5FROA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz446 (compound 4f)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
molecule keywords PFV INTEGRASE
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5froA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5froA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5froA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5froA03
2X74A 1REVA 3OQ5A 4CF2A 1NJXA 4FVMA 4M41A 3LP1A 3E9GA 1ASVA 4ZTFA 1RT1A 1Y97A 3KLIA 4OGEA 5DK5A 3HO1A 3TAEA 2D9TA 1SKWA 5JS2A 1OYXA 3OYHA 2IAJA 2E6LA 3K58A 1ASUA 4KV8A 2XY6A 1A5XA 1RDAA 3LAMA 3HXMA 3NGIA 3QLHA 1WSJA 3DB4A 5K14A 1BCMA 4DLGA 3MEGA 2DY4A 1SKSA 4MFBA 1OZ2A 4I2QA 1SSFA 2K3XA 3FLGA 1FXXA 4MQ3A 1LAVA 4DFPA 3ALYA 1U4BA 2BUDA 1UWBA 2HHXA 3ZSWA 3O8VA 3LZIA 1LWEA 3T19A 3BDPA 3ZT2A 1H3ZA 3M8PA 3VA3A 2X35A 3AVKA 3FFIA 1I3AA 2OPRA 2YNIA 1HJRA 3I8DA 2HMIA 3NCIA 1XI1A 1EXQA 2LVMA 2G8WA 3HM9A 4HCCA 3PX4A 4OLAA 4OVAA 1LV5A 3QIIA 4FJHA 3KJVA 4L8RB 5HROA 3PO4A 4CEAA 4CK3A 3KLGA 3TAQA 4ELTA 1HRHA 4FZXC 3AVGA 4AHUA 1ZBLA 3ZT4A 4ZTJA 2VWJA 5D3GA 4CJ3A 4JRQA 4O55A 3SZ2A 4I9QA 4CEEA 3V9WA 5J26A 3SD4A 2BE2A 2I5JA 1RT4A 3O3GA 3K5MA 3SQ1A 2QK9A 3AVIA 4DTJA 3VQQA 1WAJA 4BD3A 1DTQA 1S9GA 4C5EA 2GV9A 2P51A 4FW2A 4CECA 4CEOA 3VQ8A 1JLCA 1KFDA 3P5JA 4CGDA 1SL2A 4M3ZA 4CGGA 3OYLA 3VQPA 4NCBA 3AA2A 3V9UA 4DQSA 4Q0BA 3OS2A 1VRUA 4JS4A 4DSEA 4DTUA 4L59A 1DLOA 1BGXT 2YHBA 1Q9YA 1KLMA 3OY9A 4N5SA 3CEYA 2P0KA 1GOBA 4W5OA 1NK4A 4C5IA 4PWDA 3L2RA 4AHCA 3AO1A 1J53A 2WOMA 3MEWA 2HHVA 4N4GA 4FL6A 5J39A 3UT1A 2XDPA 4IUQA 4A4EA 2RN2A 4OJRA 4CIGA 3QNOA 4B9NA 1VSDA 5KGXA 3FEOA 3LANA 3THVA 4NZGA 3S6WA 3NTKA 3OYKA 4FXDA 1WSEA 1KCFA 2ZQBA 4CK1A 2OPPA 4DQQA 1B92A 2A1RA 2P5OA 3M9QA 3K57A 4EDUA 1HYVA 4A4HA 4DU4A 3OYCA 4DFMA 3RR8A 3VQ5A 1YT3A 3ZSQA 3U3YA 3S9HA 3LYIA 3QJ6A 1S1WA 3IG1A 2CKKA 5HRSA 3TAPA 4KB1A 5M9OA 1KVAA 4CEBA 1RTDA 3V9SA 4W5TA 4CEQA 1JLEA 4CJRA 5FRMA 2PQWA 2DIGA 4M3YA 1WLJA 4O44A 3NAEA 1UA1A 1KHCA 2JGUA 2RJFA 2E6MA 3AVBA 3D0PA 3SV4A 2VG7A 1SKRA 2MWOA 2YV0X 4CRIA 4KHQA 3KKRA 3RMBA 1NK6A 4RW8A 3EZ5A 3KLEA 3DLEA 1TKTA 4CEZA 4BDPA 3M8QA 3SJJA 1QHTA 3MEDA 3RR7A 2IC3A 3TANA 2O4IA 3QINA 4QQGA 5FRNA 4BWMA 1S5JA 4N41A 4JLHA 4HHTA 4DTMA 3WNFA 2RHIA 3UIQA 2XY5A 1IG9A 1RT6A 4ZHRA 1NJWA 1U49A 4QOZB 3L2VA 1VSLA 4CHOA 4FLYA 1KRPA 3OYAA 1HPZA 2KFNA 4F2RA 3T1AA 4FJMA 3HJFA 1HQUA 5CZ1A 3AO3A 2R58A 4DF4A 1KTQA 5J2NA 4E7JA 3DRPA 1N5YA 2ETJA 4Z4IA 3C6UA 3WNHA 3MP8A 2EQMA 2LDMA 5D6WA 1S6PA 2XY8A 4I9LA 2M16A 1WSGA 3NBPA 3ASMA 3LPUA 4E89A 3TAGA 5CYQA 3V81A 3AA4A 4DQPA 4DTSA 2Z1IA 2KFZA 4FLTA 3AO4A 2G8VA 4DU3A 3IAYA 4PLIA 3LWLA 4C8LA 1TVRA 4DSLA 1TGOA 1IH7A 2EHGA 4CJSA 3LAKA 4ID1A 2HQXA 3VQBA 4CHPA 3QEWA 4IUTA 1I39A 1S6QA 5CYMA 4AH9A 4HUGA 2HVIA 3SYZA 4BE0A 1NOZA 1VSKA 3AV9A 5SWMA 1C0TA 1K6YA 3ZSRA 1L3TA 4PUOA 1RTIA 5KE3A 1HMVA 3V9ZA 2XY7A 4FK4A 3KUFA 2KW4A 3L42A 1VSFA 3HK2A 4KREA 4FM1A 3RRHA 4PA1A 2R5MA 1IKXA 4CJQA 4DQIA 4X34A 1W9HA 3HP6A 3P8HA 2F5KA 3LH0A 1A5WA 1ZBIA 2QKBA 1HYZA 1JL2A 4ID5A 4PL6A 1VK0A 3HVTA 2YKNA 3A2FA 4KTWA 1QE1A 4PLLA 5I42A 2RI2A 4GW6A 4IKFA 3OJSA 1NKBA 4B08A 1QQCA 4DSJA 3MP1A 3OYJA 1GOCA 2RJDA 1YVUA 4C8KA 3CM6A 5J2QA 3FC3A 3AA5X 2E6NA 1L3VA 4HUFA 1RDCA 5KTQA 4B9UA 4UC4A 2OA8A 2FBYA 3PY8A 2VG5A 4CF8A 3ASKA 2Z1GA 4N47A 3VQ7A 2ZD1A 3ZSXA 4DTXA 1N27A 1B9DA 4E1NA 3AVAA 4CEFA 4FLVA 2RF2A 2IS3A 4CE9A 4CJTA 4DTOA 3SPYA 4AILC 2X4YA 2PYJA 2IG0A 3DLKA 3EAEA 3F70A 3OYDA 4Y1DA 4CF1A 4C5HA 3QERA 2D0CA 1S1XA 2RKIA 4BDZA 2WONA 4AHVA 1KSPA 3PFSA 4BE2A 4OGCA 1R0AA 3D45A 2QKKA 1RBRA 4C8NA 3E9FA 4DS4A 3SQ0A 1T03A 3MECA 2HQEA 1S1TA 1BIUA 1HQEA 1RBUA 3OYMA 3DLRA 1JLQA 4IFVA 3ZSOA 4PQUA 2KZMA 1XC9A 4CERA 4CF9A 5HRPA 2JTFA 1JLGA 4N4HA 4QW2A 3CM5A 3PNWC 4OVLA 4CIEA 1VSHA 1UA0A 4DWIA 2G8UA 2IOCA 4CHYA 1U47A 3QIPA 4DFJA 4Z4GA 4CJUA 3PUFA 3ITHA 4Z4HA 2JZ2A 2RI3A 1QSYA 2MWPA 4FJGA 1EP4A 4FLUA 1BL3A 3QIOA 4E7KA 1CXUA 3CFPA 2LTOA 4F3TA 3NHGA 3HPGA 1ZYQA 1QSSA 1T05A 1KFSA 4KPYA 1JXEA 1TKXA 2FC0A 3CQ8A 4M3XA 1NOYA 3PMTA 3O3HA 3SNNA 1BIZA 1BQMA 4KRFA 4J2EA 3V6DA 4Q5VA 3NGZA 1UOCA 4E19A 5J1EA 3HPHA 1C1BA 3V1OA 4CJFA 4KB0A 3ZSZA 4K8XA 1JLAA 3KK2A 4C8MA 4FJ5A 3C4SA 1TK5A 2EQKA 4AHRA 1TAUA 2NLUA 4CJEA 3OYEA 1RBSA 4G1QA 4KAZA 3KK3A 3BGRA 1KLNA 1D9DA 4OPJA 1EETA 3HPOA 3SCXA 3ZEHA 4OPKA 4FJXA 4LD0A 2AJQA 4KHSA 4FZYA 2XK0A 3OYIA 4NS5A 4WE1A 3HT3A 2M1HA 4DFKA 2ITGA 4RW6A 4CGJA 3SPZA 3RRGA 5C24A 2HHSA 4DQRA 1RT3A 3RTVA 2O4XA 4LSNA 3DLBA 4EP5A 3H8ZA 1XWLA 3P8DA 4FW1A 4KFBA 3MXJA 4LH4A 5KRTA 1XHXA 1X9MA 4FK2A 4KI6A 4KHUA 4B9LA 4KHYA 4CGFA 1RI0A 3RMDA 2A1SA 1UAXA 4FLXA 1U48A 3LP0A 1CLQA 1SUQA 3H08A 3AVFA 3HYFA 4BACA 5CY4A 3U3GA 5HRRA 3CYMA 3VQAA 1TKDA 4KHWA 4FJIA 4CCHA 3DB3A 1RBVA 2B6AA 3RMCA 1GOAA 4N4IA 4B9XA 3OMGA 3KD5E 3KIOA 4OLBA 5JS1A 3OMCA 1TK0A 4CFCA 1FKPA 1O1WA 4RG2A 3DOKA 3S3NA 3L2WA 4DSKA 2VWKA 3OVNA 4B9SA 3TAMA 1L3SA 4E7LA 2RHZA 2X6NA 4ICLA 3DLGA 4DTNA 1N6QA 2G8KA 1C0UA 4Z0UA 3DRSA 4CFDA 2GFAA 4O5BA 4O0JA 2DFHA 1JXBA 3K59A 3NTIA 2BANA 3AO5A 3AVCA 2Y1IA 4LD6A 4C5GA 2X6SA 4GY5A 1L5UA 1YTAA 3NF6A 4LH5A 1QTMA 2Z1HA 3NH0A 4OKKA 4DU1A 1LW2A 2VG6A 3NF8A 2RJCA 3SUQA 3AVNA 2DFFA 1RDBA 3ZT1A 3KD1E 1CXQA 2D0BA 5IN1A 1NKEA 2EQUA 2WACA 3OYBA 3META 3B6OA 2W42A 5KE2A 5FROA 3LZJA 4LSLA 1T8EA 2L89A 4QQ6A 1ZBUA 3WNEA 1CZ9A 1JKHA 2Y1JA 1C1CA 4FU6A 4HCZA 2P1JA 4KO0A 3VQEA 3SQ2A 2RPIA 4TSXA 4CJKA 4ELVA 4FJ9A 2RHYA 3TR8A 2X78A 4CGIA 4DG1A 3I0RA 3TARA 2QXFA 2HHWA 4QQDA 4QCLA 1YTUA 4E1MA 2XRIA 4OKEA 1BI4A 3LP2A 2XO7A 1RILA 2FHDA 4CHNA 2Z1JA 3TI0A 3OYFA 3SUNA 4CF0A 1NJZA 1T7PA 1HNIA 1LWCA 3O4QA 1RT7A 4EP4A 3M8SA 3NTHA 3ZCMA 4F2SA 1HNVA 4KI4A 1WNSA 1RBTA 3DRRA 3ZT0A 2R7YA 3MP6A 1D5AA 4CHQA 3TABA 2EQJA 2HNDA 3AO2A 3V4IA 3K5NA 3MXMA 4W5NA 3QEXA 1WN7A 4M45A 2M0OA 4B8AB 3NF7A 3F73A 4DTRA 2D5RA 4F8RA 3NGYA 4GMJB 4HCBA 2G8IA 4QAGA 3QETA 2QQRA 4IUVA 2BIVA 2YHAA 4IFYA 4KHNA 3LWMA 1MU2A 4Y1CA 3KTQA 1BI4B 2IGIA 1WAFA 2FBXA 3NE6A 1FK9A 4KKOA 1SL1A 3DM2A 2OPSA 4JS5A 2ATQA 4A4FA 3ME9A 3HSTB 1LWFA 3VQ6A 3VQ9A 4HVJA 2XHBA 2FBVA 4LY7A 4EZ6A 4FCYA 3MO8A 1WSHA 3AA3A 3C6TA 3QKJA 3S3OA 4B9TA 4FLZA 3PV8A 4E7IA 4M3WA 5KGWA 4DS5A 4J2AA 5HRNA 1JL1A 4RW4A 1NK8A 1TK8A 1U45A 1F21A 3VQCA 4CIFA 2EKOA 2RHUA 3OA6A 1JLFA 1ASWA 4A4GA 2YKMA 1TAQA 1BISA 2B8AA 2DAQA 3LGFA 3AVLA 3NNQA 1CZBA 1WSIA 1WGSA 5FDLA 4DLEA 5J2PA 3LP3A 4FM0A 4JRPA 4CHZA 1VRTA 1TKZA 4CGHA 2YRVA 4IUUA 3T3FA 1B9FA 1DTTA 2DIQA 2RHXA 1SV5A 5DMRA 1RT5A 4YNQA 4R5PA 3OJUA 1KVBA 3IRXA 1NK9A 2G8HA 3RWUA 1HYSA 4CJWA 1S9EA 3JSMA 5HLFA 3SUOA 3L3UA 3C94A 3QEPA 4RW9A 1VSIA 3LDSA 1NJYA 2OPQA 5J2MA 1RNHA 3RMAA 3K5LA 5HP1A 4B9VA 4FJKA 2GF7A 3GOXA 1EX4A 4UQGA 4NYNA 3V9XA 3DLHA 5CZ2A 2HHQA 1WJRA 3K2PA 1Q9XA 2KZZA 4CK2A 1VSMA 2BGGA 4PY5A 1G15A 3H6ZA 3MEUA 4FJJA 3SV3A 4M42A 1J9AA 1J54A 3QEIA 1X1PA 2HHUA 4FM2A 3OYNA 3QBYA 4BWJA 2F8SA 2DTUA 3OB9A 4FJ7A 1C0MA 5EU7A 3VQDA 1ZBFA 1QS4A 3MAQA 4OKJA 3NDKA 2IDOA 5C6SA 2ZE2A 2OZMA 1Z25A 4F3OA 4FK0A 3OS0A 3HL8A 3TWHA 3LPTA 3QEVA 2PZSA 2BKDN 3VQ4A 4Z4CA 4B8CA 4FJNA 1ZBHA 2G3RA 4K8ZA 4HTUA 2O4XB 2F96A 5C25A 3MEVA 1LW0A 3KK1A 3BDLA 4XIUA 5C0MA 2KQ2A 1U04A 3SI6A 1L3UA 2GFUA 1TV6A 2FBTA 4J2DA 4F4KA 3P83D 1FKOA 1NKCA 4I7FA 5D6YA 2RO0A 1XNIA 3S3MA 4II1A 5KCOA 1RT2A 1S1VA 2Q3SA 3AVHA 3O4NA 3VN5A 3ZT3A 4CESA 4CJVA 2O4GA 3DMJA 4CJLA 2DFEA 1NK0A 1RCHA 3AVMA 2HNZA 2B5JA 3F9KA 4GVMA 3UWNA 4FZZA 3L3VA 2BDPA 3P1GA 2GBZA 2L3RA 3DLMA 3EYZA 4DSIA 2B4JA 4IDKA 2F8TA 4NCAA 4H4OA 1D8YA 2R57A 2LSNA 1MHNA 4CFAA 2LCCA 2YNHA 3QESA 3V1QA 3NH1A 3KLFA 3CG7A 1WJSA 3QNNA 5IAYA 4IG3A 3G10A 4CJPA 4FLWA 1SL0A 4YFUA 3TAFA 1EKEA 5KI6A 5KH6A 3MEAA 3E01A 1Q8IA 3Q1JA 2EX3A 3LX7A 1XHZA 3K5OA 4B9WA 1ITGA 3LGLA 4B3OA 2YNFA 4RG8A 1NK7A 3WNGA 2KTQA 3EY1A 3KKSA 3ZSYA 4IBNA 2G8FA 4I2PA 4DMNA 3G0ZA 5E41A 4B9MA 4M3UA 5HBMA 3NH2A 4FYDA 4FJ8A 4IURA 1IKYA 1BQNA 2X4WA 1TL1A 3HP9A 1VSJA 2E4LA 5D6XA 1JLBA 4DTPA 3OS1A 3MEEA 1KVCA 4E3SA 2HB5A 1QSLA 4M3TA 3OYGA 2HNYA 3LALA 2RI5A 3HVRA 2E5QA 5SZTA 4KTZA 4BDYA 4HUEA 2NUBA 4C8OA 5I3UA 1IKVA 3KLHA 1RTHA 3NFAA 1IKWA 2L8DA 3U6FA 2OZSA 4FJLA 3ZSVA 3CFOA 4CJ4A 1VSEA 2HHTA 3PO5A 1Z26A 1RTJA 4IUPA 2QQSA 4QVZA 3DI6A 3ULDA 2JLEA 4CEDA 4ELUA 4DF8A 2HVHA 1S1UA 4N56A 2YNGA 2P5GA 3DOLA 1TL3A 3JYTA 1OI1A 1BHLA 1C1AA 3O3FA 4NYFA 4EZ9A 4AHSA 5KRSA 1X9WA 4E7HA 4IG0A 4AHTA 2PYLA 2OYQA 2EFIA 4Z4FA 2D0AA 3FDRA 4BE1A 3L8BA 4DSFA 2K3YA 3L2UA 2VYTA 1NK5A 1X9SA 4KTQA 2GUIA 4H4MA 3LLRA 2PY5A 2LRQA 1W0HA 3PMIA 4J2BA 3AVJA 3ISNC 3C95A 3M8RA 4RW7A 1A5VA 3V1RA 4O0IA 1WJQA 1RDDA 3QO9A 3CFRA 4E0DA 3L2QA 1IO2A 3SQ4A 4NCGA 4O4GA 4Z4EA 3VA0A 4N76A 4W5QA 5KCHA 4CJ5A 3PX6A 5CIUA 3PX0A 3IS9A 4W5RA 3I0SA 5T7BA 2HW3A 3NF9A 1D9FA 4M3RA 4Z02A 4H8KA 2RJEA 4Q5WA 3B6PA 1WSFA 2X4XA 1G5VA 3DYAA 5C42A 3SUPA 1J5OA 1BCOA 2R5AA 1OZ3A 1LAWA 4CFBA 1C6VA 3MXIA
chains in the Genus database with same CATH superfamily
4MTEA 1DEJA 1P90A 2RQVA 4OGEA 1WBDA 1JJ2M 2DERA 3RPQA 3LAMA 4GYIA 3QLHA 5CVRA 2DRKA 4CC2A 2W03A 3G71Q 5KPRA 3JCMV 3CMAQ 2ZC2A 3PUBA 3VA3A 1C0FA 3IH7A 5AZJA 3F9MA 4Y17A 1NLPC 1KC8C 4ELTA 4GV3A 4M7DB 2CUDA 2HSTA 3S14J 3SZ2A 2BE2A 1LJ9A 3QQAA 3O1BA 2DJZA 2IGMA 5F0HA 2P5KA 1S9GA 2P51A 4C5EA 2QWNA 2AT1B 2WADA 2ELKA 3OS2A 4LF5K 5DM7F 1I94K 2DJIA 3K4NA 2HOEA 5J39A 4IUQA 2RN2A 1WJBA 3E9PA 5KGXA 3K69A 1Q82O 4U7DA 2ZPHB 2X85A 2ZQBA 1UG2A 1UGRB 2GELA 2UV1A 1DPUA 2X9DA 4J9EA 2MD5A 3SBTA 1Q7YO 2XC7A 1SD6A 4XKBA 5AFUH 4A61A 2NNYA 2YV0X 3O9TA 4HV6A 4RW8A 2O88A 4WXCA 4BGAA 2M9HA 2M34A 2VCPA 1R4NB 1MWMA 4R79A 2EFPA 3LA2A 3UA7A 3CCJA 2KFNA 2HDCA 5CCAA 2JWKA 1K73R 3KYDB 4BG9A 4BY9C 5D6EA 1U49A 2XY8A 1WLPB 1YJ9Q 4DBHA 3N4PA 5CQXA 2E1NA 3H5AA 3INZA 4KH6A 4BUGA 4C0DC 4BI8B 1IH7A 1QKWA 1WFWA 1VSKA 2IVWA 3ZSRA 5HKCA 4LFCK 3H6EA 1MBFA 1MUYA 3HP6A 2QYZA 3CCJQ 2E5LK 9ATCB 1FYMA 4LK0F 3CCRN 3M56A 3CP8A 3LAPA 1RDWX 2PBDA 1D5VA 2LRDA 1RDCA 3LSTA 3LQQA 4DTXA 4CEFA 3M53A 4I02A 3NMZC 3E1SA 2MD0A 2ITMA 2IS2A 4M3GA 3M0SA 4ILJA 4EW4A 4MFEA 1NJIU 4OGCA 1LCUA 3OYMA 1K4US 1XC9A 2XV4S 2VQGA 2MPXC 3CM5A 2DDBA 3EPZA 4KDPA 2EK5A 1SMYF 3L4IA 3VTHA 2DNUA 1YUWA 4FLUA 4HNUA 1CXUA 4UUVA 1TKXA 1YYVA 2AXTC 3TTCA 4JN4A 2FNAA 3OR1C 2KROA 2NYXA 2DMQA 4E19A 1MWKA 1IV6A 1NGBA 2E64A 1JLAA 3SLCA 4M78B 1D9DA 4IJAA 4A93J 4FJXA 2DKGA 2VGMA 4KHSA 4HSBA 1YXQA 1W7PA 5C24A 4AQYK 5AONA 1ZH5A 3H8ZA 4FW1A 4LH4A 2IS6A 4EJYA 2DMPA 5H1SQ 3HGGA 5HLTA 3JB9D 3AVFA 3SZPA 1AVZC 1ZQ3P 1NLVA 2XASA 1VQ4T 1NGNA 3OMCA 2RKHA 4DOZA 2COWA 2G8KA 4KN7X 4W97A 1XSDA 3RVCA 3H3OB 1QTMA 1XS9A 3QO3A 1E4GT 2MC3A 2OF7A 4BU2A 4XU0A 3M8FA 3FXJA 3HSBA 4FU6A 2GIVA 5CKEA 3KP5A 3OH9A 3CXCS 2R5ZA 5J1YA 2LKSA 1WX6A 2NUTB 2HHWA 4FT4A 1X1CA 2PG4A 2XF5A 1KIKA 4PCQA 3OYFA 4LFUA 2QASA 3H9QA 3IUOA 2FO0A 4KI4A 2OTLA 2R7YA 3QYBA 3L1PA 1B3QA 3LL3A 1MU2A 4C8QG 3K0LA 2E4HA 4CCNA 3VS1A 3A98A 2DFUA 2E88A 2DVJA 2GWRA 1TP4A 2NVTJ 3ZQCA 1PRLC 5LEKA 4CW7B 1F21A 4CIFA 2RHUA 3CPWP 4IX7A 1M30A 4A4GA 5L3DA 1KU9A 3G6EA 1VRTA 5F2RA 2R0QC 5KYUB 1REPC 2DTZA 2JJ9A 1R1UA 1ERDA 2BH1A 1FY7A 2JPCA 3QOEA 2IBDA 1ENHA 1BI3A 3I3LA 4FM2A 2GBYA 4FK0A 3OS0A 1DJ7B 5GAN5 1PKTA 3DPUA 4W1UA 2RO0A 2RN8A 3VS5A 1RT2A 4RB2C 3OBWA 5KCOA 3VN5A 1AHDP 3MHXA 1RCHA 2OD5A 4GKJK 4XN3A 1VQPQ 2PEXA 4Y13A 1ZARA 1EJ9A 3L3VA 4BRPA 4DSIA 4BREA 1H88C 3TSQA 3SJMA 2CGPA 1NGFA 2QA4N 4XMYA 3UF4A 1RI7A 4BI4A 4HZFA 1H9TA 1BC8C 2QGFB 1CQTA 1VQPA 4AYBA 3HP9A 1JBMA 2E4LA 1KVCA 2RNJA 4LDUA 3HVRA 3ER0A 1Y57A 4KTZA 1Z67A 2QGGA 3VKIA 2BZXA 3CFOA 2HHTA 1YLFA 2JJ7A 3ULDA 1BDGA 2JTMA 1KD1O 2OCCH 2VWFA 4XK8E 4JKCA 6AT1B 4M71A 3S17J 3LLRA 2DEQA 2E19A 3V1RA 3SBGA 4HVVA 1UGPB 1GXPA 1FTTA 2K9NA 2KDSA 3FJPA 4EMGA 2JA2A 1X19A 1K7AA 5EF6A 1Z21A 2DVEA 1G5VA 5LJVA 5LJWA 1W70A 1TQIA 1TZLA 3BPVA 1WFXA 3M5AA 3QUIA 3WXIA 1REVA 3L4QA 4FVMA 1T0HA 1WHGA 2IAJA 2QM3A 3K1PA 2UUBK 4AVPA 5I11A 5M5YJ 1ZAOA 1SF9A 5D8KB 4MQ3A 1UWBA 2E2JJ 3ZSWA 3S1RJ 2QKLB 4KITB 3P39A 4BRHA 3LZIA 3MK6A 2OTLQ 4DBFA 1Z77A 4M7DD 3IDHA 3PO4A 1UGVA 1HUXA 1E7OA 4EMHA 2K02A 2K9MA 4DGWB 4CEEA 1H3HA 2YCHA 1UEBA 1WQ2A 3VYTB 2Z33A 1NBWA 2XGXA 1DDNA 2Q0RA 4FW2A 3RKYA 1D3YA 4M7AG 3G0QA 1JT6A 4BHPA 3N5NX 4PJMA 4L59A 2YHBA 3ZQHA 4C8QF 4H0TB 5BPMA 4JHDB 1HLUA 4R56A 4CC7A 4N4GA 1YRNB 2CQKA 2E6ZA 1WJCA 2AK5A 4LF7K 2YX6A 3MZ8A 4NZGA 1WSEA 4B1ZA 2A1RA 3HHGA 5C12A 3K57A 3QWXX 1PWTA 4KUMA 2A36A 5M1PA 3EHRA 3ZMTA 4M75C 2RJFA 3AVBA 3RMBA 3M9AA 2HI3A 4M75G 3TANA 5M1OA 1S5JA 4JLHA 4HHTA 4BG8A 1RT6A 1NJWA 4C92A 4OAYA 3CCSI 2L01A 3T1HK 1IRFA 2QLZA 1NMDA 2CZ0B 1K79A 1Y71A 3CWUA 1FYKA 3BW1A 2W6KA 1N5YA 3VYHB 2EV0A 4DK9A 4AFZC 2M16A 1MGQA 1IGQA 1V29B 3AO4A 2WV0A 4NXMK 1TGOA 2L5QA 3VQBA 5CYMA 3SYZA 2EFOA 1XUPO 1XC5A 1X3ZB 2H09A 1FP2A 4KBMB 1VQPN 2NRXA 3A2FA 1QE1A 2RB6A 4DBRA 5J2QA 1L3VA 2YU9J 1XTDA 5KAFC 3QNNA 1N77A 3ZN1A 3DEWA 4CF1A 4JEPA 4CZCA 4OO1J 3JRIA 3VEVA 2MF2A 1T03A 3WEEA 3K6GA 3T1YK 1D1AA 4CERA 3JCMP 2VI6A 3VS7A 2OCEA 2E3IA 3QXEB 3T7ZA 1VSHA 5LJ3e 2V6CA 1XMOK 3QZ9B 4JI7K 2YU3A 4JJNK 3DLLF 1MMAA 3ZQQA 1U8BA 4ILGB 3SNNA 4D5FA 3FZHA 1M2VA 4A6EA 5GMKj 4GV6A 3I9QA 3HYIA 2DL4A 4JHDA 1KQSM 2M1BA 5D4SA 1XOVA 2BY0A 4RTVA 3X28B 3OYIA 4WE1A 2UUCK 2M0YA 3KP3A 3GUDA 2BZ8A 5KRTA 4DV4K 3M1FA 3FXMA 2HMPA 5FU6C 4IOCF 1UAXA 2B86A 1SUQA 2YPRA 3JSPA 1K78A 1IGNA 1Z91A 2V8KA 2QWLA 1M3BA 1O1WA 3S3NA 1B9NA 1I6XA 2J05A 5KYWA 2FSKA 4G7HF 1C0GA 4RLFA 3DKMA 5AQVA 3BR2A 5GAN3 4JI0K 1ETKA 1UGQB 2NOGA 2W1OA 2D0BA 4EW0A 2XAQA 2CQQA 4H5TA 4L9VA 2XPVA 5IPAA 1PUFA 2AKLA 1QVGP 4OF1A 4ELVA 2DILA 3LSGA 2VJJA 2YHYA 3LWIA 1T44A 4FWLA 4OKEA 3SB2A 1BI4A 1PSFA 3BY5A 3IKMA 2MK5A 2XAJA 4EP4A 2LTPA 1FTZA 2QDYB 4QVDA 2KY9A 4JK8A 2EAYA 4IHSA 4GMJB 5HNFA 2P9NA 4IFYA 4B1VA 5FLXK 5B8HA 4A3GJ 4UNOA 2V8JA 3K0SA 4JS5A 4L5GA 2OPSA 2XHBA 2ROLA 2V1DA 2K79A 5BREA 2IT0A 5HNHA 1N39A 5J2PA 1W4SA 4LDXA 3S2HJ 1ETOA 4M77A 5DMRA 3MXMA 4G6TB 5AQKA 4BRDA 3RWUA 2G8HA 3GZ5A 2LYCA 3WXJA 3TP3A 3TU5A 3LDSA 3GVAA 1N3AA 1QZ5A 2E8AA 2KZZA 2KBTA 2FZGB 3JRFA 3QFPA 4WK8F 2CFXA 1W1WE 4BWJA 4M7XA 1NJIC 2JOYA 3TWHA 4JI4K 1BOAA 1WJ5A 2PX9A 1LW0A 2KQ2A 5IOYA 3SI6A 1IN4A 3P83D 4NB5A 3AKZA 2XPUA 4E2FB 5KHDA 3UWNA 4XOTA 2YJEA 4A69C 4JYAK 3KLFA 3CC7A 1JXSA 1HYOA 4IOAF 1Q8IA 3H0DA 4ESJA 2LY9A 2XKPA 1VQ4I 5TKWA 3ZSYA 3MCPA 4IBNA 1W36C 3QB0A 1HKGA 5A2QE 3Q0UA 3FISA 2K9SA 2BY2A 3BPXA 4HUEA 1FEXA 2NUBA 3QHSA 4DYRA 2DODA 3C18A 5LLQA 2NUPB 3WTXC 3MX2A 3ULEA 4C3HJ 2KZVA 2P5GA 4DOWA 2LJ1A 1BHLA 1IBMK 2ZJPL 4KTQA 3GWZA 1K6OA 2VYTA 5GAN7 1NM1A 4E0DA 2D0PA 5BMZA 2JVGA 3L2QA 1IO2A 3EHQA 3MN5A 4F7UG 2GA2A 2MG4A 1YWPA 1ATRA 2J7IA 2NOHA 1LAWA 2F9WA 2WSCE 2KLOA 3AAQA 2L9VA 3LP1A 2UXCK 1A35A 5LHGA 4KGXB 3OYHA 3JAMO 1A5XA 3RYRA 3ECHA 2NRZA 4MFBA 5LJ3h 1OH7A 3F8NA 2FUG2 4QSHA 3ZT2A 4B3RK 4P55A 3I8DA 3HM9A 3FZLA 1UB9A 2NOIA 4M6YA 4ZTJA 3FR0A 2CV2A 3E5XA 4I9QA 4E7SA 3CMYA 1QQOA 2DCEA 5L3EA 1O3TA 4DNCA 1W7PB 3VQ8A 3N05A 2ADUA 3ZN0A 2O7OA 1VQ8T 2EGAA 3W6JB 3KZZA 1GOBA 1J2XA 2O61A 3AO1A 3E97A 3CWSA 4H5VA 1V4RA 1ORPA 3G25A 2UXDK 3WTSC 2LX9A 2M02A 1HYVA 4CEBA 1Z1DA 1NYGA 4ETSA 4LF4K 3TREA 2CW0F 1VQNT 4O8UA 4KHQA 1BG3A 5FLMJ 2AQEA 1WUAA 1IREB 2QXLA 3VTIA 3MEDA 2RM4A 2GX9A 1ACMB 2QQ8A 1KFZA 2OPTA 2LD5A 4CHOA 1KONA 1HPZA 1J09A 1H0MA 2F4VK 3IFRA 1S6PA 1OQYA 3C6AA 1QMCA 5GAMj 4RMOA 2O8CB 4M3DA 4PJ0C 3CC2A 3JREA 2VVKA 4ID1A 4CHPA 2M87A 4HUGA 1JCFA 1QZZA 4BE0A 6PAXA 4IRHA 1WJDA 2IA1A 2NS8A 5LGUA 4BRMA 2RREA 1VQKI 3A5NC 5IP7J 3LSRA 1A5WA 4MNUA 5EXWA 1JKOC 4A2AA 4UVCA 3IHUA 4OB2B 4MQ9F 1QQCA 5GPAA 2ZPIB 4LLGF 3M3ZA 1YVUA 3JV3A 2AKKA 1M2OA 2E6NA 4EPCA 2MI6A 2R5YB 3WXLA 2DJQA 4UC4A 3AG1H 4WQ5C 1XGMA 1HSTA 2PYJA 2IG0A 2MGQA 3EAEA 3F70A 2JXBA 1MD0A 1R0AA 1RBRA 3DQVC 4IFVA 1RETA 3GXOA 1SS6A 5DDGA 3HBLA 2QVOA 3CCVQ 3EG2A 2Z16A 3JCMc 2LT1A 3BJAA 1Y0MA 1IHVA 1X9JA 3JB9J 1VHXA 1SKUB 3GF2A 1JXEA 2W82A 2ZGYA 3L6QA 3KK2A 1TK5A 1JJ2S 1I07A 4KAZA 4BEHB 1YX5A 1JJ6C 4J19A 4BVOA 4GCVA 2I7PA 5GINA 3ROUA 1BK2A 3EKUA 4KHYA 1RI0A 4ESRA 3I56I 5D4RA 2QEXT 3DB3A 3RMCA 1GOAA 4OLBA 5JS1A 3I54A 5KYYB 3O6WA 2YUNA 4DSKA 3ZMVA 4ZYHA 4C1NK 1L3SA 2VGNA 1MDUB 2ZGZA 1LFPA 3NTIA 3ERMA 1KAXA 4QIWN 3PNTA 3K4MA 3A0HC 3BTJA 4II3A 2IJLA 2W42A 1CZ9A 2P1JA 4HCZA 3B6CA 1LUJB 3R6NA 3VGLA 4QCLA 2HPMA 5L3CA 2P81A 2OFIA 3K9KA 1YJ9T 4F2SA 3BROA 1WNSA 3BZ6A 1NPPA 4JP0A 1KQSA 2EFQA 3MD2A 5ICCA 2YUSA 1LCKA 4BC5A 1YAGA 3I4NJ 4KUDK 4A4FA 5DYMA 2IW5A 4FCYA 1WSHA 3CF2A 3SXYA 1EF4A 3AA3A 3PV8A 4Z94A 2O8FA 1IO6A 1QGPA 3CCEI 3TCJA 4D5CA 4X1VA 2V26A 3TSUA 1CZBA 3NNQA 4KFCA 4CHZA 3I33A 4HAMA 5FU7B 1AEYA 3ATUA 4A6DA 2PFBA 4XICA 1NGDA 2EZKA 4OPHA 4J9BA 5ERIA 3GOXA 3QAHA 1G15A 2STWA 4WFAL 4Y3OA 1J9AA 2DTUA 1C0MA 3L7WA 1YJNT 3MAQA 2IDOA 2ZE2A 4ZGJB 1FIAA 1K8KA 1TV6A 3I56Q 4II1A 4BXFA 2E2NA 2O03A 2DFEA 3E6DA 4CHUA 1VQPT 2CSOA 2JW4A 3DLMA 4M7AA 1RL2A 1WXUA 5DV5A 2NS0A 2YNHA 1AWXA 3CG7A 1MDMB 4CC3A 4IG3A 2VC1A 4DV6K 1LB2A 4IZ9A 1UUEA 1MUNA 3LX7A 3K5OA 2ZAEA 3K4CA 3RNJA 5HY6A 2G8FA 4XRMA 1SANA 4MEYF 3B8AX 3HB9A 1Z3YA 3N4MA 3QPLA 3OS1A 5GADJ 4XU1A 4GLMA 1PU8A 3G3ZA 1RAEB 1RTHA 3GTPJ 1IKWA 2XI9A 5ADXH 1ABQA 1S29A 1OX8A 2E3HA 5JLWA 2CSQA 5F04A 1TTHB 4BC4A 2GUIA 5GAN8 3C12A 3QJYA 2FMLA 5TRDA 3FKJA 1UJ0A 5AJ3K 3CFRA 1W5CC 3G6EI 4O4GA 3U8XA 5CIUA 3I0SA 3CC4I 1L0OC 2BY3A 1WNLA 4ME7A 1V1CA 3DPLC 2J06A 4ZDLA 1R8OB 4ELYC 4E4HA 3SZTA 4F7ZA 5JS2A 1ASUA 4JK7A 3CJTB 5BPLA 2XB0X 1UJYA 1WQWA 3GTKJ 2DYSH 2YG9A 3J7ZO 1HRHA 5CVVA 2C06A 2DXCA 1WI7A 3M57A 4FQGA 2EV6A 3SD4A 3VYGA 3O9SA 4MTDA 2XKOC 1BB9A 2VWJA 4LDVA 1K8AC 4XKWA 4NCBA 2QKMB 3L2ZA 3QODA 4M75D 3F6OA 2CG4A 3QP6A 4AI5A 1DU6A 3GEZA 2LLKA 1A0NB 1VSDA 2QBYB 4M9SA 1W4MA 2DL7A 5IYBJ 3FHGA 1D5YA 3M9QA 3WTTC 2EA4A 3QJ6A 4YOUA 1XDUA 2XGEA 3KX2A 4C2TA 4IHXA 1RABB 1IRGA 3CP2A 5LJ5e 3G71T 3D0PA 2KRHA 1NK6A 1YFNA 2CQXA 3PLAA 5IXBA 3SJJA 3QBWA 1OPCA 1CKAA 2ZJRL 4QQGA 5FRNA 2MYSA 3RZDJ 4RM3A 4XM3A 5ADXA 1HLVA 2COZA 4C1NI 2VUMJ 1FOXA 4GXOA 3NPFA 3HJFA 4LITA 3MQ0A 3BWGA 4D1QA 4AM6A 3CLQA 1WSGA 3V81A 3AA4A 2Z1IA 2KFZA 1BIAA 2UXBK 1GUUA 3IAYA 4PLIA 5F1XA 2HBWA 4M7DG 1QVGS 2JM8A 2KT8A 4DR3K 1UHSA 2RDPA 1DU0A 2HCKA 4OB3B 1YNZA 2K57A 3RRHA 2BUPA 4ENMA 1S7AA 4PKIA 1JL2A 2I8DA 3PSIA 5I42A 4DR6K 2ZF5O 3OJSA 5FPEA 4DSJA 3KYLA 3JCMe 3AA5X 1P9QC 3C7JA 3KE2A 4DV3K 3HZ6A 1ORNA 3OSVA 2RF2A 4CE9A 1B8IB 3R0AA 2W41A 2L02A 3KHYA 4AHVA 3MN9A 2CWEA 3KBGA 2HQEA 1T08B 2ZNYA 1BJAA 5HRPA 1KQ9A 1BI2A 2JTFA 1UHWA 4QW2A 2KXDA 1A04A 4CHYA 3QIPA 3ZOBA 1JKPC 2DM1A 1JI8A 5F08A 1QSSA 1OPLA 4C23A 1FBUA 1C1BA 1EQYA 4YY3K 1P4XA 3CCJT 5IT9K 1M1KC 5TJJA 2A42A 3LNQA 1RESA 5ICEA 5GMKl 1FMWA 3F5TA 1LMZA 1I3QJ 1D1CA 4Y7NJ 5FKOA 2V8IA 2HOSA 1E6HA 1CLQA 4BACA 3VERA 4FJIA 3W6VA 3OOUA 1RIOH 5KVRA 5DCMB 4LLNA 2NOLA 4CFCA 2XPWA 2L9SA 2QM1A 4G9ZA 3L2WA 3HOYJ 3OVNA 4RAYA 2Y48A 2YR2A 1N6QA 1JXBA 2RQWA 5FPNA 2Y1IA 2PLYA 3ZX0A 3CC4A 3MX5A 1LFUP 2DDAA 1CXQA 4ZDOA 3HGYA 1ZG5A 3CCQN 1T8EA 4JI1K 3ENBA 1W1FA 4YIIA 2PU9B 2BEOA 4JI6K 1DGWY 1M2VB 2A3LA 1J5EK 2Y31A 3W3DA 5AQRA 3M8SA 4MDXA 5J3LA 1OCPA 4H03B 3V4IA 1TUGB 4RTYA 3WVEB 4B4CA 4M7AE 4G9YA 2FYKA 4HCBA 3URGA 4N0AA 1Y1VJ 1XSVA 5J47A 1WAFA 1SL1A 4M78D 1KO9A 4OX9K 3VQ6A 3ME9A 1LWFA 5CO7A 2FBVA 1RRSA 2QDLA 1XJWB 4LIUA 2YUOA 4FE7A 1TK8A 1JL1A 3KXTA 2ZPEB 1BI1A 1TAQA 2W6LA 4FM0A 1TKZA 1B1BA 3GFJA 3BZCA 1T3LA 5FKMA 1YI2N 3SUOA 1P4WA 1TWGJ 4KREA 1WHJA 5HP1A 4QLCU 3RERA 4F9OA 2W24A 3EL2A 1HW2A 2BGGA 3M07A 1M90O 4YFXF 1B72A 3V4GA 4LXCA 2GQQA 2PZSA 3QEVA 4Z4CA 2HDAA 1IZ1A 4B48A 3BZKA 3CJ9A 1XGOA 4H0EA 4H5NA 5TISC 5GAHP 2ZCFB 5CLSA 4NB4A 3C7NB 3ZQFA 5KN9A 2B5JA 5DCFA 5E3MA 4B1XB 4HF0A 2V52B 4FE4A 4DR7K 4FIBA 1QVUA 2VWBA 5DTDA 1RZ4A 2R7WA 2OTLN 3Q1JA 1XHZA 1B9MA 1WHKA 1YIJT 1YIJQ 4CI6A 3WTWC 4OU0A 4M3UA 3H92A 3ENOA 5GPCA 4Y52J 3CJAA 1BQNA 5AQHA 2FD5A 3E9OA 1SVMA 4GLKA 4DQ8A 2CT4A 2WSEE 1LEBA 5J1RA 4QS7A 3T8RA 2QG9B 1RADB 2TCTA 4LK1F 1R6RA 4NC6A 3RSEB 1P92A 4EZ9A 1ZBIA 1NK3P 1VQ7I 4DSFA 2ECCA 2B0LA 1MBKA 2CV0A 1RUWA 2LRQA 1B07A 2KJBA 1ZUKA 3U9ZA 1VFCA 1HR0K 3I5SA 2I7NA 2PAVA 1U8RA 4WFBL 3PX0A 4JRIA 2FF3B 1ITYA 2ZJPF 4EM2A 2ZSHB 2KE9A 3FGUA 1YITA 1ULYA 3CBMA 3EG9A 3E7LA 2P0WA 1YITT 1QCNA 1QVGA 1VQLT 5KPTA 3SDGA 4A62A 4X1EA 1VQ8A 3TSWA 5HS8A 3CF5L 1OZ2A 3H46O 2ZSIB 3BTCA 2L9RA 5AQYA 1ZYRF 1U5SA 2HMIA 2LVMA 1ONVA 2WA0A 1U5TC 3H9GA 1QZYA 2FBHA 4O55A 1WHLA 1YCYA 2QK9A 3AVIA 3I8BA 2JK3A 1WAJA 3RIRA 2DPUA 4DTUA 4Y15A 4BRLA 2QSHX 1KG5A 2CP0A 4J6YA 4HRIA 4BGDA 1DLOA 4W5OA 4IJNA 2ZXWH 1ZBXA 4EEFG 2OUMA 5GAOq 4XBFA 1HX1A 2LJ0A 1FN7A 2HHVA 3D7SB 4B9NA 3QNOA 4I01A 2E1MB 4AWXB 2F4MB 1BA5A 4OWRB 3FM5A 3P9CA 4BJ6C 3PIOA 3OYCA 1SAXA 4HEA2 1RC9A 2JG6A 2LG4A 1WB9A 4D9JA 3CMEI 4M78G 3EZ5A 3AGKA 3WTVC 3EYYA 2BE7D 2HGCA 1Y8QB 1WSUA 2XY5A 3T1BA 4II2A 4HVUA 4IO9F 3GTGJ 3FIFA 4C92F 2DBBA 3T1AA 2CSIA 3J80E 1V5GA 3GZ6A 3VWBA 1U3OA 3EG3A 3JCMX 2D4WA 3KLNA 2ZXIA 1B4AA 1ZHFA 2VXZA 2GNCA 3R2XC 4UB8C 5F0XA 3V9ZA 1HW1A 4XLCA 2LF8A 2SRCA 2E34A 3HK2A 3CC7T 2NUPA 2FRWA 1OOTA 1JHHA 3WHCA 1EWQA 3S1QJ 3BG7A 2A41A 1VK0A 2VXEA 3LDLA 2YI1A 5HDGA 1K8KB 2DD4A 1BWFO 3HRTA 5LMUK 3PNYA 3JRGA 1DT9A 1VQMI 3V8LA 3UNGC 3JB9F 3CDIA 2C6YA 4AILC 2X4YA 4WYBA 3JCMg 2K4JA 3F72A 4YDUC 1WGXA 5I21A 3DWLE 5AQQA 1VQ9I 1J7KA 2GOMA 5IT9O 1Z05A 2JTVA 4EFHA 4PQUA 4XLNF 4CYCA 3CCVT 4CIEA 3KP7A 1AWWA 5LGTA 4EGYA 1W2BS 2CV1A 1F9NA 4GBQA 4F91B 2K3PA 1TQMA 3O3HA 5BNGA 2NUTA 1ON1A 3V1OA 5K1YA 3F3XA 1PU6A 3OYEA 1SD5A 3CCQI 3KK3A 3FXLA 1GDTA 3C0CA 1YCSB 3HT3A 2KI7A 2DETA 1QZ6A 5CYVA 2EH3A 4C0GA 1S8NA 1V4SA 4KA4A 3W0LA 2YJFA 1ESVA 5CY4A 2VKNA 3CYMA 2FZCB 3OMGA 3J7YP 2P84A 5AQGA 3HPWA 4CI0C 1KZHA 3I59B 3VRYA 2EGEA 3TAMA 3FRNA 3CCEQ 2M45A 3E5UA 3AVCA 2IGKA 3CCMA 2EYWA 2AS5F 2KK4A 1JB0E 2MH9A 5LBQA 4KN4X 4OKKA 1H9GA 1LW2A 2RJCA 4KT5C 4E47A 4YPHA 2QF7A 5FROA 1ZBUA 1H1VA 3SQ2A 3VQEA 4TSXA 3O8MA 5DS9A 4J7IA 1P7MA 2DW4A 3KK7A 3CCMQ 3FE1A 1MMNA 3LP2A 4HSTA 3J81Z 5LGNA 1MBJA 5ICFA 1RT7A 1GLJO 4D8DA 2X51A 3AG4H 2ZPGB 1MKMA 1WOQA 3FXQA 1OCOH 3P4IA 2A6AA 2L7KA 1FPQA 4L9NA 3OSFA 5IT9E 2Q1NA 3EUHA 2VT2A 3S3OA 2KRMA 2LK2A 1IZ6A 1VQ5N 4CBXA 4F17A 1QNTA 5B66C 4FWKA 1M1EB 3RI4A 4OIPF 1WA7A 1WGSA 2OFKA 1DTTA 2RHXA 4YNQA 4EQQA 4KGZB 2E1MC 4MO5A 2OPQA 2M0CA 2STTA 3JCMh 4HCKA 3WGGA 1ZRCA 5GANg 1WJRA 2ZMEA 4FJJA 2FE3A 4ISEA 1JRIA 3O80A 1N36K 2F5VA 1UELB 3BY7A 1GBRA 1OFCX 1SVOA 4J00A 2RE2A 3V7SA 3T9NA 4A3CJ 2MCNA 2O4XB 4RTXA 3RJPA 1VQ6T 2KMUA 2CW8A 3GIBA 3C2BA 2BE5F 1ON2A 3DLAA 3O4NA 4C0ZA 1KD1U 1PC0A 2HNZA 1NGCA 2HMAA 1NG9A 3DLLL 4E70A 3AG2H 3Q0VA 2XSJC 3CCQQ 3M4OJ 5KI6A 5KH6A 1JKQC 4C0FA 1BU1A 4B3OA 3RMQA 5F27A 4JAXA 1ETVA 1NK7A 3KKSA 4CZIA 4B3SK 4DMNA 2FF6A 5FO5A 2O01E 4CDGA 4IRGA 4E9FA 3VF6A 3VUBA 3OYGA 3GX4X 1Y6IA 2KIUA 3EKSA 2HVQA 3LA7A 3LM2A 4MZMA 4XTZA 3HJEA 2L8DA 3ID6A 5MLCQ 2NRHA 1P8ZA 1N3CA 4A3FJ 3GCMA 3G4ST 4JKEA 3RSNA 3D0SA 4PFOA 1FBSA 2X4HA 2KR3A 4AHTA 1PHTA 2D0AA 2LNVA 3NGPA 1O7FA 3C95A 4YEJA 3J80O 1WEGA 1N33K 1RRJA 5T7BA 3S1MJ 2BW3A 1TQPA 5E26A 2HW3A 1TUUA 1TWAJ 4M7DA 5CKFA 3LL7A 5GAN4 3MKYB 4XRFA 1ZUUA 1O9SA 4TV7A 3P9KA 2E6LA 2K3BA 2L9NA 5K14A 1JKRC 5DM6F 2NYSA 1U4BA 4BQNA 4P5OA 4EM0B 3M8PA 1A5JA 2AHJB 2O8BB 1I3AA 2YNIA 3NCIA 4M7AF 4PJLA 1E3PA 4B8XA 2CP6A 2ENMA 1OLTA 2G6FX 4MLEA 1U2VA 3MMYB 5FB2A 5D3GA 3H9NA 1Z6TA 1QZEA 2MAMA 4L6V5 2PI0A 2K85A 2YUQA 4BI3A 3PSFA 3O3GA 3F0CA 1K0XA 1AWOA 4DTJA 4C0DB 3CCMI 4ZYAA 2GTOA 3VSLA 4UVAA 2HOTA 2GAUA 5K7HA 3ZCOA 4JI3K 2V1XA 1XGNA 1M90C 3D4VA 3EGDA 3A03A 3THVA 1S1NA 1P2FA 1H641 3CCUN 2H6BA 4XIDA 5AZIB 1PM3A 2GXBA 5B3SH 2KZGA 3D5SC 3CJ7A 4L18B 2R7VA 2KVQG 4M73A 1FOYA 2Y4XA 4FVUA 4P1WA 4FWOA 3HSRA 1R5ID 4DTMA 1VQ8N 3L2VA 1XPXA 4PZJA 2YWWA 3O9RA 3DEUA 2FMYA 1BC7C 4F2RA 1YI2T 3HSCA 2XVCA 1KTQA 4ILHA 3WNHA 2LT4A 4E89A 3CMMA 4RGXA 2CH0A 2O31A 2L2PA 4BR0A 1YHQN 2A7YA 5ICGA 4EGZA 1QP3A 4LN2A 2R7ZJ 4OMZA 3H1CA 1NOZA 5SWMA 1L3TA 1HJDA 4DQIA 4G6QA 1W9HA 3ZGKA 1VQMA 3EFOA 3M59A 2E5KA 3MZYA 3P8BB 4GW6A 4IKFA 1M3CA 4M75F 3WU1B 2OAWA 4CD1A 4YIRX 1Q7YR 4JYKA 1QVFP 4PJOC 5KTQA 2D1VA 3F8CA 3VQ7A 2ZD1A 3J7AY 4E9HA 5DLOA 2BTTA 3OYDA 4BDZA 5C44J 1UG0A 2V9VA 3CMAA 3PFSA 2HTJA 2JQ7A 5L8RE 3AG3H 5HODA 4PWDA 1DGKN 3W2VA 4CF9A 4RAFA 1JLGA 4ISFA 1MJBA 4ANJA 4M7DE 2YLBA 3I0WA 2D0OA 2GA1A 1K76A 5AZIA 3GFIA 4WQ4C 4FJGA 4WXHA 4E7KA 1KGSA 2LTOA 1SMTA 3COAC 3A2KA 5DPKA 5CKDA 1T05A 2PBIA 1RKTA 3CQ8A 4X66K 3KP2A 1WJAA 1BQMA 3V6DA 4ZGDB 3K2AA 4IEIA 4CJFA 2CS7A 1ZN2A 3C4SA 4AHRA 3L2CA 2P9NB 1YIJN 3BGRA 3OOPA 4NS5A 2P9LB 4U0VA 3TTDA 4A2UA 2PMZA 2RQPA 1XHXA 2GOXB 3BJOA 1UGSB 2ZCWA 1MBEA 2BVMA 4XOPA 4CUGA 3H08A 1TKDA 4KHWA 2RAEA 4UXNA 5LFAA 3CUQB 4B23A 1CKBA 1ZBJA 3MN7A 1F36A 4OFAA 4VUBA 3SWNB 2CU7A 5KNLA 1KAYA 3DLGA 1YHQI 1C0UA 3WGIA 2DFHA 4FHTA 2VG6A 2DFFA 2CH4A 3ZT1A 5D8LB 2H56A 1QWEA 3A1PA 3OYBA 3A8GB 1QPMA 2HKNA 3JCMf 3DAWA 2V1RA 3GG4A 1YJNA 4A0XA 2GQVA 5GTIC 5M5WJ 2NVQJ 2F5FA 4RTTA 3CIPA 3EGDB 2A05A 2VJIA 1NJZA 3OV8A 1HNIA 2V9PA 5DD4A 3HTRA 2LDUA 1F5TA 2MOXA 5JLXA 3NF7A 2D5RA 4I98B 4QAGA 4KMFA 1VQ5A 4HT8A 4Y1CA 1DPRA 2R7UA 1LOJA 2ASMA 3TGNA 1YS6A 3VQ9A 1AU7A 4O5FA 3THYA 2VUBA 3C6TA 2F9TA 4HV5A 4M3WA 1P59A 5BPIA 2JVHA 1JLFA 1SAUA 2YKMA 1R71A 2B8AA 3LGFA 2K5LA 4IUUA 3DEEA 4EVVA 4JLGA 2DL8A 3WHBA 2ECZA 1OPKA 5AQJA 4U87A 1E0EA 3F6VA 2DO7A 2F8SA 3OB9A 2O6GE 3NDKA 1FZPB 3RUXA 5C6SA 2NVXJ 4DZPA 5AYFA 1ZBHA 2CREA 5C25A 1TWCJ 1U04A 1XD7A 1NKCA 3FKIJ 1S1VA 3NWSA 3HTVA 1PCXA 5AQSA 2JUGA 2CYZB 2GBZA 2L3RA 3EYZA 2F8TA 1AD5A 1M90R 2R7SA 4CZLA 4DV2K 2E7WA 1VQ4N 4PKHA 3UPUA 3MEAA 2DE0X 4B9WA 2KMTA 2ASOA 3ABLH 4RG8A 3O5BA 2F48A 3MDQA 1UHFA 2W00A 1XGSA 4DTPA 4D6WA 4J7FA 1X2MA 4OMLA 2HNYA 2PJRA 2KT0A 1VIFA 3IQLA 4XTXA 4M7DF 2OZSA 4C92B 3CLOA 5AQPA 3CC7N 5GAMe 1VQON 1M8VA 2E20A 3IH3A 5ECAA 2K5CA 1FYNA 2YNGA 3JYTA 1ZG1A 4CZHA 1GLLO 5E3OA 1WHUA 4AHSA 1BO5O 4XH1A 5KRSA 2PYLA 2OYQA 5EYRA 1WZ2A 7AT1B 5CR2A 3AVJA 2HSEB 1A5VA 4RW7A 1Y56A 3QO9A 3G1MA 3I55N 4XLAA 3SYTA 4LB5A 3VYSB 2XDVA 1BU6O 2CZ7B 3HSFA 4H5WA 1Y97A 4IPAA 3QP5A 3LSPA 2E70A 1VQ6Q 2P8TA 3CCVN 2EQRA 5AQUA 3NGIA 1I27A 4FWPA 2XRNA 3ZMSA 3BG6A 5CQEA 4DFPA 2BUDA 5IOZA 1X3MA 2KYMA 1M90U 1N34K 3R60A 4C2UA 1S72I 4AYBN 1YJWN 3CCUT 3I4PA 5HVQC 3ZT4A 5M3MJ 2HBMA 5M1QA 1O3QA 1KAZA 2I5JA 3JCMb 1MH4A 3CTAA 1R0BG 1X6OA 1MJ9A 1U1SA 4CD3A 3CC2T 3V9UA 4I2OA 3E6BA 4Z89A 1E6GA 1FIPA 5LD2C 5D5WB 1ATNA 5HK0A 2WOMA 3MEWA 1LQ1A 3M4YA 3F23A 1OYIA 1RUNA 4AI4A 4A4HA 4YOTA 1ZSGA 5FPDA 3W2WA 1VYTA 1NEGA 4JBAA 4K43A 4O44A 2K4BA 2XF6A 3GLLA 2MWOA 5GAHJ 1T6SA 2HKOA 1ZTRA 3RYPA 3WNFA 3UIQA 1POGA 3QSUA 1ZREA 4B1RA 3H3UA 3OSSC 4M77E 2ZFUA 4R8HA 2D8JA 4XQ3A 3AO3A 2ETJA 5D5UB 2OTJT 3J7AF 4PIIA 4DQPA 5CJ9A 4OIOF 1GCQA 2FQ3A 3RZOJ 3SMSA 2XRLA 2Z2SB 4G12A 1X43A 4FISA 3QEWA 3A1YA 1YIOA 1CZAN 3NVMA 4PUOA 1QBJA 4PK4A 2E2OA 1U6ZA 2YSRA 3LW5E 4CH7A 3D1NI 3LH0A 3RTRA 4X9DA 5DUIA 1JO8A 1LDKB 5JFRA 1MW7A 3G1LA 4M4ZA 5JI6A 1YW7A 4BH9A 2QW9A 4M7DC 4CF8A 4MZTA 3SWNA 4CXFA 3I55I 4HPQA 3CUQA 2RKIA 4J9DA 3H0IA 1EH7A 1T33A 3VS3A 2E60A 2K6DA 4BE2A 2A6HF 2V7YA 3E9FA 1O57A 2HVRA 2VKHA 5KYUA 5BRFA 2A07F 4FPAA 3SDZA 4HBLA 2FPEA 3DTEA 1B7TA 1LVKA 1AKHA 4KYWA 4OMPA 2QCOA 3CCRT 2QEXN 2OTJA 1NGHA 1SFKA 3W2AA 1BIZA 3NGZA 2PUOB 2CUBA 3TSZA 1RBSA 3DBLB 4LD0A 4FZYA 2PVGB 2XICA 3TTFA 3RTVA 2HQ5A 4ZH4F 1UJ8A 2WC9A 1G83A 2IGNA 3PIPL 3EZWA 1QO0D 2B6AA 4N4IA 4B9XA 1NKUA 1X6BA 4FT8A 2JHJA 3LM9A 1I1JA 5LJ3j 1FKPA 2FU4A 4JUVA 4J2BA 2RHZA 2EA2A 3EUHC 3JCMd 2A69F 4FL9A 3Q3SA 4YG2F 2RK1A 4B3TK 2LNHB 4KH1B 3CCJN 3I0XA 3CBPA 3W3CA 5AR0A 1WKMA 4AF1A 1Q7YC 2L89A 1S3XA 5TKYA 3ZMDA 3AL0C 2CH4W 1BOTO 3EDPA 3V7RA 4FX4A 2R7DA 2EJGA 4IO8A 2KJCA 3MKWB 2XAGA 2IVPA 1KEAA 1HNVA 1RBTA 1X6GA 1OKRA 1T6DA 2YHTA 1TG0A 4MDWA 3P38A 1BI4B 5EJCA 2D5VA 2HXOA 3GTJJ 2KRFA 2W7NA 3ZR8X 4DS5A 1NG7A 4DKWA 4C8QB 2EKOA 3OA6A 4JRPA 1M1KO 1WSIA 4DLEA 1KG1A 1J0RA 1T0JA 4NLBA 4CGHA 2GGRA 2YRVA 1GVJA 3T3FA 4JI2K 1MNDA 2PJPA 1KQ1A 1R1VA 1NK9A 1KVBA 5KPZA 4IF4A 4ABZA 4A0ZA 5GAOr 2HF3A 2V1QA 2ZGWA 5GANd 1KQJA 2F5DA 1Z0XA 2KL4A 3BQZA 1QVFS 3OYNA 1AOYA 3TPQA 4F3OA 1WH5A 4FJNA 3BDDA 3E66A 8ATCB 1UECA 3HOZJ 1ZX6A 1XNIA 1TUYA 4CJLA 2BVLA 3QZ5B 5JVGL 3CJBA 4KICA 4QS8A 1WHHA 4BRCA 2GWKA 2WFBA 3K4JA 4D0PA 1D8YA 2R57A 2LSNA 4A3EJ 4KH0B 2V7ZA 1WYXA 4YFUA 1EKEA 4UY8O 2DT6A 2CS3A 4U0YA 1OCRH 1HNZK 1ARKA 2XAFA 4DIQA 1TL1A 1OMIA 3CJ1A 1JLBA 1VQOA 2CGJA 3I55T 4E3SA 1QSLA 3HC7A 4A0YA 1NBEB 2A37A 3LALA 1HDDC 4BDYA 3NFCA 1X4OA 2QEXQ 3J7AP 4FJLA 2EGCA 3NFAA 2K40A 5EEAA 1YI2A 3CD6I 1IHWA 1XCVA 3CC4N 2LBFB 4XLEA 2E10A 2DLPA 4N56A 2QSFX 4QTRA 1YITI 3VESA 1ETYA 1NH3A 2VE8A 3L8BA 3PVLA 4MDAA 2FL7A 1Y07A 1W0HA 1PG5B 3IC7A 2R3SA 2RNGA 4ZYEA 4BB7A 3QYGB 2EZHA 3BY6A 2NOBA 2D1HA 1GLAG 3VA0A 4CGZA 1JUSA 3HHHA 2HZTA 2LP5A 3I0TA 1S72A 1JCGA 3CCMT 1BCOA 2LZ6B 2EBPA 3DLEA 5M3FJ 1RNLA 4ON0A 2A3SA 3E9GA 2L0AA 3ZL7C 1K8AR 1OVYA 1KG3A 4DLGA 3MEGA 1SFEA 2ACJA 3SAGA 3VYRB 3WE3A 3QICA 5L23A 3CQTA 1JU5C 4M75A 3HKSA 3FFIA 5DCMA 1VOMA 2P9SA 1GBQA 3CCSA 3FZFA 1NM7A 3H41A 1LV5A 3HTUA 5K5OA 3L1AA 2VKEA 2Q2RA 1ZKGA 4CJ7A 2QSGX 5CKTA 2YXYA 4AU7A 2D45A 1FW6A 4G7ZF 1YO5C 4CZGA 1SL2A 4UUSB 2O2OA 4M3ZA 5DEQA 2ZJ2A 3AA2A 2H8RA 2AHQA 4JS4A 3TW6A 2LOOA 3OY9A 4N5SA 1I8FA 2RQTA 3CMEQ 5IHKA 4V2GA 1J5YA 3UKRB 2Q8KA 3R61A 1R1TA 3NTKA 4A3BJ 2ZMEB 4X64K 3FHFA 1W36D 2PJRB 2DQLA 1A6IA 3THWB 2W48A 3V9SA 1H89C 3CCUI 4W5TA 4CEQA 1JLEA 4M3YA 3HUGA 1J6ZA 2VXFA 4CEZA 2ZXHA 4JQFA 3CWAA 2LF7A 4EVIA 1VQ6N 4N41A 3WODF 2JWTA 1Z9CA 2VKDA 1ILYA 4ESFA 4DF4A 1IN5A 1E3HA 3ABKH 3WXMB 1WH7A 2VJ4A 5IT3A 4DTSA 5EVZA 3PNVA 4NUBA 2VLAA 1HW5A 4QVCA 1JJ2P 1ZC6A 1PUEE 4RB3C 5IYCJ 3NARA 1I39A 1M4ZA 2Y0MA 1VI0A 2LBFA 3RKXA 1QVFA 2XG8D 1IKXA 4WQ4A 3P8HA 3Q5FA 4P9UA 2QKBA 1KC8U 2ROTA 1WPKA 2BZTA 3FJ5A 2MLGA 2FSNA 4XLFA 3MP1A 1CSKA 3BC8A 3LSHA 2P4RA 3FC3A 3LDQA 1YJNN 2XIGA 4HUFA 2C0TA 4BAYA 3UATA 3SZGA 4B9UA 3HO1A 1LPLA 1TUCA 4CICA 4E1JA 2COMA 3I59A 1XCBA 1PSEA 1OJLA 3GTMJ 4Y1DA 1LE8A 5FJ8J 2VKVA 1SFOJ 1VQ4Q 2QKKA 1WEFA 5GMKm 4CJRA 4PGGA 2Z9OA 4BKXA 2OANA 2K86A 4CO8A 4AFUC 4EMKC 4DWIA 5GAMf 2RI3A 5CR4A 5E1WA 3X2QH 3HOSA 3CPFA 3LWFA 1RLPC 4M3XA 1NOYA 2QTXA 3CXCA 4Q5VA 4LFBK 3ZSZA 2EIMH 8AT1B 1L3LA 2AJQA 3E2UA 5B1BH 4CGJA 3CD6T 4LFAK 1M1KR 4HX7A 2F4OB 1TBXA 3VUZA 3F8MA 3VQAA 4YTLA 1NHAA 2VPRA 2DJNA 1TK0A 2JS0A 2E35A 1ZHIA 3EFSA 4I6MB 2WB1N 4E7LA 2BBYA 5FU7C 4DTNA 1R9TJ 3H0FA 2WB1A 5J4YA 1KSWA 2QWRA 4HOBA 4LH5A 3CCRA 3KD1E 4ELZC 3WU0A 5EGOB 1XX5A 1D8KA 1I4K1 4DBQA 4S0HB 4GO1A 1PD0A 3VODA 3ZCMA 4XTUA 1VQLQ 3MP6A 2Y4YA 3TABA 3SFMA 2XHIA 3A8MB 3K5NA 2ABKA 3QEXA 1OH8A 2BIVA 4A54A 3I56A 1RKWA 2IGIA 5FWCA 4OMFB 3HSTB 4XTWA 4M7AC 1W2BP 2X3XD 3QKJA 4B9TA 2O5RA 1NU0A 5D5VB 1NK8A 2UWMA 1VQNA 3T5XA 3IRRA 1DQUA 3ERED 3H9JA 2COYA 1GXIE 1M1KU 3CCEA 1ZELA 1M5Q1 1S9EA 5HCKA 4YFKF 3IH2A 1KG6A 3C94A 1KG7A 2Z1DA 2CGLA 1EX4A 5CAIA 3UDCA 1NZ9A 2CMPA 1VSMA 4DR2K 4NO7A 1I5LA 3LFUA 1KXPA 4J8FA 5EU7A 4IQJA 1VQ5T 4I6ZA 3KWIA 2HYGD 3LAJA 4XORA 3GP8A 2F5EA 5JLFA 4DR5K 2BKDN 2F96A 4A59A 2Y0SA 1TSFA 2Y0SN 3DKYA 5EZGA 1KC8O 1IJWC 2VPLA 1NK0A 1KQ8A 3KZIC 1K4SA 3FM3A 1GHCA 5CPRB 4C8QD 3A02A 4F16A 3LFKA 3N4QA 1AZGB 3QDRB 4H4OA 2UXNA 5A0DA 3C0BA 3SAHA 2TDXA 3G10A 1S6LA 3TAFA 4BBRJ 1VTNC 4BQQA 2HWVA 2EX3A 2L3PA 3WNGA 2E2PA 1LWWA 3BG3A 2R4GA 3WQUA 4M6XA 4HXJA 1XMQK 2QA4Q 1D09B 2M7AA 4M9XA 1IKVA 3KNTA 1SD7A 2BYVE 3BUZB 4PSXA 1K9MC 4ELUA 1YW9A 2LR8A 3O6BB 1JUMA 2XF7A 2LQWA 1C1AA 4IFEA 3O3FA 1X9WA 3K70D 2H1KA 3DPTA 1ACIA 3C1DA 4OP0A 3M5RA 1HKCA 2JWLA 3ISNC 3KZYA 4O0IA 1WJQA 4EJTA 3G4SA 3QDFA 1NMNA 3CCRI 3R6OA 4V19S 1D9FA 3DBRB 2Q0OA 3EEQA 1R7JA 4H8KA 1NYFA 3SUPA 1OZ3A 3X20B 4NL3A 1SHGA 5BN9A 2X74A 1NGIA 1NJXA 2P5VA 3F21A 1HXDA 3DP7A 1IB8A 1YN8A 4PNOA 1MNMC 3ALYA 1N8RU 3WEEB 5TGTA 1MA9B 1V55H 3U4LA 2HD0A 3GYHX 5GAGJ 1Q18A 2G8WA 3QIIA 4ZGEB 1YHQQ 2JMCA 1SRLA 1ZBLA 2OJ2A 2VC8A 2EYXA 3ABUA 2HKQB 4NNJA 3VQQA 3PQKA 1EH8A 4IQ4A 4Q0BA 3JW4A 1VQ8Q 2XUBA 5GAGP 2QYOA 4EIKA 3CCUA 4B3AA 5FFXA 4C2MJ 2DYRH 2A5WA 4A4EA 4EJWA 1ZG3A 4K41A 2HFHA 1KCFA 1W7AA 3IKTA 4Q48A 4EJOA 2XD0A 5LJ5j 3IG1A 4NLCA 2PQWA 2GXGA 1KHCA 1OKJA 1HD3A 2DU9A 2DT5A 1AZEA 2RD1A 3QINA 4A2BA 4L9JA 4P96A 3Q9VA 4ENKA 1SEUA 4MLOA 3CPEA 4M78E 4Z4IA 4BQAA 2MC4A 1GV5A 2EJFA 5JLHA 1YX3A 3REAB 3FHZA 1Q86R 3FMRA 2HQXA 1UTIA 2HVIA 1T3VA 1YIJA 3DV8A 3VEYA 3PIPF 4HTLA 4FK4A 4DUZK 5DD8A 3E0JB 2DK5A 2A61A 4UV8A 3EE8A 4OIQF 1MNEA 1Q1VA 4PLLA 1WBBA 4J6WA 4I99C 2NRRA 5JVGF 3G4SI 1MBGA 1N25A 1PP7U 1EO1A 2RJDA 2XGCA 4BR5A 5EOYA 1KU7A 2OA8A 1YQAA 4B1WB 3G6EQ 1TYQA 2FBYA 3PY8A 1Z7UA 2CT3A 1P7IA 3B02A 3PX4A 3CBOA 3REBB 4DTOA 3H5RA 3DLKA 3ZX2A 3QERA 2WONA 2W25A 3CC2N 2ESHA 3CD6A 1PNJA 1WRJA 2Q31A 4RB0A 2L4MA 3PNWC 2FPDA 3QYEA 2Y69H 5J1UA 4FYWB 1SAZA 2MLKA 3JCUC 1BR2A 2WBMA 1WDXA 1WXBA 1QSYA 3EH2A 1LNWA 2JRTA 3CCRQ 4RA2A 1KFSA 4JZ4A 4KPYA 3ZQLA 3A8LB 1W97L 2VE9A 3VV0A 2EPFA 1M1FA 1VQ7Q 4DUYK 1SEMA 3H45C 4RDUA 1X2QA 1Y0UA 1K9MR 4AC0A 2EQKA 5AQZA 1KD1R 3U1KA 3ZEHA 2UXXA 4EA4A 2W04A 1A6QA 1YHQA 2A0FB 2HHSA 2LREA 5D5XB 3QWYA 1RT3A 5AT1B 3RMAA 3KFVA 3QWLA 2J4RA 3U1DA 3LSMA 2ID6A 3DXMB 3U3GA 3U2RA 5AQMA 4BROA 4FPBA 4DHYA 5K5RA 3HDDA 5GAMd 2WAQN 2E1ZA 4X62K 4FM4B 3CMEN 4MIMA 2PZ1A 4LD6A 1FLIA 4R55A 1Q81O 4XK4A 5IN1A 5EG2A 2WACA 5GAMh 1KC8R 5CHZA 1RI9A 4JDSA 3H36A 4CHNA 2Z1JA 4Y4RA 4PL8A 5LJ5g 2KPMA 2FRHA 5J40A 3ZT0A 4CHQA 2EYQA 3R0JA 2BXYA 2VV5A 3EG1A 3C6HA 4B8AB 3F73A 3NGYA 2YHAA 4IUVA 1HKTA 5GAOp 2FBXA 2OTJN 1BR1A 4KIFA 4KKOA 4N9IA 2ATQA 2P9PA 3DXKB 2H8WA 4EV0A 2NNNA 3M3YJ 3CETA 4OFEA 2NUZA 3D2FB 1UG1A 4RMNA 3QG1A 1IBKK 2Y90A 1QCFA 4OB0B 1QVFM 1OR7A 2ZB9A 3EY1A 3MCAB 1SV5A 3OW2S 3H1QA 4CJWA 4AFSC 4UUTA 3JSMA 1TNSA 3ZQIA 2JM9A 2H1LA 3QEPA 5HS7A 3D2FA 3CUQC 2KKOA 4O8KA 5CZ2A 4B44A 5AQWA 5F0FA 1PRMC 4F04B 1SD4A 3JRCA 3BQYA 4BHCA 2KRSA 4FWRA 3OSGA 3O08A 3ZEUA 2DA5A 3VQ4A 4M77D 3CJRB 3KK1A 3BDLA 1NEBA 3J80K 2P4WA 1RR7A 2M4KA 3S3MA 2OC6A 3EGXB 2CP2A 1B6AA 5GAN2 2XY7A 1X2KA 1UFMA 1NGGA 1N9SA 1BKBA 3PVQA 1TT5B 3ZMUA 3X26B 2L54A 2PMUA 2BDPA 1GLFO 3HFNA 4WCEL 2Q2EA 3FZKA 4KMUX 4RGSA 1WCMJ 3HRMA 3LDNA 2NRVA 4YOWA 4FLWA 1SL0A 3DF8A 2QZ8A 2OV7A 2BHYA 5A2QO 2KNBB 1VQ9T 1KU3A 1E3MA 1YE9A 1VQKA 3KLOA 1SFXA 2P7VB 2JS2A 1JTYA 3I56N 2QUFA 1VQMT 2RI5A 3VF4A 2E5QA 5KCMA 2R93J 1YS7A 1G59A 5I3UA 3CESA 3EFOB 3MCZA 3EN9A 1I1SA 5JR3A 3R8EA 3G71I 3HHTB 1HBXG 2ZFWA 3BCAA 1VSEA 3BF1A 4C92D 3DXMA 4Y33A 3IKVA 5ELZA 3BF3A 2IEKA 5FLXO 2EFIA 4BE1A 2EKHA 1C0WA 5F0CA 2F5CA 1VQKQ 1XN7A 2OJED 2KHOA 3SQ4A 4JX6A 2YSQA 3JS6A 2UUZA 4M78A 1AA7A 2P0QA 3PX6A 1GFDA 5HL7L 2HYFA 3RQIA 3B6PA 4M3EA 3AY9A 1BL0A 1J5OA 4RGUA 1VQOT 1R23A 3A01A 1I6HJ 1S7OA 2BE9B 1G3SA 5DK5A 4YRVA 2E5ZA 2D9TA 1SKWA 1OYXA 4BGBA 1VQKN 1USSA 4EAHD 4LB6B 4JV5K 2WV1A 1FXXA 1QHAA 3JRZA 3O8VA 2XHCA 1EXQA 1I81A 4OVAA 3HZJA 1ETQA 3VEOA 3TAQA 1TYQB 1UHCA 4IIOA 2HL5C 1DTQA 4HNTA 1XC3A 3S1NJ 4DQSA 1VRUA 3CC4T 2H94A 1Z3XA 1JGGA 5H6RA 2DTRA 1U06A 1KG4A 3CXCP 4AHCA 3VYUB 4A53A 3LANA 2OPPA 2P5OA 4DU4A 1PUFB 1K9AA 1YT3A 1S1WA 1Y96A 2CKKA 4H0VB 5FRMA 2IA0A 4J9CA 1WLJA 1E17A 1K83J 5I2MA 3DCFA 2M51A 2HQAA 5KYWB 2E65A 2IC3A 3E3VA 1MSFC 3O4WA 4XEIA 1EFNA 1KRPA 4FJMA 2NOFA 1HQUA 1MMDA 3GBQA 2WUSA 4E7JA 3DRPA 3JSOA 4EA5A 1D0YA 1O7LA 5D6WA 4I9LA 4BXUA 3ASMA 1EBMA 1R49A 1GV2A 1W5TA 1Z9ZA 1NNEA 2P9UA 2L0KA 4MEXF 2AQFA 3MPUB 4CJSA 3LAKA 3OTOK 2K9QA 5K5QA 1KYWA 1J59A 3ZLJA 2LKPA 2VJ5A 3O5ZA 3K9TA 1MV0B 1RTIA 5D6FA 2H3GX 3L42A 1VSFA 4FM1A 4PA1A 3G71N 4K11A 4EMKB 1QVGM 4KTWA 4YHHK 1XDSA 5GJVB 2O0YA 4B08A 2K5FA 5C0YA 4GGGA 2ZO4A 4CYDA 1IG7A 4JD2A 2YUPA 3R1XA 1FP1D 4I0AA 3CWTA 1MIJA 4FLVA 4E1NA 1TC3C 2D0CA 5GANe 5CHIA 4J6XA 1YIJI 1IC8A 4A3KJ 2K9GA 1RBUA 4J5YA 2BOLA 4B1YB 2JA7J 3WT0A 1VQOI 3ABTA 1DIZA 4MHGA 1LJOA 1W7PD 1X1AA 3DKXA 5LJ5h 1IBLK 2BHZA 5FKNA 3L9FA 4J9GA 4Z4HA 2JZ2A 1I50J 2MWPA 2QI2A 2M2EA 1EP4A 1BL3A 3CQYA 1U5TA 3Q0WA 2K2MA 1KQSP 4A5MA 3DKWA 3THYB 1OYWA 3HPHA 2EWNA 3K1MA 3Q7CA 3O2PE 2OTJQ 3J81E 3SCXA 1EETA 2X3WD 2OI3A 4DFKA 4DQRA 1NPRA 1XWLA 4V19K 2JA8J 4LGWA 5J4VA 4CGFA 3SDBA 1ZSZB 1CF7A 3LP0A 4YOVA 4MQVA 5JVTA 5FWBA 3D2EA 3DFGA 3KD5E 2M3AA 1UFFA 4DV7K 3U9GA 2E2HJ 4PFPA 4RB1A 2Q36A 4O0JA 2XROA 2O8EA 1YTAA 2OU2A 4KHNA 1RDBA 3I56T 3MN2A 1IAWA 2G9WA 3A01B 4LSLA 3T0YA 1UZCA 3MMVA 5EEHA 3E19A 4AM3A 2DPPB 2W40A 1YI2Q 2XRIA 5C10A 2QEXA 3K4BA 1LWCA 4H0PA 2M7BA 1IXCA 1D8JA 4JI8K 4W5NA 3GO5A 1WN7A 4PJOA 3QETA 3CVSA 2NAZA 3KTQA 3VOEA 4WF9L 3ZBDA 3SEQA 3H0HA 2D8HA 1MH3A 4DYQA 4FLZA 4EIAA 3KEYA 3AT1B 5EC7A 4U88A 2LJ3A 2FLOA 2W0ZA 3NMUA 2IPQX 4BC2A 4WCIA 2DAQA 1QW1A 5BOXA 2JA5J 5FDLA 1QHHD 2DTIA 2Y30A 2AZVA 2KXCA 2HVSA 3CCLA 5M1KA 1YQLA 2DIQA 1RT5A 5IP9J 2KSSA 3QU3A 4BC3A 1VSIA 3IWZA 5F1JA 4B9VA 3V9XA 2DL3A 4B6MA 3K2PA 1B34B 3JXUA 1WIEA 3J81K 3WG7H 3QEIA 1ZLJA 3IRQA 2KIFA 3I35A 3SFIA 4KGVB 3HL8A 3G6EN 5C3EJ 4K8ZA 4JX5A 4C92E 3RCOA 1LFBA 3CCLQ 3GMEA 2HQNA 4ESBA 3AVMA 4GVMA 1Q86O 3ZRGA 5M5XJ 2B4JA 1VNDA 4MLHA 4XLPF 2XSDC 1MHNA 3JB9I 2OTJI 3S15J 2CQ7A 3FDYA 4RM2A 2YNFA 2IS1A 3ZQ7A 4B9MA 1RAHB 3R6MA 2MABA 1PVEA 2WAEA 3OR2C 5GMKe 1ZLMA 4AIAA 5D6XA 2L2OA 2HB5A 3VW4A 5SZTA 4LG0A 2EPDA 1T0FC 3U6FA 2R7TA 1P6RA 2XDDA 2JLEA 1ODDA 2O9SA 4Z2YA 1TL3A 3PO2J 2LKXA 1X9SA 2KDOA 4H4MA 2B7EA 3IUCA 4L3QA 1SZ2A 2A08A 3ZQGA 4H5RA 3IP4B 4I09A 4IDHA 2R5ZB 3ATVA 1X1DA 3HOWJ 1EA3A 2DT7B 4YPRA 4NHJA 1WJFA 4XLHA 2Q1ZB 2EWSA 2WWYA 4M41A 2QTDA 4LIVA 4JLIA 1VQLN 4KV8A 2RA2A 1Q82C 1S72T 1VYUA 3AHUA 2NOJB 1SKSA 3I55Q 3AARA 2AP1A 1Y0NA 4QPOA 5LL6S 4E6RA 1HJRA 3TVTA 3QPSA 5HLHA 2L3QA 5GANh 2D1XA 4LUEA 3AVGA 2O8BA 3BG9A 4JRQA 2FSJA 2LY2A 3K5MA 2F2VA 3SQ1A 3NWTA 1KFDA 5FD6A 4CGDA 1HSJA 4A5NA 4M7YA 3EG0A 2ZJQF 4A5AA 3J7ZI 2LMJA 1J53A 3FMSA 1P7JA 3GTLJ 3UT1A 2XDPA 2ICWG 3M0RA 2YRDA 4CIGA 4LLLA 3S6WA 4H0YB 2NS7A 4ZDPA 3CXCM 4DQQA 1XMAA 1TLHB 1SRMA 2E7XA 3ZSQA 1NGJA 4MDBA 1TT0A 3TEEA 3NAEA 4UY8I 3SV4A 3AAPA 2IVNA 3J80Z 4L5JA 2CUZA 1EIFA 5IY5H 4B24A 1FMKA 1IG9A 1QQNA 5K7FA 4NC7A 2R58A 1T95A 2VBXA 3C6UA 2EQMA 3GBTA 2PN6A 2G8VA 3TP0A 1TVRA 4UB6C 4XNFA 4BY6C 4DSLA 5J8FA 3V8KA 3TBIA 3AV9A 1WI3A 1K6YA 3ENHA 5E1ZB 1GCPA 2YRCA 3FSPA 3CCYA 4NDLA 2V1NA 2F5KA 3I53A 4B1UB 1X2NA 4PL6A 3X24B 5J3BA 2YS9A 1OYYA 1U2WA 3ZP5A 3F2KA 4G8XA 4KJZA 2G0EA 4C8KA 3WVDB 2O8EB 3K1NA 3K70C 4A57A 2ZMEC 3I5UA 4WX9A 3F10A 1LDJA 3FWEA 2QWMA 4UVBA 1OH6A 3B6AA 4N4NB 3TMOA 1W2BM 2K27A 1LKXA 4C8NA 1S1TA 2DO3A 3QYHB 2KQWA 3C7NA 1OEBA 3M0QA 1OCCH 2XKOA 4F92B 3VETA 2Z5UA 5F6FA 4DV5K 2PQ8A 4M6VA 3MKZA 1Y39A 3GNGA 2HS5A 4Z4GA 3PUFA 1MZBA 3ZXSA 1JXOA 4KRFA 3H35A 4KB0A 4XQFA 4FJ5A 1R4MB 2HDWA 4CZZA 4LD9K 3CCQT 3QOPA 1VQ9N 2HZDA 1AWJA 1FYLA 2LSOA 1Z9QA 4JKHA 1M3HA 4J2DA 5GJWB 4KI6A 4IEEA 1I1GA 1X9MA 2IVOA 1F4KA 4U7BA 4FLXA 4NOYA 3LDOA 3HYFA 3FXUA 4IOCL 4WTOB 2B63J 1LDDA 3TDUC 3KIOA 4JOMA 5E3LA 2EJ9A 2BY1A 4IHTA 2FOKA 4L0ZB 5FLXZ 2X6NA 3WTYC 3DRSA 1K1ZA 1R5GA 4N0AC 1IRZA 3OIQA 4PJOD 4BR2A 1K8AU 5E3NA 1ETXA 4EMKA 1BA0A 1FSEA 4JZ3A 2X78A 1QVPA 1YTUA 2HBPA 1ORKA 3GW2A 3TI0A 4GRIA 2NRWA 3OGDA 1VQ5I 4RKUE 5KK1A 1N78A 1ZGJA 2DA2A 3AO2A 1J75A 1XQOA 1Q81U 2JPSA 2CZ6B 2M0OA 2KRCA 5EG0A 2KKZA 4KH4A 2RF0A 1FK9A 3RPUA 1A31A 2K3FA 4O5VA 5KGWA 3TO6A 1TTYA 5GTHC 4QT7A 5IWAK 4CCKA 4HYEA 3DTKA 2ISZA 1MPGA 1WI9A 3OJUA 3BFMA 5CQGA 2R7OA 5HLFA 2PFUA 4RCCA 4PJOF 1Y96B 1QQJA 1MMGA 4S04A 3DLHA 3K7AJ 3JSCA 4FWMA 2NVYJ 3OWTA 4CK2A 3CMET 3ELKA 3MEUA 2FEZA 5DM7L 2EFWA 1TOVA 2E1OA 1YRNA 3JRBA 4BVPA 2OZMA 2E2QA 3KETA 3VEXA 4B8CA 2DA7A 3IMXA 1HJOA 3O1WA 5FLXE 2FBKA 1L3UA 1V76A 3HFOA 1RR8C 5GAMg 4CJVA 3RR6A 4FWQA 3GPLA 2KP6A 3OW2P 2OQRA 2LC2A 5GMKh 4FZZA 2MMPA 3O9QA 4IDKA 3EUAA 2F5TX 3VRZA 3M8JA 4JPBW 3QESA 4C3IJ 3CCUQ 4PL7A 3SAFA 3LGLA 3SEZA 4N4OB 2GBQA 4I2PA 4KBOA 2JHNA 4IURA 1IKYA 3ASNH 4NC8A 2CFOA 5CKHA 1SG5A 1ZK8A 1MUDA 2PMZN 3DWLA 2O8DB 5A0GA 3KLHA 1M1GA 2V7FA 5IT9Z 4CJ4A 1NK2P 2HKXA 4HX8A 1IN8A 3PIPA 1E4FT 3JTHA 5M1NA 3KZBA 4DF8A 1DUXC 2CP7A 3L00A 3CCJI 3PJRA 3KPHA 4NYFA 1Q82R 3D5RC 3HIFA 1NK5A 2EYYA 4ZYDA 4NCGA 3H1VX 4CCJA 5AQOA 5C42A 1VQ5Q 3D6RA 4GYGA 2QAZA 4CFBA 1U9NA 3MEXA 3VSKA 3D7EO 3HXMA 2FX0A 2DI3A 4ATOA 2IA2A 2K3XA 2FA5A 1LAVA 1KHIA 2HHXA 3VDXA 4BXXJ 1H3ZA 3MWPA 4HCCA 4OLAA 1IJJA 4FJHA 3KJVA 3IH4A 1K8AO 2X1DA 4KT0E 2P9IA 3OA9A 3V9WA 1VQMN 1HKSA 2EZIA 2DN0A 1Y7XA 4CFAA 2RPNA 3EGXA 1JLCA 5JHUA 4CGGA 1F1ZA 2OZUA 3VQPA 1BW6A 4BL0B 1BGXT 2Y2ZA 3L2RA 3CCEN 2RQRA 3N0UA 1M8MA 2FRYA 2LQ8A 2N8GA 5H2FC 2IXSA 2NOEA 3LH5A 4OAZA 1JCEA 3CMAN 1OH5A 3KWGA 1V3FA 2X6OA 1U1TA 4FOIA 2LX7A 3LYIA 3GLXA 1KVAA 1D0XA 1D0ZA 4F7UA 1HKQA 1LOTB 3LDPA 2G7HA 2DF6A 1SKRA 2DOFA 1X27A 4BDPA 4I6MA 4X0GA 5LJ3g 2HNHA 1J9IA 4ZHRA 5FU6B 2GUPA 4AIJA 1ZQ1A 4CZEA 1WEIA 5E79C 2P9PB 2VB6A 4FWNA 1OULA 2LDMA 4I0BA 4RAGA 2OX7A 2IP2A 4FLTA 1U84A 3PGGA 2DMTA 4CCOA 3CMAT 4YORA 4JJBA 1Q1HA 3J7AO 2VOPA 2EIFA 1GLDG 1Y8RB 5AIQA 3KUFA 2GM4A 1VQ6I 1AHJB 4X34A 3VU3C 2I2LA 2O8DA 4OMOA 3VPRA 1YWOA 5CVJA 1NKBA 3OYJA 1GOCA 4QKUA 2HSPA 3V7CA 4M77B 4LOCA 3R3LA 3ASKA 1IXSB 3LSKA 5BS6A 4DJAA