA 4CGIA 3AVAA 1TWHJ 2F5CA 2COWA 2P9PB 5C12A 2XHIA 3I71A 4AFSC 5DTDA 1QWFA 2W04A 2CRGA 4LITA 4D8KA 1SKSA 1Z9ZA 3OOUA 1ZUYA 4BRNA 1U1SA 5LJ3e 1QU3A 2ESNA 3FXLA 2A6TA 2XDPA 3THYB 2NUPB 3RKQA 3CLOA 3HHHA 5HOOA 1UGVA 1TW2A 2VXDA 4RS8A 2NUPA 4FM1A 4AT1B 1RDUA 2W40A 2CGHA 3F9MA 3A01B 4YOWA 1VQ6A 3JTGA 4OU0A 4EW0A 2AHQA 4DV1K 4LFCK 4V19S 3EKUA 2P9LA 3FZMA 3RRHA 2HDDA 3CF5L 3K9JA 4GKJK 3J7ZO 2PX9A 3E9LA 3M8PA 3R9PA 2X48A 3RZOJ 2DJIA 3AAQA 1HPMA 3MN2A 4XNFA 3MD2A 5LLQA 4W5TA 4I6ZA 1WFWA 3QIOA 2K7LA 3CC2I 2HHTA 1ZRCA 1XMKA 4HXJA 1AEYA 4RTYA 5AT1B 1SRLA 3JCMP 3FC3A 1RBUA 3JB9D 4BRQA 4IG3A 1Q8IA 3SBTA 2BUDA 2V9PA 3E6MA 2ICWG 3B6AA 2RH2A 1KU3A 1N36K 1XCBA 5LHHA 2GFUA 3T1AA 1Q9YA 3Q9SA 4DG1A 3FIWA 3BQZA 1REVA 4A5BA 1SG5A 5A2QO 4M72A 2I5UA 1Q81C 1VQKN 5KNLA 2GOXB 2FB7A 3DTKA 2R58A 4BHPA 5CK9A 3H92A 5AIPA 3HKZN 5IHKA 3CMAN 3CC7Q 1XPXA 1KEAA 2LCCA 3NCIA 2AS5F 4J6XA 3FMSA 1FX7A 2E41A 2RJCA 4CZHA 3MN7A 6AT1B 3JAME 4WFAL 3HSCA 4XLNF 4A3JJ 2RHIA 1QVFS 2O8EA 2NOBA 4CZFA 4KIBA 2YX7A 1NGCA 4C8QA 1MH3A 1JUMA 2E1MB 3FZHA 2VCPA 1UCRA 4DGWB 4XU0A 1YJNI 4D7NA 1SRMA 3OIPA 2RNAA 1SL1A 2YNGA 2KP6A 3RERA 4BHBA 4BRPA 3RQIA 2I8DA 3A8GB 5HRNA 2GA2A 3S14J 5KVRA 1T3LA 2HF3A 1Z3XA 4FLZA 1S72T 4BACA 4C92F 2ECCA 3I58A 4W5QA 2NVQJ 2VKVA 3CCEN 2VBYA 4DFPA 1RDCA 3F0CA 1Y64A 1EETA 4XQ3A 4CGGA 1XN7A 2E2PA 1IBMK 3SPYA 2GZWA 2QEXT 2QQAA 4TSXA 1P4AA 1J3TA 1ZBXA 4KI6A 2O2OA 1DT9A 1RBVA 2DNUA 5BRDA 1J5OA 4UHTA 4OMOA 3G4SA 5M1PA 4XK4A 3VW4A 1YHQQ 2LY9A 4A62A 1BI0A 5FD6A 2E1YA 2K9MA 2HCKA 5LL6S 2KSSA 4CGHA 2O03A 2FQ3A 1QVFM 2HMIA 4FJIA 4ENMA 3AKZA 4HDVA 3QB0A 1SHFA 5FWCA 3D6RA 1OULA 4KIFA 2M7BA 4BRKA 1UA1A 1YIJA 1H3HA 4CJEA 4RLFA 4C3HJ 1J59A 1ZLJA 2PN6A 2EJ9A 1QKWA 1KC8O 2YJFA 2BY1A 1IXDA 4ILJA 4FWSA 4M7DB 2QEXA 4FW1A 3OYJA 1BR4A 2G8VA 4EA4A 1WN7A 4OPJA 2OU2A 4EZ9A 4Y91A 1K9MR 2DIQA 2DL4A 3RPUA 1DU6A 4M9XA 4BB7A 4CDGA 1TL8A 4V2SA 4LF9K 2R7ZJ 4A54A 3LSPA 2DEUA 5L3FA 2PMHA 2KMTA 5GAOm 2IS6A 5FO5A 3D2FB 2P4WA 3BPXA 2D2WA 1JRIA 3CCLQ 1NJIO 1S1VA 1CZ9A 2M4GA 4LDUA 1M3HA 2R57A 2A3LA 3RR8A 2X3XD 3UDCA 2FBKA 4AHRA 2XICA 3H35A 4FLTA 3OSFA 1YITA 2NXNB 2OTJQ 3FKJA 1S3XA 4QS7A 3N5NX 1FSEA 5IYBJ 1RT4A 1R00A 2CYYA 1ZBUA 5C10A 1RRJA 3SK3A 4DOZA 4HOBA 1WQ7A 2ZCFB 1WA7A 4CCOA 3THKA 2OPRA 1YHQT 4UVAA 4KHWA 1MGTA 3FKIJ 3O9TA 4DB3A 1FOKA 2VE8A 3JB9J 2ED1A 3J7AF 4CC4B 2DIGA 2K3XA 4JHDB 1G3TA 5GAGJ 1OPCA 1RR7A 4OB3B 2V1NA 3LL7A 4I01A 3THXB 2JMAA 2K40A 1TYQA 5KE3A 2M16A 2PUOB 5GAMe 3C0BA 4M77B 1X9WA 2P5OA 1QBJA 3UA6A 5HS9A 1ZX6A 3TTCA 2F4MB 3E5UA 2EK5A 4BH9A 4GV3A 4L59A 3ZT1A 2VGNA 4BYYA 1GOBA 3AGKA 1K1ZA 5ICEA 1I8FA 1K9MC 3HPGA 3ZP5A 4ON0A 4BRLA 1J53A 3OR1C 4QT7A 2HBPA 2VC8A 3HTSB 1VSIA 1M90R 3HOZJ 4LFBK 3L2QA 3SNNA 4DSFA 1S22A 1RT1A 3V1OA 2I5JA 3DU6A 1G2HA 4JYKA 3I0XA 3K2ZA 1V54H 3T69A 4IHYA 3CCJT 3QPSA 2O88A 5K14A 1X2QA 1RTJA 1O3QA 5JVGF 4IDKA 3CFPA 4NL3A 3F3XA 2NRXA 1X4OA 3ID6A 1BUPA 1R77A 2JUGA 1TWCJ 5LJ5e 1XQSC 4ETSA 2DO3A 2HVQA 2K7AA 4CJUA 2QWMA 4BC3A 3JS6A 5FPDA 2QK0A 1ASUA 2OV7A 2LYCA 2KY9A 1WJQA 3CCLI 5KN8A 1JI8A 2B8AA 1RBRA 4H4KC 4CF9A 3MEDA 1S6LA 3F6OA 1UGPB 2KE9A 2Y1JA 3VS4A 4OIQF 2IGIA 2UU9K 3QEXA 5DEQA 2OJED 1I5ZA 1ZHFA 4RGRA 2XAGA 1NK6A 1KHIA 3CF5F 3LPTA 3VYGA 3LSIA 1SV5A 1YJWI 2RN8A 5KRSA 3PM1A 3AG1H 1OH5A 2YSRA 5IAYA 4RW6A 4XN0A 1G8XA 1GLCG 4CECA 5GMKh 2K6DA 2LCLA 2E70A 2VC0A 4FL6A 1MU2A 4A5NA 2X1CA 2QAZA 1KONA 3LWIA 1T6DA 2G7UA 1VSDA 2Z0WA 2VB6A 3KKSA 1J7KA 2GUPA 4WFBL 3CMAI 3FBNB 1ZC6A 4I0BA 4BHCA 1PUFB 4NLCA 4IF4A 1MUNA 5AQGA 1NTCA 5GAN8 3CCJA 3QU6A 5F6FA 2LZ6B 5GANf 3NGZA 4EQQA 3E9GA 3SUPA 3BTIA 2P9IB 4OAYA 2H8WA 1HD3A 2LX7A 5D8LB 5GMKe 4CH7A 2IA1A 5GAOq 3G71Q 5IYDJ 4RB3C 4M78C 5KRTA 1QVGS 1TNTA 5F0XA 1VQLA 4W1UA 3VQ9A 4CCHA 4IRIA 4L9JA 5LJ5h 3MEVA 4EM1A 1IUFA 2IS4A 3F9KA 4DZPA 2ELHA 4ATOA 4XSZF 5B1AH 5DK5A 1FBSA 2DLPA 2O8KA 3P8BB 3LL3A 4FPAA 2GWRA 1KG5A 4Y28E 2STTA 4HZFA 3VU3C 3CCMI 2O8DB 4HEA2 2WBNA 3C1DA 1YJNQ 2LKPA 2X0LA 1BYMA 1V4RA 2LT1A 2O8FB 3I55A 1D3BA 1ZBSA 3L42A 1RUOA 1OVQA 2DU9A 1BC7C 4HF2A 3IKMA 1QZEA 4M7YA 4YORA 1FLIA 4PL6A 1ZLMA 1R36A 1LOTB 3RIRA 3AT1B 1RDBA 1F4KA 3TPQA 2BZ8A 2R7YA 2MYSA 5LD2C 1YQAA 2QA4Q 3QNOA 3C7NB 3O9RA 1POGA 2H94A 1YI2A 5H2FC 2VQFK 1UHCA 3PFIA 4E9GA 3CC2A 1Y96A 1RDWX 2DW4A 4AHCA 2P6SA 2IIMA 2Q2EB 2KQWA 2IGMA 2KRFA 1TUDA 3CDLA 2ZFWA 4DQQA 3T8RA 2EKOA 3ECOA 4YDUA 2DJNA 3LDOA 2B5JA 4H03B 2WC2A 3PO2J 3LQRA 2D0CA 3O3HA 5J1UA 1W0HA 2V1QA 4YNQA 4G9YA 1LWYA 3CPFA 1VQ7Q 4XRMA 2K5FA 2I7PA 3IL2A 2K9NA 5ED4A 4B47A 2IS2A 2RK1A 3QP5A 2P0KA 2H8HA 4ZN1A 3HO1A 4OFHA 3ZOBA 5GINA 1IDYA 1SEUA 3VF2A 5DMRA 3VQ5A 4I99C 2E1MC 1U9NA 3MVPA 1M90O 2M51A 2YT6A 2WACA 5J3BA 4NDLA 4FO0A 4AILC 1QVFP 3CD6Q 1W6XA 5TGTA 4I76A 4CYDA 1V4TA 3J7AP 1JJ2A 3L8BA 4OGEA 2PEXA 4C2TA 3EE8A 2HZYA 2RN7A 3KD1E 4CEOA 4OINF 1QQIA 1BJZA 4C1NI 2BXYA 5M1KA 2D1HA 2CV1A 3TQ7P 2FQ4A 1Z25A 4JKDA 1UUEA 2LX9A 3NBPA 2RQUA 3QEPA 3ML6A 4CCLA 2AJQA 1T6SA 2M45A 5CJ9A 3K4JA 2NLXA 2RMOA 1PHTA 4CICA 4JYAK 4C92A 2R0QC 2A0FB 3DXMA 4PJOC 2HKOA 4C2MJ 3I0SA 1KXPA 3JYTA 4A6EA 3K9TA 3PNYA 3JCMd 5E1WA 2H56A 4Z0UA 4M78B 2E71A 3HOWJ 2DX1A 2GXAA 1ETXA 2MA3A 4FIBA 4KNYA 4MGRA 3K2AA 3JAMZ 3D2EA 2JTVA 4XAXB 1L3LA 3AVKA 4HRIA 1VQ4I 4RTUA 3ULDA 3KPHA 3ME9A 2K9SA 2HDAA 2CKKA 3MX2A 2H8RA 5LJ5j 1FPQA 1K0XA 1U78A 4ESBA 4XU2A 3PIPL 2KROA 3ZGKA 2BE9B 1VSFA 5CZ2A 2V26A 3BCAA 4IX7A 1X1DA 4Z4IA 4HT8A 2EJFA 2KI7A 3UWNA 1XDUA 5KYXA 2RB6A 2B9SA 1NJZA 2F8TA 2JRTA 2D1XA 4LG0B 4C3JJ 5LGNA 4II1A 2ZJ2A 1S8NA 4PJOD 3K2PA 2FBHA 3DLLF 1VQKA 1U5TA 2EINH 1D9DA 2OYQA 1IH7A 1GCQC 4MZPA 4IUTA 3NFAA 3VDXA 2X35A 2MD0A 3HKZA 3C4SA 3VUBA 3G71N 4JX6A 4ZYEA 4BQAA 3GTGJ 1F1BB 3KNTA 1VFCA 4BD3A 3DOKA 2OTLT 3ONQA 1D0YA 2AP1A 1J09A 5LFAA 4B21A 4HV6A 5L3CA 1WZOA 1QLYA 1I5LA 2V7YA 3DXKA 3LAMA 5EG2A 3BJ6A 1TW3A 3D5LA 4MFDA 3QYGB 4JLHA 4AWXB 3QYHB 3U2RA 1OLTA 3CCSA 1VQON 2GIVA 3S3OA 1BR2A 3MCPA 2VQHA 5KYYB 4KFCA 1WAFA 4RB0A 4CEQA 2UZKA 3LDLA 3D7EO 2D45A 1LAWA 3NAEA 4RTZA 4JKBA 1SF9A 4RUGA 3D1NI 2A40A 1D8YA 4F92B 3CC7N 1AT1B 4XTUA 3VS5A 4S04A 3P31A 4QKUA 2RNJA 3GWZA 1VQOT 5HLHA 1Z05A 2GTJA 1TWGJ 2YHTA 5E3LA 1SVOA 2MC4A 4AIJA 2LKSA 3G6EA 1Z6TA 1W97L 2CH4W 1VQOI 1NM7A 1IGUA 4EAHD 2IVMA 1U6GA 2L7FP 5FLXZ 3SUNA 5J3LA 3WGHA 1KD1U 3A98A 4H0XB 2K3FA 3PQJA 4AHUA 1K4SA 1AWJA 2HOTA 4I98B 3L2CA 2JNGA 2AKLA 1WI3A 5J39A 5EY4A 1WYXA 1R1VA 3CUQA 4BUPA 2VE9A 3SEMA 2VLAA 2W57A 3EH2A 3KK3A 2DKGA 5CQXA 1M1FA 3EUHC 2KHOA 3I56A 3AO5A 2W4SA 2JZ2A 1U2VB 1QW1A 2HSPA 5D5UB 1Q1VA 5HS8A 1YQMA 3AO2A 5EZHA 4AQYK 1JU5C 1E6GA 4WK8F 2FVUA 5AQVA 1T6CA 3VQDA 1N32K 5HRRA 3FX3A 4HAMA 4LDXA 1WBBA 3Q9VA 3ZSZA 4DTUA 4XQFA 1IKYA 2MABA 4NHJA 4ESJA 4X62K 3QRFF 3IKVA 2C0TA 4DKWA 3QUIA 2FZGB 5AZJA 4JHDA 2DMQA 5F08A 4CJFA 3HVTA 1NK2P 4H5TA 1Q81O 2HQXA 3DRRA 2CT4A 1TKTA 4DR7K 4CZJA 4W5NA 1QS4A 1QVGA 2LREA 3CCMT 3F22A 2GUIA 4HW0A 4XTZA 2HQNA 4HSTA 1O57A 4HUGA 1ZSZA 4BQQA 4CJ5A 5MLCQ 3IH7A 3C6TA 5DLQE 1Q82U 1TL3A 3B6OA 5ELZA 1YJNA 1IJWC 5GJWB 1HF0A 5HBMA 2R5ZB 3E2UA 1ZG5A 4PJJA 3H3OB 1QKXA 3I56I 3HIFA 1ZARA 3S3NA 3L2RA 4C8QB 2VT3A 3PNWC 1FYMA 2BTTA 3CJAA 3LDPA 5J1YA 1VSHA 4L5IA 2KTQA 1QA6A 4EM0B 3CCUN 3THWB 3QJYA 1FMWA 5EGOB 4ID5A 4HQEA 4L18B 2VG7A 3JCMX 3KEYA 1S1UA 3MEEA 4Z2YA 3G71A 3I64A 3DTEA 1JLBA 4MQ3A 3JSPA 2AQFA 2OTLQ 4HSRA 3U21A 3WG9A 2MWPA 5GANh 1R0AA 2ZKZA 2HHVA 1TUYA 2RQWA 3F23A 1OYWA 1ZBFA 4E0DA 3H41A 2IBDA 2QWNA 1MZBA 1TKDA 3P9CA 3OS2A 2VKDA 4B09A 4KICA 1WEIA 3QYEA 1M4ZA 5IY5H 3JTHA 2BOLA 4C92E 3QPHA 3BF3A 2W10A 1N9SA 3JREA 1SS6A 2M8GX 3OYBA 1LCUA 5J8CA 2XKPA 3PMTA 4M3TA 3VGLA 5CE3A 5D6WA 3T1BA 5BREA 3OJUA 1YTYA 3BG5A 3DBLB 4YOUA 4CEFA 1UECA 1JGGA 4EEFG 1EBMA 2XRIA 4XU1A 5GANd 2LR8A 2VBXA 1VQLN 1TS9A 1HJOA 3JB9I 1BU1A 1TUGB 2YWWA 4B9XA 2LG4A 1QHAA 2OZSA 3N4PA 2E2OA 4PKHA 2R7WA 3O3FA 1L0OC 1VQ5Q 1BCMA 4PKCC 4B48A 2KIQA 4RGUA 4MO4A 3HRUA 3CCVT 2D0BA 4NC7A 3FF5A 1J6ZA 1YHQI 4NYNA 2ZF5O 3SQ2A 3TL4X 5CIUA 4JI1K 3QZ5B 3A8LB 3RNJA 1WLJA 3VJPA 3CP8A 2L0KA 1O3TA 3P5JA 4G12A 5IH2A 1VQ9T 2QKKA 1VQPI 3TU5A 1JCFA 2A28A 3L2UA 2QTVA 4KH4A 4CJPA 4M75B 1VQ8I 4FT8A 2ZCWA 4FM2A 4P1WA 3VSLA 3WT0A 2KPMA 1O4XA 2V1RA 1E0EA 2RHYA 3CMEN 4XICA 2QWWA 5JS2A 4A61A 2JGUA 3K5OA 5F27A 1MIJA 5J4YA 4DQ8A 1WH7A 4I2QA 5HNFA 1K8AC 5EZGA 4KYWA 4XMYA 1YJNT 3LSJA 5L3GA 4A6DA 2ZGZA 2BH1A 1JHFA 2B4JA 2F9TA 3EHQA 2K5IA 2QQ8A 4F17A 4ITVA 4DYCA 3UB5A 2VI6A 1BOTO 2KJCA 3CUQC 1YIJT 4ICLA 1KRPA 4EP5A 1P4WA 1QCOA 1YQKA 1T0FC 4ZTFA 1XNIA 3LZJA 3EUHA 4K11A 4MO7A 2XIDA 1W2BM 5HCKA 2CZ0B 2CQXA 1VQNN 4F7UG 4C8LA 4LIVA 3C2BA 4JRPA 3EFRA 3SBGA 1UFFA 4C30A 2EBIA 5K7FA 2DFIA 1WZ2A 2LC4A 5KAIC 3G25A 5CQYA 1V29B 3M8EA 2DPDA 5E20A 1NBEB 4DF4A 3PQKA 4M63C 2Q2RA 3QETA 2EFQA 2GIZA 3S1NJ 3KTUA 3F2KA 3VQ6A 2E19A 3EFOA 3TTFA 1YS6A 3LAPA 1K8KA 1IUYA 3SJHA 3KP5A 3CCRI 4KO0A 4WFNL 2BY3A 4P55A 1RDAA 4C8NA 5CQEA 3E66A 1HYZA 4YEJA 2YU9J 2IVOA 4UVBA 3X25B 2F2VA 2DA6A 3HSBA 3IUCA 1KQ9A 4YFKF 1XNRK 4O5VA 2E36A 4YDUC 3CJ9A 3TI0A 1Q82C 3SHWA 4E4HA 4J9CA 1MUZA 3CZ6A 2WV0A 3IFRA 3NH1A 3BOQA 5FKLA 2DK5A 2O5RA 4CJLA 4IJAA 3REAB 1J75A 2F4OB 4XH1A 2L9NA 2NOFA 3CCVN 3WTYC 2NZTA 1VQ6N 2LQ8A 1T3VA 3L09A 1H8AC 2YX6A 4X65K 4L9TA 5GAN3 1B72A 5BPNA 2DO7A 1NK7A 3HP6A 4JAXA 2P1JA 2OFIA 2EX3A 4GYGA 4EMGA 2EFNA 1OU9A 2CU7A 5JR3A 3SJJA 5FLVA 4DR2K 2X4YA 2GOMA 2K9LA 4L5JA 2VWKA 3OOPA 3RZDJ 1TTYA 1N5YA 3SDZA 3AG4H 3CCVI 2G8IA 2J6OA 2WWYA 4CI0C 2XAUA 4KIGA 5AQXA 2XDBA 3OW2A 3LWFA 1YHQA 5AQIA 2LY2A 4I0AA 1NJIU 3CCRA 4A3GJ 3DLMA 2G8FA 2JK3A 3RR6A 1RI0A 3VS6A 2UUBK 3BDDA 1G6NA 1S72N 3C7JA 1E4FT 4Q48A 2GBZA 5TKWA 4B8XA 1ULYA 2FZCB 1JCGA 5FU6B 3EG2A 1V5FA 4AF1A 1FBQA 2DTUA 5HODA 1HR0K 3DLBA 1Q86R 3BDPA 3DWLE 1HNIA 1IV6A 3UNGC 3LAJA 3X26B 4M9ZA 2G3RA 1Y1WJ 2DD4A 5LJWA 3HSRA 2FA5A 4Y52J 1L3TA 2LOOA 4PGGA 2AXLA 3TAFA 1T98A 5FW9A 2YUOA 2EQMA 4C8QD 2NRHA 4FJHA 1ACIA 5D4SA 5DM7L 1X75C 1G3WA 2JTFA 5FD5A 2Y2ZA 3I5UA 2HMAA 5LJ3f 2DK3A 4Q47A 3AAPA 1RI9A 3OYMA 1GT0C 1XC3A 4XM3A 2O8DA 3JRDA 4JD2A 2CS7A 2GXBA 2HL5C 3OA6A 5LHGA 3LP2A 1TAQA 2DXCA 2B0LA 2L9RA 1S3JA 1NOZA 3V42A 4X1EA 5BN9A 4KT6A 4DV3K 2DA1A 4FETA 1NKBA 5E8GA 4YIFA 1K79A 2D5RA 2O0YA 4BQOA 5KGWA 4C5GA 3NHNA 2KZMA 2L3SA 4RW4A 4OVAA 3KHYA 3BCBA 2FNPA 4YIRX 4FZXC 4M3ZA 2ACJA 3A03A 1YT3A 2O61A 1Z3YA 1BK2A 3P8DA 2K5CA 2GAUA 4GKKK 2X6YA 1VQOQ 4FPBA 3WG7H 1KVBA 1OOTA 4CCNA 1R59O 3TSUA 1WJFA 3K0SA 1PD0A 3V9ZA 2KJBA 1T0FA 3ENBA 3BLYA 3FXMA 3H45C 3ZCOA 3GTJJ 4FK2A 4QTRA 4RM3A 4EIKA 1HUXA 4OPAA 2KFZA 2BW3B 2E35A 4M7DG 3WHCA 2KVQG 1XC9A 1JUPA 3NRVA 1TC3C 5DDGA 1YJWA 4DFJA 2LNBA 4EJVA 2IG0A 1LUJB 2XGCA 4CERA 3SD4A 1FJGK 4HVJA 1N5ZA 2DOAA 3IP4B 3S2DJ 2X4WA 4DBRA 3RKYA 4I9LA 1IJJA 1H9TA 2QQ9A 2BZXA 2OI3A 4ZYDA 1HRHA 3HYFA 4BDYA 1NU0A 2RF0A 3MMVA 3RQ4A 4A3CJ 2ZZDA 4FJJA 3FHZA 2A5YB 3CCET 2H3EB 2KQRA 1RDDA 5AQKA 1BW6A 4J9FA 1JXOA 4EP4A 1NK4A 3MEAA 4B3TK 4DJAA 3MN5A 2E6ZA 3H1CA 3CO6C 3QWLA 4PNOA 2E1OA 4XEIA 3QO3A 2EQIA 2ZPIB 3TMOA 4M4ZA 1HJRA 4C3IJ 2K86A 4MNUA 4LIUA 5IOYA 1RIOH 1MBKA 5I3UA 4DSJA 2B7EA 1NM1A 3RMSA 1QQCA 4K2EA 1NG7A 1W36D 2JQ7A 3BC8A 5C6SA 3RCOA 1ZSZB 4Z88A 1LV5A 1R1TA 1VQ5I 3R6NA 5EC7A 2F4VK 1TK0A 2FE3A 4ME7A 1HQUA 1EIFA 2B86A 1JEGA 5KYXB 3EGXA 4L6V5 5KCOA 1VQKT 2GBYA 5KQ8A 2CP0A 1MWMA 3ESWB 3AA5X 2E60A 1IRZA 4JI0K 3JCMb 5E8IA 2Y31A 4A69C 2A36A 2OCCH 3CCVQ 2Q0RA 2E1CA 1PP7U 4XRSA 4CZGA 4W5RA 5GAN7 3HBTA 3OSSC 1MSEC 1ABOA 3PVQA 5IP9J 3AGRA 1MMGA 1U45A 2CW0F 4OGCA 4Z4GA 4YOQA 3CMEA 4NC6A 3ABUA 3J80O 4EJTA 1NYFA 5JICA 2ZPFB 4LDWA 1KZHA 4KTZA 1A6IA 4Y3OA 4Y7NJ 2L3QA 2RQQA 3R3LA 3CCQQ 2HS5A 1CF7B 5AZIB 1A0NB 2ZXHA 1LJOA 1IKXA 2BHYA 1CF7A 2YNIA 4J7IA 1QMCA 2CGJA 4NYFA 3QFPA 1D4XA 3MXMA 3A2FA 2J7IA 4MDWA 1NBWA 1KQSM 3CUQB 4CGJA 1LWEA 3O8VA 1MA9B 3ZQCA 4CXFA 4OO1J 4A4KA 1TKXA 1MGQA 4H4MA 5KH6A 2VKEA 5GAN2 2QA4N 2RI3A 4R0KA 5GMKj 3DLHA 1LEBA 4W97A 2XPWA 4EV0A 5AQWA 1MMNA 1M27C 2Q3SA 1HNVA 1P90A 1YJ9I 1FW6A 3DWLA 4X6AJ 1WHHA 2JUFA 4OF1A 2L7KA 4OMNA 1TQIA 2XO7A 1UGSB 3FXJA 2DMPA 4BR0A 1KJWA 4RTXA 2BE2A 2WTEA 4FLWA 2BVMA 1JTXA 4KN4X 5FLMJ 3D0SA 4I09A 5I2MA 4Q0BA 1BI4A 4G7ZF 2Y4XA 3JR9A 1N8RU 2VN2A 4WYBA 4XLPF 4QCLA 3UKRA 2OUMA 2HQHA 4N41A 1TWFJ 3Q0WA 4FISA 3VPZA 3FSPA 2DYSH 1HKTA 3EGXB 1XQOA 4HVUA 3N4QA 4PJOG 2EHGA 1NHAA 4N0BA 4RCBA 4RG2A 1VSLA 5LHIA 2B6AA 3WU1B 4GV6A 1N8RC 4F93B 4MZMA 2VJIA 3H9NA 1RT3A 4RW7A 4EM2A 2UWMA 3VEYA 4B9NA 2HQ5A 2NNNA 1WI9A 1PDNC 4NC8A 2A5XA 4MEXF 2KYMA 2MLGA 4F04B 4AM3A 3O5BA 5E3OA 3TWHA 4LD9K 3DF8A 3HTUA 3C12A 4B3RK 4LGWA 5IYCJ 2BE5F 1BQMA 4BR7A 3D45A 2EW3A 3PV8A 1B59A 4M77F 3BR6A 2D0NA 2HR3A 4QW2A 4Q4ZF 1VQ7A 3SZ2A 4M7AF 1B9FA 1AVZC 1QQJA 3QSUA 3A01A 2KLOA 5HK3A 3H5NA 3HI0A 2FRHA 2CT3A 4RB2C 3M59A 3GZ6A 1IO6A 2BUPA 4E1MA 2KRNA 1EH8A 2QZ8A 3EHRA 2LVMA 4J2EA 1YUWA 2EA4A 2QQRA 4RBOA 4IOXA 1J9IA 3OS0A 1XGSA 3CJCA 3LA2A 5GAOl 5CVUA 3CXCP 4NQWB 3AL0C 3HC7A 2CUZA 3TAMA 4ASNA 1F1ZA 5CVJA 1M1EB 3TEEA 2GQVA 3WTVC 1VQNQ 1AOJA 1VQLT 1C0GA 3HPHA 4BR5A 3SQ0A 3JCMV 5H6QA 3Q7BA 2BE7D 1Z9QA 2K5LA 4KMUX 4A2UA 1C0WA 4ZC3A 3ZQGA 4KTQA 4F3TA 5AJ3K 4DTNA 2X4HA 2OTJT 3JRIA 3I55Q 1TV6A 5FLXK 2FMLA 5F64A 2MSYA 4JJCA 1HQEA 2Z33A 1B1BA 3I4NJ 4ENKA 3LH5A 3CESA 4FZYA 5A2QE 1ZGWA 2WAQN 4OB1B 1YTAA 3T5XA 4I02A 2VC1A 3CYMA 3LSTA 5AR0A 1NG2A 1IRXA 2EFPA 2M5WA 1BGXT 1D8JA 3VQCA 4LK1F 4Z4CA 1GV2A 3KZZA 2YNFA 3S17J 3RKWA 2RHKA 5E79C 5LMUK 2P9KA 2QLZA 1LDKB 2Z9OA 3ZX2A 1T0JA 4J7FA 5HLTA 1KVCA 1LWVA 3WEEB 4MLOA 4LJZF 1U2WA 4RMOA 5TJJA 5FRNA 2OTLI 1JGSA 3CCJQ 2QGGA 4OP0A 2Z99A 3M0TA 4KPYA 4XIDA 3LA3A 3HRMA 5GADJ 1OCTC 3GG4A 1UZCA 1F5TA 1YI2I 2HBMA 4FVUA 4M78D 1K76A 3A0BC 2NOEA 3EGDB 2V51B 4C92G 3OY9A 3B8AX 3TSQA 3JB9F 4ZYAA 4CFAA 1A04A 3AVBA 5C42A 5EU7A 1AWWA 2QGUA 1IKWA 4Z89A 2XSJC 3KETA 5M5XJ 1M3CA 2HBJA 4M7DF 3CPWA 5SWMA 3O6BB 4R5PA 4FQGA 5M9OA 1XHXA 4ELYC 3QDRB 3EYIA 2FF4A 1OCZH 1VQ8T 2VJ4A 3EKSA 3F73A 3CWAA 2DK8A 2K27A 4CHUA 4KMFA 1XOVA 2QXLA 2K85A 3ZXSA 1BC8C 3C7NA 1V5GA 3E7LA 4BR4A 2IRFG 2O3FA 4DIQA 2PYLA 1VQ9A 4A2BA 5GMKl 4HT9A 2ZPHB 3JRBA 2KFDA 1RTDA 1WHGA 4M75A 2VWBA 2X6SA 3CCRN 3WQUA 1ZELA 3G6EQ 4M3YA 4BE1A 1Q1HA 3VQ4A 1TSFA 3K1PA 1VYVA 1WSUA 1Q81U 5FWBA 3CPWM 2HHXA 3I0WA 2WC9A 3LPUA 3BY7A 1ODDA 3QIPA 3DEWA 4IRGA 1H1VA 3ALYA 4CK2A 3LSGA 4EFHA 4W5OA 3HYIA 3HP9A 4CYCA 5CR2A 1DPRA 4JLIA 4MLEA 2LVSA 1KC8U 4MTEA 5KAFC 3CMAT 3A8OB 4N4HA 4RCCA 4AHTA 2E3IA 3ULRB 2ID6A 1HSQA 4M77G 1N75A 3B6PA 1U3OA 1YQRA 4C23A 3FRNA 3LYIA 3K4LA 3TAPA 2XF6A 1MWKA 4J6WA 5AYFA 3ZLJA 1VRTA 2JA6J 1S6PA 5KE2A 3QESA 1Q7YU 2MOXA 3HHGA 1T03A 4PWDA 4M3UA 3H6EA 4FHTA 3J7ZI 4O8KA 4XSXF 3UPUA 3G71I 3CERA 5GAHJ 4JN4A 2MD5A 4C8KA 3M3ZA 1R1UA 4FJMA 2CQQA 5A2QZ 2ASPA 3TAEA 1NG9A 2YRCA 2VXEA 1IG9A 1YJNN 2IGOA 4UNOA 5EOYA 2LY1A 1FZPB 3HT3A 3O8GA 2YXYA 3ZT4A 4RW8A 2EYQA 3INZA 4XL9A 4M7XA 3DTIA 3TOAA 2LH9A 3C6AA 1Z7UA 3ABLH 4DV6K 1DGRM 2FU4A 4JX5A 2QENA 3SDGA 1Q86U 1K78A 1JLQA 3NVMA 2DT7B 2V8JA 5AQFA 1XMOK 1YBYA 1AD5A 3AA3A 4ISGA 2QKLB 1N34K 4DS5A 5LBQA 1QPMA 3GBTA 1YW7A 3NPFA 1S7AA 2LBFA 3SZTA 5AQZA 2NNYA 1TYQB 4PFZA 2G8KA 3OYAA 2EFOA 1QP2A 2FUG2 1OQYA 4EMSA 1OPKA 1B3QA 4BQLA 3K5MA 2E6NA 4M77A 1WJBA 4ZDLA 4BG8A 3U9DA 1OR7C 2IPQX 3FIFA 4U0YA 1HLUA 3O8MA 1PUEE 4IJNA 5AONA 5FROA 5C44J 1WHKA 3KBGA 2OTLN 3ZT2A 3COAC 1ZG1A 4H4OA 1W9HA 3ZX0A 1RT7A 3FFKB 3CPWS 1WSEA 2N8GA 2DETA 4CEDA 2I2LA 1JUSA 2DQRA 2JOYA 1Z9CA 3WHBA 2DZCA 4LFUA 4B1XB 1K4TA 2E2IJ 1AKHB 1WGXA 3ABMH 5CYMA 3VV0A 4LH4A 3D0PA 4IIOA 2QEXQ 4H5RA 2K2MA 3L9FA 4C8QC 4HUEA 2JMCA 3TEDA 2L7MP 1EP4A 4YFNF 2GTOA 3EY1A 2IVNA 1VQNA 4OKKA 2UXNA 3ZMTA 1YJ9T 1L3UA 3T0YA 2DEQA 3W3CA 3K10A 1ZLKA 2RPIA 3W6KB 2ME6A 3PVLA 1XJWB 4PGHA 4JPBW 3WXMB 3G4SQ 3O4WA 3M6GA 2W7NA 3LWHA 1FMKA 2UXDK 3O9QA 2NOIA 1D9FA 3JB9G 2CSQA 3J7YJ 2O9SA 4IUQA 4MQ9F 3RMDA 3GL1A 3F10A 2GQQA 1J0RA 2ZPBB 4RDUA 1VSMA 1USTA 1UG1A 5GTIC 1TBXA 4BUGA 4KHNA 2HOAA 2HMPA 1W4MA 3OMGA 2P9PA 4DNCA 3PNVA 2D8JA 1ZYRF 3NMUA 3P39A 2VYTA 2DVJA 2XF5A 2K4YA 1ZH5A 3GTMJ 1K8AR 2CP5A 3V7CA 1BB9A 2CUBA 1JXEA 3CC2Q 1KHCA 2EQKA 5D4RA 1U6ZA 1VIFA 1BG3A 3CHWA 3THXA 4X66K 1YI2Q 2Q0OA 2L54A 3PSIA 4A57A 4G6DA 1QP3A 3UIQA 2K9GA 1WKMA 2YKMA 2I0NA 1XGMA 5GTHC 1ZK8A 1T56A 4HYEA 1KG7A 4CVNE 1B8IB 4BRGA 4BE2A 3LSHA 2COBA 2XPVA 1KYWA 3WTZA 2TCTA 3C6HA 1ARKA 3ENOA 2DD5A 4DQRA 3CCQI 2PZ1A 4PLIA 2YHWA 5LJ3h 2GLOA 3CO7C 4KHQA 2BHZA 5AQLA 1K61A 2MH9A 3OBWA 4IBNA 2Y48A 3U6FA 3M0UA 5FKNA 3CCYA 1REPC 3ZL7C 2GEMA 4L9VA 2E5ZA 5EX5A 1I0CA 3F6VA 3DLEA 1AZEA 3TO7A 2IDOA 1WIEA 4UB6C 2K57A 4KRTA 4B9VA 2JPBA 2DL5A 4JJBA 4OMMA 2K9QA 1Y7XA 1BISA 2VWJA 4N0AC 3NGYA 1VIEA 1C0UA 2VKNA 3BZCA 3RRGA 3S6IA 2FZKB 4DBQA 1QRYA 4FSVA 2A41A 1HW5A 4BY6C 2KT1A 2LSNA 3HOVJ 3MWTA 1IG8A 3SAGA 3GFLA 3HJFA 4M3GA 4BRHA 4J9HA 2P0WA 1MH4A 1A31A 2D0OA 1RESA 1U2VA 3BTJA 5JVTA 3KWIA 4KGZB 4FYYB 5CYQA 4EW4A 4HX7A 5J1EA 2JA8J 4HG2A 1NKUA 3T8TA 2E8AA 2GFAA 3FLCO 2LRDA 3UA7A 2CYZB 2YX4A 1RAAB 3GXOA 2BKDN 3W0LA 1U4BA 4H0TB 3L4IA 1IN7A 4LK0F 2WV1A 4HNVA 2HVSA 4KUIA 1VQ6Q 4XRSG 4BGBA 1S9HA 4N4OB 4HTUA 4XLHA 4FSXA 1G99A 3NWSA 4ZYHA 2RKHA 1RTIA 2X6OA 1WAJA 4EGZA 3PIOF 3I53A 4BXUA 4OOIA 4PJLA 3G7ZA 2F2WA 3IDHA 3EN9A 4PZJA 4JKFA 1YO5C 2WOMA 1YXQA 2RDPA 1IW7F 2HYJA 3FMRA 1QVUA 1KTQA 2RJEA 4XTXA 4FE7A 3DOLA 1XMQK 3K9KA 1UAAA 3FHNA 1RC9A 5HKCA 1DTQA 1I1SA 2EKHA 2DLLA 3ULQB 3HSTB 4CHPA 3VQQA 5HDNA 4ZH4F 1W1WE 1WJRA 3Q1JA 2QA4T 2XI9A 1WB9A 1HNXK 2JRMA 4RGSA 1HBXG 2DPUA 3CC7I 3S2WA 5BR9A 5D5WB 1N8RO 3O08A 3K5LA 3FK6A 4FU6A 2M1BA 3M3YJ 2BANA 1XUPO 2PQWA 4DLEA 1GVDA 1YX3A 3T1YK 2YRDA 3BDLA 1GXQA 2CS3A 3GZNB 5M5WJ 1FBUA 4UVCA 1WXTA 1TNSA 1H0MA 1SPKA 1M90C 4CC3A 4YG2F 4JI3K 1KAXA 4BC4A 4RAZA 4KGVB 1G4DA 4C9YA 4BWJA 4OMFB 4U7BA 4DS4A 1JLGA 4B4CA 3KLIA 2ELJA 1K8AU 2KXCA 2ZQBA 4OMYA 3MJXA 1MPGA 2PAVA 3RMAA 2EGEA 2ITGA 1JKHA 1KFSA 1PD1A 3JV3A 3B6CA 1YP5A 3WEEA 1D09B 1YI2T 3H0HA 4DZJA 4DQSA 3A5OC 2VJ5A 3K0LA 2GWKA 1YIJN 1U47A 5BN8A 4DQPA 3CDHA 3SQ1A 3EFOB 5IWAK 4DTPA 3QFUA 4BI8B 4Z4EA 4GMJB 3GBQA 4PL8A 3SCXA 3NE6A 1ITGA 2M0MA 4F2SA 2AO9A 1ZHIA 2VODA 1ACMB 3I54A 3CQ8A 4I6MA 4XKVA 1ZA2B 3CCQT 3C2GA 2DA7A 2D8HA 4CJ3A 1I6HJ 3S32A 1SD6A 1FOWA 3VF6A 5HS7A 3TSZA 3OIOA 3WTSC 4DTOA 1WI7A 1NK8A 2VPLA 3FK7A 5J2QA 2CSIA 3DP7A 2CP2A 3AVCA 2VUBA 1QSLA 4LOCA 2EJGA 1Y0NA 2HXIA 1EF4A 4PKIA 1S29A 5KHDA 4A3DJ 3OL3A 3LMMA 3CCSI 1Q86O 2QW9A 3CBPA 4M75F 3MK6A 2JN6A 2Y90A 2V8KA 1OV3A 4DSKA 2MIOA 3EETA 2CZ7B 2DVEA 2EYWA 4KISA 5DV5A 3SDBA 1O75A 5E1XA 2P9UA 4E7SA 3CC2N 4J6YA 2ZM6K 1B72B 4L5EA 2M3AA 3MEGA 1VA7A 4KKOA 4C92B 3F8MA 4AI5A 1FMVA 3CXCA 3MHXA 1MSFC 1TWAJ 1R0CB 2ZO4A 1RACB 3NF8A 1TKZA 4OMQA 4Q5SF 3GTLJ 2LJ3A 1N3CA 2ZJQL 4HA8A 3V9WA 3VTIA 3SWNC 1WDXA 2HKXA 3ZCMA 4DTJA 3NTHA 2ROTA 2HTJA 3RSNA 2QK9A 2LMJA 2HOEA 2QF7A 1JLCA 2JJ9A 2UXCK 3QG1A 3BG6A 1LB2A 3LQQA 4UUVA 4XRFA 1IHWA 1YW8A 2FPEA 5ICGA 3A8YA 4KDPA 1KD1O 1SKUB 4LY7A 3Q5FA 1X1PA 4LLGF 2JS2A 3WQTA 3ZN1A 3OYYA 2IIRA 4L5GA 5AIQA 1BO5O 4Z4HA 3WNFA 1HKBA 4J83A 4IOAL 1NGJA 4X0GA 1PSFA 2UYTA 3CJNA 3CMEI 2LC2A 5HVQC 3DMJA 4DEYA 1JLEA 4G1QA 2H27A 2XB5A 2BY0A 3DYAA 3VGKA 4FYWB 3FGUA 3SUQA 4HNTA 2OFKA 3CEYA 4EZ6A 4LLNA 2DCEA 1SVLA 1KG6A 2ASMA 3RESA 3QICA 2PJRA 1X3WB 1I5OB 3ITHA 1YITI 1E2XA 4FJLA 3OBYA 4B9QA 4DLGA 1K73R 5EVZA 1KU9A 2CJJA 5M1FA 3NDKA 3CCRQ 4BY1J 1NPRA 2FBYA 2OD5A 1AWOA 1LJ9A 2RHUA 2G8HA 2JWLA 5B66C 1WX6A 2HEQA 3L1AA 4RA2A 3LSMA 3R2XC 2FSNA 3S93A 3I9QA 2C06A 2QWOA 3G0ZA 3SYTA 1UDLA 3KCCA 4IL6C 4BS9A 2XHCA 3E9PA 3WE2A 1AOYA 4JK7A 3QPTA 1C6VX 3L2ZA 1D0XA 3CCMA 3RPQA 1M8MA 1FTTA 2PMUA 1JXSA 1JKOC 3MKLA 5GAMf 3I0RA 3F8FA 2FXAA 2Q97A 3T7ZA 3BE3A 1KFZA 4CBWA 1MBJA 5F1XA 3CWUA 1NK3P 3ULEB 2HPIA 4M7DE 4HPQA 1RUWA 1KG1A 1EQYA 1W7AA 4IOAF 1SKWA 5BPIA 5EDNA 1H92A 1SFKA 3ER0A 3SUOA 2UXBK 3VEWA 3IAM2 4Z6YA 1TU0B 1J5EK 1MJAA 2P7CB 3QP6A 3GUDA 1E17A 3DLAA 2L8DA 4KI4A 3ZFJA 3VQAA 1Y56A 2E5NA 1XMXA 3V8KA 2ETJA 3JCMe 1ON1A 1W36C 1SAXA 1X6OA 2Q0UA 3CIPA 3G10A 3BWGA 2ZGWA 3QINA 4JI4K 3NARA 4M77E 1KQSS 1QSSA 2MGQA 1N33K 1B9DA 3DXJF 5LEKA 3M4YA 3ZQHA 3BZ6A 2P81A 2RV8A 1BWFO 1UJ8A 3F72A 2W41A 1U04A 3TR8A 2O4XB 4QS8A 5J2NA 3R60A 3OYLA 2YHBA 3IG1A 3OA9A 1NGGA 4M6VA 4RAGA 2R5MA 1OVYA 3FM5A 1S72Q 2HHWA 2HZTA 1RZ4A 3EGDA 1PU8A 4IFYA 2O9VA 3CCST 1OCCH 1W1FA 1RNHA 1E4GT 4Y17A 3FWEA 1IXSB 2M1HA 2ZNYA 3MZYA 3KWGA 1IHVA 2E5QA 1GCQA 5EJCA 2R7VA 3VEOA 3IV5A 5B8HA 4A4GA 3ZMUA 4WF9L 2CSOA 3TKYA 3Q7CA 1WRJA 3IH3A 3VEPA 4EMKC 2A42A 2K3PA 4F52A 4M75D 3EZWA 2TDXA 5DUKA 5GAMj 3AO3A 2VONA 3BUZB 3ELKA 4AD9A 4KUMA 2BGGA 1ZA1B 2E5KA 3D7SB 1VQ8N 1JXMA 2H09A 1UJYA 5KPTA 4DV7K 1Q18A 1R7JA 4NCAA 5GAHP 3MP1A 3PO3J 1OH8A 4JZ3A 4JI5K 3PGGA 4M7AD 1E3PA 4EVVA 2Y1IA 1RLPC 3VYRB 3PLAA 2OA8A 1LPLA 1KG2A 2Q36A 4BG9A 2BW3A 3EDPA 2BXZA 5GAEJ 1TWBA 5CHIA 1G5VA 4OX9K 5DM6F 2R5YB 2DL3A 3SMSA 4H5NA 1M2VB 3NGPA 1IREB 1VQKI 2F2EA 2DL8A 2ZE2A 4FLYA 4ESFA 3MXJA 2CP6A 3H9JA 2K3YA 4U7DA 1U49A 1QVGP 3CC4Q 1WJDA 4M78F 2AIRB 2O31A 3GIBA 4NNJA 2FO0A 1S1TA 4E6KG 4IOCF 2FD5A 4GO1A 4AFQC 2HSEB 2WADA 2ZSHB 4A5AA 3HRGA 3LWMA 2O8CA 4F91B 3TW6A 2RC4A 1RBSA 3OWTA 4IFEA 5DD8A 3HOSA 4UV9A 1ENHA 1TH7A 4ZGJB 2DXTA 1NGAA 3OMCA 1JLAA 1UHSA 4R8HA 2E7XA 5JLHA 3K4KA 2GGRA 1U5TB 4XH5A 3BTLA 3ISPA 3HRSA 3K6GA 5F1JA 1SL0A 1VAZA 3D5SC 4IIMA 3QBWA 5GIOA 3ASMA 1P92A 3ID8A 4BL0B 5C25A 4YOVA 2KZVA 2IAJA 2ZXJA 5FJ8J 2DERA 1MBFA 2V75A 2JM8A 3FZFA 2VQGA 4RLQA 1FNNA 4FWLA 4FOIA 4DU3A 3TO6A 1GRIA 4LUEA 5AQSA 4KFBA 2BDPA 2G8WA 3K5NA 2EWSA 1TQMA 2QVOA 2WFBA 3AVHA 3HB9A 1FC3A 2WAQA 4LUDA 2CREA 2OPQA 2LRQA 2X1DA 2O8EB 4QLCU 2RQTA 2E88A 3REOA 1PYVA 1T05A 1QQMA 3HOTA 3BT9A 2O8BB 4AG2C 2A69F 1ZR2A 1R71A 1KFDA 4A53A 2G9WA 2XU8A 3VENA 3CFRA 2VXZA 4G8XA 2JA7J 1BJAA 3I3LA 4C8MA 4DR5K 2JTMA 1P9QC 4JLGA 3LALA 4LB6B 4HKEA 3NAUA 2D5VA 1BR1A 3JCMh 1P7MA 4AFZC 3C18A 5L3DA 2FF3B 4OWRB 4M3DA 1BQNA 4BJ6C 2JVVA 4E7ZA 1XSVA 3I55N 5J40A 1PG5B 4GY5A 5GANg 1BIZA 3FISA 1KA8A 4RTVA 4F8RA 4OIPF 3H6ZA 3E5XA 3G2BA 4PFOA 4LDVA 5IHNA 4E7LA 1VQ4A 1HYOA 2A1RA 2JVGA 5K5RA 2RHZA 1I50J 2O4IA 2DTHA 1N6AA 3U3GA 1HU0A 1BI1A 2V79A 2CUJA 4G6TB 3AARA 3ZEUB 3TSWA 3UT1A 3ATUA 3WU2C 5E84A 2EIFA 1YG2A 2H6CA 2NRZA 4M78A 4ELTA 1F21A 2DFFA 1MUDA 2MPXC 3GF2A 3GTKJ 1MDUB 5GANe 4HLYA 1VQ8Q 4Z94A 2M0YA 1VSJA 4CZEA 4GLMA 1ZREA 4KH0B 4F7UA 4F7UF 4DA4A 1TXQA 1GFCA 5J26A 1W0TA 4M7AA 3RDIA 2PJPA 2QYOA 3CVTA 4LF6K 4J00A 4DTMA 5AQOA 4F3OA 2NVUB 2W24A 3KKRA 4LSLA 3OVNA 1WSFA 4FT2A 4QSHA 3J7AO 4JS4A 4MQVA 3MN6A 3H8ZA 1UWBA 3VQPA 3U1KA 3W6VA 2AZSA 4DYRA 4B3AA 4A63B 3SWNA 4L3QA 1YJWN 2SEMA 2F8SA 3QODA 2QWPA 2LK2A 3HZ6A 3GCMA 3BZKA 2OJ2A 2XAHA 4O0JA 1YVNA 3CCSQ 5BS6A 1U06A 1I94K 2CUFA 2CW7A 3I55T 1GXPA 3NF9A 2JM9A 1NEGA 3A4CA 3EG3A 4A0ZA 4DW6A 4M45A 4Y13A 4OAZA 5LJVA 2EZLA 1WQ2A 1ZN2A 4KJZA 2D0PA 4F2RA 2HXOA 3LCNA 3VMFB 1E3HA 3EH1A 1Q9XA 2P6TA 2J5OA 4M3XA 3HXLA 3PIPF 1HW2A 2L02A 3QQAA 2PI0A 4J9BA 5K5QA 2ZMEC 4E7IA 3ZQFA 1X3NA 4YHHK 4EIAA 4KTWA 2HGCA 3VODA 3CPEA 3GLLA 5LJ3g 3RSEB 1MDMA 2IGKA 2MF2A 4V2GA 4JI6K 1P4XA 2HD0A 3AO1A 1X3UA 2DYRH 3GE1A 2CQNA 2ZJQF 4QVCA 3KP6A 4U0VA 3QKJA 3DV8A 1YFHA 5M1NA 4OPHA 4PJNA 4BBSJ 4WX9A 4ILHA 4J2DA 5KGXA 4D0PA 4AC0A 2F5FA 1B07A 4M3EA 4YIIA 3SV3A 4HCBA 3TOBA 3CJRB 3KZIC 2HNHA 3X2QH 5C2FA 3BY5A 2DAQA 4H0OA 4EVIA 3JAMO 4BXFA 4CFBA 1R4NB 3SXYA 4IURA