5FROA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz446 (compound 4f)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5froA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5froA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5froA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5froA03
4MFBA 3ALYA 2O4XB 4KFBA 1VSFA 4AHUA 2YKNA 2JGUA 2RHYA 4CJSA 4F4KA 4BACA 1HYZA 4B9LA 1HNVA 1C0TA 5IAYA 4CFDA 3KTQA 1RBUA 1GOAA 4IBNA 4OVAA 4CJTA 1U45A 2B5JA 4CERA 3SQ2A 4DF8A 2HNYA 3MP6A 2Z1JA 2RN2A 3RRHA 1T7PA 2P5OA 3AO5A 1BI4A 2ETJA 1G15A 3C94A 4CEFA 4W5QA 2XY7A 3TWHA 4FZZA 3OYJA 4OLBA 3E9GA 1SSFA 5J26A 2EQMA 1Q8IA 2O4XA 1S1XA 4BD3A 3DMJA 3OYDA 4ID5A 1RBSA 4FM0A 2B8AA 4RW6A 2EQJA 2RHZA 2Z1IA 1N27A 4DG1A 4N4HA 1Q9YA 2KFZA 3ZT1A 3NDKA 2FBYA 3S9HA 1NJXA 2IG0A 4N4IA 4LH4A 2W42A 3G10A 3MO8A 4FJGA 1U04A 4Q5WA 1WAJA 4CFBA 4B9MA 3SQ4A 4CF9A 1GOBA 3VQCA 4DSFA 4KHYA 4ZTFA 4GY5A 1W0HA 1JLBA 3EYZA 3LP0A 4PWDA 4CJPA 1J9AA 4B9WA 4C8MA 2FC0A 3VQ7A 3DI6A 1SL2A 1HYSA 3K59A 5D6YA 2G8UA 1HRHA 4FJNA 2LRQA 3WNEA 2ZE2A 3KK2A 4C8NA 3NCIA 4OJRA 1IKXA 1H3ZA 4CEDA 3L2WA 3ZSVA 2QXFA 1TKZA 1RTDA 2OZSA 3E9FA 4E7KA 5SWMA 5I42A 3RR8A 3OYIA 4KHSA 4X34A 1QHTA 4DWIA 3EY1A 4HTUA 4DS4A 3V9XA 5KGXA 4KV8A 1SV5A 4F2RA 2YNHA 2KW4A 1JLFA 3VQAA 4CJVA 4FLVA 4FK4A 4N47A 4CESA 2BDPA 3L3VA 1KRPA 4CF8A 3C6UA 5D6XA 3CM5A 4DFKA 4CJLA 3KLHA 3DLEA 3TANA 4JS5A 5CIUA 2YNGA 4BDPA 3L2UA 3ZT3A 5T7BA 1FKOA 3PO4A 2HQXA 1RNHA 3VQBA 1NKBA 4H8KA 5CY4A 1JKHA 5M9OA 1MU2A 4FU6A 2JZ2A 3NAEA 2WOMA 3PY8A 4E19A 1RT6A 3TARA 2R58A 4RW7A 1B9FA 2X78A 3ZSWA 1I3AA 4FJHA 3DLKA 2X4YA 2DFFA 2OPQA 5HRPA 2BGGA 2X4XA 3AVAA 3ASKA 3TR8A 3KKRA 4YFUA 3V4IA 1IKWA 3OYLA 3PUFA 1J5OA 4Z4GA 4JS4A 3OYKA 3RTVA 3EZ5A 2HHSA 4CJRA 3KLEA 1U49A 4CGIA 4E89A 2XY5A 1WJQA 3I0SA 2A1RA 4C5EA 2E6MA 1EKEA 3CFOA 3CFPA 4LD0A 4KB0A 1WSJA 4CGFA 4CK3A 3G0ZA 3H6ZA 4HUGA 2VWKA 3DLMA 1RTJA 4QQDA 1BL3A 4KHWA 3QIOA 3D0PA 1WNSA 4Z4FA 4CFCA 5HRNA 4Q0BA 2OPRA 2G8IA 2XK0A 1W9HA 1S1WA 1WSFA 3JSMA 4AHCA 3CFRA 2LCCA 4Z02A 2DIQA 3D45A 3LDSA 3HSTB 2BKDN 5CZ1A 3QINA 3FC3A 3MEUA 1NK4A 3KLFA 2K3XA 4DQSA 3LP2A 3K2PA 3SUOA 4FK0A 4QQ6A 3QEXA 1LAWA 3AVCA 1B9DA 1BQMA 3VQDA 2DY4A 1O1WA 3PMTA 3LLRA 1BCMA 4N76A 4M41A 3MEVA 4NCAA 1KVCA 1S9EA 1LWFA 2R5AA 2EQUA 4HHTA 4OLAA 1HPZA 2A1SA 4II1A 4FJLA 4BE0A 2WONA 1VSIA 1C0MA 2CKKA 1HYVA 2L8DA 3ZT2A 3VA3A 2BUDA 1RILA 1TK8A 3HPOA 5HLFA 1JLCA 4CJ3A 4O0IA 3LGLA 1X1PA 2B6AA 3NH1A 3OYMA 3ZSQA 5J2NA 3AO3A 3QEVA 2FBTA 4B9VA 3NTKA 4KHQA 2RI2A 2ITGA 1XC9A 3WNHA 3OYFA 4KI4A 1QS4A 4A4HA 3WNFA 5C25A 4OKKA 4KTWA 4E7IA 3LWMA 2G8HA 5FDLA 3PV8A 4CGHA 3OJUA 4EDUA 4DQPA 4PY5A 3AA3A 1D8YA 3KK3A 2AJQA 1EXQA 1FXXA 2O4IA 4CJKA 4J2AA 4RG8A 1NOZA 3DLHA 4OPJA 1S6PA 1TK0A 4C5GA 3CG7A 1WLJA 4N41A 5KCOA 3P5JA 2OZMA 1NKCA 2P51A 2BANA 1NK6A 1BGXT 3PNWC 3MAQA 2RPIA 3QEPA 1X9SA 3SCXA 5C42A 4DU3A 1VK0A 1WGSA 3Q1JA 5KH6A 4FLUA 4N4GA 4CK1A 3T3FA 1NJZA 4O0JA 3CEYA 4EZ6A 4EP4A 3SUPA 4JRQA 3VQQA 3VQ8A 1YT3A 3L3UA 4CEQA 4I7FA 3HM9A 2R5MA 1KVAA 3C4SA 1TVRA 4M3TA 4PUOA 3RMDA 3IRXA 3O3GA 5KE3A 2RJDA 2IS3A 5FRMA 3K5MA 3L8BA 1HQEA 3DRSA 2RKIA 1NJWA 4H4MA 4DTRA 1TKDA 3S3MA 3OYNA 4KRFA 4DSLA 3H8ZA 1KLMA 3PX4A 4QOZB 2RJCA 4EZ9A 4UQGA 2ZQBA 2RF2A 4IUQA 2Q3SA 4M3ZA 1YTAA 4IFYA 4CRIA 1RT2A 3ZSRA 1RT4A 4YNQA 3O4QA 1ZBUA 4F3TA 5KGWA 2GFAA 1ZBIA 2HW3A 5HBMA 3KKSA 1XHZA 1VSJA 1NK9A 3PFSA 5C6SA 4W5NA 4B8AB 2LDMA 3K5NA 3HL8A 2P1JA 1R0AA 3VQ4A 4E7LA 1UAXA 3NNQA 1S1VA 3DLRA 3NBPA 2WACA 3RMBA 1VRTA 4I2PA 3NF6A 4PQUA 4WE1A 1N5YA 3MEAA 1LWCA 4DTUA 2G3RA 2XY8A 3HXMA 5HRSA 4DU1A 1QSSA 4CEOA 3UT1A 4PLLA 3OMCA 3DOKA 3GOXA 4FW2A 3NH0A 1T03A 1RDBA 3HK2A 1FKPA 4L59A 3AV9A 4BDZA 4F8RA 4CEEA 4F2SA 4Q5VA 2HNZA 2DFEA 3M8RA 4E3SA 1Y97A 1IKVA 4AHVA 4DMNA 2LSNA 4Y1CA 1J53A 1VSLA 4K8XA 1REVA 5KE2A 2F8SA 1KSPA 4ZHRA 3T19A 4XIUA 4AH9A 1JXEA 2FBXA 4DLEA 4PL6A 4F3OA 1KFSA 3FEOA 1S5JA 4IFVA 3OYAA 2Z1GA 3K5LA 1BISA 3OS2A 4CGDA 3C6TA 3V1OA 2HHQA 2NLUA 1XI1A 1UWBA 3SZ2A 1BCOA 2IC3A 4CHOA 1TL3A 4KREA 4QVZA 1HJRA 4ICLA 1ITGA 2EX3A 4RW4A 3OS1A 3AVLA 4KTQA 1WJSA 4C5HA 1ASUA 3AVGA 3OS0A 1NK5A 4B3OA 3SUNA 4Z4IA 5I3UA 2VG6A 1SL1A 1FK9A 3VQ5A 4CJQA 4QW2A 4JRPA 4CCHA 3DLBA 1DLOA 4FJMA 3SQ1A 3AA5X 4LD6A 2MWOA 3I0RA 2HHTA 3OYBA 5FRNA 4HUEA 3V9WA 2XHBA 1L3TA 2DIGA 1L3VA 4GW6A 4NCBA 4ELTA 3RRGA 3VQEA 2HQEA 3QIIA 1NOYA 2E4LA 4NCGA 4FJIA 2IDOA 3OA6A 1S1TA 3V1QA 3MXMA 1F21A 3L2RA 4OGEA 4L8RB 1S1UA 5HRRA 3ZEHA 2XDPA 3P1GA 4ELUA 4G1QA 3OVNA 3LAMA 4DSKA 2HHUA 4QQGA 1LV5A 4FJ9A 2OA8A 4FZYA 5J1EA 3M8SA 1WSIA 4H4OA 3UWNA 2E5QA 3K5OA 3ZSOA 4PLIA 1TAUA 3E01A 2EHGA 4QAGA 3F70A 3L2QA 3LZIA 1UA1A 3DLGA 1T05A 4M42A 4KPYA 1UOCA 2ZD1A 3FDRA 3MEEA 3AO1A 3RWUA 3MEWA 4LSNA 4Z0UA 1L3UA 3QEIA 4FK2A 2HVIA 5KRTA 4IURA 4DTMA 4IUPA 4A4FA 2BE2A 4GVMA 3KD1E 1D9DA 1OYXA 4HCBA 5C24A 3OYGA 2JLEA 3DB3A 4CEZA 2YKMA 1KFDA 2FHDA 4TSXA 1S6QA 5HP1A 4I2QA 3KJVA 4DTPA 3NH2A 3M9QA 2D0BA 3QNOA 2RJFA 1QE1A 4DQQA 3CQ8A 5DK5A 4FXDA 2M1HA 2VG5A 4IG0A 2PYLA 4KO0A 2P5GA 4E1MA 3HP6A 3ASMA 2YRVA 2M16A 1XHXA 2QKBA 4N5SA 3MECA 4CEBA 1KLNA 3TAPA 3OYHA 1S9GA 1EP4A 1HMVA 4FVMA 3KUFA 1TV6A 4O55A 3C95A 2FBVA 2G8VA 4B9SA 3H08A 3L42A 5KTQA 1ZBHA 3OQ5A 4I9QA 3O4NA 4KTZA 1RI0A 2VWJA 3LH0A 4R5PA 3AO2A 1B92A 3TAGA 1D5AA 3KK1A 1L3SA 3OB9A 2VYTA 1OZ3A 4OVLA 3NF7A 4IDKA 3TAMA 1RTHA 4FJXA 3AA2A 3PX0A 5EU7A 1SKSA 3K58A 3DM2A 2GFUA 1CXUA 1KCFA 4M3XA 4LSLA 1VRUA 3WNGA 3ZCMA 3CYMA 4O5BA 4CHYA 1EETA 4ELVA 3HT3A 4DTSA 5FROA 3VN5A 4KHUA 1WSEA 3NF8A 2XRIA 3IG1A 3DYAA 4AHTA 3V9UA 3QESA 4CHQA 4W5TA 1WSHA 3KLGA 3UIQA 4KHNA 3SYZA 3B6OA 1C1AA 2YHAA 4GMJB 4FJ5A 3RR7A 2X4WA 4FM2A 5HROA 4CIEA 4B8CA 4B9UA 4DSEA 1VSEA 3QIPA 3LP3A 3HVRA 2M0OA 5SZTA 1BI4B 1WAFA 3NTHA 4CHPA 2RHUA 3S6WA 1RTIA 3OY9A 4BWJA 1ZYQA 2XY6A 1WSGA 1RT7A 3NHGA 3NGIA 1NK8A 4IUUA 3NGZA 2OPPA 2L3RA 4HCCA 2PYJA 1RT5A 3HYFA 4C8OA 3PO5A 4N56A 1NK0A 2HHWA 3LYIA 4E7JA 4KI6A 3PMIA 2GUIA 1QSLA 2QK9A 3CM6A 4IUVA 3DOLA 4ZTJA 4BDYA 4CJUA 3MXJA 4O44A 5J39A 1ASVA 3FLGA 4M45A 4ID1A 4M3WA 3K57A 2B4JA 4FJKA 3AVNA 3MXIA 1I39A 4CGJA 3SQ0A 1DTQA 2OYQA 3S3NA 3F9KA 4FLTA 4HVJA 3A2FA 4B9XA 3HO1A 1CLQA 4BE1A 3OMGA 1D9FA 4O4GA 3V81A 4AHRA 4NZGA 2D0AA 2X35A 5C0MA 3OJSA 1RBRA 2PZSA 4IUTA 4AHSA 1J54A 4DSIA 4RG2A 4CE9A 3IS9A 4B9NA 2R57A 4RW8A 4Z4CA 1YTUA 3U3GA 1C6VA 3M8QA 1N6QA 2XO7A 2KTQA 3QO9A 2JTFA 2F5KA 2EQKA 2GBZA 2MWPA 3QJ6A 2Y1IA 2G8FA 1C1BA 4KKOA 3AVMA 2D5RA 1TL1A 3O3FA 1X9MA 3AVJA 3LALA 4OGCA 1OI1A 1G5VA 1CZ9A 4HCZA 3META 4DLGA 1TAQA 4A4GA 1BQNA 1JL1A 4DTXA 4W5RA 1C0UA 1SKWA 4LY7A 3TAFA 4DTJA 1BHLA 2G8KA 1RT3A 1ASWA 4FLZA 3AA4A 1IO2A 3DRPA 1Z26A 4DTOA 2X74A 1RCHA 1CXQA 2Z1HA 2OPSA 4CEAA 4FLWA 4FJ8A 3PX6A 3HVTA 4CFAA 1VSMA 1LW0A 4BE2A 4M3YA 3QBYA 3P8HA 1C1CA 1QSYA 3V9ZA 3V1RA 1OZ2A 2RJEA 3MEDA 1NK7A 4CIFA 3MEGA 1RDAA 1HNIA 3LAKA 3KLIA 2D9TA 5KI6A 3M8PA 3QERA 3NTIA 4J2BA 1IH7A 3LZJA 3SV4A 2EKOA 1IKYA 1YVUA 3SUQA 1SUQA 3HJFA 3P8DA 3AO4A 3V6DA 1QTMA 1CZBA 3S3OA 4NS5A 4BWMA 1TK5A 3HP9A 4CIGA 4J2DA 5J2PA 2DFHA 4I9LA 3ZSYA 1T8EA 2IAJA 1NKEA 1XNIA 2RI3A 5JS1A 5IN1A 2HNDA 4M3RA 3AVHA 1ZBLA 3P83D 3ZSZA 3VQ9A 2RHIA 1BIZA 1JL2A 2IOCA 4CF2A 1LAVA 4FLXA 3QKJA 2R7YA 3ULDA 4DS5A 4IKFA 4DFPA 4FLYA 2QQSA 5D3GA 3BDLA 1RT1A 3B6PA 3VQPA 5DMRA 3QEWA 3SPYA 2I5JA 1JLQA 1VSKA 4JLHA 1KVBA 2D0CA 1LWEA 2LTOA 3NFAA 4Y1DA 4FL6A 1JLAA 3SV3A 2HMIA 3JYTA 1LW2A 5D6WA 4MQ3A 1IG9A 2E6NA 4FM1A 4CJEA 3ISNC 3LPTA 3SJJA 4NYNA 4FW1A 3SNNA 1X9WA 4E7HA 2YHBA 1JLEA 2RI5A 2RHXA 4B08A 2L89A 1U47A 4B9TA 4EP5A 1JXBA 3TAEA 2KZMA 1JLGA 3O8VA 2QQRA 4FYDA 4DTNA 4PA1A 4Z4EA 3KIOA 4KB1A 4CECA 1VSDA 2F8TA 2EFIA 5E41A 1SL0A 3U6FA 4E0DA 5KCHA 3OYCA 4FZXC 4AILC 1HQUA 3QETA 4J2EA 3LANA 2ATQA 4C8LA 2KQ2A 2P0KA 4DFMA 3NGYA 4CHZA 2IGIA 4W5OA 2G8WA 3BGRA 2GV9A 1RDCA 4HUFA 3T1AA 4LH5A 2GF7A 3HPGA 3NE6A 2O4GA 4K8ZA 1A5XA 3NF9A 1GOCA 2PQWA 2YNIA 3THVA 2HHXA 4CHNA 4IG3A 3FFIA 2X6SA 5CYMA 3RMAA 2HHVA 3AVBA 3TI0A 3LWLA 1QQCA 4CJ5A 3VA0A 4A4EA 4CJWA 2KZZA 3BDPA 1WJRA 3OYEA 5JS2A 4DU4A 1RBTA 1RDDA 3ZT0A 1U48A 3QLHA 3LX7A 1TKXA 3F73A 3LGFA 1A5VA 2RO0A 3SD4A 1KTQA 3LPUA 4DQRA 2QKKA 3HPHA 4KAZA 3LP1A 1VSHA 3DRRA 3SPZA 4M3UA 5KRSA 2HB5A 4C5IA 4DQIA 5CZ2A 1UA0A 2YV0X 4CF0A 4NYFA 1BIUA 1A5WA 4DFJA 4OKEA 3MP1A 3MP8A 2X6NA 4C8KA 3KD5E 1Q9XA 2Y1JA 2K3YA 4DSJA 4RW9A 2E6LA 4CJ4A 3ZSXA 3U3YA 1MHNA 2NUBA 1KHCA 3V9SA 3SI6A 2DTUA 2DAQA 3TABA 2PY5A 1TGOA 3ITHA 2BIVA 2KFNA 1EX4A 1DTTA 4FCYA 3L2VA 1WN7A 4FJJA 2F96A 1L5UA 4CJFA 5J2MA 3RMCA 5J2QA 4UC4A 3ZT4A 4E1NA 4Z4HA 5K14A 4CGGA 3EAEA 3O3HA 3QNNA 4OKJA 4QCLA 1K6YA 3AVFA 4CK2A 1ZBFA 4CF1A 3VQ6A 3AVIA 1Z25A 1TKTA 1SKRA 4FJ7A 1NJYA 3I8DA 5CYQA 1XWLA 1RBVA 2HVHA 3DB4A 3TAQA 2VG7A 4OPKA 3AVKA 3IAYA 3ME9A 2LVMA 2YNFA 4DF4A 1U4BA
chains in the Genus database with same CATH superfamily
2EZKA 1BW5A 1IJJA 3R9PA 2AT1B 1WXTA 2XKOC 2JGUA 1QVUA 4G12A 4DJAA 3IAM2 2OC6A 3CXCP 4FWRA 1HYZA 3I59A 2LQNA 1N8RR 4B9LA 1PRLC 2IEKA 1TUGB 2DERA 3GTQJ 3HOXJ 2LCLA 3G6EI 5C12A 4I2OA 1EF4A 4CFDA 3KTQA 1EFNA 2M0CA 3REAB 1K8AC 4AT1B 4OMFB 1Q7YU 1NBWA 2CZ6B 1X75C 1V54H 5BPMA 2VC1A 3AKZA 1N9RA 1WCMJ 4CERA 3SQ2A 5C0YA 2VE8A 2G7HA 1VQKT 2JS0A 3EGDB 1OYWA 3MMVA 2Z1JA 3Q0UA 1OQYA 2Z2SB 3O6BB 3LH5A 3FZKA 3VYSB 8ATCB 5B3SH 1N36K 4OMMA 1BI4A 5LHGA 1G15A 3CD6T 1H8KA 2ZB9A 1V5EA 2K40A 3W6VA 2I0NA 4PHTX 3ROUA 1VQ5T 4OLBA 1Z9QA 4BL0B 1BW6A 1SSFA 5J26A 1S1XA 3FHZA 4BD3A 3DMJA 2FLOA 3GBGA 1VQ9A 4IIMA 2B8AA 3E5UA 4KFCA 1C0WA 1Y0MA 1M1KC 1D1AA 4N4NB 1VNDA 2Z1IA 1FTZA 4IOAF 3NVMA 2FOKA 5M1QA 1VQOA 1N33K 3NDKA 4A12A 3S9HA 4CC2A 2NNWA 1X01A 4DZPA 4M78F 2J5OA 3GNGA 2V9VA 3G10A 4A61A 3MO8A 3KPHA 2XAHA 1LOTB 2ZPFB 1U04A 4Q5WA 1JCFA 3A0HC 4LGWA 3EGDA 1BYMA 2ASOA 2Y4YA 4CFBA 4FYXB 3WTYC 3QFPA 4IX7A 1BBZA 1IV6A 3HHGA 2ZNZA 2HSEB 4PWDA 4CJPA 2WADA 1J9AA 1U1TA 4JX5A 3DI6A 2KI7A 1VQ9I 4K25A 2G8UA 4UY8I 2ASMA 2DJIA 3D5RC 2ZE2A 1Z05A 3C18A 4BB7A 1X9JA 4M6YA 2HDCA 5JHUA 2V1DA 1VQOI 2H1LA 1PHTA 2CDTA 1IKXA 3Q7BA 4CEDA 3UB5A 2NVYJ 1KQ9A 4B9QA 2RQTA 2EFNA 1XMQK 1RTDA 4HT8A 3H1VX 4A57A 5FU6C 5I42A 1DIZA 2FXAA 4HTUA 2K85A 4BROA 3V9XA 1OPKA 2KE9A 4BUPA 2Z16A 4CESA 1GLLO 2CSOA 2ZPBB 1S7AA 2XVCA 4M3GA 5HDKA 4KH5A 1YQRA 1RUWA 4CH7A 4JUVA 2YNGA 3FBNB 3FMQA 1I0CA 4ZGJB 5LLQA 4M6VA 2NVUB 3UF4A 2VXFA 3K4MA 3ZT3A 2JUGA 1IBKK 2GGRA 2VBXA 4UB6C 3BG5A 5M9OA 1R5ID 4FU6A 1IN8A 2P8TA 2WOMA 2MABA 3CCJT 2LJ1A 3PY8A 3TARA 1RT6A 4FO0A 1OJLA 4RW7A 3PLAA 2R7WA 3H3NO 2QGFB 4AFUC 1WEIA 1I3AA 2GAUA 3URGA 4FJHA 3DP7A 1KQSS 1D3YA 1G6NA 3G1LA 2EJGA 1J9IA 2WBMA 3H45C 1K1ZA 3EETA 2QVOA 4C2MJ 2X4XA 5AIQA 4KGZB 1PKTA 1ZR4A 4MO4A 1MGTA 1XMAA 2KP6A 1R8OB 4LDUA 3TR8A 3KKRA 4YFUA 2H8RA 2I7NA 4RS8A 1IKWA 3PUFA 1VQ9N 3JW4A 1J5OA 4A63B 4M7AB 1TQPA 1OLTA 4EJZA 4HRIA 3EZ5A 1W5SA 3EHQA 1VQON 2PAVA 1U49A 2J6OA 1ZG1A 1WJQA 3VSLA 2WV1A 4C5EA 1LDJA 2GTDA 2HQRA 4BQZA 3K2ZA 1EKEA 2OF7A 2DFUA 5GJVB 2A28A 1K73O 3QBWA 3K0SA 3J81O 3QOPA 2V75A 2PVDB 2RHKA 1X69A 1J5EK 1MV3A 1R49A 1YJWT 3M0SA 2RF0A 4P5OA 2XU8A 4RWTA 5K7ZA 3DLMA 1RTJA 4QQDA 1BL3A 4KHWA 2HOEA 3QIOA 1ZQ1A 2KHOA 4C8QD 3D0PA 2R7FA 3THWB 1WNSA 3CC4T 2BXYA 3ZR8X 3VEPA 4EJYA 2JT4A 3ERMA 2DYIA 1XUPO 3BY7A 1WSFA 3K70D 3FR0A 1OX8A 1YX5A 4KH4A 4BJTA 1A0NB 2BZ8A 3X2QH 2DIQA 4EW0A 5GANe 1XX5A 4D6WA 5K7HA 4FPBA 4YOWA 2BKDN 5EJCA 2D1HA 2FZKB 3KLFA 3P38A 3LP2A 3K2PA 2R7UA 4FK0A 4M7AC 4FYVB 1Q7YO 3RKYA 3PMTA 3LLRA 5M3MJ 2IS2A 1SD4A 3ZX0A 3MEVA 4NCAA 3I58A 1KQSP 5B1AH 2A3LA 1ON2A 1FWZA 3K4NA 2EQUA 2BUPA 4OLAA 1BU1A 5B5EC 5LEJA 2W24A 1K76A 2PTKA 1HPZA 2EW3A 2OAWA 4LMYA 2XIGA 2O3FA 2KAFA 1T0HA 2WONA 1VSIA 3L6QA 2DO7A 1M3BA 3O1WA 3THWA 1T33A 5F1RA 2RB6A 4DV1K 3KXTA 1WHMA 2CREA 1VQLA 1HKCA 1VQ6A 5HLFA 1JLCA 2EH3A 5J1RA 2CQNA 1TWCJ 3DLAA 1X1PA 3LGLA 4BY1J 4PL7A 1QMCA 1NJIO 3C0BA 4GVEA 3ZSQA 1DDNA 4BRAA 5J2NA 1UHWA 4FT4A 2YR2A 2L02A 4BYYA 2X0LA 4KHQA 1IHVA 1SD7A 4ZNXA 1YJ9Q 4WK8F 1TTYA 4HCKA 4FE4A 1B7TA 2HSTA 2UXXA 3JCMX 4M7YA 1SQKA 2HNHA 1QS4A 4A4HA 2EYYA 2J06A 4OKKA 1QVTA 1Z7UA 3OL3A 4E7IA 2MIOA 3ULRB 2OTJT 4JI0K 1I50J 3K1NA 5FDLA 1PKSA 3PV8A 4DQPA 2TDXA 3M0TA 3CBOA 2KSSA 4J2AA 2QM3A 3LWFA 3HKSA 2HPMA 3BPVA 4CZIA 1NOZA 5GAMh 4OPJA 1S6PA 3PIOF 1VQLI 1VQ6I 2CYZB 4LIVA 1LEBA 4XK8E 1H92A 1JJ6C 3QAHA 2I10A 2V7ZA 2V9PA 3VEZA 3CVTA 1YWPA 2WWYA 3IV5A 1EWRA 4LIUA 3BE3A 2Z33A 1DUXC 2NS7A 2QSFX 1TC3C 1ABOA 5AZIA 3DF8A 2PX9A 2AZSA 4EMSA 2OAUA 3BJAA 2H3EB 4RGRA 2AKLA 4JX6A 5FWCA 2ZJQF 3MWTA 3MZYA 3UA7A 3QEPA 4EFHA 1VYVA 3EHRA 2DYRH 4HOBA 2Q8KA 1VK0A 5BRFA 3Q1JA 2DX1A 4Z94A 4Y28E 4FLUA 1NJZA 2WB1A 3R6SA 3C6AA 4E6RA 5KCMA 3SZGA 4IZZA 2KNBB 3E3VA 3VQQA 1CQTA 4NUBA 5JLXA 1BUPA 1YT3A 3HPWA 3JCMf 8AT1B 5AFUH 2HBLA 4CCOA 4ATOA 2ID3A 3C4SA 4M3TA 1S72A 1MNMC 4E4HA 3SZTA 3DXMB 1PUFB 2PQ8A 5KE3A 2RJDA 1B4AA 2VXZA 1IRFA 3AL0C 4I76A 5FRMA 3K5MA 2O9LA 1HQEA 3ASOH 3DRSA 2RKIA 3P31A 1EH8A 1M2VA 4GDFA 2JMCA 2E41A 2KFDA 1RDUA 2X4HA 3RTRA 3BFMA 5TGTA 1K79A 1KLMA 4LB5A 4QOZB 2OFKA 1WKMA 2RF2A 4F14A 1WFXA 4JLIA 5HNHA 1KD1R 4IHYA 1RT2A 4LNPA 4S0HB 2DDBA 2LKPA 2F5DA 4V19S 3CCRQ 5KGWA 1ZBIA 1U78A 2V1XA 2OTLQ 1VQ6N 4KIBA 3VS0A 4JKAA 5IP7J 5AQSA 1NPPA 1M8MA 1S72I 4QVCA 3CJCA 5GTIC 1VI0A 3C12A 5LGTA 1O75A 1ETOA 1PUFA 3CPWS 3ABMH 3VENA 3HL8A 1GLEG 1R0AA 1ENHA 1R77A 2MF2A 2JHJA 2LKXA 2M8GX 4LK0F 4RAYA 1YI2A 3DLLF 1OQKA 4HV5A 1VRTA 2FBKA 4B3AA 1H88C 4JKBA 3CCST 3J7AP 2RDPA 1BM9A 3MEAA 5GJWB 2GCXA 3OOUA 3NWTA 1ESVA 3SAFA 2LC4A 1J7KA 2FQ3A 4DU1A 1HNZK 4CEOA 1WSUA 5LL6S 4CZEA 3M55A 1X2QA 2DPPB 2M4KA 3ZQ7A 3ESWB 3TP0A 3DOKA 5GAN6 2RQPA 3QRFF 3FXOA 3NH0A 5KYWB 4AUXA 1O4XA 2H94A 2O31A 2ED0A 4JEPA 2Y69H 1DU6A 4CBWA 1T03A 4PDKA 2E2IJ 4ZZDA 1Y56A 2QTXA 3ZMSA 4L59A 3TQNA 2F4MB 1R1TA 2DAOA 2EFPA 3K0LA 2IVMA 4K43A 3PSIA 1WHHA 4Q5VA 1ZARA 3N4PA 5GAMg 3L4IA 2IA0A 1OV3A 3CUQC 3E97A 3V8LA 2MCNA 2ZNYA 3VS5A 1YI2I 5KN8A 3Q0VA 1X19A 4K8XA 3TEEA 2XAUA 4IRGA 1KC8U 2JN6A 3EGXB 2VE9A 2BY1A 3O9RA 1FP1D 3PIPA 1ZUUA 5AQZA 4AH9A 1KFSA 1JJ8C 5C4XJ 2COZA 3S93A 3GTLJ 4CD3A 4UNOA 4DYCA 3SZPA 3QP5A 1J75A 3OYAA 1AU7A 3CETA 1B9NA 1MBEA 3J81K 3NRVA 3C2BA 3A03A 2DU9A 2KRHA 1BISA 1S72N 3CPWP 4M7AF 2NLUA 3TVTA 4M75A 2JVGA 4XRMA 1XI1A 3GTOJ 1FSHA 2KT8A 2ABLA 1HR0K 4KREA 4M7DD 4ICLA 4LITA 1P59A 3OS1A 2ETHA 3AVGA 3RKQA 3OS0A 1NK5A 3RPUD 5I3UA 2E6ZA 3EFOB 3JCMd 4E9FA 3QQAA 2HOAA 3EGXA 4UY8O 1PCXA 3WVDB 4A3GJ 4JRPA 3LWIA 3DLBA 1DLOA 1YCSB 2BY0A 2CP2A 2MWOA 4C1NI 3I0RA 2IS4A 1ATRA 1RETA 3CCUT 4HUEA 3CESA 1PU6A 2EJ9A 2R7ZJ 3CMEQ 2XHBA 3QYGB 4RTTA 3GIBA 4GW6A 1WI7A 4ELTA 1X4PA 3RRGA 1NBEB 2DYSH 2NOLA 2W6LA 1PRMC 3QIIA 1VQNA 4NCGA 1ON1A 1FIPA 5C2FA 4XKWA 3EH2A 3MXMA 1Q81U 3L2RA 2QEXQ 1GLDG 5FLXO 3I9V2 4S04A 1KAZA 4H5TA 4Y17A 5HRRA 4Y15A 5EDNA 4DW6A 1Z6RA 2MYSA 2R7TA 1VQKN 1EQYA 1JXMA 2RQUA 3QYHB 1W2BA 2QWMA 4G1QA 3JRAA 2DE0X 4BI3A 4JPBW 4LJZF 3EFOA 2HHUA 4MZPA 4EJWA 4XTYA 4D8DA 2O7OA 2ZC2A 4FJ9A 1J59A 3KTUA 1X3MA 1S3JA 2KVQG 1GRIA 2QM1A 3KP4A 1RACB 5F27A 1WSIA 1KU3A 1UB9A 3ZSOA 3CD6N 4XTUA 2IVWA 4PGGA 1TAUA 4A54A 3LM9A 4HF0A 3BCAA 1VQ5N 2HQNA 2KRCA 1UA1A 3JCMP 1QZ5A 3VB2A 2EYXA 4J19A 3DLGA 2PJPA 1TU0B 2IVPA 5B66C 2XDBA 4HZFA 4M42A 4ZGDB 1UOCA 2ZD1A 2DTIA 2JJ7A 3RWUA 1HCRA 1VQNI 2C6YA 3FJPA 4Z0UA 1HLUA 3QEIA 2IBDA 3I5UA 5JVGF 4IURA 2P9UB 3SHWA 4IIOA 1OYXA 2EYWA 4IO9L 3OYGA 2JLEA 4WQ4A 1Q18A 2O8DB 1IV0A 2LT4A 4BY7J 4JI7K 2KK4A 1W7PB 1Z0XA 2X9DA 4FT8A 5CJ9A 2FHDA 4TSXA 2P9LA 4LB6B 3L7WA 2RJFA 1NYFA 5CQGA 1VQPQ 4A5BA 2LJ3A 3CQ8A 1BO5O 5GAOq 2B9SA 3CQTA 3F21A 4MMKA 1Y0UA 5DK5A 1G3SA 2M1HA 3CMMA 2ZJRF 5LMNK 2K5FA 2YRVA 1XHXA 1K0SA 3SQNA 5LJ5g 4C92B 2JRTA 1S9GA 4KYWA 5GAGJ 2W1OA 3HSRA 1EP4A 1HMVA 4XNFA 2P9UA 3CPEA 3M3ZA 2Q1NA 2FBVA 3LA2A 3R0JA 1W2BM 3MCAB 3E19A 3A8MB 2O8DA 3VGKA 2HTSA 3KYDB 2QWOA 3QWYA 4ISFA 4I9QA 4KTZA 1W7PA 2DJZA 1X43A 1T39A 3VYHB 4E70A 3G4SQ 1QZZA 2D1KA 1R9TJ 3HSFA 5LHHA 1B34B 3AO2A 4AI5A 1D5AA 4N0BA 3KK1A 1OZ3A 1H89C 3NF7A 1QQNA 3D2EB 4YPRA 1T6DA 2DN0A 5TKWA 4LF5K 1N9SA 4AWXB 1RTHA 4FJXA 1WQWA 3E7LA 4UXNA 3GF5A 2GFUA 4M3XA 1AEYA 3C65A 3QPTA 4C92A 1EETA 4GO1A 3HT3A 2W82A 3K4KA 3JB9J 4D9JA 4IOAL 4M73A 4KHUA 1ZRDA 3GW2A 4M77G 3TEDA 3UE5A 2ROLA 2E1ZA 2NOHA 1PWTA 2D5VA 1NGHA 5DD8A 2VPLA 1KC8O 5F6FA 1XG1A 5CVRA 4HBLA 3RR7A 2X4WA 3U9ZA 1BKBA 5HY6A 1VQ7Q 1PSFA 4B9UA 3D2EA 4XAXB 1VSEA 4FX0A 1YVNA 1AOJA 1X2KA 3OTOK 2M0OA 4JI5K 3M1CA 1E2XA 2JM9A 1AVZC 2P9NB 4EPCA 5AQLA 1TP4A 1XGSA 4ISEA 2DMQA 1LPLA 3CCQQ 2XPUA 3FIFA 4A0YA 1NK8A 2VUBA 4B1YB 3CCMQ 4B44A 3DXKA 2OPPA 2L3RA 2Y0SA 3Q9SA 4ON0A 5IHIA 2LMDA 2X1DA 3E6CC 3LYIA 4PCQA 3BT9A 4E7JA 1S22A 1RI9A 5ICCA 5LBQA 3CLOA 6PAXA 3HHTB 3PMIA 3FWEA 2GUIA 4J8FA 1FYMA 3CM6A 1QKXA 5E84A 5EEHA 3ZN1A 3DOLA 3KWGA 4MO5A 4BDYA 1ZBXA 1YRNB 4CJUA 3S41A 3MXJA 3X24B 2AZVA 1OR7C 2RM4A 2PN6A 2A5YB 4UNFA 4M3WA 3IL2A 1SMTA 2P9NA 3SQ0A 1M4ZA 3S3NA 2HPIA 2PFBA 2EPFA 3HTUA 3O3KA 1Q81O 4OX9K 4FWQA 3IHUA 2EYZA 1D1CA 3TKYA 3S17J 1PNJA 1O7LA 3OMGA 5GMKi 2M4GA 1RLQC 3H1QA 3IMXA 1UJ0A 2MMPA 3V81A 4R56A 1ZSZC 1WPYA 2DL7A 1T3VA 1NGEA 3C7JA 1RAHB 3RDVA 5ILUA 1QZYA 2PZSA 1LVKA 4DYRA 1J54A 1XS9A 2KZGA 4A6EA 2R57A 4Z4CA 1YTUA 4JRKA 1GFCA 2XO7A 3DFGA 1T0FA 3A98A 2F5KA 2Z1DA 1Y96B 2MWPA 2LNVA 1YRNA 1C1BA 5AFUA 2K4JA 5AQYA 1WQ2A 1KK7A 1T6CA 1TL1A 4JQFA 3O3FA 5CQXA 3AVJA 3LALA 2H8WA 2EA4A 1E4FT 4M3DA 5E1WA 1E6HA 2PJRB 4AM7A 4HCZA 4J9HA 2EGEA 1BQNA 5DPKA 1TW3A 1B3QA 1C0UA 5M5XJ 4LY7A 4XTVA 2BZYA 4DTJA 2OTJN 1ASWA 3EG9A 3QUIA 4DBRA 3L1AA 1JCEA 5FGMA 3Q9VA 3SHFA 1Z67A 1VTNC 3I54A 2IA1A 1KG6A 2DOEA 5E79C 2WC9A 4DK9A 3HVTA 3FK7A 5FLXK 3I71A 3LL7A 5HLGA 3W3CA 4UVBA 1LW0A 2Y48A 1HKQA 3QBYA 3JCMe 1IGQA 3K2AA 2P81A 3V9ZA 2K86A 2YS9A 3B73A 1YQAA 4CIFA 3MEGA 1Y96A 3JB9F 1S7EA 4I02A 2EWNA 2XROA 2MK5A 1VQNT 2E5NA 3D6RA 3UKRA 1IH7A 4JJDA 4MDBA 3SV4A 2ESNA 3KCCA 1KIKA 1VHXA 2JA8J 3SUQA 1SUQA 1UB4A 3HJFA 3OIQA 3AO4A 1AZEA 5GADP 3V6DA 1QTMA 2HVSA 3QSUA 4BC2A 2PJRA 1YJ9A 4CCMA 4G6TB 3SJMA 4NS5A 1ZC6A 2HOSA 2CGHA 1YG2A 2ACJA 2HU9A 4CIGA 2AHQA 2P9KB 4J2DA 3A5LC 3E6MA 1C6VX 5EG0B 3ZSYA 3EG2A 1OKRA 5J1YA 2QI2A 2BHZA 5IN1A 1QVGS 2EINH 4IXAA 1YAGA 3BQYA 2LDUA 3AVHA 1ZLKA 3F3XA 4II2A 1RNLA 1FJLA 5GAEP 3QG1A 3ZSZA 2RHIA 4EMGA 1BIZA 2IOCA 2QYZA 2MW8A 4M77E 2XGDA 4CF2A 4FLXA 3RNJA 2R7YA 4BC3A 3BG7A 1MBKA 3CO6C 2DL4A 2QQSA 1WWXA 1FYLA 3X28B 3B6PA 2V7FA 4BQQA 4PJOA 5GIOA 1YJ9I 3GVAA 1VSKA 3WODF 2K4YA 2D0CA 4ELYC 1USSA 1LWEA 2W6KA 4A5NA 1F43A 2J6FA 1JLAA 2CMPA 5EXWA 2KQRA 3ZOBA 2OJED 3JV3A 2K3PA 3WTZA 4CCNA 2P9KA 4E9HA 4PNOA 4B47A 4FM1A 5KYNA 4OB3B 1IRGA 3PNTA 3FSPA 1BI3A 3LPTA 4C2UA 1WH5A 3SNNA 2KY9A 1CKBA 1YWOA 1GDTA 5E8IA 4OP0A 9ATCB 3R3LA 2NXNB 4O6JA 1H641 4B1XB 3PIOL 1N5ZA 4OINF 3QBXA 2L89A 1P8ZA 3HFOA 1JXBA 2ITMA 1JLGA 2QQRA 2P6SA 4WQ5C 1I6XA 4Z4EA 4KB1A 1UJYA 1KQJA 5D5XB 4ESFA 1W36D 1OOTA 1VSDA 4MQVA 2OI3A 2K9QA 3ML6A 3AGKA 5E41A 3KWIA 3WTSC 3TSQA 3IP4B 4DR5K 3BWGA 4JKHA 3PFIA 2ZJQL 3VTIA 4OMPA 3E5XA 3LANA 2ATQA 5A2QO 2AQEA 4C8LA 1QVGP 1OEBA 2G8WA 3E2UA 2MA3A 3M1EA 2Q0OA 1RAFB 4IXCA 2GF7A 5FO5A 1X3ZB 4F04B 4K8ZA 3ABUA 3NF9A 4CYDA 1GOCA 2QWRA 1PM3A 3VSKA 5FW9A 3CCRA 1H0MA 2I2LA 3ABTA 2OTLA 2XICA 1KU9A 4AF1A 2HHVA 1WNLA 3T1HK 3TI0A 3HI0A 3VA0A 4EM2A 3BDPA 5JS2A 1RBTA 4YOVA 2A07F 1RDDA 2O8BB 3ZT0A 1U48A 2IIRA 1QVFM 2CUFA 3OR1C 3OS5A 4YDUA 2EV0A 3CQZJ 2EWSA 4EMKC 1WDXA 3NWSA 3SD4A 4M78G 4Y33A 2V4JC 4XTWA 4M3BA 3CBPA 4BU2A 4KAZA 3T9NA 1Q82C 3DRRA 3SPZA 3V4GA 2CZ7B 3T5XA 4DQIA 1ARKA 5CZ2A 5GMKe 1UA0A 2YV0X 3KE2A 3RQIA 3CP2A 2DFIA 1OCPA 4XR6A 2WBNA 4NYFA 1QBJA 4LDWA 1KG7A 1A5WA 4AMCA 4AU7A 1W4SA 1J6ZA 4OKEA 2X6NA 3CCRI 4RTWA 2Y1JA 2Q36A 5AQNA 2OTLI 1E3HA 4M75D 2L01A 5AQGA 4BG8A 4CJ4A 1D09B 3E5QA 3ZSXA 5GANh 2QA4T 4XLFA 4LDVA 1KHCA 4RB0A 4F7UB 2P0PA 3CC2Q 4CJ7A 3A8HB 4MDWA 3SI6A 2DTUA 3C2HA 2DAQA 1E3MA 2RQQA 3I64A 3ITHA 1MH3A 2DL8A 1TWAJ 4WYBA 2KFNA 1KD1U 3LSIA 1DTTA 2E2QA 4FCYA 1ZQ3P 2JTEA 1WN7A 3T69A 2M5WA 1EV7A 3HSCA 3CZ6A 3SYTA 2F96A 1L5UA 3SFIA 3ATUA 2JT1A 2YUPA 4BR2A 4UC4A 3CJ1A 3DLLL 2F4OB 2DBMA 2JMAA 3ZT4A 1GCQC 4Z4HA 3PE0A 5FD6A 5B1BH 2UZKA 2UU9K 3AVFA 2PLYA 3KFWX 5I11A 4IQ4A 4CF1A 3VQ6A 1Z25A 4CZFA 3VMFB 3CCUN 4PKHA 3VERA 3OBYA 1M9SA 2DOFA 2WY8Q 4F17A 1GVDA 2HVHA 4FWMA 1WOQA 4NB4A 4OPKA 1FTTA 4XM3A 3AVKA 1U9NA 1V3FA 5ICEA 5DM7F 2XGXA 2KBTA 4F7UA 3HHHA 4NO7A 2P9IB 4MFBA 4KFBA 4AHUA 5L3DA 1N75A 1VQMT 4B21A 3MKWB 2CW0F 1LWVA 3H3ZA 4ME7A 1U5TB 3KLOA 4BBRJ 1HNVA 5AQTA 1JB0E 3INZA 3VV0A 2E88A 3DWLE 1HSTA 4B1WB 1Q86R 1N3AA 2VXDA 5F08A 1RBUA 3ECOA 4IBNA 2XPVA 2X1EA 1U45A 2FRWA 3SEMA 2R7DA 1USTA 1R22A 1SFUA 3FZHA 2WSCE 2DPNA 3ISPA 1ABQA 1T7PA 2JJ9A 2RA2A 2E19A 5L23A 5HL7L 2OTLN 3CMEA 2KRNA 1KQ0A 2FNPA 3AO5A 4B3RK 2EB7A 2GQVA 2DMNA 4DHYA 1BN5A 2XY7A 1Y1VJ 1D3BB 1JO8A 1MJAA 2Y2ZA 4HDUA 3OYJA 3FLCO 1TL8A 2P9IA 1Q8IA 4FM0A 2F5EA 2QEXA 2RHZA 4DG1A 4NNJA 4M6XA 1U5TA 4YIRX 1LKXA 1MUDA 4XLPF 1SD6A 4I0AA 2FBYA 2E35A 3S6IA 4KBOA 2O5RA 1NJXA 1K61A 4U0WA 2IG0A 2UXNA 1DU0A 2XDVA 3S2WA 2CWEA 3EE8A 5GPCA 3RZDJ 4XMYA 2XGCA 4EIKA 3M0UA 2YT6A 4J9BA 1K9MU 4L3QA 5LJ5d 2M7BA 1UHMA 1RUNA 3CMEI 2R7VA 3KLNA 3SQ4A 3C0CA 3VQCA 2L7MP 4DSFA 4KHYA 1RIOH 4BBSJ 4GY5A 4ZYGA 4F55A 2HBMA 2DA4A 1D3BA 4B9WA 3BW1A 3ABLH 2SRCA 4KN7X 4JI3K 2CT4A 1SL2A 1FSEA 1SANA 3K59A 3M0PA 2DBBA 3DBRB 5D6YA 4WFBL 4HTLA 2QEXI 4YHHK 5AN4A 4D8KA 3WNEA 3FRNA 1W7PD 1ZTRA 1U5SA 2KIQA 3COAC 3NCIA 2BBYA 3J7ZI 3E9PA 2D8HA 3P8BB 1POGA 3ZSVA 2QXFA 3SDZA 4OMLA 4KHSA 4DWIA 3EY1A 2E60A 1VQPA 3EUHA 1RR7A 4IO8A 2L7ZA 5KGXA 4Y7NJ 4QT7A 5FFZA 3OW2A 4CJVA 4FK4A 3M7GA 2XD0A 2PMZN 4C92D 2ZJPF 2RNJA 1VOMA 3S2DJ 3C6UA 3CM5A 3KLHA 3TANA 1E6GA 1A04A 5CIUA 1IDZA 2DDAA 1KO9A 4BDPA 1I5OB 2D0OA 1GLNA 4M78E 4RCBA 4ORZA 2Y9YA 1Q1HA 4BC5A 1Y57A 2AXLA 2KIUA 4G7HF 1XCVA 1IHWA 2GXAA 2Z9OA 1M90U 3LL3A 2EFWA 5CY4A 2J6KA 1JKHA 2G7UA 4BXUA 1GL5A 1RR8C 4Q48A 1WJFA 3J7AY 4J9GA 4C0DC 1XDSA 1HU0A 4QS9A 3G4SA 2DTRA 4J6WA 2R58A 1VQPI 3W6KB 3FZLA 5HVQC 2X78A 3BR2A 1V5FA 3CJRB 4A3JJ 1X6GA 2EVRA 2RAEA 3U9DA 2X4YA 1XDUA 2ZJRL 1ZSGA 4LN2A 2KT1A 4F91B 2BGGA 5A2QK 3BUZB 3SB2A 1NK2P 3ASKA 2LMJA 3A02A 1NM1A 1VA7A 1TG0A 1N3CA 4K41A 1LWWA 3OYLA 2BEOA 1YIJT 2M51A 3TO7A 2CSQA 1KD1O 1MMAA 3SMPA 4JYAK 4HVWA 2CW8A 3OYKA 3RTVA 2HHSA 4KGXB 2FRHA 3TTFA 3BG3A 2JTMA 2L4AA 1IN7A 2DLPA 3I33A 4LFUA 4CGIA 5GINA 4E89A 3VUZA 3RKWA 2LX9A 4Y0WA 3G4SI 2E6MA 3RQ4A 4RCCA 4BY6B 5BPIA 3GFIA 4HEA2 3I5RA 4CK3A 3G0ZA 3H6ZA 3I4NJ 4N9IA 3I55Q 1Q1VA 3A1PA 3KP7A 2A0FB 3JSOA 1GV2A 3ID8A 3HKZN 1VQ8T 1VQ4T 2VJ4A 3EO3A 4Q0BA 4WFNL 2OPRA 3HUGA 2XK0A 1MJBA 2M3AA 3IUOA 3KZYA 4HSTA 2E3IA 3ZN0A 1HLVA 3JSMA 4EHUA 4AHCA 3MN7A 4LFCK 4RB2C 4M74A 2QBYA 4HSRA 3CCQA 5GAOm 1J2XA 3LDSA 4WCIA 4UB8C 5CQYA 1WJDA 2FXUA 3QINA 3PO3J 1T8IA 3CCMA 3J80O 1NK4A 1YITQ 4OO1J 4KHPK 2Q0UA 3H9GA 4DQSA 1VAZA 2A7YA 5EZGA 5BQTA 2KRMA 3SUOA 3P4IA 2LY2A 2NNYA 1BQMA 2Y30A 3VQDA 3THYB 3BLYA 1O1WA 3T1BA 1YO5C 1BCMA 1W70A 3H3OB 2LKSA 2HKOA 5AQMA 3E9OA 2DILA 1JJ2S 1VQ7I 1Z77A 1W97L 4HHTA 4DQ2A 3KP3A 3I56T 1J5YA 4II1A 4BE0A 3PUBA 2LSOA 4M4ZA 4BY6C 3A5NC 2VQGA 3BR1A 2HL3A 2HNIA 4JD2A 1NGBA 2JA5J 3BZ6A 2JNGA 2XI9A 5GAMj 4R8HA 4UUSB 2CGJA 4J7IA 3CCEQ 3ZT2A 1M3QA 2DMPA 2Z3YA 1RILA 3JAME 3CCQI 1WZ2A 1VIEA 4IPAA 2W00A 3HPOA 2DA2A 3KBGA 1MWKA 4CJ3A 1I3QJ 2LX7A 2JHNA 3M0QA 3CCMI 3NH1A 2EKHA 3OYMA 1WLPB 1LDDA 5GAN4 3M4GA 4JKFA 2Y9ZA 4JBAA 4DR7K 1Z1DA 3NTKA 4P55A 3ZQQA 2ENMA 2QQAA 2ITGA 4UV8A 3E6DA 2CFXA 1NGIA 1RLPC 3WNHA 3THYA 5AQRA 4CUGA 1PD0A 1EWQA 4PSXA 2E2OA 4DEXA 2VIXA 4B6MA 1IBLK 4BRNA 2F69A 4IOXA 3LWMA 2G8HA 1K9MO 4M3EA 4CGHA 4EDUA 4PY5A 3KVGA 2VKHA 3M0RA 1ZRFA 5JVHL 4L6V5 2O4IA 4D5CA 4OIOF 4B3XA 1V29B 4UUSA 4FVUA 4JP0A 4L9JA 3GNFB 5LJWA 3QPSA 5BRHA 2ZXJA 1RPWA 2XC7A 2B7EA 3ER0A 2HBWA 1WLJA 1W5CC 2CV0A 4EIAA 4BXFA 4XN0A 3VYRB 3CVSA 5DLQE 3H0FA 2LNHB 3U23A 2JUFA 2V51B 3A0BC 2OZMA 1NKCA 4OAZA 4OB2B 5GAHJ 2P51A 2COWA 2BANA 4PFZA 3K9KA 2EBPA 1JJ2P 1BGXT 3PNWC 2EYQA 2W41A 3W2VA 3MAQA 2KGTA 1CKAA 2V1UA 1UDLA 1VQ7N 1W1WE 4JK8A 2COBA 2CFOA 5H6RA 3WTXC 4CK1A 3C7NB 3MN2A 3CEYA 3GEZA 3H0DA 1M1FA 3H3UA 2V1RA 4CZJA 1KYWA 4EJVA 2VWBA 3HYIA 3DTEA 2CP7A 1JHHA 4JRQA 5KVRA 4PJOD 3CF5F 1N6AA 4M9SA 4LXCA 3CCQN 3L3UA 4CEQA 1IV8A 1KU2A 3HM9A 2AP1A 1KVAA 4M7AG 3ASNH 4E7ZA 2FO0A 3RMDA 2ZJ2A 5EF6A 3I4MJ 2MFZA 3O3GA 4A0XA 1GV5A 1M90O 3VS7A 2JSPA 4XIDA 3VYGA 2GOXB 3MCPA 1JCGA 3L8BA 4XQFA 5K7FA 3SK3A 3BF3A 4DV2K 3EFRA 4IEJA 4BKXA 5JHFA 1G2HA 1MBJA 3S3MA 1TKDA 4DSLA 4DV6K 2DPDA 3EH1A 3H8ZA 5IT9O 4XKCA 4CDGA 4P1WA 2VN2A 3NQOA 4AFSC 5IY5H 3S1QJ 2L9SA 3ULEA 4V2FA 4UQGA 5AQJA 3QB0A 4KISA 2FF4A 2GQQA 4J9CA 4M3ZA 2H09A 3SEZA 4TV7A 2XAQA 4XONA 2I5WA 2FEIA 3O4QA 1ZYRF 5M5WJ 2E5KA 2K3BA 5LJ5e 3AG1H 1ETKA 1UGPB 3AAQA 2LFBA 2ID6A 1LFBA 2IVNA 3KKSA 1LFPA 1XHZA 2HCKA 2FA5A 1Y71A 4B23A 4W5NA 1JJ2M 3VODA 3HOYJ 1LVAA 2OZUA 2LDMA 4V2SA 2VQLA 1G2BA 2L0KA 3VQ4A 3ZQCA 4RA2A 1UAXA 4C8QC 3NNQA 4JI8K 3F8NA 2ZXWH 3RMBA 4BRPA 2F9TA 5IOZA 1Z9ZA 3T0YA 2OUMA 5J4VA 4PQUA 3K70C 4WE1A 2P0QA 2K4BA 3VGLA 3K69A 3WUHA 1B6AA 2XY8A 2FSJA 4WXCA 1GUUA 5HRSA 3FHGA 3CTAA 5GAN7 3BTJA 4WCEL 2BGCA 3FX3A 2VOPA 4DV3K 2KL4A 4PLLA 1LJOA 1E3OC 3ZFJA 4HLYA 2FB7A 2EA2A 5E8GA 3GOXA 3PVLA 2LNBA 5LRRA 1RDBA 1JUPA 5CE3A 3P9IA 1FKPA 3O4WA 2XRNA 4XLHA 3AV9A 3NVKA 2QSHX 4ZDOA 4L9NA 4H5NA 1S6LA 4E2FB 4KIGA 1MDMB 1K78B 5D5VB 4CI0C 2DFEA 5KYYB 1Y97A 3N5NX 4BRLA 3G4ST 4AHVA 2Q2EB 1P7IA 2LSNA 1K73C 3VS3A 1WX6A 5KE2A 4L5GA 2E2NA 1KSPA 2K9LA 4ZHRA 3T19A 2CQXA 1VZ0A 5CKDA 4AIDA 3HOVJ 1JXEA 2HMPA 4DLEA 4F3OA 5JMVA 2WAQN 2QA4N 1S5JA 2O01E 3M9AA 3CCVQ 5C10A 3UNGC 5JLFA 3J81Z 3F0ZA 2PNIA 2F6CA 4NB5A 3BR6A 1ZRCA 2WC2A 3OS2A 1YW7A 3WGGA 2LF7A 3M4YA 4G94A 1BCOA 2IC3A 1TL3A 3VOEA 1MDMA 1K78A 5KYYA 1ITGA 2EX3A 4RW4A 1Q7YC 3KEQA 1FIAA 3L2CA 1WJSA 4FETA 2IW5A 3CJTB 2Q2EA 4IHTA 4B3OA 1SPKA 2GELA 4M3FA 1R4MB 3ID6A 1JHFA 4CGZA 5EC7A 4CCLA 3LDLA 1FK9A 1NTCA 4S05A 4ESRA 4NBQA 3SQ1A 3J7ZO 4LD6A 3A5OC 2CZ0B 2VKEA 3OYBA 5FRNA 4D0PA 3L09A 3V9WA 1JUSA 3W6JB 5AIPA 5K5OA 4JKDA 3CMAQ 1R59O 2O6GE 2DIGA 1R0BG 2UYTA 1VQMN 3EG1A 2NUPB 3VQEA 3N4MA 4DBQA 4KICA 4G8XA 4FJIA 3V42A 3OA6A 2DZ9A 1S1TA 1RC9A 3V1QA 4IQJA 2WSEE 1M8VA 1PU8A 4OGEA 1S1UA 4J9FA 5IYCJ 1ETVA 4ELUA 4BH9A 2A68F 1WJCA 3ZL7C 4XTZA 1PVEA 3LAMA 4A3KJ 4DSKA 2HF3A 4PJ0C 2LOOA 4JZ3A 4QQGA 3JCMh 1U2VB 1LV5A 3G71T 2OA8A 5L3GA 4FZYA 3OIPA 1IJWC 5D5UB 2R0QC 1VQKQ 4CC7A 4M7AE 3M8SA 1YP5A 4IVNA 4LLLA 4C3HJ 5C2DA 2E1MC 4QS8A 3T8RA 5AQHA 3CC2I 4JDSA 3L2QA 1LCKA 3LZIA 3WGIA 3HRTA 4YFXF 1IREB 4J9IA 1T05A 5I2MA 2R7QA 5EOYA 2W10A 3CD6Q 2OCEA 1O7FA 1VQ5Q 4J83A 3HXLA 1QQJA 5KNLA 3S1RJ 2ZPEB 4WF2A 2NOFA 1U3OA 4A4FA 2BE2A 4GVMA 4ZYHA 3KD1E 4G9ZA 2X3WD 2L9VA 2F5VA 3H9NA 5DY9A 4RB1A 1ZHFA 1IG7A 4KITB 2ZMEB 1LCUA 2YKMA 4FYWB 4B3MK 5D7UA 5HP1A 4I2QA 2CQQA 1UEBA 4DTPA 3PFYA 1DPUA 1WXBA 3NH2A 1RRSA 1O3SA 2IIMA 1UE9A 1I81A 5HS9A 2D0NA 1U2VA 4XTXA 2X3XD 2NVQJ 4KUIA 3NEUA 2FSKA 3M4OJ 1SRMA 4DR2K 1IRXA 3V7SA 2VG5A 1FT9A 2A6AA 2E20A 2QF7A 1W0UA 2QWQA 5DM7L 3HP6A 1WZOA 2QKBA 2DL3A 1GXIE 4CEBA 2LZ6B 3MWPA 4Y4RA 2KEAA 3PGGA 1IGNA 3OA9A 3LM2A 4XH5A 3QU6A 2BH1A 3KUFA 3O9UA 1TV6A 2CH0A 3ZGKA 2Q2RA 5CVIA 2QQ8A 4B9SA 2A61A 3HC7A 1FJGK 5KTQA 4XORA 1R7JA 2ZMEA 4BS9A 3O4NA 5LJ3f 1O57A 3LH0A 5FU7B 3MKYB 4R5PA 4ZYAA 4M7DB 3OB9A 2PVOB 1V55H 1DQUA 4IJNA 3GUDA 3M5RA 1MA9B 4CCJA 1Q86U 1OCZH 2MH2A 2K2MA 2LCSA 3HTVA 3CC2N 1VUBA 2RV8A 1IRZA 4OPHA 1SEMA 3AA2A 5EU7A 3K58A 3KEOA 2EQRA 5IT9K 1RAEB 2FF3B 2HHHK 5CVVA 2E5ZA 2J5PA 1VRUA 1G99A 2F5TX 3ABKH 3ZCMA 4C8QF 2TCTA 4O5BA 4A3CJ 3JCMJ 2J4RA 4ELVA 4KUDK 4DTSA 1SHGA 5ICFA 5FROA 3GOIA 3VN5A 1WSEA 2DYBA 2HKXA 3LSTA 2XRIA 3IG1A 3DYAA 3RVCA 2DO3A 1XQHA 4ZGEB 3GFLA 1OH5A 5FLVA 1W4MA 4CHQA 5L8RE 4WWCA 5CR4A 4A53A 4MTDA 3A01A 3KLGA 5AR0A 4KHNA 3SYZA 3TREA 3S1MJ 1SAZA 2NOEA 3CO7C 1OPLA 2NYXA 1MIJA 2RN8A 3X26B 2M8EA 4FM2A 2RH2A 3WTWC 4CIEA 5AQQA 2A37A 3VFZA 2ZGYA 3JRZA 2JMWA 2VQCA 3JCMQ 3QIPA 1YQMA 4M7DC 3CC7T 1SKUB 2UWMA 4EVVA 5KQ8A 5SZTA 1BI4B 3NTHA 3JCMg 3BC8A 4YEJA 4GYIA 3OY9A 3CXCA 2QTVA 2FUG2 1OMIA 3RPQA 2DQLA 3BZCA 2P5KA 3GYHX 4A3FJ 3WXIA 3NGIA 3A8LB 5LJVA 3DBLB 1CGPA 1JKPC 3AHUA 4ZN1A 3A8YA 4IUUA 3NGZA 2M87A 3FDYA 5GMKh 3H0IA 3G25A 4A59A 4FISA 3F5TA 4QPQA 1AWJA 3IH2A 4N56A 1NK0A 3QMLA 3CUOA 2HHWA 2CH6A 4CZZA 1KONA 2R7OA 1F36A 1UMQA 4KI6A 4CD1A 1VQ8N 1VQ4N 3WHBA 4ZC3A 1IF1A 3CCLT 1DGRM 2D0PA 2ESWA 1QSLA 2QK9A 5IYBJ 5HLHA 4YY3K 2ZJPL 5GAN5 3WXKA 4ENKA 3EKSA 5C15A 2BE7D 2UXCK 4EGZA 3F72A 3CC4Q 4M9XA 3CF2A 1YHQT 3HIFA 2Y4XA 4M45A 1K73R 4H0YB 3K57A 2B4JA 1JT6A 4FJKA 3RIRA 4CGJA 3AGRA 4UUVA 3QYBA 1MPGA 2Y31A 3SJHA 4HVJA 1HKSA 4X1VA 1OVQA 5KAIC 2HTJA 1IN4A 2OQRA 3CLQA 1ZX6A 4BE1A 1QKWA 1FNNA 1D9FA 3F2KA 1YX3A 2CH5A 2HI3A 4O4GA 3JCUC 1RAGB 1SAXA 3TO9A 3M07A 3PNVA 4CBXA 1RRQA 3I55A 3V7CA 1HW5A 1YBYA 1LEAA 5C0MA 4HWIA 1UHCA 3FGUA 4YPHA 4AHSA 4EMHA 4RG2A 4CE9A 5LFAA 3GMEA 1Z21A 2E10A 1AOYA 3M8QA 3K4CA 1N6QA 3QO9A 2JTFA 2GBZA 1J3TA 3CXCM 4C92G 3ZMVA 1LPQA 1JQQA 3AVMA 5LJ3d 4A2UA 1WBDA 4M9ZA 1R71A 4DOWA 1X9MA 1JGSA 1EJ9A 4XLNF 4OGCA 4A2AA 4A3LJ 2NAZA 3WE2A 1CZ9A 1WHUA 4A3MJ 3META 5TRDA 2DODA 1R1VA 1R23A 4W5RA 3EUKL 3P9KA 1SKWA 1BHLA 2LP0A 1ZBSA 2IPOB 1U84A 3S15J 4B1VA 2XAJA 3AA4A 1ONVA 3DRPA 5ECAA 3I55I 1CXQA 3LDOA 4L5JA 2OPSA 2KT0A 3RYPA 1YJNT 5FLXZ 4GV3A 5ELZA 4CI6A 1NJIR 4IWVA 2OTJQ 2NRAC 1VYTA 1ZLJA 1TUCA 1VSMA 2PI0A 2RK1A 4RAZA 4EW4A 4EATA 1I1SA 3CCEA 2KMTA 3K10A 1H3HA 3D4VA 3V1RA 4JV5K 1OZ2A 1U3EM 2D9TA 3A5ZB 3NTIA 1QP3A 2L3SA 3OBWA 1JRIA 1YITI 1YVUA 3U2RA 1BG3A 2N8GA 1EH7A 1KG2A 3CI5A 5AQKA 2CQKA 3P8DA 3ZQFA 4PJJA 4IEEA 3GO5A 4IFEA 1CZBA 5LMUK 2W04A 1HF0A 2G9WA 2JA7J 2D45A 2RPNA 2EFQA 4NLCA 5JR3A 1TK5A 5D5WB 4FWLA 2DRKA 3IQLA 2CRGA 3DXJF 4XRSG 2YUNA 1T8EA 1V4SA 3CCYA 4LFAK 1FZPB 4NXNK 1NKEA 2RI3A 2HNDA 4C9YA 4U0YA 4XQ3A 2L3PA 3S14J 3GPLA 4B3TK 2VB6A 3CCEI 2EGAA 1Q86O 1M30A 1FMWA 4L9VA 1TW2A 3LSMA 3UATA 1GBRA 5KK1A 1N32K 4YG2F 3QKJA 5CYVA 2BOLA 3BDLA 1LNXA 1RT1A 4AC0A 1NYGA 1NG7A 3HL2A 1OISA 2KYMA 1LWYA 4M77A 2HXOA 4B4CA 4Y1DA 4L9TA 4FL6A 2V7YA 5J47A 3SV3A 4ZZLA 4MQ3A 1SD5A 3EG3A 2H3GX 4FYYB 1SSHA 4BRFA 3I55N 3R6MA 4IHSA 2VL8A 1NZ9A 5BMZA 2H6CA 1AWWA 4GBQA 4NYNA 1EH6A 3SJJA 1WH7A 1LJ9A 4FW1A 3K7AJ 1X2MA 4HX7A 4MZTA 2YHBA 2WAEA 1T95A 3BROA 1Y1WJ 5CLSA 1Z9CA 3JCMc 1RKTA 5F04A 4E9EA 3IWFA 1U47A 3QDRB 4H5WA 1FLIA 3TAEA 3O8VA 2DT7B 1WYXA 3JTHA 2P5VA 3KIOA 1YITN 1UG1A 2HYJA 3F9MA 4B1RA 3CJNA 2XSDC 2D0QB 3L2ZA 5LY3A 3O9TA 1NK3P 1O3TA 2JA6J 4LK1F 5GAHP 3U6FA 3OH9A 1M1EB 5FKKA 2KIMA 4FZXC 4AILC 1JI8A 3M1FA 3AT1B 3QODA 5GADJ 3WU0A 1KC8C 4DV7K 1BI0A 4FX4A 1KQSA 1K6OA 4DFMA 4R79A 1UELB 3NGYA 2IGIA 2M0MA 1MZBA 1BIAA 4M7DF 1TT0A 1JE8A 3T1AA 3VU3C 2GTOA 4YOYA 1U2WA 2B0LA 3KEYA 3P39A 3CCSQ 4RGUA 1NLVA 1A5XA 4A62A 4DA4A 1N77A 1OFCX 1X1CA 3U1KA 3CCEN 2PQWA 4BHPA 5J6XA 4H0EA 3CF5L 2NOBA 5GANj 2HHXA 1MUNA 3HDDA 1TH7A 2X6SA 5CYMA 3AVBA 2FPFA 3LAPA 5GAEJ 3LWLA 4A4EA 5BN8A 3ZRGA 3ZP5A 4CSWA 2KZZA 1WJRA 3OYEA 4NXMK 2CH4W 1NNEA 3IKTA 1FOWA 1FN7A 2P4RA 3F8FA 2L5QA 5AZIB 1RUOA 1A5VA 3JRFA 4MEYF 3EUAA 3G6ET 1KTQA 2QKKA 4QVDA 2WFBA 1NEBA 4BR4A 3JS6A 4DOZA 4M3UA 1JXOA 2HB5A 3VOVA 1R1UA 3RYRA 2PMUA 2YG9A 3GZNB 2V52B 2V8KA 4CF0A 1XGOA 2R7XA 4BY9C 4H0PA 2Z99A 2L9NA 3KD5E 1QCFA 3SWNB 1Q9XA 4RW9A 2R5YB 2X48A 2R7SA 4GV6A 4P9FA 4C3JJ 1MHNA 1HNWK 1X1BA 2NUBA 3TU5A 4OAYA 1TXQA 2FZGB 3TO6A 3LSKA 1TWHJ 2A05A 2GA2A 3TABA 1Q81C 1K8AR 4F92B 2BIVA 1PD1A 1M2OA 2V1QA 1PYVA 3O5ZA 1HW2A 1ZELA 1K4SA 2W57A 4M71A 2DKGA 4G6DA 2QK0A 2D4WA 4RDUA 1TSFA 3UA6A 2E65A 4CJFA 5DLOA 3RMCA 1KQSM 2F4VK 3LSHA 3BR0A 1M2VB 1QRYA 3QNNA 1F4KA 1YQLA 2YHWA 3K4BA 5L3FA 1AT1B 4BR9A 3VETA 1XNQK 1R00A 1ZBFA 4OFAA 2GA1A 3MX2A 4LFBK 4OMNA 4RTVA 5FFXA 2IAIA 4NC6A 4DV5K 3DKYA 1WI3A 2H8HA 3CCVA 4FJ7A 3I8DA 2CZ1B 3SWNA 3TDUC 3JTGA 3BJOA 2VG7A 2R5YA 4DQ8A 1M1KR 3SAGA 1NLOC 3IAYA 1SVLA 3CCUQ 2HDWA 2XIDA 4LUEA 2VYPA 3ALYA 3HSEA 2O4XB 2FMLA 3WXLA 3LFUA 1EO1A 3KETA 1VQ9T 3ZCOA 4F7ZA 1NMDA 4CJSA 4D1QA 4BACA 1SHFA 2HMAA 3I4PA 2MG4A 3UR3C 4JKGB 3BJ6A 1P92A 1C0TA 1VQOT 3QWXX 4A5AA 2IGNA 1PUEE 1GOAA 1NWKA 2JRMA 4B24A 4C0ZA 2X6WA 3ZMZA 2Q0RA 3CIPA 1X27A 1LE8B 4OVAA 3MKZA 1OCTC 3ATVA 2M0YA 2R93J 4PJLA 2JUCA 2PU9B 3MZHA 4H5VA 5ED4A 3CCVI 4LF7K 3MP6A 2YJEA 2TRTA 2RN2A 3DWLA 3RRHA 2O8CB 2NLXA 1OH6A 1VF9A 2O03A 1WHKA 3GLXA 3P7NA 3CMAA 2ETJA 4CEFA 1BWFO 2DMOA 3TWHA 1M27C 4Q4ZF 4FZZA 1T44A 3E9GA 3F8BA 3DKWA 2EQMA 3O5BA 2O4XA 1G4DA 3HRSA 2YU3A 3HGYA 5ADXH 4JN4A 4ANJA 4ID5A 3JCMW 1XQPA 2P0WA 4RW6A 3Q3SA 3EZWA 4CXFA 4AVZA 1N27A 4C0GA 4JKGA 5LJ3e 2FX0A 1Q9YA 1UUEA 2KFZA 4GXOA 3ZT1A 1H1VA 3ZQLA 2OJ2A 4JYKA 4XLEA 2ZZDA 6AT1B 4JX4A 4N4IA 4LH4A 3CDIA 4KIFA 1LOJA 1AA7A 1LE8A 1QQIA 4FJGA 3OIOA 2CG4A 4BI4A 1VQKA 2ECZA 2O8FA 2HGCA 1N25A 2KISA 1W36C 2VI6A 1OH7A 3FZFA 2W0ZA 2WV0A 4J7FA 2O8CA 3WXMB 4CF9A 2QUFA 3HFNA 1XSVA 3FISA 3CMAI 4GY2B 3D1NI 3Q0WA 1E7OA 2CH4A 4FASD 1JLBA 3BOQA 4JZ4A 3CD6A 2VV5A 4Z89A 2YX4A 4C8MA 1VQ5A 2FC0A 1BC8C 4Z6YA 3HOWJ 1HYSA 2W48A 3REOA 3GG4A 2DTHA 3OV8A 5GANf 1HRHA 4FJNA 3QFUA 2LRQA 3IAS2 4OWRB 3BY5A 4BVPA 4M75B 3CJQB 2O8KA 3KK2A 2YSRA 4C8NA 3J8AA 2FF6A 4OJRA 5M1OA 3MN9A 4XLCA 5HNFA 3L2WA 2JWLA 3L9FA 2D8JA 1I6HJ 4J6YA 3E9FA 5KYUA 3LOCA 3BDUA 2DK3A 2JQ7A 4A93J 3OYIA 4X34A 2IGKA 1VQKI 4DS4A 3TL4X 3PL8A 5FKNA 3CCVN 4KV8A 3RSNA 1SV5A 3BCBA 2YNHA 2HBJA 2W25A 1JLFA 4FLVA 1PG5B 5LJ5h 2VUMJ 2IP2A 1FMKA 2BDPA 5BREA 3L3VA 4CF8A 2I8DA 5D6XA 3CD6I 4DFKA 3DLEA 1Z7LA 2JW4A 3FM3A 2AIRB 4X6AJ 1VQ5I 2DPUA 1IN5A 4KULA 3TGNA 3L2UA 3R0AA 3PO4A 2PBIA 1QZ6A 2OQGA 1RNHA 2KRSA 3JSPA 1QO0D 2BE5F 2LYCA 4BJ5C 2KLAA 4H8KA 5DTDA 2EPDA 2ZSHB 2Q97A 3M8JA 3FM5A 4OIQF 5LEKA 3ZBDA 1GT0C 4M75C 4M78A 1YW8A 4HNVA 4E19A 2KJBA 4JK1X 4GKKK 3M53A 4IOCF 2I5UA 1B9FA 4BHBA 3ZYYX 1FY7A 3WQTA 4N0AA 5JFRA 5CHIA 5CHZA 3ZSWA 2GEMA 4XL9A 3CC7N 2DFFA 3HRUA 3CMAN 3PM1A 5A2QZ 5HRPA 3QICA 5TKYA 1XMXA 2CYYA 5AQWA 5L3EA 2BVMA 3AVAA 4A2BA 2XB5A 4PUSA 2YHYA 3V4IA 2CP3A 4PFOA 5AQPA 2ZO4A 2MSYA 4Z4GA 2HQ5A 4X9DA 2V1NA 3VJPA 4DR4K 5HKCA 3HTSB 3C2GA 1QZEA 2AQFA 1CSKA 4CJRA 2EK5A 2X9HA 2KXCA 2XY5A 5CKEA 4EHTA 3I0SA 4JK7A 3MHXA 3CCLN 5E1ZB 4LD0A 4KB0A 1FOKA 4B1UB 2GWJA 4CGFA 2P9LB 2LH9A 3GFJA 4UVAA 2HXIA 4XU2A 2VWKA 1N78A 2VKNA 1MUYA 3I0WA 1S5LC 1HDDC 1T98A 5HLTA 2STTA 2IS6A 3DKXA 3HG9A 2HKNA 3CPWM 5HRNA 2RQVA 2IPQX 2L54A 4DNCA 1W0TA 2G8IA 4RLQA 1S1WA 1IO6A 2JN0A 1VQLT 3CFRA 1VQ6T 5EEAA 5AQUA 4UUTA 1ZUYA 1NGGA 3D45A 2QGGA 1U8RA 5CZ1A 3FC3A 2IA2A 3MEUA 2GX9A 4YOUA 1U6GA 2NRZA 3LDNA 3QEXA 5CQEA 3AVCA 1YIOA 1B9DA 1DEJA 1MJ9A 2DY4A 4C3IJ 3FXLA 2RD1A 2CV1A 1QPIA 4N76A 5D6EA 2GBQA 4AG2C 4KH0B 2NVXJ 1LWFA 1YQKA 2FYKA 3M6GA 5DCMB 4WXDA 4WQ4C 4H0OA 4DCHA 5BR9A 2A69F 3FXMA 4ZYEA 3CC4A 1C0MA 2DXBA 1A35A 1HYVA 1MMSA 3W0LA 2LBFA 2NOGA 1HJOA 2HQAA 3HZ6A 2DD5A 2JPBA 2AK5A 1U6ZA 2K9SA 1TK8A 1IW7F 5KQDA 1MMNA 1HKBA 4PJMA 1YE9A 4O0IA 2B6AA 2A40A 2ME6A 1K83J 2EZHA 3QP6A 4WXHA 4GNIA 3QEVA 2FBTA 1KGSA 4H0XB 2O8EA 4ZJZA 3RR6A 5J40A 1NE8A 2ZPIB 2P6TA 4I6MB 2Y0MA 1ODDA 1KU7A 1YJNN 1D1BA 1QWEA 1I5ZA 3FHNA 3OYFA 3BF1A 1MH4A 3TP3A 3WNFA 3TTDA 4MGRA 4DUZK 1WHJA 5CKFA 4XRFA 3VWBA 1R0CB 9ANTA 3RCOA 1LFUP 2M1BA 1TWBA 2X4JA 5MLCQ 3OJUA 5DCMA 3AA3A 1MUZA 1D8YA 2AJQA 1EXQA 1FXXA 3CC4I 4W97A 5K5RA 1N8RU 5DV5A 2GXGA 1DP7P 3DLHA 3BY6A 3GCMA 5FKMA 1TK0A 1A36A 1TUUA 2FSNA 4C5GA 1S72T 3CG7A 4N41A 5J1UA 5KCOA 3E0JB 1O13A 3FXQA 2VKVA 4KA4A 2IGMA 5J4YA 3OHRA 2PG4A 1FP2A 1KXPA 2HVRA 3DXKB 2KLOA 3CCJN 4C92C 1XB4A 3NMZC 3LA7A 3GTPJ 4I6MA 1QQMA 2RPIA 2SEMA 1X9SA 2Z0WA 3SCXA 1GLBG 2OTJA 1HA8A 5KH6A 4N4GA 1JUMA 3SFZA 1V1CA 4PKIA 3FXUA 1UZCA 4EJOA 2XKOA 4MDAA 2R5ZB 3EQLF 2VOOA 4I01A 4HNTA 3VYTB 1SEUA 5KYXB 4FM4B 2NYSA 2OX7A 5KPTA 5ILSA 2L9RA 2PUOB 4I7FA 3LQQA 1EA3A 4M77D 4MLOA 1SG5A 3IH3A 1AKHB 4PUOA 3TOAA 3IRXA 2DXUA 3OSSC 2E7XA 4CCKA 5DS9A 3PT9A 1AWOA 3VPRA 4FSVA 3MJXA 5GAOl 1Y8RB 2F5FA 1UCRA 2RREA 1ZR2A 1JKQC 4PGHA 1NJWA 3RKXA 5IPAA 4DTRA 3F23A 1YI2T 4GFBA 2KDZA 2G6FX 3OYNA 2XGEA 4KRFA 5HS8A 2OTJI 4RTXA 5H1SQ 4OMYA 1YJWN 1MBGA 4EZ9A 3PIPF 1RL2A 1BR1A 2ZQBA 4A0ZA 4IUQA 4KMFA 1NMNA 1YTAA 3T8TA 5E18F 2A41A 3CC4N 1XOVA 1OU8A 1R6RA 4LG3A 2HSPA 3ZSRA 1RT4A 4YNQA 2DNUA 3CPFA 2R5ZA 3TPQA 1QQOA 3PIOA 1KSWA 5KYXA 1P4AA 1VSJA 4YFKF 1QCOA 2AKKA 1NJIU 2KHMA 3V8JA 1AKHA 1NLPC 4M75F 4LF4K 1WJ5A 5FU6B 1GVJA 4CO8A 3K5NA 4HQMA 2DMTA 2P1JA 3RSEB 4HYEA 3SAHA 1TUYA 4E7LA 2M9UA 1JU5C 3DLRA 2PMHA 1SFKA 2LLKA 4B3SK 5AT1B 3EG9B 2GNCA 1N5YA 2DTOA 1F1ZA 2LP5A 1R58A 1LWCA 4DTUA 5CCAA 2ISYA 3HXMA 3CQXA 1KG3A 2ZXIA 4XH4A 3IKMA 2ZBKA 1YF5L 4JKCA 5FLMJ 4BEHB 4Z88A 3UT1A 4GYGA 4OU0A 5EX5A 4W1UA 1I1JA 1QHAA 1ACIA 3OMCA 1IXDA 3SXYA 4HVUA 1QP2A 2FD5A 1YS6A 2G0EA 4FW2A 4UHTA 3JRBA 1KD1C 1Y64A 4RMOA 3TW6A 3PVQA 3HK2A 3UKRB 5IXBA 3ZETB 1T0FC 4N9HA 1R5HA 4F8RA 3JREA 2K79A 1EZZB 4F2SA 1CZAN 3G6EN 5DEQA 1O3RA 1XQSC 1RDWX 2NRTA 2RMOA 2HNZA 4HA8A 4MFDA 3M8RA 4E3SA 3FBIB 3RSEA 4YIIA 4J8OA 3LMMA 1RZ4A 4DMNA 3WE3A 2LREA 5GTHC 4Y3OA 2CU7A 2VONA 4Y1CA 1VSLA 3GP8A 4OMZA 4GRIA 3LQRA 2DA6A 3D5SC 2K5CA 3CCSA 3CW7A 3D7SB 2FNAA 3C6HA 4IEIA 2FBXA 2BY2A 5AZJB 1XC5A 3QOEA 3FEOA 2VKDA 4FQGA 2YRDA 4GLMA 3IH4A 4BEHA 4DGWB 3Q7CA 4IFVA 4EGYA 1TUDA 1AWCA 1I5LA 2COYA 3JB9H 4OIPF 1IDYA 3G0QA 3K5LA 2P5LC 2QA4Q 1GLAG 2YUQA 5HDGA 4YRVA 2HHQA 2HFHA 5ADXA 3UPUA 3N97A 3ZETA 1DPRA 4C23A 1UWBA 5CR2A 4PJOB 4CHOA 4BRIA 2V8IA 4ZDLA 3QHSA 3WVEB 2YLBA 1P7JA 1JEGA 2EIMH 1QHHD 1YTYA 1ASUA 3DEWA 1MKMA 2GQIA 4BRDA 2DMUA 4Z8AA 5AQVA 3DLLA 5E20A 3W2WA 4CVNE 3R6NA 3J80Z 3CCSI 1NGCA 2K2VA 2GXBA 4DEYA 2QW9A 1G3WA 3NGPA 4JJBA 1RADB 4FJMA 5GP9A 3AA5X 5AZJA 5BOXA 2A3ZA 2ZFUA 2RE2A 1WGXA 1N8RO 2HHTA 2GTJA 2DA5A 4Y13A 3F22A 3TQ7P 2DCEA 3J7AO 2C0IA 1L3TA 3OOPA 4WF9L 1L3VA 2KIFA 4CYCB 2L0AA 1JKOC 4C8QG 2HQEA 1FBQA 1NOYA 1E4GT 2E4LA 2IDOA 1GCPA 4WFAL 3CP8A 1SMYF 1VQMQ 2EFOA 1F21A 2H27A 1NGNA 2E1HA 4L8RB 4BRKA 1FOYA 2XDPA 3P1GA 4DIQA 2R3SA 3AG2H 2JPCA 4KUMA 4PJOC 3OVNA 4J9EA 2DOAA 1IUFA 1K9MC 1QVFA 5HS7A 1QCNA 2AO9A 1TQIA 2H3JA 2W84A 4EEFG 5J1EA 4BGBA 3DEEA 3N4QA 4RM2A 5EG2A 4H4OA 2E5QA 1XMKA 3K5OA 1HSJA 1W1FA 4PLIA 1ILYA 5GPAA 3UDCA 3E01A 2EHGA 4QAGA 3F70A 3CCUA 3R4KA 4OOIA 3ENBA 3TSZA 5IP6A 2UUAK 3IHOA 4KPYA 4CYCA 3TDZC 3MEEA 5EZHA 2FJ1A 4M7AA 5GAN8 2VBYA 4C92F 1YN8A 2DXTA 3NPFA 1L3UA 4MNUA 2HVIA 1U0JA 3ZX2A 1SF9A 4JI2K 2GWKA 1S8NA 4ETSA 3ERED 4DTMA 3FMRA 4QPOA 2IT0A 1D9DA 5C24A 3F6VA 2PUKB 3DB3A 1QVGA 2H56A 4WX9A 4EQQA 1KFDA 3WG7H 1JXSA 3VEWA 2RK2A 3LWHA 1S6QA 3CCSN 1K8AU 4QTRA 3DBHB 4C30A 4PKCC 2ECCA 3IKVA 2D0BA 1WEFA 4BR5A 1BA1A 1QE1A 1TYQB 1C0FA 1W5TA 3VF4A 4BG9A 1F5TA 3CCUI 2OV7A 2M34A 1XG7A 2PYLA 2P5GA 4E1MA 1G8XA 1OCOH 1R4NB 3QZ9B 5DM6F 3MECA 1BB9A 4J9DA 2P9SB 1YYVA 1KYZA 2DJQA 1OH8A 1HOMA 5BR8K 1S1NA 1M90C 5FKOA 4LF9K 4U0VA 2CO5A 3S32A 4L0YB 3SFMA 3MMYB 2YHXA 2IVOA 3HTRA 3TW7A 3ZQHA 4O55A 2EIJH 1M1KU 4KT6A 3H08A 3HRMA 3I35A 4K0KK 5GAN3 2QSGX 3L42A 4I7HA 3OQ5A 4RTZA 1RI0A 2ZCWA 2DEUA 3CWTA 4DV4K 1FOXA 2CUDA 3EDPA 4BUGA 1B92A 1LUJB 4YDUC 3TAGA 1AHJB 2O0YA 2VYTA 2EZLA 4I98B 1TYQA 4BJ6C 1RAIB 3RMSA 4IDKA 3TAMA 3VDXA 5IT9Z 3AL0B 5J3LA 4I99C 4ISGA 3DM2A 1KCFA 4LSLA 1H8AC 2P9SA 1JT0A 5A0DA 1B72B 3N05A 4AVPA 5E3LA 2DK8A 2B86A 4M78D 2DA7A 4MLHA 1X1AA 4XU0A 2MBFA 2RKHA 1ZGJA 2OAZA 2YU9J 4IHVA 3OMYA 1QVGM 4OIRF 2XB0X 1D0ZA 4IF4A 1TWFJ 3H5RA 5GMKj 5F64A 3V9UA 2HOTA 4DR1K 2GBYA 4D5FA 1QU3A 3QESA 3ULQB 2BTFA 3OWTA 3F0CA 2LY1A 4W5TA 2RGVA 3CWAA 2YJFA 1WSHA 2HDAA 3HBLA 4OMOA 3RZOJ 5GAOp 4AM3A 3B6OA 3HB9A 1C1AA 2YHAA 2CUZA 2VQEK 4GMJB 1D5YA 1TLHB 1A5JA 4X66K 4DSEA 1IGUA 3HVRA 2EJRA 2A36A 1XSDA 1WAFA 2PMZA 3M59A 4CHPA 2RHUA 3S6WA 1RTIA 1T08B 2NRWA 4BWJA 5KPZA 1ZYQA 1UFMA 2XY6A 1B72A 1WSGA 1PP8F 4X0GA 3NHGA 4ASNA 1MV0B 1YIJQ 4O8UA 4RGSA 4HCCA 2PYJA 2ZWHA 1RT5A 4HXJA 3U21A 3HYFA 4C8OA 5JLHA 3PO5A 4EM1A 2CGLA 2E1YA 4UV9A 2BHYA 3DAWA 4C8QE 3P9CA 3AAPA 1XGMA 4AYBA 3JAMO 3B6AA 4RLFA 4B48A 1SVMA 1KA8A 4KT5C 1VQLN 4U7DA 2NRRA 4IUVA 4IZ9A 1VQ8Q 1VQ4Q 1FPQA 5AONA 3MZ8A 4DZJA 1UTIA 3JSCA 5DM7R 3KZBA 5J39A 4DYQA 4EV0A 3FLGA 2CV2A 1ASVA 3CUQB 2VGNA 4ID1A 2QLZA 3OSFA 3DXMA 3MCZA 3MXIA 1I39A 2STWA 4EAHD 2OYQA 3H0GJ 3F9KA 4M72A 4HF2A 1KG1A 3WTTC 3A1YA 2A3SA 4R1HA 2HVQA 4B9XA 1WQ7A 2CJJA 2MC3A 4XBFA 4HAMA 3W3DA 2K6DA 4IOCL 4P5NA 2C0OA 1BIBA 3O9QA 4NZGA 2HR3A 2L2OA 1U5TC 1X4OA 2D0AA 1WVRA 3IRQA 3GLLA 3OJSA 4IUTA 5BRDA 1VIFA 5EY4A 2XSJC 4B9NA 3J81E 1C6VA 5LD2C 3I56Q 1X3UA 2EQKA 2F1LA 2K5LA 2DVJA 3QJ6A 3HKZA 4YOXA 2Y1IA 2VC0A 2LR8A 1YS7A 3QPLA 3CUQA 2IS1A 2Q31A 3KNTA 2QCOA 3H36A 1SFOJ 4HLXA 5K1YA 1OI1A 4PJOF 1G5VA 1XTAA 1YJ9T 4DLGA 1TAQA 4E1JA 3GBQA 2DXCA 2D1XA 3AY9A 1AZGB 3GWZA 1ZHIA 3EN9A 2G8KA 1RT3A 2XHCA 4FLZA 2IXSA 1RCHA 1K8AO 4M7DG 4RBOA 1IBMK 1BOTO 5BNGA 2WB1N 2RC4A 2Z1HA 1XCBA 2VQHA 3KP5A 1UECA 2QGUA 3PX6A 3PSFA 3CERA 2DM1A 4H4KC 2A6EF 4A3EJ 4M3YA 1W2BS 1YFHA<