5FROA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz446 (compound 4f)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5froA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5froA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5froA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5froA03
4CIEA 4B3OA 4ELVA 4F2SA 3DMJA 2RPIA 4C5IA 1RT6A 2G8IA 4N4HA 4F2RA 5HRSA 1L3UA 1HNIA 2FBTA 1ZBUA 3SV3A 2HQEA 2YKNA 3C94A 1J9AA 1QTMA 1TK5A 4L59A 2D9TA 1WSIA 5IN1A 2M16A 4DTJA 3HK2A 2X6SA 3TI0A 3O4NA 1DLOA 1VRTA 3K57A 4M45A 1RCHA 3ZSQA 3TWHA 2GFUA 4FJ7A 1NJWA 1T7PA 1C6VA 5KGXA 1S1VA 4CF8A 3SV4A 3OYNA 4E0DA 3LLRA 3OYCA 4BWJA 5CZ2A 3NF6A 2RI3A 4OGEA 2EQMA 3SQ2A 1RBUA 4KHYA 3OJUA 3AV9A 3M8QA 4M3YA 5HLFA 4DU3A 1NKCA 2RJFA 1O1WA 3CM6A 4M3WA 3KKRA 4G1QA 4M3UA 3OA6A 4C8MA 4N76A 1NOYA 4FLTA 1Q8IA 3L2QA 4B9MA 4DFKA 1CXUA 4DSJA 4IURA 4CGIA 1W0HA 4LSNA 1NOZA 4E7JA 2LDMA 1KTQA 3S3OA 3EY1A 2IOCA 3QO9A 2BDPA 3AO1A 3SUOA 1HRHA 3NNQA 4FLVA 2R58A 4CEFA 1RBSA 3PO5A 3HT3A 3NHGA 3TAPA 1QSYA 4EDUA 2HHSA 1HPZA 1LWCA 4DQIA 4PY5A 1TKDA 3NCIA 4LD6A 1OI1A 1JLFA 3AO3A 3UIQA 5CYQA 2R5AA 1VRUA 4FLYA 4W5OA 2O4GA 3LP0A 2L3RA 3LX7A 4DU1A 2XDPA 4Y1DA 4OKEA 2RO0A 4MQ3A 1WAFA 4QQ6A 3V9SA 1S1XA 1X9SA 4CFBA 2EQUA 1JXBA 3NDKA 4CEAA 4CFAA 4AILC 3DRPA 3DB3A 4I2PA 2NUBA 2Q3SA 4IUVA 3AVFA 4DQPA 2HVIA 2X6NA 5JS2A 4CJPA 1S1WA 3PNWC 4IUQA 2K3XA 1RDAA 3T1AA 2OPQA 1KVBA 1G15A 3O3HA 3PUFA 4E7IA 4KRFA 1HYZA 2MWOA 1WSHA 1U49A 4Z4EA 1S6PA 2P5GA 3AVIA 3IG1A 4B9TA 4Q5VA 4FL6A 1UA0A 1B9DA 2B5JA 3OYMA 4QW2A 5KGWA 4CIGA 2E6LA 1IG9A 3VQ5A 3QLHA 2RHYA 4X34A 1HYVA 4O0JA 1JLBA 1TKXA 2QKKA 1I39A 2OPSA 1W9HA 3RMAA 4I7FA 3CM5A 1T03A 1BISA 2IS3A 3PO4A 4RG8A 1GOAA 1L5UA 1SKWA 3MP1A 5KRSA 1RBRA 3SCXA 4CHZA 4LY7A 4EZ9A 4IKFA 2CKKA 1X1PA 4O44A 3MEWA 3VQ8A 1FXXA 2KQ2A 2LCCA 4DMNA 1N6QA 1VSKA 3ZT4A 4C8KA 1G5VA 5CY4A 5M9OA 3ZEHA 2Z1GA 2G8WA 2KZZA 4C5GA 2RKIA 2XY5A 5KH6A 2LTOA 4FJXA 3PX4A 4BDZA 3U6FA 2IG0A 1F21A 4CERA 3E9FA 2YRVA 3RRHA 2FBVA 3K5NA 2LSNA 3KD1E 4CJQA 2HHTA 3NAEA 1XC9A 1NKBA 4DFMA 1T8EA 1SKRA 1BIZA 4CEDA 4FXDA 3NGYA 3G0ZA 5CIUA 2O4XA 1K6YA 4F3TA 3OQ5A 2BIVA 3DLBA 3L2VA 2HNDA 3NFAA 1LAWA 3HL8A 4O4GA 4E7LA 4CGFA 2W42A 4OVAA 4E7KA 5KI6A 2D0CA 1NK7A 1TL1A 3P83D 1VSEA 4KTZA 4CFDA 2DFEA 5J2NA 1LAVA 1FKPA 2HNYA 2A1SA 5C42A 1BIUA 4HCCA 3MXJA 3DRRA 4M41A 3QERA 4DQRA 1IH7A 3QEXA 3TAEA 4CJEA 1GOBA 4CHPA 3LH0A 4DU4A 3ZSZA 5D6WA 1YVUA 4FJHA 3OS1A 2JTFA 3SQ0A 1NK9A 1BCOA 4GMJB 4M3XA 2HNZA 3NF7A 2HW3A 4UQGA 1ZBHA 4BD3A 1Z25A 4PLIA 2P1JA 3AVAA 4CJ5A 2XY6A 1WSFA 5J2QA 3LANA 3WNHA 3C95A 3QINA 1Q9YA 4ZTFA 1WSEA 1BI4B 4KKOA 4B9XA 3LDSA 4DS4A 2Z1JA 1NK4A 4IFVA 2VYTA 2HVHA 1SL1A 2XRIA 3L2UA 5FRNA 1S5JA 3LALA 1XI1A 3QIOA 4BE1A 3A2FA 4LH5A 4DFPA 1VSDA 4N47A 2KW4A 3VQ4A 2KFZA 2XK0A 4ELUA 3P8DA 3AO4A 1ZBIA 4EP5A 3WNEA 4HCBA 3SUNA 3SPYA 4HCZA 1WJRA 4M42A 4RW9A 2DIGA 4RW8A 3KK2A 2JGUA 4Z0UA 3CEYA 5HBMA 4Y1CA 1KLNA 2PY5A 4CESA 3NH2A 1BHLA 2XY7A 4DTUA 3ISNC 5SZTA 4FLUA 2DFFA 2FC0A 3U3YA 3EZ5A 1KCFA 2MWPA 4OPJA 4QVZA 4AHSA 4A4GA 3IAYA 4NCGA 2OYQA 1RT4A 2DIQA 2BANA 1T05A 4QQDA 4CGJA 3MEVA 1RBTA 3MEDA 4Z4HA 2EKOA 2VWJA 3V1RA 3HPOA 4Z02A 4CHOA 1EETA 4H4OA 5DMRA 2LVMA 1VSFA 3TR8A 3HP6A 4DWIA 4CIFA 4DQQA 2HB5A 2EQJA 3UT1A 3HVTA 4IDKA 1XWLA 4CEBA 3M9QA 4FLXA 3NH1A 1WJQA 1D9FA 4HUEA 4NYFA 3FFIA 1IO2A 2WONA 3S3NA 2JLEA 4FLZA 3OYJA 4F8RA 2VG7A 3PFSA 2PYJA 5FROA 3V9UA 4OLBA 4KHNA 2D0BA 2RHUA 4E19A 1SL2A 5KE2A 2RHIA 1WN7A 2E6NA 1KSPA 4GW6A 3RR8A 2RJCA 1SKSA 3DLGA 3KIOA 3QETA 4B8CA 3SQ4A 1RT2A 3AA2A 4CE9A 1HJRA 2X78A 3AVKA 3MEUA 1J5OA 5IAYA 2LRQA 5C6SA 3ZT2A 3C6UA 3NF8A 3AVGA 2Z1IA 3P1GA 3K5LA 1XNIA 3D45A 5J2MA 1WLJA 4KREA 4DS5A 5HRNA 1N27A 1J53A 4FJ9A 3OYFA 4OVLA 3UWNA 3S6WA 4CK2A 3PMIA 3SUPA 2KFNA 3SI6A 3RWUA 1SUQA 4CJUA 4PLLA 3OYBA 1ZBLA 4ZHRA 1DTQA 4FCYA 2YKMA 1YTAA 4II1A 2OA8A 4HTUA 4DLGA 4CJFA 2PYLA 3OY9A 4KO0A 4DTXA 1KVCA 4NYNA 4DLEA 1JKHA 1TAUA 1BL3A 4DF8A 1S9EA 2OZSA 3O4QA 4CK3A 3KJVA 4IUTA 3F9KA 5EU7A 4ICLA 4KHSA 2ZQBA 4IBNA 3LAKA 2G3RA 3G10A 2RJEA 4FJJA 2HHUA 1RT3A 4HHTA 3CFOA 3L2RA 5J39A 3HSTB 3VA0A 4NZGA 1LWEA 4HVJA 2F5KA 2OPRA 3NGIA 4CEQA 3OB9A 3KUFA 4JRPA 4C8NA 3TANA 4LH4A 5C25A 2ITGA 1TAQA 5J26A 4KV8A 1WNSA 3KK3A 4DQSA 3DRSA 3CQ8A 3KKSA 1GOCA 1IKXA 2GUIA 4W5TA 5HRPA 3F70A 1VSJA 4QCLA 2B6AA 2D5RA 5J1EA 4JLHA 2OZMA 3NTHA 3NBPA 4FJKA 3OYLA 4CF9A 4B9UA 3RMDA 5HROA 3NF9A 5D6XA 4DSEA 4N4IA 4Q0BA 2F96A 1OZ3A 4FZXC 1TVRA 3DI6A 1WGSA 4KHWA 3DLMA 1CZ9A 2AJQA 1RT1A 4CGDA 4B9NA 4N56A 4NCBA 4F3OA 1N5YA 3V81A 4ZTJA 3T19A 1RTHA 1S1UA 1BQMA 3SD4A 3DLRA 3FDRA 3M8SA 3AVMA 3CFRA 3KLEA 4FYDA 3MP8A 4FU6A 1ITGA 1S9GA 4FZYA 3LPTA 3QNNA 3AA3A 2L89A 3HPGA 1QS4A 2P51A 3NH0A 3TAMA 2BGGA 2Y1JA 4CF0A 4RG2A 4E7HA 1C1CA 3H08A 3V9WA 4CGGA 1ASWA 4OGCA 1JLEA 5SWMA 4OLAA 4KTWA 2KTQA 4MFBA 1LWFA 4J2DA 4I9LA 2FBYA 4RW6A 4O55A 2DFHA 4DTRA 3P8HA 1BI4A 1TKZA 1LW2A 2DAQA 3T3FA 3VQAA 3KTQA 2HHQA 3K59A 3P5JA 1KHCA 4OJRA 3OYAA 3LAMA 1HNVA 3LP1A 3OYIA 4AHRA 3LZJA 1D9DA 4CEEA 3LGFA 1IKYA 4W5NA 3MAQA 1ZYQA 1TK8A 5C24A 4ID1A 4OPKA 3DLHA 1JXEA 4FJIA 3HM9A 3BGRA 3OS0A 3I0SA 3HXMA 4ELTA 2RI5A 1WAJA 3QIIA 5CYMA 4FM1A 1KFDA 3QJ6A 4DF4A 5D3GA 4C8OA 3K5OA 4FW2A 2ATQA 4KI4A 3ZT0A 3OYHA 3DM2A 1VK0A 3AA5X 3RMBA 2Y1IA 2R5MA 3ULDA 2XY8A 2BUDA 4CJSA 4L8RB 4BE2A 1J54A 1RT5A 4KB0A 3M8RA 1EKEA 2G8KA 4LD0A 1EP4A 1NK6A 3KLGA 5HP1A 4LSLA 3IRXA 3MXIA 1C0MA 4CK1A 2P0KA 1BCMA 1U04A 1KVAA 3QEVA 3KLFA 2ETJA 2YNIA 3KK1A 1A5XA 4KPYA 4Q5WA 4FJNA 2R57A 4CECA 2PZSA 1A5WA 3VN5A 4FJLA 1RDCA 2VG5A 2G8UA 1NK8A 2Z1HA 2ZE2A 4RW4A 3VQDA 2KZMA 2G8HA 4GVMA 3ZCMA 3NE6A 4H4MA 3MXMA 1S6QA 5J2PA 4CHNA 3S9HA 1Q9XA 3K58A 3ITHA 3QIPA 2EX3A 2A1RA 1FK9A 5K14A 3OJSA 2XO7A 1CZBA 2B4JA 3GOXA 2YV0X 3VQBA 4E89A 3DLKA 4PA1A 5CZ1A 1RI0A 4CGHA 4E1NA 1H3ZA 4EZ6A 3HYFA 3H6ZA 4CEZA 4B9LA 1QE1A 3ZSOA 4QQGA 3MECA 1S1TA 3E01A 3HO1A 5D6YA 2HQXA 4Z4GA 1RTDA 4FVMA 3AVLA 4J2BA 3WNFA 5KRTA 4E3SA 3I0RA 1NJXA 3DOLA 1MU2A 2K3YA 1U4BA 1VSHA 4QAGA 5C0MA 3ME9A 4A4FA 4FLWA 1U48A 3EAEA 4PWDA 1ASUA 4AHCA 4E1MA 4W5QA 2E6MA 2D0AA 4B9VA 3PMTA 5E41A 1SSFA 3BDPA 1IKWA 2HMIA 4YNQA 3QEIA 3VQ7A 2IDOA 4KB1A 2JZ2A 2YNHA 3LP3A 4N5SA 1TL3A 3SNNA 4CEOA 4DSFA 3TAGA 4HUGA 1C0UA 1ASVA 4EP4A 4F4KA 3MEAA 3SJJA 4BDYA 1CLQA 3CYMA 5DK5A 1WSJA 2X35A 4YFUA 4AHVA 4DSKA 3V9XA 2ZD1A 3AVNA 1JL1A 1RDDA 3DLEA 2IGIA 3OYKA 1XHXA 3V9ZA 4AHTA 1WSGA 2O4IA 4PUOA 1VSMA 2G8VA 3SUQA 4Z4IA 4TSXA 3RR7A 3FEOA 4FZZA 1NJZA 2QQRA 3DYAA 4BE0A 3O8VA 4O5BA 3PV8A 4CJRA 3K2PA 3AVHA 3U3GA 1UA1A 4FJGA 4W5RA 2QKBA 4FJ8A 4CHQA 4DFJA 4FW1A 2YHAA 1EX4A 3QBYA 2NLUA 3ZT3A 3L3UA 4FK2A 2BKDN 2HHXA 4IUPA 3HP9A 3NGZA 3M8PA 3O3FA 1U45A 2HHVA 3V1OA 2F8TA 3ZT1A 1RNHA 4Z4CA 1QHTA 4BWMA 3C4SA 4NS5A 2RJDA 3E9GA 4DTNA 1OYXA 1NK0A 1L3TA 1B9FA 4J2AA 4CJKA 4B08A 3EYZA 2GBZA 2WACA 4NCAA 4C5HA 3PX0A 3K5MA 4DSLA 4IUUA 4K8XA 4N41A 1TKTA 4OKJA 2GFAA 4FM2A 4FM0A 1ZBFA 4IFYA 5KCOA 2PQWA 2EHGA 1REVA 1HYSA 2E5QA 1UOCA 4KFBA 1C1BA 4CJ4A 3KLHA 3KLIA 3D0PA 3ASMA 5I42A 3TABA 1RT7A 2VWKA 4M3RA 1TV6A 3AO2A 1HMVA 1SV5A 2WOMA 1HQEA 3DB4A 4FJ5A 3RRGA 3ZSWA 4JRQA 1C1AA 5KE3A 2FHDA 3L8BA 3L42A 1NKEA 3O3GA 4IG3A 4K8ZA 3LZIA 4C8LA 3V1QA 1QSSA 1I3AA 4FK0A 1TGOA 4A4HA 4CF1A 4PQUA 4PL6A 3IS9A 4AH9A 1LW0A 1A5VA 5KTQA 3HJFA 2QK9A 4DTSA 3LYIA 3LWLA 2GF7A 3V6DA 4N4GA 3OS2A 3PX6A 4OKKA 2BE2A 2X74A 3I8DA 1QQCA 1RILA 2EQKA 4ID5A 3OYDA 3MEEA 3VA3A 2QQSA 4M3ZA 4CJVA 4KHQA 3C6TA 1OZ2A 3B6OA 2YNGA 4BDPA 3NTKA 2X4WA 3LGLA 1LV5A 2VG6A 4KTQA 5T7BA 4FK4A 3LPUA 4CFCA 1SL0A 4JS4A 1YTUA 3CG7A 4FJMA 3VQ9A 2RN2A 4M3TA 3VQ6A 4DG1A 2IAJA 4DTPA 3KD5E 2OPPA 1X9WA 1L3VA 3AVCA 3V4IA 1X9MA 2EFIA 4CJLA 1RTIA 3OMCA 4B8AB 3VQPA 3ALYA 4RW7A 1D5AA 4I9QA 3QESA 3CFPA 1Z26A 3TAQA 3L3VA 2X4XA 1XHZA 1VSLA 3DOKA 4GY5A 1RDBA 4CJ3A 3QEPA 1JLCA 2M0OA 1EXQA 4Z4FA 3ZSXA 1B92A 2I5JA 1RTJA 3FC3A 1UWBA 3AO5A 1QSLA 3RMCA 3BDLA 3QNOA 1Y97A 3QEWA 3L2WA 1UAXA 4BACA 2QXFA 4XIUA 1TK0A 4DTOA 2RI2A 3NTIA 3AVJA 2F8SA 4O0IA 5FDLA 5FRMA 4A4EA 1BGXT 4KAZA 1D8YA 3S3MA 4CJWA 3ZSYA 3JYTA 3FLGA 1FKOA 2P5OA 3MO8A 3Q1JA 3SYZA 1C0TA 1JLGA 3H8ZA 4I2QA 3LP2A 1KLMA 1YT3A 4JS5A 3B6PA 3HVRA 4IG0A 3F73A 3QKJA 2YHBA 3AA4A 4B9SA 3ZSRA 2IC3A 2B8AA 1RBVA 3ZSVA 2GV9A 4CF2A 4CRIA 5HRRA 3AVBA 1DTTA 1HQUA 3TARA 2DY4A 3VQQA 2XHBA 3SQ1A 2DTUA 1KFSA 3RTVA 2HHWA 3SPZA 1NK5A 1BQNA 2FBXA 3LWMA 4DSIA 2O4XB 3PY8A 4KHUA 4DTMA 4CHYA 3WNGA 2RHXA 1MHNA 3THVA 2RHZA 2R7YA 1R0AA 1NJYA 3OYEA 4C5EA 1KRPA 4HUFA 4H8KA 2M1HA 3TAFA 3MEGA 4KI6A 4UC4A 2L8DA 2G8FA 1WJSA 2RF2A 2YNFA 4CCHA 5I3UA 1VSIA 3SZ2A 4CJTA 1IKVA 3META 4QOZB 2X4YA 4B9WA 5KCHA 3MP6A 5JS1A 4J2EA 4R5PA 1JL2A 3OVNA 3JSMA 4AHUA 4WE1A 3HPHA 3VQEA 1L3SA 1JLAA 3VQCA 2E4LA 1CXQA 3OYGA 1JLQA 1U47A 3ASKA 3OMGA
chains in the Genus database with same CATH superfamily
1BUPA 1UHWA 2DOEA 4B3OA 3HTUA 3TQNA 3DMJA 1J0RA 4M7DE 4N4HA 3IWFA 4XTWA 4F2RA 5HRSA 2KQRA 3G6ET 1XCBA 4F14A 2LY2A 2Z3YA 1PWTA 5TISC 3VPZA 1ZLMA 2HQEA 4A59A 1J9AA 3FSPA 2BXZA 1TK5A 2L4MA 3ZLJA 3JCMJ 1WSIA 1JTXA 2CV1A 2M16A 3HK2A 1NGJA 3ZL7C 3O4NA 1PU8A 3QPHA 1POGA 2LF8A 2A5YB 1WZOA 2HQNA 4KDPA 3D4VA 4M45A 4GKJK 4JOMA 3KPHA 2GFUA 2KXCA 1HUXA 1MNDA 1T7PA 1K6OA 1AWCA 2QSGX 5FGMA 2A36A 4DR3K 3SV4A 3OYNA 2DX1A 3VODA 1YBYA 3REBB 3EZWA 3AKZA 4ZGJB 4BWJA 2PAVA 2EFOA 3CWAA 1X75C 2J6OA 3F0CA 4F7UF 3UE5A 1XNQK 4C1NI 3MK6A 3ASOH 3DP7A 4ZYEA 2R92J 1ETQA 4DU3A 4JZ3A 2CGJA 2RJFA 5CVJA 3NWTA 3CM6A 3KKRA 2M4GA 4XKVA 4ILJA 2GTDA 2STWA 1CXUA 4IURA 2JM9A 4LSNA 1NOZA 2QQ9A 2HKXA 4E7JA 1SD4A 1GXIE 3S3OA 4XH5A 3EY1A 3TO9A 5FWBA 2IOCA 3QO9A 3MN6A 2BZ8A 3A98A 2DDBA 4GVEA 1EH7A 2OTLI 1ONVA 1OYIA 1FZPB 3QXEB 3O8MA 3A8OB 1FY7A 3CQZJ 1RBSA 3SWNB 5GANf 1WBDA 4XN0A 2H3EB 1Y39A 4LF9K 4EDUA 3HSFA 5EG0B 1CGPA 3CPWS 4N9IA 3C7NB 3JB9D 4PY5A 1TKDA 3C6HA 2EFNA 5H2FC 3K69A 3NCIA 3HM5A 2R5AA 3D2EB 2M02A 3THWB 4W5OA 4UOBA 3S1QJ 4BC3A 3LP0A 2R7SA 3CC7T 3CCVI 1CKAA 2XDPA 4OKEA 3C2BA 4YOUA 1JUMA 4WFAL 4N0AC 2BXYA 2ZJQF 5JHFA 1SFOJ 1S1XA 1MMSA 3QBXA 4A0XA 1LEAA 5D4RA 3H0HA 5EVZA 2G9WA 4CEAA 3L4IA 1QQJA 3DRPA 3F23A 4CHUA 1EQYA 1YAGA 3MCPA 3T69A 3ULEB 1WI9A 3GMEA 3A01A 3BUZB 4F16A 1W0UA 3PJRA 1D1CA 4A5MA 5E3OA 2LF7A 4IUQA 4WF2A 2K3XA 1MWKA 3T1AA 3AG4H 5ERIA 1NE8A 5EEAA 4RCHA 2MWOA 1WSHA 5JLHA 1MBKA 4E6RA 3WODF 4EW4A 5LJ3h 2ZB9A 5BN8A 4B9TA 4DV7K 4FL6A 1YCYA 1UA0A 2Y30A 3FM5A 1WX6A 4QW2A 1QQMA 4A3LJ 3PIPF 3HRTA 2AT1B 3TTCA 3J81Z 3TP0A 1YFNA 1ABQA 2A08A 4BC2A 5GAN3 1VIEA 2RHYA 4X34A 1HYVA 1JLBA 1LNXA 2QKKA 1XTDA 4K41A 3JAMZ 4I7FA 3WGHA 4EJZA 2I10A 3AAPA 1U9OA 1GOAA 2IVWA 2KLAA 2QA4N 3MP1A 1Q86R 5KRSA 1E6GA 1YHQT 1YW9A 1N32K 3N4PA 5GAMd 2RN8A 1F4KA 3LL3A 3MJXA 2JPCA 5KNLA 2FZKB 2ME6A 4H0VB 1FXXA 2KQ2A 3UKGA 4QWQA 4UV9A 4Y13A 3G25A 1GV5A 5CY4A 4O3MA 2OI3A 2IVNA 2Z1GA 2LJ0A 3CMAA 4BY9C 2VBZA 2NRVA 4XQ3A 4CZEA 1YJWA 2RKIA 4EGYA 1M3CA 2NAZA 5KH6A 2X4HA 1IBMK 3RR6A 2L02A 4P5OA 4UVAA 4BDZA 3CCJQ 1F21A 4CERA 4C8QF 2DOFA 1DP3A 2YRVA 3J7AP 2B9SA 1A0NB 2A0FB 2CW0F 2LSNA 1QVFM 2X6YA 2P5LC 4M7DB 1VQ4N 1VUBA 1CZAN 1RI9A 5FKLA 3CJNA 5DM7R 4CEDA 5HL7L 4PJOB 4FXDA 2M4KA 2Z1DA 1B72B 1ZLKA 4MMKA 1VQ5I 2RN7A 3CLQA 1W36C 5CIUA 2CH0A 4F3TA 3OQ5A 4HRIA 3THKA 1BKBA 2HZDA 3Q0WA 3L2VA 2DL5A 1OVYA 1RKWA 3B73A 1B59A 5LEKA 4BEHA 3H1QA 3ZEUA 3DCFA 1LAWA 3CMEN 3HL8A 4JI2K 4F9OA 2K02A 2LKSA 3F8NA 2JVVA 3E2UA 4M7AD 3QO3A 4E7LA 1N8RR 1WLPB 2WC9A 1QHAA 5AQZA 3FRNA 2JA2A 3LSHA 4JK7A 4CZFA 4KT5C 2OFKA 2BUPA 1Y1WJ 2DFEA 4MNUA 4A57A 1XDSA 2HYJA 1VQ9N 3CO6C 2DYBA 3H1CA 4CHPA 2XGDA 3MN5A 1VYTA 4CVNE 1YVUA 5ICFA 3ERMA 4YFKF 3BWGA 3SQ0A 4HNUA 2VE9A 1BCOA 4GMJB 2W82A 2HNZA 2QWRA 2HW3A 4UQGA 2RAEA 2ECZA 1Z25A 5FU6C 4OINF 3JCMX 1VQKQ 1Z9ZA 2E10A 4XORA 2P1JA 1DEJA 5GJVB 2WB1A 4RB0A 2K5IA 1WSFA 1UUEA 4YY3K 3LANA 3CI5A 1M4ZA 3QINA 3OH9A 1ABOA 1WSEA 3NQOA 1I4K1 3HFOA 3BTLA 4DS4A 2UWMA 2OX7A 2ZJQL 1X1CA 1QGPA 4FWPA 1YQAA 1B9MA 3ZX0A 4M63C 4CZLA 2VQCA 2E2OA 4PNOA 1YNZA 2VI6A 1BYMA 3CCVT 3LFKA 2KDOA 1K1ZA 3VQ4A 2GQVA 4ELUA 1GT0C 3LWFA 1KQ8A 2XHKA 4EP5A 3WNEA 2MW8A 1SMYF 2W7NA 3SPYA 4C92A 1WJRA 4B22A 2F2WA 1Z7UA 1XQOA 4G6DA 4JYAK 1OPCA 3PSFA 1TYQB 2JGUA 4Z0UA 3M0QA 3EPZA 4AFSC 4UVBA 1K9MC 5HBMA 4Y3OA 1P4AA 1KLNA 1X2QA 3PIPL 2PY5A 4CESA 3NH2A 1BHLA 1TQPA 3MEXA 4PHTX 3ISNC 1YITQ 1XG7A 5SZTA 4FLUA 2Y4XA 3FXQA 3EZ5A 4CC3A 3CCQQ 5LJ3d 2FNPA 1E2XA 2FX0A 3IAYA 4FOEA 3K6GA 3EFOB 3JSPA 2AO9A 4EIAA 4QQDA 5L3EA 1YQKA 3DXKB 4ZN1A 2L3QA 4CGJA 2ZGZA 1RBTA 1J7KA 1WQ7A 1T0JA 3VEYA 1MIJA 3A5ZB 3SWNA 1MV0B 1Y96A 1JJ2M 5JLFA 4Z02A 2CSOA 1PG5B 4LF7K 4BU2A 4F3QA 2EV5A 3SJHA 2MK5A 4HLYA 2YU3A 4YOTA 4ZDLA 2PVOB 5EG0A 3C7NA 2A61A 2IA1A 5J6XA 1VQLQ 3HP6A 4FTHA 4DYRA 4DWIA 1RKTA 4JJDA 4DQQA 2HQAA 3CDIA 1XWLA 3NH1A 1WJQA 1M3HA 4XEIA 4HV6A 3A8HB 2JLEA 4OB2B 2DEUA 4FLZA 3CC4A 2VG7A 3NWSA 2DJQA 1FSEA 2GELA 3P4IA 5E1WA 5GTHC 4D8DA 3ABLH 3UKUB 2EB7A 1MUDA 3V9UA 2PFUA 3LSRA 4YOVA 4HPQA 4KHNA 4E19A 5M1FA 1K79A 5KE2A 1X6GA 1N3CA 2JN0A 1T38A 4XU0A 2AA4A 4XLCA 2VOPA 3HSBA 1KSPA 1QO0D 1VZ0A 4RB3C 4A3DJ 2Y4YA 1SKSA 2COYA 1XMQK 2CW7A 2HSTA 3SQ4A 1RT2A 2ZBKA 1O13A 4D8KA 2VKNA 1ZELA 1D09B 2W6LA 1WJBA 3MEUA 1J5OA 2LRQA 3HDDA 3MHXA 5FLVA 1K0XA 5CVVA 1YIJQ 1WJDA 2M5WA 3VUZA 3FBNB 5F1RA 3A02A 3HKZN 3V8KA 5EG2A 2WA0A 2GZWA 4RAGA 4BI3A 3GTMJ 2ZXJA 1N27A 1VQ5T 3DPUA 4FJ9A 2E5KA 3E9PA 2KFNA 4RTFD 1Q82O 4RM3A 1SUQA 4PLLA 2E8AA 3J7YJ 1K8KB 1VQMQ 5H20A 3IFRA 1W1FA 2OQGA 5DY9A 4XNFA 2YKMA 1IBLK 3EHRA 1UHCA 3SMSA 2PYLA 1GDTA 3L2ZA 1LCUA 4DTXA 2K4JA 4DLEA 3WUHA 2HF3A 1S9EA 3VS3A 2OTLA 3KLOA 3BJAA 1D0ZA 4IUTA 3H41A 1TUDA 3GBTA 2EZHA 1A35A 3OL4A 1LDJA 1ZUYA 2QQAA 3LAKA 5M1OA 2G3RA 3G10A 3ZMZA 4EM1A 5GMKh 4AG2C 3QYHB 4IOCL 3FWEA 5LL6Z 3JCMb 1RADB 3H0GJ 1LPLA 3HSTB 4GYGA 1NH3A 4KNYA 2B63J 4HVJA 3NGIA 1MSFC 4CEQA 1DGKN 3KK7A 2E88A 3TANA 1JJ6C 1RAIB 1TUGB 3CMYA 3WT0A 2CGPA 5CAIA 1RIOH 2E5NA 2ITGA 3A4CA 2KE9A 4A0YA 4A6EA 5HY6A 1KQ0A 3GTLJ 2QWLA 4LDWA 4EAHD 4OU0A 3K2AA 1VQPA 5HRPA 4M7DA 1H3HA 4QCLA 2D5RA 1FC3A 5GAGJ 5J1EA 4UHTA 4XRSG 2OZUA 2VYPA 2DXBA 4KN7X 4PJOA 3CDHA 3HKSA 4I2OA 4RTVA 2HOSA 2XGEA 5KHDA 5LJ5g 5HROA 3QPSA 2PMZN 1UGVA 4GV6A 3CCJI 2V1XA 4Q0BA 3X26B 2VXDA 2HQHA 3K0SA 3DI6A 2V9VA 3IUCA 5IT3A 2AJQA 1RT1A 2EW3A 1IRFA 3L2CA 1ZA1B 4C30A 4B9NA 4NCBA 1T95A 2R7RA 5AQLA 3V81A 5J8FA 5L8RE 2X1EA 1K76A 1RTHA 3T19A 2F2EA 4CZCA 3QWLA 1PP7U 3T7ZA 1QA6A 2KK4A 2KDSA 3CCMN 2JW4A 1I50J 1QQIA 3I58A 1KG7A 1QS4A 1ZTRA 1X3NA 2O9SA 1AKHB 3BP8A 1IN8A 1NGGA 1SEUA 1TBXA 1R49A 1STZA 1WKMA 2Y1JA 3O4WA 5IP7J 3O80A 3EG2A 5JVGF 1R77A 5D5WB 1JLEA 1QCNA 3MWMA 5CKEA 3FXJA 1QQOA 1JE8A 5IYBJ 2FA5A 3K4JA 1WZ2A 1S3XA 3Q0UA 2DXTA 4GFBA 4J2DA 4IO9F 4WCGA 3HOZJ 2JVGA 3I5RA 4RW6A 5M5WJ 5JR3A 2DFHA 1VQON 3VGMA 4DTRA 2JMCA 3M1FA 3FIWA 3T3FA 3ESWB 4E9HA 2NNWA 2E41A 3TREA 3OIOA 2NRWA 4BY6B 3WU1B 5BPNA 4JNEA 3EUKL 3SWNC 3MD2A 2EJFA 4AI4A 2LMDA 2CP0A 2LSOA 3LZJA 1D9DA 1VQKI 3LGFA 2K4YA 1IKYA 2P9SB 1RDWX 3REAB 2GTJA 1AWOA 3GLXA 5GIOA 2MPXC 1FOKA 5TKWA 3HM9A 1TQIA 3OS0A 1HDPA 4XTXA 2YR2A 1M3AA 3EGUA 1W5TA 2KYBA 2EK5A 3B02A 4DF4A 3SBTA 1V76A 5C10A 4WWCA 4A2BA 3K5OA 2D8HA 2JWTA 4EJWA 4M77F 2CZ1B 4FW2A 1FOYA 5GPCA 1UJYA 3DM2A 3RMBA 3D1NI 2GLOA 2RVCA 1NJIR 3MKZA 4EJOA 1VQ8A 5HS9A 3B6AA 2JSPA 4JI8K 4YORA 3AG3H 1WJAA 5CLSA 1GCQA 3W2WA 5J3LA 2P9IA 3GEZA 3FHFA 4J6YA 1SF9A 1G59A 3DWLE 1W2BP 4BC5A 1ZUUA 2Q2RA 1RABB 3DXKA 1GCPA 1BB9A 4OMLA 3V7RA 1ZBJA 4A61A 1HNXK 1KJWA 4CK1A 1DQUA 3SEZA 3CCUN 1YITI 3LSTA 4C92D 1ETXA 1NYFA 4EIKA 2XSJC 2GWKA 1B34B 2WBMA 4NQWB 3CCQI 1CSKA 1A5XA 5M1QA 1M1KR 3O9QA 3I56N 4FJNA 2EIJH 5E3NA 5JICA 3CCET 1QKXA 3CTAA 2GGRA 2PZSA 1BG3A 2GEMA 1A5WA 2V1QA 4MDXA 1O3TA 5GTIC 2QM3A 2BTFA 4M78E 5KPTA 2DA9A 2P84A 2ZE2A 4WCIA 1YE9A 4MLOA 4P5NA 4DOZA 3VQDA 2M7BA 1AOJA 2G8HA 2H27A 1DU6A 3DBLB 3ZCMA 4C8QD 2DJIA 1FYMA 5J2PA 3JCMh 1VQLI 3ITHA 4W1UA 4BL0B 5GANd 2RB6A 4JJCA 1CZBA 2B4JA 1O7LA 4E89A 4GXOA 3DLKA 1TS9A 4PA1A 4E1NA 1BR4A 4EZ6A 3H92A 5IHKA 4B9LA 2UXDK 3MECA 1HQCA 5A2QK 2ESHA 1Q81O 3LDOA 2LP0A 3X28B 2MCNA 4AD9A 1LWYA 5KRTA 3G6EN 2YLCA 4G9YA 4E3SA 3QP5A 1MU2A 3IC7A 2HNHA 3CO7C 1C0WA 3ME9A 5C0MA 2OQRA 2CUZA 3CCJT 1NGBA 5GAN6 4PIIA 3WU2C 4A4FA 5EC7A 4FLWA 1I1JA 1J6ZA 3EAEA 1ZGJA 1K8KA 5ICGA 2IIRA 2E6MA 4XTVA 4KIGA 1G2HA 1LFUP 3NFCA 3K4MA 4PJOC 1YIJI 1KD1O 1X2NA 1H92A 3THXB 3QEIA 2D45A 3DF8A 1U5TC 1UG1A 2JZ2A 1PCXA 4N5SA 1TL3A 2WAQN 5JVGL 1U6ZA 2JMAA 3H9QA 4U0WA 3FGUA 2DTIA 3DLLF 1PP8F 3CBOA 4JV5K 1QVGA 3QU3A 1WCMJ 4BDYA 4D6WA 4M75C 2Y9YA 3WTWC 2F5TX 3SFZA 1I5LA 5AQGA 1CLQA 2C0OA 4BXUA 2OAUA 2KT1A 4QS9A 4YFUA 4AHVA 4DSKA 3V9XA 4E9FA 3H45C 3OSGA 4KA4A 1EV7A 1R00A 3DLEA 2IGIA 3LW5E 3VTIA 2MG4A 4HVUA 2YX6A 2KHOA 5A2QE 3O9UA 5GAMj 2FD5A 3AT1B 5AQQA 1OH5A 4PUOA 5CR2A 2ENMA 3GVAA 4Z4IA 5HS7A 2K57A 4TSXA 2Q0RA 4PKIA 4IRGA 4L5GA 2ZC2A 1A36A 3QP6A 1HXDA 3U2RA 1KQ9A 3H3VK 4O5BA 4KT0E 1LFBA 3K2PA 2O8BB 4FJGA 2MOXA 2QKBA 2E2QA 1ARKA 2HDCA 2MIOA 3OWTA 3QBYA 2NLUA 3WVDB 3ZT3A 3L3UA 5K7ZA 2AKKA 4FK2A 3NGZA 2FZGB 4HQEA 1IF1A 3O3FA 1U45A 5IYDJ 2E71A 4ZZLA 4ZJZA 1QHTA 1V5FA 2P8TA 2IRFG 4ELYC 4JI7K 2Y2ZA 3G1MA 3C4SA 3JB9G 4NS5A 2RJDA 2LJ3A 3E9GA 1IN4A 4E9EA 1OYXA 1R5HA 1NK0A 3KHYA 1TTHB 3C2HA 1B9FA 4RB1A 3CC7N 5AQJA 1N9SA 4IVNA 3EYZA 2J5PA 1ZK8A 2K5FA 1WGXA 4C5HA 3VF6A 1WYXA 3WTSC 4M7DD 1LFPA 4K8XA 4N41A 4HF1A 4OKJA 4JBAA 2EJ9A 2DAOA 4AM7A 3CJQB 1AKHA 4FM0A 1ETVA 1ZBFA 3QOEA 5KCOA 3DPTA 3SB2A 4KFBA 1VQ9Q 1LEBA 3KLIA 2XC7A 4L0YB 3PGGA 4M3RA 1MBGA 1YITT 4CZJA 2WOMA 2BGCA 3A1YA 2HOTA 3DB4A 1M90R 2A3SA 1KQSA 1PD1A 2M8GX 2FMLA 4CC4B 4HCKA 2PMUA 4TV7A 3O3GA 1NM1A 3J7AO 2CT4A 3A0HC 5ICCA 2O8KA 4Q47A 3S1MJ 2QYOA 4NNJA 2A37A 2ECBA 3C0BA 2E2NA 2DT5A 5GAN7 2DI3A 1TGOA 4A4HA 3M57A 4XKWA 2DD4A 4M75G 1XGNA 4AH9A 2HKOA 2P9SA 2ZPHB 2Y69H 4YEJA 4PKGA 3CCSQ 2GF7A 3OS2A 2W48A 3FZLA 2DA2A 2JHNA 3HOVJ 3AARA 3BCBA 1FWZA 4E47A 1VQLT 4ID5A 5IH2A 1YHQN 2ICWG 3JW4A 1UB4A 2QG9B 4M78B 2F4MB 3VTHA 5FFZA 4EMGA 2TRTA 1AOYA 4BDPA 3GOIA 3H5NA 2VBXA 5ILUA 3J7AF 4FWKA 2B7EA 3T1YK 2LDUA 4CICA 2JT4A 5H1SQ 2KBTA 3ONQA 1YIOA 2F4OB 3W3CA 1Y71A 2CU7A 3T9NA 4NB5A 2VBYA 4WQ5A 5GADP 1W97L 4PUSA 1YTUA 3A1PA 5CK9A 3VQ9A 2RN2A 1TP4A 3KD5E 2IAJA 2W1OA 4CW7B 3TPQA 2IA2A 4IXAA 4IHYA 1X9WA 5AQKA 2JWLA 3V4IA 4YELA 1VYVA 4JKHA 1X9MA 4CJLA 3QODA 2K2VA 4XKCA 5GAOp 5BS6A 5AQTA 1SAZA 4RW7A 3DLLL 4PKHA 2HPMA 3PLAA 2PEXA 1NBWA 1OYWA 3CMMA 1B34A 4ESBA 3A8MB 3BW1A 1K78B 2DK5A 5HK0A 3TEEA 5LJ3j 1NMNA 1IZ1A 1ACMB 4XM3A 5CHZA 4A5AA 1XHZA 3IMXA 3V8JA 4F91B 3P38A 2JWKA 3QEPA 1RI7A 2YXYA 1JLCA 4WK8F 3F6VA 3K1NA 1EXQA 3CVTA 4Z4FA 5GAN5 5EDNA 2L54A 2FYKA 2OCEA 3FXOA 1QPIA 1W7PB 2W25A 2K3BA 2FJ1A 4IEJA 3BDLA 4OB3B 5KYWB 4IEIA 5CO7A 4M7AG 4PL7A 4CC7A 1ETOA 3TBIA 2L3DA 5ICEA 4DHYA 1UMQA 3QEWA 1JXOA 4MHGA 4AF1A 4UUVA 3DFGA 4XLNF 3OW2A 4G8XA 2GX9A 1HKSA 2VBWA 4FWNA 3F3XA 2F8SA 4B4CA 3OYYA 2JS2A 3TGNA 4FYXB 3G2BA 1AHDP 1VQKA 1OH7A 3RSEB 4XIDA 1NGIA 5FRMA 1BGXT 3O8GA 2OTLN 1D8YA 1YG2A 4CJWA 3ZSYA 4BGDA 3TOAA 1KC8O 3WVEB 3SYZA 1C0TA 4BREA 2MYSA 2VJ5A 3LP2A 4JS5A 3JB9H 4A3IJ 3HVRA 4CO8A 4LF6K 3VEZA 1K73C 5GAOm 4IOXA 4C2MJ 2ZPFB 1Z91A 4CZKA 4XLFA 1Z21A 3PIOA 3AGRA 1DKGD 2K9NA 4LDUA 5J1UA 2GV9A 4CF2A 1BU1A 4PGHA 4LFUA 1IB8A 1Q7YC 3AVBA 3TARA 2E5LK 2RNGA 3F5TA 4ZN3A 3GWZA 3CCVN 2KMUA 1TC3C 1TT5B 1BQNA 4HWIA 1T8IA 1FNNA 4IO8A 2DMQA 3FB9A 3TDZC 4B24A 3H9GA 2SRCA 1H89C 2Y75A 3QZ5B 2LCSA 2RHZA 3ERED 2CP5A 4AWXB 1R0AA 4DV2K 3P39A 4BS9A 4C5EA 3CCQA 3KZIC 1D5YA 1Y0UA 2M1HA 2ASMA 5AR0A 3MEGA 2DXCA 4UC4A 4ZYDA 2UZKA 4D5CA 2P0WA 2XHCA 5DD4A 3NVKA 5I3UA 2D4WA 3SZ2A 4CUGA 2RQUA 1VQNQ 1OOTA 2IT0A 2FPEA 3META 2DU9A 3CCYA 3WXKA 5F0HA 1YS6A 3OVNA 3VUBA 4AHUA 3JSMA 3G4SQ 2COMA 3VQEA 1JLAA 3LAPA 2O8BA 2L4AA 2H6CA 1T39A 4LDXA 1VQLA 1HPMA 1U47A 1GLEG 3OIQA 4IWVA 3VF4A 3UA6A 5AZJB 2DA7A 4B1XB 1F5TA 2TDXA 2G8IA 3T5XA 3QYGB 3NEUA 2HS5A 3JRZA 4IHTA 1YJNQ 1Z67A 1I94K 2QYZA 4BY6C 5A2QO 1HNIA 3M55A 1WHKA 3ZMDA 1USSA 2GQIA 2YKNA 1QTMA 2DPNA 3IKMA 5I21A 3FZVA 4BR4A 5IN1A 2E3IA 1BR2A 5B66C 1VRTA 3K57A 4RUGA 4DQ2A 4X1VA 2Z0WA 1N33K 3BFMA 3BT9A 3HRMA 5E1XA 4CF8A 3TMOA 2AP1A 2KKZA 2DO7A 2V52B 2ATCB 1OCPA 4E0DA 3GYHX 1YIJA 3OYCA 3WHBA 1MDMB 1FTZA 5IHNA 2Q0UA 4BR7A 2ZGYA 3JCMV 1WEIA 4KHYA 3SQNA 2YT6A 1FYNA 2BBYA 3EFRA 1W4SA 2Z5UA 2DMOA 5BPDA 2DD5A 3AV9A 3H3NO 1XD7A 3CCMQ 4M3YA 2HFHA 5AZIA 4K42A 4AIAA 1VQ6Q 4GY2B 2NOLA 1UFMA 4M3WA 3HGGA 2KZVA 3S1RJ 5D7UA 4C8MA 2P9LB 4HF0A 3RDVA 1LOJA 1VQMA 5AQFA 3L4QA 1R23A 1S1NA 1J5EK 5D6FA 6PAXA 1IG8A 5C2DA 4M73A 4DSJA 4CGIA 1GLLO 2KFDA 4IRHA 1K4TA 2VXFA 3DWLA 4JKDA 3MKLA 1VQ5N 4JX5A 2LDMA 2L9SA 2XVCA 2VVKA 2VKEA 2QQ8A 2XUBA 2BDPA 1VQ9I 4EMKC 1HRHA 1FIPA 2NS0A 1QVFS 4RAFA 4X9CA 2R58A 3ZN0A 3RSNA 4DBRA 1VQOQ 4OAZA 2SEMA 3PO5A 3F6OA 2EBPA 2RF0A 5J1RA 2LP5A 3GL1A 1D1BA 2HHSA 4M78A 1HPZA 1LWCA 2VQGA 2DTOA 1MGTA 3UIQA 4JAXA 5LJ5h 2CV2A 9ANTA 4FX0A 3BJ6A 2IAIA 2YUSA 3ABUA 3VESA 3LSMA 3JCMe 4XOPA 3GFLA 5M1KA 2KRCA 3F8MA 2L3RA 3CCSI 3LX7A 2FVUA 4CCJA 1AWWA 3CCRT 3OH6A 4AM6A 1R0CB 3VPRA 4II3A 3V9SA 1IN6A 2EQUA 1LJOA 4R1HA 1P59A 3VERA 1UHMA 5LHGA 3NDKA 4DW6A 2PTKA 2E2JJ 2XDVA 2DVJA 1BIBA 5LFAA 1LE8B 4YFXF 3OSSC 2OTJI 4I2PA 2UUBK 2KRFA 2Q3SA 4DQPA 2X6NA 5IOZA 2L3PA 4CJPA 3JR9A 5AONA 3PNWC 2X1DA 1PKSA 2ZJRL 4XAXB 1RDAA 2BY0A 1KVBA 1HNZK 1YW7A 1K78A 4E6KG 4E7IA 1NG2A 3S6IA 4V2FA 2I5WA 3PFIA 2P5GA 3N4MA 2O31A 3AVIA 4OX9K 3O6BB 4Q5VA 4C3JJ 2LX7A 1W4MA 3EQLF 4ZZDA 1NGFA 4CIGA 3LDPA 1KA8A 4ZYGA 4ENMA 4F7UG 4MQVA 1E3OC 1A6QA 2BTTA 3IH2A 3VQ5A 2Y0SA 4DBQA 1W7PA 4BRIA 3UKRB 4OFEA 5KYWA 1I39A 4XU2A 1W9HA 3W6VA 3SK3A 3GTQJ 3RMAA 4GLKA 4JZ4A 3JCMP 2IS3A 3PO4A 2W57A 4RG8A 2B0LA 2A42A 3CP2A 3DQVC 3M8EA 1RETA 5EGOB 2E12A 2UV1A 1UCRA 3TKYA 5AIQA 4LY7A 4EZ9A 1MBFA 2IS1A 2ESNA 5GMKj 3Q9VA 5JFRA 3M0PA 3MEWA 5J47A 1V4RA 2ZNYA 2HZTA 4XH4A 5BR8K 2DA1A 2UYTA 3ZT4A 1V54H 4F93B 2R7FA 1D3BA 3I5UA 5AQXA 4HDUA 2AZVA 3QFPA 3TSWA 4RMNA 1R22A 3KEOA 1ON1A 4FE7A 4C3HJ 2DXIA 4EJYA 2HWVA 3CCLQ 4D0PA 1FEXA 5D5VB 2FBVA 3K5NA 2EZIA 3P31A 3J80O 2ME0A 1MH3A 3FXLA 1DDNA 4BY1J 1NKBA 5IT9O 4DFMA 2CSIA 1NK2P 1WFWA 1BIZA 5DS9A 3NGYA 1NGDA 3H3OB 3LSIA 1HKGA 5EX5A 3G0ZA 1YVNA 1KG4A 2K5LA 2E2IJ 1AT1B 5GAOl 2IVMA 1O4XA 2EZKA 3DLBA 3K70C 3K1PA 1SC7A 5C4XJ 3U9ZA 4DYQA 3NFAA 5AQRA 4KGZB 5CVIA 1SD7A 1FP1D 1JJ8C 1B07A 2DDAA 4P9UA 1OMIA 4Q48A 4OVAA 4C0FA 3K7AJ 2M87A 1NK7A 3P83D 1Y07A 2HDDA 2P4RA 2BZYA 4KTZA 3VRYA 4H0XB 1O57A 1H0MA 5J2NA 4XTYA 2HNYA 4P55A 5C42A 1BIUA 1EBMA 2M7AA 5L23A 4I09A 2GTOA 3DRRA 4GKKK 3QERA 1BO5O 2AHQA 3HOTA 4DU4A 1WHLA 4X9DA 4O5VA 4FJHA 1NYGA 3OS1A 2GBYA 4BRCA 4N4OB 3D5LA 2JTFA 3HRGA 4U88A 3M07A 3R60A 4CC2A 1Q81R 1GLFO 5AJ3K 4CYCA 2ADUA 1WWXA 3BY7A 3NF7A 5AZJA 1QZ6A 4B8XA 2D1KA 4BD3A 1VQNI 3PL8A 1R59O 4M7YA 1NG7A 3AVAA 4NLCA 5GP9A 3M6GA 3O3KA 5KCMA 5D5UB 5KYYA 1AVZC 4A3CJ 4E70A 3JTGA 4AVZA 3NAUA 2QXLA 3EUAA 2XICA 3WNHA 3G4SI 3SMPA 3KLNA 3C2GA 4DZJA 1XC3A 3CCEN 3H3ZA 1KD1R 3DEUA 1BI4B 1R4NB 2XROA 5GAMf 1NK4A 3CC2T 1UB9A 4IFVA 4BQLA 1SL1A 4Y92A 1KXPA 4B48A 2XRIA 5LRSA 3RQ4A 3LALA 1W2BS 3A2FA 3CCST 2W4SA 4ZGEB 1R4MB 1KG3A 4JKAA 2IVOA 3HOXJ 2CYYA 1VSDA 2CW8A 3T1HK 1IDZA 1ZG3A 1SD5A 1YJNI 2KFZA 3P8DA 3AO4A 2BZTA 1TUUA 4V19K 3HSRA 4HCBA 4BH9A 4HCZA 1MDMA 4C8QG 2CMPA 2HDWA 2V1NA 1HW2A 2VWBA 1BOBA 3DXJF 4KMUX 2CDTA 4Z94A 4YPRA 2YCHA 2OTJT 3EGXB 4JUVA 1MWMA 2P6SA 4FM4B 1D3YA 3CEYA 2MMPA 4AFZC 3JSOA 4NOYA 2P9LA 5LEJA 3HHGA 2V6CA 2RK1A 2FC0A 4UV8A 4FSVA 2AIRB 3K70D 3ER0A 1FBUA 2JA8J 5F1XA 2E7XA 1N39A 3M0TA 4LOCA 2QEXQ 3CCJN 4A4GA 3HRUA 3CF2A 1WEGA 1RESA 5B1AH 2DIQA 2BANA 5FLXO 1T05A 2BVLA 2NS7A 3CCMI 1RRSA 2NOHA 3ECOA 1VQ6I 3LA3A 1H9TA 1NLPC 4BHBA 4B3MK 1EETA 4QS8A 5DMRA 4J9HA 3ZPLA 2LVMA 2O8CA 1TTYA 2UUCK 5DUKA 2FF6A 2QA4A 5CQYA 2HNIA 1DPUA 2F5VA 5LGNA 4CIFA 5FKKA 2YX4A 3UT1A 3NHNA 4ZH4F 2LOOA 4CEBA 2XDDA 4FLXA 2NOEA 1UELB 1D9FA 4HUEA 1XSVA 2D0NA 1JKRC 4DBFA 4S0HB 4JI3K 5J40A 1YHQQ 3JRFA 4F8RA 3T1BA 1B3QA 5JI6A 1M9SA 2GWJA 2K9SA 2DBMA 3H0DA 2FLOA 1XN7A 2RHIA 5LY3A 2V9PA 1KYWA 2W85A 2QWMA 2E6NA 4GW6A 2VE8A 2RJCA 3LM2A 2V7ZA 1ITYA 1RAFB 1LE8A 1X58A 4B8CA 1D0XA 3FHNA 2E35A 2CQKA 2WUSA 4CDGA 2DMTA 3ZQ7A 3H9JA 1H641 4CXFA 1N9RA 3ZT2A 3RDIA 4M78D 2HBLA 3I0WA 2DERA 2Z1IA 4RAZA 2KL4A 1BN5A 2NOZA 1RUOA 4MGRA 3GZNB 3CQTA 1XNIA 4PFZA 1MDUB 3A5NC 3D45A 1S7OA 4OMMA 1U06A 4YFNF 3JAMK 1PUFB 2IP2A 2CZ6B 3HB9A 2F4IA 4K25A 2O8DA 1FSHA 2EPFA 3QOPA 2NRXA 3RWUA 2C0IA 3LA7A 5E17F 4XH1A 5K1YA 3CJ1A 2VPRA 1ZBLA 1LB2A 2ISYA 4ZHRA 3UKRA 1JCEA 4FCYA 3DV8A 4LDYA 1YTAA 4II1A 1FX7A 3M4YA 2YHWA 2O8XA 5TKYA 4NYNA 2PNIA 2X1CA 3E5UA 3E1YA 1BL3A 4DF8A 4M3GA 4IHXA 2ZO4A 2DLPA 4CK3A 1VQ9A 1K73U 3F9KA 4HQMA 5EU7A 4P9FA 4OWRB 1NPRA 4IBNA 3KTUA 4PJNA 1XC5A 1AU7A 4BUGA 2VV5A 5LJ3f 1K83J 2YRCA 3OTOK 4FJJA 1Y6IA 1UECA 1BI1A 2H94A 3CFOA 3ENHA 1U5SA 2I5UA 3L2RA 5J39A 1Q7YU 3I55T 1Q82C 1LWEA 4I76A 2F5KA 3VYGA 1YITN 2YWWA 3J81E 1UJ8A 4C8NA 3GF5A 3VWBA 5GAN4 4M3EA 3I3LA 1KQJA 3CCQN 4O8UA 2V8KA 3CXCA 1CF7A 1MJBA 2FF4A 1TAQA 5EYRA 3W6KB 3Q9SA 3RI4A 2JK3A 3CQYA 1WI7A 1IAWA 3JAME 5I2MA 4YIFA 2DYRH 1IKXA 2GUIA 5D8KB 5FU6B 1QP2A 2HYFA 5F08A 2B6AA 3G7ZA 4U87A 2AQEA 3PM1A 4JLHA 2CGLA 4R79A 1NM7A 3OYLA 3NMUA 2L7KA 2P7VB 2E2HJ 1F1ZA 4JX4A 1ZHFA 4NDLA 4KUIA 1IXSB 2WY8Q 4DSEA 3TO7A 1VQLN 3I59A 4PZJA 4FZXC 1TVRA 5L3GA 4NXMK 1WGSA 3CCLI 1S72Q 2ZGWA 1GXQA 4KHWA 3DLMA 3CCVQ 4U7BA 4UXNA 2ZFUA 4PSWA 5LJWA 2QWWA 1KGSA 1ORPA 2A6HF 4N56A 1ETYA 3AL0B 2WAFA 2IIMA 4JKBA 4D9JA 3WQTA 4A62A 4B3TK 2HEOA 2MAMA 2DRMA 1ETKA 3KEYA 5B5EC 1HLVA 3FDRA 3M8SA 2E19A 3KLEA 5AQMA 1XSDA 1WUAA 4FU6A 3BPXA 1ITGA 1S9GA 5E3MA 1R1VA 1GLAG 4QTRA 2JJ7A 1QQNA 2XF7A 2K27A 2CUFA 4BGAA 1K8AC 3OSVA 3CIPA 2ZXIA 1MUYA 3NH0A 2YDLA 5K5RA 1YS7A 2RQRA 1HSTA 4JHDB 1HBXG 2M8EA 4BR2A 1C1CA 1BBZA 3V9WA 1XPXA 2LKPA 2CS7A 1UE9A 1UTIA 4J9EA 1YIJN 5HDNA 2BZXA 3EG9B 5SWMA 3RNJA 1SAUA 2HAXA 4OLAA 2OJ2A 2BH1A 3I71A 3HL2A 2ZCWA 1LWFA 4MFBA 4ANJA 4HF2A 3BC8A 1G4DA 4I9LA 5GAOq 2M0YA 4EA5A 3REOA 3MQ0A 3OOUA 5BOXA 2E70A 2ZM6K 1BI4A 1TKZA 3VQAA 4ISGA 4XL9A 5F1JA 3KTQA 1HSJA 4WQ4A 2P5KA 1OULA 3UPUA 4KN4X 4OFHA 3ZX2A 2HHQA 3IL2A 2VGMA 1T3VA 3P5JA 4C1NK 3IAS2 3LAMA 4ENJA 3OYIA 4AHRA 1A04A 5H6RA 4CEEA 5KPZA 1CKBA 1V29B 1BC8C 3HOUJ 3PO3J 3M5AA 4JKCA 4KJZA 1T6SA 3ZQQA 2CH6A 2Q97A 2RK2A 3J7YP 1WH5A 3DTKA 2R7TA 4XBFA 5LJ5e 4ID1A 4OPKA 3CLOA 2FPDA 1ZBSA 1JXEA 4FJIA 2CV0A 3FKJA 3I0SA 3HXMA 3W2VA 2RI5A 3CBPA 2F48A 3VYHB 1R5GA 4M77C 3EGXA 1S6LA 4C8OA 4C2TA 1GLNA 3N97A 1Z9CA 4LNPA 3OYHA 4J9CA 1RAAB 2YJEA 2ABKA 3ZQFA 1P7IA 2RNJA 3CF5L 3F10A 2KSSA 2WFBA 2WV1A 3HKZA 3MDQA 3MVPA 4XLHA 1U84A 2F9WA 3GFJA 5HLGA 1RFQA 3M8RA 1VQ7T 2KP6A 3FXUA 2XMFA 1R7JA 3FLCO 2IGNA 1ZGWA 3IH7A 2NVUB 5GAEJ 1VAZA 2PQ8A 2E20A 1NK6A 2O9LA 4G12A 2PUKB 2QQBA 2HBJA 4LSLA 1QVGP 2X85A 4LG0B 4HX4A 4I7HA 3GUDA 1BCMA 1WQWA 1K9MO 3KLFA 1N34K 4C0DB 2ETJA 3K9JA 1NG9A 4XKBA 2FMYA 1NU0A 2D1HA 4Q5WA 2QEXI 2CP7A 2Q8KA 2LVSA 3VGKA 4CECA 5GAGP 4RM2A 4GYIA 1HDDC 1HX1A 4HW0A 2Q1NA 2G6FX 2HSEB 2VG5A 5GMKm 1VQNA 4BR9A 2X51A 1YX5A 1IUYA 2EYYA 2Z1HA 2IPQX 4M3FA 2JPBA 2YLBA 2K7LA 4B1YB 4RW4A 2WSFE 1HW5A 3OW2M 3G4SA 4GVMA 4RAYA 4Z89A 3ZMUA 3MXMA 4HV5A 2KY9A 3L6QA 1MW7A 1T44A 3RTRA 2FSNA 2VJIA 1XGSA 2A1RA 3OJSA 2YV0X 3HI0A 1OLTA 3NGPA 2R7DA 3KP5A 2D0QB 5DLOA 4BRDA 3J7AY 2LC4A 4CGHA 1MUZA 3S17J 4J7IA 3ZQCA 3H6ZA 3SAHA 1OCOH 3ZX3A 4QQGA 1YJNA 2DPUA 1BDGA 1YHQI 4RTXA 2RE2A 3HO1A 4L6V5 2W40A 5AQUA 4Z4GA 3F21A 5HOOA 4H5VA 3L1PA 2JTMA 4FVMA 2CUBA 1YOVB 4AMCA 3WGIA 3WNFA 2K85A 4IX7A 2P9UB 1PUFA 2DA6A 2D1XA 3TSUA 2K3YA 1FJGK 1JGGA 1WB9A 3MN9A 3O9SA 2HKNA 1XGOA 3ZP5A 3CCLT 2ELHA 1HK9A 4AHCA 4M77G 4ON0A 1G6NA 2DPPB 4B9VA 5DYMA 4I98B 4PJOE 3RYRA 4HX8A 4Z6YA 3I54A 4YNQA 2DYSH 3C18A 3M8FA 1V55H 3VQ7A 2R7OA 2IDOA 4Z8AA 5HS8A 3GP8A 2ZPIB 5J3BA 1VRLA 4ITVA 5ADXH 5FLMJ 1QZYA 1M1KO 1KQSP 2MC4A 3CCMA 1K4US 3JCMg 2Z2SB 4FWRA 2J5OA 1VQ6A 1HU0A 2ID3A 4J6XA 3WXJA 1C0UA 1XMOK 1ASVA 4OPAA 4M75E 2E34A 1IRGA 2RC4A 4XK4A 2W10A 2WY7Q 3KFVA 2EIKH 1BL0A 3HTRA 4WCEL 3GCMA 2CP6A 1MGQA 3FZFA 1XHXA 4PFOA 2A28A 1ON2A 2MLGA 1WSGA 2O4IA 3JCUC 1VSMA 2G8VA 4IOAL 1W5CC 3RYPA 4NB4A 1OPLA 2OV7A 1VQOA 3EGDB 3SUQA 2QVOA 3CW7A 1OH8A 3FEOA 2WC2A 1MKMA 4AQYK 3AVHA 4RDUA 2ROLA 3RIRA 4FJ8A 4C0ZA 4CHQA 2XAJA 5HLIA 2YHAA 3JRCA 2ZPEB 5TRDA 1BA1A 2ZSHB 4LG3A 4IUPA 1P7MA 3J81O 4CYDA 2QGUA 2IPOB 3GTPJ 4WQ4C 3T8RA 4BR0A 3V1OA 3ZT1A 1RNHA 4Z4CA 3X20B 4V19S 4EW0A 2JM8A 3VW4A 1E4GT 4XTZA 4B21A 5ILSA 5FB2A 3ZXSA 3JAMO 3JB9I 4FX4A 4DTNA 4EPCA 4A3MJ 1TOVA 3D7SB 2EWSA 3A8GB 3FR0A 4J2AA 4CJKA 2NVXJ 4BGBA 1T2KA 1I27A 3CCRN 1I6XA 2L01A 2O2OA 4S04A 2HEQA 3O6WA 1HLUA 4NCAA 3ZQLA 3PX0A 4DSLA 3ZQIA 4WFNL 1S72I 2GFAA 2MH2A 1Z05A 2DNUA 3NRVA 1S22A 1MPGA 7AT1B 4JHDA 2EPDA 1HYSA 1MBEA 4A53A 1UOCA 3KLHA 2F5CA 4UY8I 3R9PA 3D0PA 3TABA 5C3EJ 3F8FA 2VWKA 3FXKA 4A69C 3CCUA 4OPHA 2VQEK 3IKTA 2G0EA 3AO2A 1LUJB 4MO5A 1HMVA 5EJCA 1SV5A 2VJ4A 3VGLA 2ZNZA 3BR1A 2EV0A 1WDXA 3ZSWA 4OMYA 4RMOA 4M71A 5ILVA 2DN0A 4PJJA 4KH6A 3I56A 2QEXT 1RZ4A 1I6HJ 3M54A 4K8ZA 3OW2P 3M0RA 1H8AC 3GTGJ 4C8LA 2E1YA 1QSSA 2BHZA 1I3AA 1SSHA 4FE4A 1UG0A 2ITMA 2HF4A 1J3TA 3J7ZI 4CF1A 3Q7BA 2WSCE 1BIAA 1T6CA 2BOLA 2OUMA 1WXTA 3HJFA 3CCEQ 1JKPC 4G6QA 1YLFA 4G7HF 3QDKA 4X6AJ 3ZN1A 5TGTA 3DBHB 2DFIA 5HCKA 1IN7A 3MEEA 4JYKA 2QQSA 3URGA 4J7FA 3OSFA 5LJ5j 4XRSA 2K9QA 3C6TA 4QS7A 1ZSZB 1UG2A 2VT3A 2DA5A 4HEA2 4C92F 3KE2A 2A6AA 5IP6A 1ZLJA 2W6KA 4B3XA 2DKGA 5T7BA 4FK4A 3CCLA 3EKSA 3G6EA 1FIAA 4CFCA 3H5AA 1SL0A 2HTJA 1Q1HA 2P5VA 1ZA2B 2DYIA 4M3TA 2KRHA 1I3QJ 2NUTB 4J9GA 5CKHA 1L3VA 3AVCA 4CJ7A 4H0EA 4PDKA 4LG0A 4B1RA 2H8HA 1RC9A 2EFIA 2VB6A 1OQKA 4L9VA 4B8AB 4R56A 4E7SA 1X19A 4AIDA 3BQZA 4HNTA 3JB9J 3BCAA 1M90O 5GAN2 2C6YA 3VEVA 2LBFA 4BRMA 3CMAQ 4LXCA 1UHFA 1X4OA 1YJWQ 2CYZB 4EEFG 2RDPA 4J9FA 5DDGA 3R6SA 2WAQA 4BHPA 3L3VA 4MDBA 5J4VA 3X24B 3DOKA 3J8AA 1RRJA 4GY5A 3CD6T 2DF6A 4CJ3A 4DR4K 4BR5A 2LQ8A 1GFCA 4DV5K 2MA3A 1RTJA 3AO5A 4HXJA 1QSLA 4KRTA 3RMCA 1U5TB 4O8KA 4JRIA 2FOWA 3A03A 3QNOA 2XB0X 2E3HA 3CMET 4RGUA 3L2WA 1JCFA 4BACA 5C0YA 1T33A 2ZXWH 4X62K 1TZLA 3QYEA 1MZBA 3AVJA 3MN2A 3FXRA 4M75B 3R0JA 5DCFA 3M0SA 4H0OA 5FDLA 5GMKl 4A4EA 1OX9A 4KT6A 4KAZA 2R3SA 1H9GA 1SFKA 3S3MA 3VEWA 3O9RA 5EXWA 3WG7H 3FLGA 2ECCA 2L5QA 3MO8A 3M1CA 2J05A 4JRKA 2HBPA 1JLGA 3H8ZA 1U78A 2STTA 2P9UA 1KLMA 4Y52J 4BYYA 1YT3A 1PD0A 2M2EA 2V7FA 4JLIA 4IG0A 2HL5C 3D6RA 2IA0A 2A5WA 2MD0A 2E1OA 2Q2EB 2X3XD 9ATCB 2L2PA 2IC3A 1F43A 4LJZF 3JCMf 5HKCA 8ATCB 4IOCF 2JXBA 3CC2N 2K79A 2RQQA 3RPUD 2O01E 5KQDA 2WWYA 5AQNA 1TL8A 3MZHA 1Q82U 5IT9Z 1JJ2A 1HQUA 3M4GA 3VQQA 4UVCA 3CC7A 2V1RA 2OCCH 3CCSN 1RACB 2LX9A 2CGKA 3C65A 2EYQA 3CUQB 4MO4A 2FBXA 3IUOA 1KC8C 1ZRDA 1YXQA 2X6WA 1EWRA 3LWMA 4DSIA 5AQSA 2FRYA 4CHYA 3AL0C 1S72T 5FJ8J 4LFCK 3VYSB 4CSWA 5CQGA 1H8KA 2OTJN 3FFKB 3X2QH 5KN9A 3ASNH 4H8KA 1YI2T 3TAFA 1YJ9Q 2QEXA 2FE3A 1ZQ1A 2L8DA 2G8FA 1Z3YA 1VSIA 4QOZB 4B9WA 1ZXOA 2YUNA 4EV0A 1X3WB 3EGDA 1X3ZB 2NRZA 3LFUA 1TNTA 1RR8C 1IJWC 4WE1A 1ZR2A 4PGGA 4LLNA 4AVPA 1W36D 5HVQC 3CPEA 1MBJA 2KIFA 3MWPA 2EZLA 1IRXA 4M7AB 2M34A 1JEGA 2E4LA 2HDAA 1CXQA 3OYGA 3OMGA 2JA6J 3VEPA 4DR1K 2ELJA 4DV6K 4ELVA 2RPIA 1E6HA 1UGSB 4C5IA 4FPBA 1S29A 2ZJ2A 4HNVA 3EFSA 1G83A 1GXPA 4D1QA 5BPLA 2EIFA 3TU5A 4M7DF 1L3UA 5BR9A 2OJED 3MMVA 4K11A 1YHQA 2D2WA 3JRGA 1K8AU 1B4AA 1ZBUA 1JBMA 2V9KA 2QI2A 3C94A 4PJOF 2OPTA 3HPWA 2D9TA 3NARA 4VUBA 3GE1A 1OQYA 4DTJA 2X6SA 1OYYA 4M72A 2E1CA 3PVLA 4NL2A 3QICA 3SLCA 1SVOA 1P6RA 1RCHA 2L2OA 2EA2A 3D2EA 3ZSQA 3TWHA 4LF5K 3THWA 1U0JA 1IV6A 2VQFK 5FPMA 3HFNA 3L1AA 5KGXA 1U2VB 5EEGA 1B7TA 4F7UE 2A6EF 1DU0A 4DNCA 4LD5A 1VOMA 5CZ2A 5FO5A 5LGTA 5J8CA 3SQ2A 1RBUA 2M51A 1WPYA 4F04B 3OJUA 5GJWB 5E18F 2FXAA 2DFUA 5HLFA 4HKEA 3BF3A 2A5XA 3CC4Q 3V42A 3HXLA 1IO6A 5L3BA 3GX4X 4MDAA 3OA6A 4J8FA 3HUGB 1SVLA 3QPTA 4IF4A 4L9JA 3ULEA 1J9IA 1ZAOA 4I6ZA 1LVKA 3K2ZA 2A68F 4X0GA 2NS8A 4GV3A 1IV0A 5TJJA 1SKUB 3S16J 2CP2A 3AO1A 4NC7A 4YRVA 3LL7A 1SS6A 1CQTA 3NNQA 4DR6K 4C0DC 2HU9A 3Q5FA 3FK7A 4CEFA 2VODA 1W0TA 4RCCA 4H0YB 4OMQA 3HT3A 3TAPA 2AK5A 2YG9A 5CJ9A 4LF8K 3VSLA 5AQYA 2DMPA 1IHWA 4B23A 2O7OA 2M0MA 1KSWA 3JXUA 1ZGAA 4LD6A 1JLFA 1X6BA 3AO3A 5CYQA 3DU5A 1W2BM 3GW2A 2LCLA 3ZQGA 1FP2A 5BREA 1XNRK 2BVMA 3I55N 3CCEI 3H35A 1DPRA 3QYBA 2E5ZA 5FFXA 4IEEA 3GTJJ 4XLEA 4GV9A 1VQNN 1I07A 3MKDA 2RO0A 2JUCA 2W0ZA 1WAFA 4QQ6A 4YOYA 4MFDA 4CFBA 3ULRB 3FBIB 2NUTA 3G4SN 3S1NJ 4CBUA 4Q5SF 4CFAA 4AILC 1ORNA 4JI5K 2MLKA 3ULQB 2KIMA 1W70A 1M8MA 2NUBA 2QCOA 2X9DA 4Y33A 1VF9A 1RAGB 4CZGA 4K2EA 5JS2A 2Y0MA 1S1WA 1DUXC 3WXLA 3QJYA 1RUNA 4LMYA 2OPQA 5LL6S 3E9LA 2J06A 2E65A 1G15A 2DPDA 3CCVA 3O3HA 3R0AA 3PUFA 5F27A 3EEQA 2L9RA 3G71Q 2HQ5A 2IS2A 5CQEA 4AFUC 1YJNN 2MSYA 4YPHA 3SJMA 3IG1A 1WJEA 2WTEA 2XF5A 1B9DA 1PVSA 2B5JA 1K7AA 3OYMA 4YDUA 3SAGA 4IFEA 1JQQA 3OBWA 3BOQA 1HW1A 1QU3A 1JHHA 2VONA 1B72A 4M74A 2E6LA 1IG9A 1ZUKA 3PVQA 1VQPQ 3QLHA 3A5LC 4BHCA 1KO9A 2F2VA 2YUQA 1U5TA 1FLIA 4KMFA 2V79A 2AXLA 2V51B 3CMAI 1JCGA 3BTIA 3FISA 3CJ9A 1YJWI 4HA8A 3CM5A 1FMWA 1BISA 1HF0A 4EMHA 1QZEA 3K1MA 3LDNA 2F5EA 2IS4A 3I5SA 5I9EB 1SKWA 1NGAA 2XPWA 4HSRA 3SCXA 2K9GA 4CHZA 1BW6A 1N78A 4M75A 3HYIA 1OCRH 1X1PA 3E9OA 4LFBK 3C1DA 4X64K 4O44A 2HBMA 5F6FA 1O7FA 1WPKA 2V8IA 3VQ8A 2BE5F 4H5WA 1XSXA 1N6QA 1VSKA 4Y7NJ 1E0EA 2R7ZJ 2D8JA 4C8KA 1VQ6N 1G5VA 2X6XA 3ZEHA 1ZN2A 3WTZA 2JUFA 2KZZA 1R36A 1JB0E 4ATOA 1IUFA 2LTOA 4PSXA 2DK8A 3A01B 6AT1B 3PX4A 3GFMA 3CBMA 2Q2EA 2JSCA 2IG0A 4LFAK 3OHRA 5EEHA 5D6EA 5CPRB 1K9MR 2XAQA 1IXDA 1U8RA 3RRHA 3CJCA 2NUZA 1WHGA 3W2AA 2RD1A 5LJVA 2P0PA 3NAEA 1XC9A 3ROUA 1T8EA 1E17A 3CUQA 1EH8A 2CH4A 3R6OA 2JOYA 4B3RK 1YCSB 3PE0A 1K6YA 2FBKA 1XDUA 2DK3A 3C3WA 4OFAA 1V5GA 4WYBA 2R7QA 1IC8A 4CGFA 2W42A 1HKQA 4E7KA 5CYVA 5KI6A 1Q7YO 3VEOA 4BVOA 1TL1A 2W03A 4CFDA 3IRRA 3R3LA 1TYQA 2EFQA 2ABLA 2A1SA 4I02A 4HCCA 4F7UB 4M41A 1JHFA 5CQXA 4DQRA 1IH7A 1VQ5A 3QEXA 3TAEA 4CJEA 3LH0A 1LKXA 2I2LA 3ZSZA 5CVRA 4DV3K 3WU0A 4NC6A 1Z3XA 4KULA 1NK9A 1RDUA 1IZ6A 1SFEA 4RWTA 2FSWA 1IRZA 1YJ9I 2EFPA 4M3XA 3UR3C 2VOOA 1FYKA 1OPKA 1J2XA 5GAOr 4BJ6C 5FW9A 4PLIA 1KU7A 3VYTB 2RPNA 4M7XA 1BBYA 2Z9OA 1NGHA 3EFOA 4FT4A 1VQ8Q 2E1MC 1FN7A 4CJ5A 1E7OA 1BJAA 4CCMA 5J2QA 2XF6A 3FIFA 3EL2A 2JHJA 1Q9YA 3U23A 4HVWA 5K7HA 3M56A 4EMKB 5CKFA 2NOGA 2QW9A 3LDLA 3MWTA 2N8GA 2YJFA 1Q86C 4B9XA 4CCNA 2Z1JA 4ENKA 1S7EA 1UGRB 2HVHA 2MC3A 2ISZA 3R6MA 3OMYA 4CCOA 4FWOA 2I7NA 1S5JA 1E4FT 1XI1A 3QIOA 4E9GA 4BE1A 4LH5A 1DGRM 4RGXA 3TL4X 1QVGS 2KW4A 2XK0A 4A54A 4ESJA 1U2VA 3JRDA 1TNSA 1ZSZC 1PSEA 1XCVA 4M42A 1PSFA 3UKUA 2J4RA 3CCRQ 4RW9A 1IGQA 2DIGA 4KISA 4RW8A 3KK2A 5E84A 3KXTA 3F2KA 4YIRX 2L9VA 2LLKA 4XN3A 2DTHA 4A12A 1R58A 4Y1CA 2CWEA 1MA9B 2XY7A 2UXCK 5LLQA 2DFFA 3KP7A 1I0CA 3BR0A 2MWPA 4Y28E 4OPJA 1ZRFA 1R6RA 2X48A 3MX2A 3RQIA 3GLLA 2ZKZA 2PN6A 4CZIA 4AHSA 2RV8A 3CCLN 4ZDPA 5J1YA 3SXYA 4FASD 5F2RA 2P6TA 1SG5A 1GBQA 3FZHA 4BAYA 2UUZA 3F8BA 4HBLA 5AFUA 3MEVA 3CC4I 2EKOA 2VWJA 3K4KA 3V1RA 5KQ8A 5E79C 3ZMTA 3HPOA 1SRLA 4CHOA 3CMAT 1N8RC 5EF6A 1YJWT 2EBIA 1I5ZA 1OKJA 4YDUC 1RRQA 5BN9A 5E20A 3TR8A 1EFNA 4J01A 5AQIA 1SAXA 3CXCP 2HB5A 2EQJA 3N0UA 3HVTA 2P81A 3PNTA 4CBWA 2PVGB 3PSIA 1SMTA 3QDFA 1OFCX 1M2VB 3FFIA 1IO2A 4WFBL 3LMMA 4ABZA 1ETWA 3OYJA 1KG6A 2FZCB 3KFWX 4LF4K 1MJ9A 4C92B 1B9NA 2AS5F 2PYJA 2J7IA 4DV1K 5FROA 3IRQA 2D0BA 2ZJPF 5AQOA 3OOPA 4DYCA 3GPLA 1WHHA 3TVTA 1WN7A 2QGGA 4EM2A 4QVCA 1MV3A 3RR8A 2LQKA 3T8TA 3DLGA 3KIOA 3EE9A 1D5VA 1MUNA 3AA2A 3ZYYX 3SEMA 4AFQC 4EJVA 1KQSS 1HJRA 2X78A 1NLOC 3HSEA 3AVKA 1S7AA 3BZCA 3SZPA 4YHHK 1LDKB 5C6SA 2BW3B 2LNVA 3TTDA 3C6UA 3KYLA 1OR7A 5LJ5f 5I11A 3AGKA 3P1GA 4LUDA 3KEQA 1R8OB 1QZ5A 1SEMA 4C8QB 3K5LA 4NO7A 3BG3A 2KT0A 5HRNA 1BA0A 1P2FA 4JKGB 1J53A 4OVLA 2A07F 2RNAA 3S6WA 4CK2A 3PMIA 2DMNA 3SI6A 1Y96B 2VASA 4XTUA 1IXCA 4FWMA 3GXOA 2LH9A 2EWNA 2CS3A 3CUQC 1PRMC 2OA8A 1WXUA 3I0TA 4HTUA 4CJFA 4DLGA 5D5XB 4KO0A 3G71I 3DTEA 2OZSA 3O4QA 2JNGA 4HSBA 1LCKA 2FQ3A 5KVRA 3BG7A 1ZX6A 4KHSA 2PX9A 3KZZA 2IBDA 2JTEA 1FBSA 5FU7B 2ESWA 2P4WA 2PJPA 3BZ6A 1B8IB 3U9DA 1VQPI 3JS6A 4WXCA 2R5YB 2A41A 2ZMEB 2QWOA 4MMLA 5A0LA 5JHUA 1U3OA 1YJ9T 3C0CA 3G1LA 4A63B 3D5RC 4Y15A 1JUPA 3IQLA 2QK0A 3KUFA 3UNGC 4MLEA 4JRPA 4PJOD 1JUSA 3E1SA 2E7WA 5AQPA 1KC8U 3PNVA 2GOMA 1W7AA 2VL8A 2QEXN 1XS9A 5J26A 2YUPA 4R0KA 4M7AC 4KV8A 3CCEA 2CJJA 1HOMA 3VKIA 1T56A 1PHTA 2XI9A 1FMKA 4DQSA 3VENA 2I7PA 3CQ8A 2E1ZA 1GRIA 5K5QA 4OMFB 2LK2A 3F70A 1TWCJ 1VSJA 1NG6A 5A0DA 1YUWA 3PIOF 4M75D 2OZMA 4FJKA 3P9KA 1FJLA 4J83A 2HOEA 4CF9A 4B9UA 3EHQA 3RMDA 3I35A 1L0OC 4S05A 3CC2Q 5D6XA 3CHWA 4ESFA 3INZA 3BR2A 1IV8A 4KH0B 2EH3A 1OZ3A 4EATA 2VUMJ 2W00A 5DUIA 5BRDA 1TW2A 1OJLA 3QWYA 3GZ5A 4CGDA 4YIIA 4F3OA 2LY1A 3CPWA 3HHTB 4RBOA 3OW2S 3JCMd 4EHUA 3KP2A 4ZTJA 4A3JJ 5C12A 1QZZA 1HD3A 2V26A 5C2FA 1JI8A 3SD4A 2Z99A 4BQNA 1BQMA 2A3ZA 3A0BC 3AVMA 1O3QA 3CFRA 4YOWA 4FYDA 4F7UA 2FO0A 2OTJQ 3RKQA 4FZYA 1VYUA 2VQHA 2V8JA 2IS6A 3AFHA 3LPTA 2WADA 3H36A 4BNCA 3CCJA 3AA3A 2L89A 4ZNXA 2P51A 1X4PA 2NOBA 2PU9B 3L0QA 5ED4A 2BGGA 4CF0A 4RG2A 2Q1ZB 4E7HA 3H08A 3HOYJ 2KEAA 3P8BB 5IXBA 3CC4T 2ELKA 1PNJA 1ZG1A 4KTWA 4A3KJ 4XU1A 3RPQA 3E5XA 1QKWA 2FBYA 3SZGA 4RGRA 3JRBA 4EMKA 1VA7A 1B1BA 4Z2YA 1VFCA 3P8HA 3CD6N 3G1JA 5BMZA 4KICA 4NQWA 3TDUC 1MMAA 2ZJPL 1KHCA 2ED1A 4OOIA 1HNVA 1OCTC 3V7SA 4E2FB 2I8DA 2HR3A 2VXEA 4O6JA 1VQ8I 5HODA 4W5NA 1TH7A 1RR7A 3MAQA 1M1FA 1XQSC 1ZYQA 1KZHA 3IP4B 3HOSA 1TK8A 5C24A 2E6ZA 3LWHA 3DLHA 2R7UA 4YOQA 4DR2K 4CI0C 3BGRA 3WE2A 3DBRB 3FHZA 1U1SA 5CE3A 2QM1A 1TUYA 3K4CA 5F64A 4A4KA 5CYMA 4M77E 2BE7D 1KFDA 5D3GA 2EQIA 4OMOA 2X6OA 1Y64A 3KWIA 1V4TA 2X4JA 2MABA 4KI4A 4FSXA 3ZT0A 3AA5X 2GQQA 2DL7A 3VMFB 2JRMA 2Y1IA 1OEBA 3EG0A 5M1PA 2XY8A 3TSZA 1AZEA 2BUDA 2OTLT 4L8RB 1T3LA 2XKOA 4BE2A 1J54A 3SAFA 4BRGA 1WFXA 4N9HA 3VRZA 5AIPA 3OA9A 3CCRI 4A3GJ 2YHTA 5FPNA 1PM3A 1VNDA 2NRAC 5B8HA 4B1UB 3KLGA 2K4BA 4HAMA 3IRXA 1OR7C 3MXIA 2P0KA 3H3UA 1KVAA 2FSKA 3U8XA 3QEVA 3PIPA 4MLHA 3HGYA 4CBXA 2P9PB 3G71T 2LYCA 2ZF5O 2YNIA 1GVDA 2HBWA 1AWJA 1PRLC 2DZCA 3EH1A 2GBQA 4JI6K 4ORZA 1V5EA 4A2UA 4WXHA 3HZJA 1YJ9A 3THXA 2D0PA 3MKWB 2FBHA 2R57A 5K5OA 3ATVA 2XRNA 2EFWA 3VN5A 1USTA 1S72N 4U0VA 5HK3A 5GAHP 4LC9B 4F17A 1NK8A 1VQPT 1M2VA 1AD5A 1ZC6A 2VC0A 3G3ZA 4M78F 2YHXA 1YI2N 1QP3A 2ZJRF 1SZ2A 1TG0A 2ACJA 1QMCA 2D6FA 2MD5A 1YITA 4H4MA 1T08B 4AIJA 3M3ZA 5DM6F 2NNYA 4CHNA 3S9HA 2EX3A 3RERA 4ASNA 3I55Q 3T0YA 3JCMc 1UAAA 3PIOL 2NOJB 5CZ1A 1RI0A 3QHSA 3S14J 3L7WA 5CVUA 4H0TB 3K4LA 1YN8A 1QE1A 3F8CA 2KYMA 2OD5A 1S1TA 4BQOA 2BW3A 2XSDC 3W3DA 3E01A 4BRPA 1UZCA 5JLWA 1Y57A 2P9IB 2TCTA 3AVLA 4J2BA 4C8QA 3QU6A 2AHJB 3UB5A 3AAQA 3I0RA 1X69A 3HBTA 3DOLA 4JKGA 1EJ9A 1VSHA 4QAGA 2AQFA 4RLQA 1PJRA 3DLAA 5KYXB 2JRTA 3ENOA 1U48A 1ZH5A 1JO8A 1ASUA 3VF2A 3A5OC 1GL5A 4E1MA 2HGCA 2D0AA 4LK0F 1TWFJ 1YX3A 3PMTA 4J5YA 4BQQA 1SSFA 3BDPA 1QBJA 2QUFA 2I0NA 3K0LA 1LWVA 4W97A 2JVHA 1LJ9A 2DW4A 3GF2A 4CD3A 2YNHA 2KISA 1WHJA 2IVPA 2HL3A 2CREA 2M1BA 2C06A 4NXNK 2JT1A 4A5NA 1NJIC 3MAJA 1ZARA 3SNNA 4CEOA 3FE1A 4DSFA 1B8IA 4L9TA 3O08A 2DJZA 3TAGA 5L3CA 3ZR8X 1OKRA 2R5YA 3MEAA 4BRFA 1OCZH 2ZMEA 2LZ6B 4CA0A 3S8PA 4PJ0C 4J8OA 4FWLA 1QVFP 3L09A 1WSJA 3ELKA 5GAOn 3FKIJ 4QSHA 3HM8A 3AVNA 2H1LA 2M0CA 3SHWA 3HTVA 5M5YJ 1RDDA 2OBPA 1OU8A 2RHKA 1XUPO 3V9ZA 2V6EA 4AHTA 2QDYB 3LQQA 4J19A 1YQMA 1GHCA 3MCAB 4P96A 4FHTA 2ROTA 1PU7A 1H1VA 5EZHA 4FETA 3VEXA 3RR7A 1NJZA 1KHIA 1M1KC 3O8VA 1OU9A 1JU5C 3U3GA 4LN2A 3P9CA 2MF2A 1T6DA 2L9NA 4I01A 3G0QA 1KFZA 4DFJA 4FW1A 4H5RA 5GAEP 2HVSA 5EZGA 4FYYB 1VQ8T 4DIQA 1SQKA 5B3SH 2CH5A 2HHXA 3M8PA 3CVSA 2YS9A 1WA7A 4FWQA 2HHVA 2JS0A 3R61A 3EN9A 4L5IA 3VS4A 1ZG5A 3DEWA 1YRNB 4KGVB 1AWXA 1SPKA 5FKMA 3SDZA 2GXGA 3KNTA 1NZ9A 3CC2I 3BY5A 1SANA 4M6YA 2GBZA 2WV0A 3ZQHA 4QPQA 3K5MA 4IUUA 4PJMA 5FD6A 5GAMe 1TKTA 1BOAA 4M77B 5IYCJ 2GNCA 2EYXA 1WEFA 2VT2A 1Q86U 2HYGD 2PQWA 3G71A 4ETSA 1TUCA 2E5QA 1SD6A 4CJ4A 5GANh 4P1WA 1N36K 2R5ZB 2DA3A 2VKVA 4F92B 1VQ7Q 3ASMA 1RT7A 3VS2A 2EIMH 2XU8A 1HJDA 1TV6A 2A7YA 2XKOC 2QWNA 1HQEA 3RRGA 4JRQA 1C1AA 2HMPA 2FHDA 3SFMA 3L42A 1RGIA 3QFUA 4GRIA 1NKEA 2ASPA 3BDUA 4IG3A 4U0YA 1FT9A 3LZIA 3DPLC 4N4NB 1K8AO 3V1QA 3QSUA 4OB1B 5DM6L 1WHMA 4PQUA 2CZ0B 1X27A 4PL6A 2EJGA 2HCKA 3AY9A 2L7ZA 5L3DA 1A5VA 2QK9A 4DTSA 3QYFA 2KIUA 3LYIA 1K73R 2DQLA 3ABKH 3LWLA 4N4GA 4KIFA 2BE2A 2CO5A 3I8BA 3WTUC 4WF9L 2X74A 3I8DA 3I33A 5FPEA 1RILA 5L3FA 1UHSA 2OU2A 4IHVA 4M3ZA 2EV6A 1Q7YR 2QBYB 4CJVA 2WTUA 2FOKA 4KHQA 1OZ2A 4C92C 5J4YA 3B6OA 2YNGA 3LQRA 4BKXA 5HNFA 1BOTO 5IHIA 2CP3A 2WBNA 4DUZK 2VG6A 1JJ2P 5E8GA 1N8RU 1U9NA 1SFXA 3RSEA 2QAZA 4KTQA 1O3SA 3R8EA 1FOWA 5EOYA 4C23A 1KONA 2FEZA 2PBIA 4ZYAA 4MTEA 4JDSA 4YG2F 3BY6A 3H46O 4FJMA 3IH4A 3VQ6A 4QKUA 4FIBA 2EA4A 2B86A 1ULYA 3RUXA 3S2DJ 1EA3A 3LSJA 3VYRB 2YPR