5FS5A

Breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNANSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5fs5A00
3ZL2A 3JWNG 4J3OG 3BFQG 4X50A 4AUJA 3JWNE 1PDKB 4J3OF 1ZE3H 2XG5B 5CGBA 4LOVA 4BUQA 4X5PA 3ZPDA 4AV0A 4AVKA 3JWNH 4AVIA 4J3OH 4XO8A 4X5QA 4XOCA 4ATTA 5FWRA 2XG4B 5LNGA 4XOEA 1UWFA 2JMRA 2WMPB 1TR7A 3RFZA 4XODA 1KIUB 2UY6B 5F3FA 4CA4A 4XOBA 4AUUA 5IQNA 4CSTA 5FS5A 2JTYA 4XOAA 5ABZA 4AVHA 1N0LB 5IQMA 5JQIB 3SQBB 1KLFB 3BWUF 1N12A 2VCOA 5LNEA 2J2ZB 3ZL1A 4X5RA 4AVJA 3MCYA 4AV5A 4XO9A 5AB1A 4CSSA 4AUYA 5FX3A 1QUNB 3ME0B 5FLUA 3BFWA 5AALA 5F2FA 4AV4A 2UY7B 5AAPA 5IQOA 2W07B
chains in the Genus database with same CATH superfamily
2O5ZH 4S1DD 3L8QA 1E3ZA 4QKTA 1AI1L 1AXTH 4P2OA 4PYHA 3L4VA 3TBWA 1EWHA 5FYKD 3S48A 1BZ7B 4JB9H 4XN7A 1IVLA 4PMEA 1F1AA 1FFNB 3DVIA 2X7LA 4PLJC 3RPIB 4G9FE 3GEWB 2OR8A 4YDMA 1LEGB 2E7LA 3VM5A 3QUZC 5D1XA 3RTQB 1U33A 1L6PA 1SNRA 2WQWA 2CNZA 3RVWC 5JR1L 1CI5A 4POUB 4MAYD 3TWCL 3HE7B 4P9HC 2QGBA 3PABB 2NNCA 2QKIA 3ZKNC 8CGTA 5E51A 1BZ9B 2JSFA 1BPLB 3IDMA 2ENYA 4LT7A 1P2CA 4JMXA 4ZNEE 1AD9B 3MGOA 2Z8WC 4UV7H 5C2BH 1NFDB 3QIWB 4NLAA 4XPGH 3GSNB 1OCZB 1RLBA 3P2DA 2H9GA 5F9WC 3KR3L 2QL1A 1PLAA 4OCWH 4BGDA 1P1ZA 3FO2B 3INUH 4QIRA 1FAIH 1RK1B 4AQAA 4KRNA 1CFBA 1I1CA 2IDSA 3VQMA 2D7MA 2H3NB 5KJ4A 4M6AA 4NRYA 1P9MC 4GAFB 4PY7A 12E8H 1BLIA 5BUGA 1NCCH 5C2UB 4LCWB 4RRPG 4PU2A 3QEHB 5T3XL 3NIFE 5EF1A 4PJ9A 2YXMA 3BZDA 1XB3A 3FU6A 1RUKH 3NTCH 3HNSL 3WMQA 4XMLH 2C1PA 5A6LA 2OMVA 3IMSA 3WS3B 1NC2A 1IJNA 3ZMRA 2DTSA 4X6FA 2Q7AA 4LHUA 3FT1A 3BUPA 1R17A 3LNHA 1TETH 2E9JA 4OZFA 4LNRA 4KK6C 4KOBA 4PRHB 4A7UA 5LLIC 3MXWL 4GLRI 1KIQA 3QIBA 2BMKB 4FKHA 3EOBA 3FUKA 4OGQC 3QISA 5JA9A 2YD6A 2J25A 3BSZH 2FEDC 4K07A 3ZE0B 2AEOA 4UT6H 2FHCA 1BYNA 4LAJH 4PJ6A 4LPXA 2C9XA 3LZLA 3BFOA 2X4OB 3ABGA 2FH8A 2F5BH 3DVFA 2RH0A 4G8GD 4JZOB 4BV1A 3Q8EA 2B7DT 3V6ZA 5JW4Q 1UHVA 2I32A 1D9KB 3S2CA 4JFQA 2O5ZL 1MDAA 3BX7C 4I9WD 1SY6A 4NQXB 1M42A 4LL4A 2YS4A 1XGZA 1KXTA 1NFDF 2HSIA 3AU0A 3ARGD 4JB9L 4JFPA 2C4FU 2VLRE 3MV7B 1IM9D 4PCYA 4ZS6D 4LPYA 3WGUB 5I5IA 4K3DH 4I2XE 4AEIL 4WW2F 1J0HA 1U4EA 1VEMA 4G3YH 1G9EA 3MNWB 3BH4A 3D30A 3KMDA 1L0XA 5F7BA 1XF4A 2GUOB 3K72A 5HD8D 5SWZE 5KJRH 3UADA 4JFDB 1OANA 3K6IA 4Z3GA 4UV7L 3IGKA 2FJSA 5C2BL 4XPGL 4OZ4B 2F7IA 1PTZA 4QTHB 3K3QA 5EEWA 4OCWL 4XNDA 1UA7A 2EXWD 4NPYA 3INUL 1FAIL 2A6JB 5FYLE 3JVFC 5FM8A 2AS5M 1O75A 2XUWA 4X0KB 5T5FH 2CHZA 5AWNH 3MV9D 4KKCD 12E8L 1CFVH 1NCCL 4L4TB 4L5FL 2NW2A 3ZGIA 2WW8A 3DDGA 3LD8B 5FXCH 3QRBA 2W94A 2ZOTA 2P5WD 3ZE0F 2WO4A 2CBOA 4F37F 2WLNA 3NTCL 3EO1A 3T1WA 1UWYA 2X4NA 4XMLL 4NSKB 3ETBJ 4PP2B 5AB2A 2DH2A 3Q01A 4QYOA 4P5TD 3MV8D 4FQXD 2PTVA 3DVGA 2EJ1A 3FB5A 1EBPA 3MJ9A 1TETL 5C0DB 3CFEB 2CCLA 4L8DB 4QRTA 1RP8A 3L9RA 1NGYA 4A7VA 1H0DA 1FIEA 2IWEA 1XHHA 4HK3J 4JR9H 4DZBA 1MCJA 35C8H 1VZIA 3ARXA 3CFIC 5T3ZE 4FZEH 4G8IB 4HUWB 5I23A 4I0PB 3BSZL 1EQWA 4QRUA 2V2TB 5J06A 3KJ6L 4HMDA 4UT6L 4E41E 3L9BA 3VWJD 1AO7E 2R2HA 1XL6A 1H15B 2AXGB 2OTUA 2F5BL 4R2GB 3GMPB 4PRIB 3HBGA 4UMSA 1ZS8B 4OZGA 4G8FA 1GOGA 3I6LD 4U1SB 4KDVA 2E75C 1I3GL 3EGDB 1TMCB 5IQMA 3E6FB 4JFUA 2G2RB 2O30A 4XVUD 4ZTPH 1ZLVK 4MNGA 3SPGA 1A9BA 3VXMA 2A4EA 2RB8A 3LQZB 4K7PX 2Q3AA 4K3DL 4JN1H 4U6TA 1NMBH 3ZE1E 2V8LA 4NO2B 1IVTA 4G3YL 2X9WA 1N3NA 5AW2B 4OCRL 2GI0A 4K7PH 3Q8FA 1GAFH 2L3BA 5EU6D 3S34H 5IGXL 1HSBA 4GQRA 2NY2D 3VFOA 5KJRL 2D2CC 2QBWA 1XBDA 3CX5J 1B0GA 1BFVH 4JHUA 4ZYKA 4XXCC 4KK5C 1P84K 1LNUA 1OSEA 4EBQH 1UTDA 1BQHB 3BIAX 5F7MC 1IBGH 1LLAA 3ATDA 3KNBA 4LLVA 3OR6B 4ZTOH 3Q2NA 4DKAA 1S7XB 1MFDL 1OGPA 2RGSA 3EH2A 4M1CC 3KXFD 3UFIA 5BVJB 3BQUD 2M26A 1QACA 1J9SA 2NT1A 5AWNL 4IRJB 3AS1A 1FJ1A 2EEXA 3FT0A 1MDTA 1NWOA 1CFVL 4N0CD 4LLMB 4GQPH 1YC7A 3EYSH 2OI9C 5KYXA 2M8XA 4UTBH 4ZX5A 3T6QC 4B60A 5I16A 2EQDA 5I8OH 3JTTB 3DSNA 1FSKB 1GC1H 3WNNA 4E0RA 3IXTA 1PZCA 2X53A 2W38A 3FHQA 2HZHA 3MUUA 4JFFE 5JQ6H 2O61A 1KYOK 2B77A 1IQDA 1LWRA 3EYQD 3ARBC 1BOGB 5FFLA 1WD8A 3NYKA 2GBTA 3OKNA 4HIIB 1LO5B 4U6VH 35C8L 5C09D 4WJ5A 3MRDA 4FZEL 4BZ1A 3FFDB 3I75B 5I6KA 1NBVL 5L2JB 2B9AA 1TU2A 1CDYA 5JHDA 3A6OA 3IKCB 2YMXH 5BJTB 4Y2OB 4CGUB 3O9WA 4DPCX 1KWKA 2J43A 3QORD 4QAMB 4MCZA 1MHEA 1U6AH 3X2QB 2IDQA 5AOMA 4IBLT 5IHUH 5GHWH 5DO8A 1UADC 1M7IA 3DLQR 2VDLB 2HLAB 2E9GA 2X40A 1U8HB 5BV7C 3VI4B 2YUWA 1ADQH 2CO2A 1TG8A 3GMLB 4ZTPL 1BQUA 3VGFA 3WXVH 5T33H 5EEZA 4A2DA 1PW3A 1JCKA 5FECA 3GKZA 3KH3A 1VERA 5AVUB 5C0CE 2LAAA 5JOEA 2Z7ZA 4BQCA 4OKDA 4XGZB 2CUIA 1NMBL 3KPPA 4ORGA 5IROA 4JO3H 1L0YA 1CFMA 3PJLA 4RMWA 2J20A 1BZOA 1XO8A 3B9AA 4OLEA 4K7PL 1GAFL 3FQRA 3CC1A 2C9UA 4XCNA 3KDMB 3RVXD 2X88A 3ZHDA 4P5MB 2K0RA 4A6YH 3QNZB 4FNRA 3RWEB 2V8MA 2ADIA 3D0LB 3NACL 4ZTOL 1H5BB 5IG7A 1YEHL 2Z4TA 2MFNA 3GXUB 4N2FA 1D5XA 4L3CA 2K7QA 1E28B 1ESOA 1K3ZA 1XMEB 4YHMH 5EBLA 3L7EA 4GIAA 2VM3A 5IB4A 3V5KB 4AV5A 3ESPA 2CE6A 4RGMB 5DU7A 3RL1A 4NQEA 3EYSL 2WTRA 3DO7B 4UTBL 1L3NA 1ZHNA 3OF6D 4M9PA 2V0AA 5D2LA 3TBVA 1DTUA 4ADJA 2YRLA 2J2ZA 3TEWA 3N85L 3KW8A 3AUVA 3MV11 3UTTA 4Y2DB 3DWTA 2CD0A 4NZ8A 4PJ5B 1GC1L 1THAA 5LO7A 2ESVD 1G7LB 1XV8A 5JQ6L 1UEYA 1UXSA 3NAAH 4APQC 2P5EB 3HG1B 1LQBC 4R0LB 2IALA 5CU9A 4W6YB 5EC2A 5I17B 3DX7A 2TRHA 5IVXF 2VSKB 2YK1H 4OIFA 4XI5D 4U6VL 2DEXX 1QQDA 1GYVA 2JFCA 2QPFA 3KPQA 4XP1H 1MEXH 2AZUA 4DPBX 3O41B 2YMXL 2VZVA 1OD7A 1NGWA 4DWHA 5EU5A 4M3JA 3PHQB 4JGJA 1OE1A 2CBMA 3SKJH 5GHWL 3WELA 4G6AD 2GTZB 4LSPH 3VDBA 1ADQL 5C7ZA 1G9ML 1KZQA 5F7YC 5K59F 3PWJB 5D7LA 3LS5H 4IJTA 3WXVL 5F3BB 4WEMB 1RJCA 3OL2A 3QZMA 1DQTA 4J3UA 1VF5C 3ZN6A 4K3EH 3B9KB 4YPGB 4ZUTB 4MJIA 2A4ZA 4DP1X 4JO3L 2MCMA 2K8QA 4JRXB 2XDHA 4G5ZH 3WDIA 2VE6A 1IO4C 2WTOA 2ARJB 4A6YL 4TUUA 4PRBB 4K5NA 2OCCB 2QEJA 3KPRB 1C16B 5DUMH 3QUZB 5HDQH 2R0KH 1SXCA 2ZPKL 4KKRA 1QTSA 1JCVA 2OZNA 2XY1A 1CVSC 5CLXA 2DMKA 4OFYD 1U8CA 2W9DH 2WBJB 2X28A 4ZJ9A 4LARH 1EIBA 4GKZA 4Y4FC 2AK4E 4JY6B 5DYFA 2FSEA 2Y72A 5JDSB 2DTMH 4HQQH 4PWEA 4PWKA 2YIHA 4V1DA 4Y1TA 1NOLA 3WO4C 1KYUA 3OHXB 5FO8B 3OPUA 4UQBA 3KYMB 3L3HB 2FO1A 2ZNXA 3PL6D 4IHBA 1GXEA 1CDCA 1NANI 1HK6A 2IBZX 4X9IA 3NAAL 1RUPH 2DOCA 3UJTH 3HR6A 3ZKXB 4N86A 2BC4A 2EEDA 3SOBH 5CCKH 3PHAA 3FB7B 4LPCA 2YK1L 5GGVH 5HVHB 4IKIA 2G3ZA 5TK4A 1DUYA 1TCRB 4XP1L 3VB9A 1MEXL 2IV8A 2F19L 1HQRB 5EU3A 4ELDA 1PEWA 4E2OA 2OTWB 5DJYA 1PX8A 3BFWA 3SKJL 3WKQA 3MN8A 2JCCB 1FCCA 3G9VA 3IPEA 4ZODA 4LSPL 1Z5YD 1P1VA 1KCKA 1W8EA 3NVQA 3IMRA 1A9EB 3LS5L 4GRWH 3VFGH 4KK9C 4Y9EA 3U46B 1EH9A 3HLAB 4WCYH 5E6SB 3GIVB 4K3EL 5C0FA 5DK2A 4C58B 3IFOA 1BGXH 2CAKA 4G6KH 4KDWA 5T1LB 2NSMA 3II1A 2PCFB 3MRKB 1MJJB 3O8XC 3VGAB 4O9HH 1P7HL 2UUDK 3BI9X 2ZUSA 4O02H 5IW6A 3CHQA 5DUML 5HDQL 2R0KL 2W81C 1XZ0A 3VH8G 1QLRA 1LJMA 4P2QB 3GLEA 4GAGL 1DVSA 2OW6A 3L3JB 1XQ4A 1KLUA 1TEYA 1YY8A 4ZXBC 4PJFA 2EYSB 3T3MB 3HLKA 3IGAA 3MNZA 4LARL 1A2YB 1VAHA 1KPRA 2JK5B 3RIAK 1U3HD 4OBSA 4G70B 2DTML 4HQQL 2A6DB 1I7ZB 4GQ9H 5DFVD 1S7UB 4EN3D 4LBEA 2D2OA 4XXDA 1XGQB 4JFYB 4NOFA 4XNMB 1ZHLA 5DZ9A 5BZDB 4N9OB 4FHKA 1M6OB 3NGBC 1WT5C 1QLFB 2HG0A 2IWGA 4NRZA 2JCCF 3TO4B 4B27A 3QHZH 1PQZB 3IAGC 1RUPL 4FFVD 3CQFA 5CGYD 4EUPH 2YPVL 3U6RB 1KCUL 3SOBL 5CFHA 3DA0A 4ZOEA 3VD2A 4PUBL 2VXQH 2W0FA 5LDUA 5GGVL 1T0MA 1O7VA 3KLDA 4I0KA 4MXVF 5CAYB 4WF7A 3KM1A 1RZ8A 5LGJA 2Q87A 3ENEA 5EBWB 3S4SA 3M17A 2CHDA 2OL3B 4YDJB 4M1DH 4KH2A 4U4BA 1FBIH 1KSRA 3HI5H 3E7JA 1INEH 3BAWA 3QDGB 5D1XE 3FT4A 3VFGL 1T7XA 1T2QH 4FFWC 2B3RA 2BK8A 4YIQA 5KYNA 4WCYL 4MMYB 2D0FA 2P43B 3MXVH 2GHWB 1KY7A 5FDYA 3BIBX 4K4KA 4KUZH 1A0QH 2A6KB 3EF7A 3VG9C 1HZHH 2D0GA 2JNZA 3LKOB 4IGBD 4G6KL 5MEOB 4R4FH 4B9KC 4F57H 5FA4B 4F7KA 5AOKA 4O9HL 5HHOD 4TKWA 4OI9A 3C12A 4JW3A 3U2JA 4GRLB 1BLNB 4F92B 4J7RA 2F5AH 3OKLB 1BVNP 2R4RL 4X0NA 3GSNH 5HVWA 2PO6A 5F7NC 4N0UA 2DI8A 1CI3M 1YPZA 3DRQB 4KQ0A 1KPVA 5E00B 5FOBA 3GXIA 1MHHA 1W8NA 2NY3D 2OXGA 4BBWA 1OGAA 1M3JA 4HJ0C 3LHAA 4MDIA 4M48H 1I7UA 1R47A 3GB7A 3MLZH 4H20H 4POZD 4D9RD 2PWHA 5CHNB 1XSJA 3DUUB 1M57B 4DGYH 1YA5A 2NY6D 4GQ9L 4K94C 3UBXG 3V4LA 2E59A 3EO0A 4PB0H 4ZMNA 1UB5B 1FN4B 1VZHA 2O72A 5C08D 3F5WA 4RETB 2Y5TB 4G9FB 3EGXB 5DEJA 4XNAA 4HZ1A 1UM6H 2ZSVA 5E6IA 4URKA 4DSYA 1K4CA 4BYHA 2Q3ZA 3ZTCC 3OGCB 1IBHA 4LPVA 3QHZL 1LMIA 3OKKB 2FTAA 2BY1A 3I85A 2WNWA 3KPSD 5D4JA 4A2EA 4JHVA 2VXQL 2F8IA 4QT5A 5DYOA 3WEAA 1U8LA 1HE8A 2B14A 3NCJH 3RZCC 2XLLA 1OO2A 4XHJD 3NJMA 2B1AH 4U1JA 1QSFD 5E1IA 5G4MA 3BT0A 5T1KA 3DIVA 3EFFB 4UQ9A 1J05B 4RCAA 1NC4A 2UX7A 4NHUB 2OBGA 1T1XB 4RAVA 3LYRA 5D71H 4M1DL 4HKBB 4JFXA 3KPOA 3ARBB 1FBIL 4EUPG 1INEL 1DQQA 5CJQH 3TCLB 5DF0A 3MJ7B 4LHQB 5DZLA 2YAEA 2AJ3B 3DTXB 3NIFB 3TN0D 2I9TB 3FDWA 2NNAA 3BUBA 4AIXA 2A0LD 1CXKA 1H6UA 4P23D 3Q2LA 4TNVK 3MXVL 1BVLB 3OWEA 4KUZL 3ARFA 4NKDB 1EHNA 4U6HB 1MIML 1VFAA 3QPKA 3R4DA 1DQLH 1WCBA 4F57L 1U3JA 5LXVA 4CDHA 4G1EA 1FNSH 3GMQB 2BS8A 3V0WH 5TDOB 4IRSB 3CZSA 1YDPA 2ENJA 3BD3A 3BAYA 5DA4A 4O2EB 4PTUA 2BSED 2F5AL 5DJXA 3UP1A 3SBPA 4ALAH 3CSYA 2HFGH 1KC5H 3K8LA 5FUOL 1E5YA 1FG2B 1ZSDB 3CZLA 5AW8B 2YGQA 3KCWA 2BSDA 4U3CA 2FEJA 3KYAA 2D8KA 2I26N 5D7JC 4HGWB 3DHJA 3WN6A 3HE7D 2VABA 1SGKA 1JWUB 4M48L 5EO1B 1MWAH 2AFNA 3MLZL 2Q8AH 2CPCA 2VIRB 3RNKB 4BH7A 5F9OH 3MRPA 4DGYL 3D85A 1NCTA 2ERJC 3D3VA 5A2BA 3QIWD 1U41A 4PB0L 5EBGA 3S5YA 1P7QD 3DBXB 4KK8D 1HHJB 4U3SB 3WFHB 3TYFB 1BFOA 1AQDA 3MTXA 4NPJA 4ONHA 1XEDA 1UM6L 4RNRB 1RSFA 4I2XB 1TTUA 1DQDH 1M4KA 3MI6A 1IGMH 3NT0A 4X98A 2X5PA 1CJYA 4LCWD 3VDAA 2ADFH 3ZQXA 5KSVB 3P4MB 1Z9NA 3NIFF 1FZMB 1FYHB 4B96A 3VD9A 2IAMD 5SWZB 2HN7A 4OCNC 1DVQA 4Z7WB 3NCJL 3A4FA 4S1RH 4GIPD 1C12A 2BSTA 1QWHA 4OZGE 1VIWA 5LAPA 2WC7A 5L8JB 4HCFA 4HSQA 5D71L 4BELD 3QAQA 3LKQB 1Q9OA 4MNGE 4LP5A 1CIDA 3QQ9C 5HI3D 1HAWA 5J0BA 3VXME 3STZB 3DV6A 3D4ZA 5CJQL 1S9VB 4M61A 5HDWA 5L4JA 3H9HA 2Q86A 1RZPA 1T22B 2OV0A 2EVFA 4FP8H 3NPZB 1BG9A 2JMRA 3U7AA 2V2WA 3NCMA 4HVBA 1NGZA 4HPOH 1H9DA 2FE0A 4AENA 5I76A 3ZO9A 2X41A 4HGKC 1CICA 1D9KD 4BSJA 4GJTB 3V4VB 3HC0A 2CR0A 2Y4SA 3ATFA 2AI0L 2PR4L 2ZT9C 5IB5B 4BKLA 1N64H 1M2VB 1FNSL 5E2UH 3LSOA 1WDAA 2EO1A 1G7JA 3FTGA 3LAFA 3V0WL 1D7BA 2ORBH 4LDOB 3SY6A 4PIBA 4ALAL 5J5EA 2PP9A 1TZOA 1PY0A 2HFGL 3HI1A 1KC5L 3R7RA 3ULSA 5FHAL 1J0JA 1ZKAA 2X10A 3KGSA 4E41B 5IEKB 1AO7B 3P3SA 1M1XB 1CXLA 2AQ2A 3MOBH 3CN3A 5CO1A 4IDLA 2FZ3B 2NDGA 1MWAL 4AIOA 3V5DA 4JFDD 4PJBA 4EXKA 3IMTA 1NM4A 5ICXA 2IBGA 2NX5D 4HMCA 4TN9A 2R39A 1H6TA 4R97B 3CFDA 5D5MB 5FWQA 3ZYJA 3UZQB 1CT8A 1DQJA 5HPMB 3TVMA 1DQDL 1SYVB 1IFHH 3ZE1B 1IGML 1DO6A 1PX3A 2BP0A 2B5IB 4MZ3A 4N9GB 4Y4FB 5FGSA 4L4TD 1LE9A 1AMXA 2Q9OA 4DEWA 3N9GH 2ADFL 4PAZA 3CFKA 3LQMA 3BEWB 3CSFA 4BCYA 5JHDE 1XIWC 2ADJA 4O51B 43CAB 1CE6A 1GRWA 3WO4B 4S1RL 4KZEH 4TTDC 3RVTC 1NLBH 2Y3AA 1P5UC 4WFFE 1EFQA 4OT1L 4Z0BH 1FLRH 3G04B 2XQBH 1RZJH 2X1QA 3GI9H 4MYPA 1VPOH 2R15A 5T1DH 1E5UI 4LKCA 1S9YB 3GWJA 4GSXA 5E5MB 2J6WA 4L48A 4KKBD 4OAWA 2V9UA 4JGMA 1QW8A 4DETA 3RWHA 4NQUA 3HZKA 4FP8L 3NA4A 1J1OH 3DURA 4EVNB 3MOAH 5ACZA 3Q9PA 4YQXH 4R2GD 2XKNB 3RGHA 25C8L 4LGRB 4Y5VC 4CC4A 5JW5B 2F6AA 3IJSA 3QYCA 2GBAA 3NQIA 5L88L 2EIMB 4JFFB 1OCCB 3D69B 4PJ8B 5FO7B 3QG6A 4PJEA 3RJOA 3FU9A 5FM5O 4QF1A 5I19H 1WYJA 4J39A 2ZUQC 3B3IA 5E2UL 2OMXB 2ODHA 2ORBL 2FH6A 3KYNA 5CEXB 3ERXA 2L4OA 3TZVD 1JXKA 3MFFA 3RBGA 1RVFH 1ASOA 1F3JA 4KKLD 2LABA 4TQPA 7CGTA 1SMAA 2H6PA 3FQNB 4R7LA 3ZE1F 2C3GA 4NQEE 1DN0A 1KYFA 3MOBL 3FU8A 4N8CH 5D2LE 3UEQA 4GFXA 3T0XA 3DK0A 5MEQB 3IXAA 4LLQA 5T1JA 1SLWA 3UTTE 3P4NA 1I8IB 1N0LB 1XGUB 2BY2A 2Y2TA 4KHTL 4HULB 4YHNB 5IOPA 3QE5A 3DMMC 1BQHG 2LU3A 3W38A 5DMIH 4DERA 4L1TA 5C0CB 5CUSH 5HYIA 2JXMA 4L23A 4KVNH 1M71A 1WF5A 3VXNA 1BX2A 1FNGB 2QVFB 3T0VA 5AKRA 3EJSA 3N9GL 5EBMA 5IJVA 2YR3A 3J7HA 1KLFA 4H8QA 1CVRA 3VQ2C 5IHWA 2Q76A 3RDTD 2NLJB 4WTQA 4RAUB 4CMMB 1NLBL 2QQKH 2B59A 1ZLWH 4EDWH 3FQUB 5E8PB 3GSOB 1JPST 1FLRL 2JI2A 2B39A 2XQBL 4QHPA 1RZJL 3C5ZC 3E1ZA 1VPOL 5D7LE 2J4WH 5T1DL 4YDLC 3DETD 5LWYL 3H9SA 4ZFZB 5ABDE 3HAEB 4OV6F 1HKFA 3MR9A 1EAOA 2FO8A 2ATKA 3OGOE 3P0YH 3QNXA 3TIEB 4C4UA 1K4DB 2DWDB 4MJIE 1MRDL 3V8CA 2WCGA 4Y4HC 1BBJA 1J1OL 2W65B 3D50A 4J3OG 4NQCA 3N40F 3MOAL 5KVGH 4M8QA 4YQXL 3VTAA 1DCLA 1XSOA 5E24E 4NUQA 3UTZA 1ZLEA 1U8QB 1MHCA 1A1NA 2JKJA 2FJHB 4KC3B 2KMWA 2B2XL 3W5MA 5DJZA 3RB7A 1QFPA 4PS7A 4YR6A 2NUTB 4HAGA 2NTSP 4MVBC 3H7BA 5I19L 1JPFA 1PX4A 3BVWA 4HUMB 4JQVC 3WY4A 5I74C 4WHTB 1K5WA 2J8HA 1RHFA 5GSVA 1F2QA 1G7IB 4S0TD 1RVFL 3ECQA 5HGBB 5I0VA 1L9MA 5LKNA 4S1SH 1MQ8A 5SWQB 2OZ4A 4M29A 3VG9B 4GOSA 1JFQH 2DICA 4V1DE 5E8EA 1KCVH 1AKJA 4M62H 4N8CL 5E5RB 3F64A 5D1ZA 4ZFOB 2NRDA 1E7UA 1I7TA 5I6OA 2BVQA 3WTXA 4ZUWA 4N25A 1W72B 4LHJB 4XTRC 2HVKB 3D0VA 3CFJB 1Z32X 1YQVH 1F4WH 4KVNL 3KEHA 4L3FA 5KBLA 3WNLA 2DPKA 4DKEH 2RBLA 1AQHA 1YMHA 2WXPA 3NPSB 3JT2A 2FL5B 3EXJA 2ZD0A 3QNFA 1X6NA 2YN5A 3LMJL 1FA4A 1V05A 5KS9A 2IBBA 3OAYK 2E7BA 4U1NA 1GH7A 2NMSA 3AC0A 1P6FA 2QQKL 2WGXA 3IJEB 4LDEB 3AS3A 4PJ5D 1OP9A 3SDCA 2TAAA 3VFMB 1I1AB 4EDWL 3S97C 1VCAA 5DTFB 2YD3A 4JFHE 2YGVA 2P5ED 3HG1D 5IMLB 2J4WL 4CU7A 5L8LB 3CZFB 5A7BA 4X5WA 3CX5K 4HWZB 3P0VH 3MRMA 1AIFA 1QO3A 2AK4B 4PRNB 1AH1A 4RDQG 3P0YL 1D7CA 3VSTA 1HNYA 3RZCB 2B3IA 2AK1H 2OS7A 4L8BB 3QJFB 3QJZA 3RP1A 5DS2A 3ZKMD 5KVGL 1A64A 1OB0A 4XN2A 1I4FB 1BJ8A 3QQNA 4QNPE 5GS1B 3WEBA 3ZRFC 1JZGA 3MLWL 4A7QA 3N06B 1OE2A 4D0CA 3N1GC 1KYAA 3TJPA 5CNHA 1G0XA 5H2BA 4YMPA 4AKOA 3W56A 4M8RA 3HS0C 4GXVL 4Z3HA 3KVPA 3AM8A 3WO3B 1JV2A 5ADPH 3UYPA 1XR9A 1JGVH 1T04A 3B9KD 4PJFE 4OR1A 3P3UA 3ISRA 3TBTA 1KJ2A 1VCBC 1W0WA 1JERA 4E9YA 3PXLA 2C5DC 4DO6A 1KCVL 4M62L 3A47A 2DWSA 1R5VA 4PBVC 5GPRA 1SVCP 2XBTA 3ZRSA 4CJ0A 3QK0A 4N28A 3W81A 2BY3A 2VLJD 3DGGB 2ATAA 1CLYH 3KPRD 5HI4D 1LK2A 5DHVA 1L9RA 4MNQE 2HMID 2WBJD 1GCYA 1OHZA 1YQVL 3U36A 3O11A 1OAZH 1FYTA 4I18A 2ICEA 3H54A 1WAAA 5D7JB 1KB5H 1IBYA 3C8HA 1DQKA 3ZKQD 4DKEL 3QQXA 2CALA 5I1KH 1LO2H 3KHOA 3GS7A 5B38A 4LLUA 2D31A 4ODHH 4A2MA 2EXYD 4LMQE 3D2UA 3O4LA 1KLGB 1AG0A 3EYFB 1QW9A 1G7HB 4FCAA 2ZCKH 4OJFH 5JUEH 4JN2A 5KSAA 3F12A 2YAPA 4BKSC 2XNAA 1JMZA 2QR0A 3EKCA 1DHKA 2NXYC 1FVDB 5DUBA 3P9LA 2X09A 1T5WA 3RGVC 5ID1B 4W6XB 2BIQA 1U8JB 1UFUA 3PY9A 3L9YA 2BHUA 3P0VL 3PQYA 3Q8BA 2Y1YA 3C08H 5IESH 4ES8A 3QUMA 4X5XA 1U92A 1WG3A 4YFLF 2QTVA 1MF2L 3VXTB 1KIUA 1KBVA 4JUTA 2UY6A 1K8IA 3BVNA 4K7FA 3PWLB 4YL9A 1KELH 4AYFA 4D8PA 1F3RB 1GGUA 4YL4A 2ED6A 5L7XH 3S5LA 2H6OA 3WNPA 4P8QA 5L4IA 3VGDA 3SPJA 3CXFA 2C9PA 1GGBL 2VMDA 3LS4L 5FB8B 2DWYA 3D18A 4N0UE 1QKZH 3GXDA 1YPZE 4BFOA 3K4AA 5FO9A 5J9PB 3VFRB 1YN7A 3EJUA 3RVVC 1IEAB 2KLTA 5CR8A 2BNUA 1JGVL 1OGAE 1MIEH 4ZPTB 3TNNB 1JZ6A 2XFXA 1AIZA 4H8HA 5AUMA 1TZGH 4LIQE 4MB4A 2VXVH 1HHIB 2IADA 5T1LD 2MHAA 3CN1A 3HFFA 4BZ2H 4P2OB 3VXSA 2EDWA 3TBWB 5DR5L 1WBZA 3MLRH 3OX8A 3GTVA 2X7LB 3NRFA 4YPJA 4YWGH 3QSKB 3Q6GH 1CLYL 5ICUA 5D1XB 4FXKC 4NBXB 4F7EA 3B5TA 1WFNA 3O2DH 2OW7A 4P48A 4PJXA 1I7RB 4Y4KA 1OAZL 1AS8A 1KB5L 1E90A 2QKIB 3ZK0A 5FFOA 4MKMA 3IDMB 1LO2L 1P2CB 1CZ8H 2YPLB 3US9A 4ODHL 2MQGA 4U2ZA 3MGOB 5CBEB 1TFPA 1EVTC 3IMVA 4KZDH 1O7DC 2H9GB 2ZCKL 3Q2WA 4OJFL 1P1ZB 2J7LA 1XT5A 4X8XA 3MRIA 3IJHA 4AQAB 1WWBX 1AKPA 4NRYB 1EV2E 4PY7B 3TO4D 4KAQH 1XFPA 5IMOA 2EDMA 1I8MA 4QXTA 4IBQA 1U9KA 1WBXA 4LZKA 2FATH 1AJ7H 1R6VA 3LEXA 4PJ9B 3C08L 5IESL 2MQ0A 2VSCA 1EZVX 3DYPA 3MRFA 2C1PB 1ZLUH 2OMVB 1ZIBA 4BUHA 2IG2H 3V0IA 2GJRA 4X6FB 3NEOA 5HI5C 4U49A 1KB9J 1KDJA 3VDCA 2GY7B 5DGQA 1BA9A 4OZFB 4LNRB 3QO0A 3L3GA 1SM3L 4AI7A 3UTOA 3QIBB 3SKMA 2IQ9H 5FF6A 3ARPA 1W8OA 2MOVA 3EOBB 4UAOC 1Z7JA 2QADB 3LRHA 3QDGD 5GS3A 5GGRA 4OZIA 1QKZL 2APVA 1TFHA 4UNIA 3SDAD 1T7YA 2KZBA 1B6UA 2YA0A 2ZXWB 1MIEL 2XA3A 1WUZA 1OK8A 1RXLA 2OMZA 3V6ZB 4RMQA 1TZGL 3T9WA 4JFQB 3ZUCA 2VXVL 4LSQL 4ZOBA 3QH3A 4BZ2L 2IDCA 3D3VE 4WTWA 1QSZA 3MLRL 4TSCH 1ONQA 4K9EL 1AS6A 3CFUA 4FF9A 4JFPB 4RH4A 3V0AC 4YWGL 4F33A 1AMYA 4GRLD 3Q6GL 3L4XA 1U91A 4XP4H 3FHAA 1SJVA 4H0LC 2HTLC 3EGSA 4NN6C 3O2DL 5E9AA 5CIPH 3UDWA 3UGXA 5DRWA 1OSZA 1DVZA 2ZWLT 4CAGA 3K72B 1KGYE 3MBEC 4FI8A 4MXWH 1MJUH 1BVZA 5DJAA 1SF3A 1CZ8L 1OP5K 4HEPA 5DRZA 4WI0A 1DE4A 2VAAA 1G84A 4KZDL 3POCA 1LTXA 2Z31C 4Q4EA 3G5XB 4H5SA 1MI5B 4ZW8A 4KBPA 4NPYB 3L48A 4G9FD 3DMMB 1MAJA 3IDJA 3B8SA 5KYUB 5D70H 5ICYB 1QBLH 3WI9A 2JV6A 1R3HA 4X6CA 1E43A 4KAQL 1MKFA 1HESA 2P8LA 1ILUA 2NW2B 4PPTA 1IC7H 2FATL 4HETA 1HJCA 1T83C 1G7QA 2OCFD 2D7TH 2X4NB 1DEEA 5GZOA 4AT6A 1BSIA 5B7MA 2IG2L 4U1KA 3NN8A 4OFVA 1S2EA 4QYOB 2G5UA 2EDJA 4PY8I 3DVGB 3FB5B 5KTEH 4J3WA 5IJKC 3QS2A 4QWWC 2JI3A 1H8LA 1EXGA 1USZA 4HCIA 1H0DB 4YDLB 1FWXA 2IQ9L 2NY0B 3D7PA 3LXUX 4DZBB 1XGTB 1DANT 5E0FA 5IIEA 5HJ3A 2P7TA 4MAYA 3P2TA 1TQCB 4QRUB 2BZ7A 4Y4HB 2R2HB 5HGDA 1SJEA 5T3ZH 3MKKA 3VSUA 2JJVA 3U9PL 2HFEA 4ODTH 4OZGB 4G8FB 3UOAB 3FUNA 5AD0A 3L6FA 2DH3A 4PJBE 5ADOH 5TK2A 5GISH 2AAVA 2BHYA 4TSCL 5D55A 1DQIA 1QNZL 1EAQA 3BKMH 1RMFH 3LKRA 4IRSD 1HIMH 3ARYA 2VDKB 3LIZL 3VXMB 1UGKA 4CSTA 2HVBA 1EXUA 2YOCA 3HB3C 4XP4L 4KOCA 4N8PA 4XMUA 2WV3A 4HS8H 3UP6A 1DBAH 1N3NB 3FTXA 3KLKA 2FYVA 4LVNC 4HUVA 1HSBB 2JH2A 1AANA 4GW1A 1IZKA 4MXWL 1MJUL 4CDGC 4OCLC 4ZYKB 1B0GB 2ZOUA 5E8OA 2YFNA 2DS4A 1LNUB 2YMTA 3KNBB 5B8CC 3RA7L 2XFGB 3QIUC 2VLRD 4F2MA 5E6IC 2CRZA 4OGAC 5D70L 4N2EA 1QBLL 3HFMH 4NCDA 1UXLA 2Q20A 3GK8H 4EEEA 5MEPA 1FJ1B 4WWNA 2GIXA 2EO9A 1FG9C 2E8YA 2NZ9C 3K46A 3TBSB 4BFRA 1IC7L 1QR1B 1GIGH 4GBXD 3RURA 5KYXB 4L18A 3P11H 4E5XB 5I16B 5SWZD 1OV8A 5FV2A 4ABQA 5A2FA 3EOTH 2D7TL 1JGLL 3WIHH 2AEIT 2R9HD 5F2FA 4AKQA 3DSNB 1MFCH 5C70A 3SYCA 3ARGA 4E0RB 1TJXA 3IXTB 4OZGF 3LN5A 1IM9A 1WAPA 3KGTA 1K5NA 2O61B 1CDIA 3FCTA 4PJEE 1D7FA 3OQ3B 4HS6A 1FVEB 1FZKB 3BT2H 5JDJA 4XT1C 2BERA 2NOYA 4UDUA 1F00I 2JKSA 1TT6A 3MRDB 3SZ6A 3WLWD 2WN2A 2JKTM 1TU2B 5JHDB 2F2HA 2XWDA 2BHFA 4AYID 5D2NA 4W9IC 3ZLQC 5T3ZL 2XV0A 4IRZH 4MCZB 2ID5A 1MHEB 2J71A 4JCLA 3KH4A 3U4AA 4ODTL 4XVJH 2X12A 1CFNB 1M7IB 4U7MA 1FE8H 5ADOL 4IS6A 5DFWH 3VWKA 4OI7A 3ZO0A 1TZHA 5AVRB 1DFXA 1RMFL 3C60C 2VTFA 3GJFK 3D06A 1ZEAH 3GSUA 1NDTA 3NSDA 5T3ZD 3VRJA 4PRAA 3BUDA 4ORGB 3KPPB 5JIPA 2WQSA 2DKSA 4HS8L 4E41D 1MNUH 1AO7D 2FLMA 5LBSL 2MNWA 2CWRA 3FQRB 4XCNB 2KZWA 1AHWC 1P7KA 4FQXA 4CILA 3ETSA 1LO4H 3ZGHA 3BKJH 4KJYB 4PRPA 3N41B 9CGTA 2ADIB 1CFTA 3DJSA 4MLIA 5IG7B 2WIIA 1F58L 2N4IA 4ZK8A 5DZOA 1DCEA 1D5XB 3DTDA 4L3CB 5EBLB 5GQBA 5IB4B 3F05A 3H9SE 3HFML 1A6VL 1MCFA 3L7EB 4BWWA 2F9BT 3GK8L 4ZQKA 2X9YA 1JXJA 1O6VA 4AH2B 3ZT7A 2WYTA 3RL1B 4FXGC 4NQEB 4ZSOA 3NRQA 2WTRB 5DVPA 3ZYIA 1ZHNB 3P11L 4KXZH 1T5XA 5D2LB 3TBVB 1UACH 2J1ZA 4NQCE 4CGTA 3EOTL 2J2ZB 3GC3A 3PP3H 1CDBA 2VQTA 4HOZA 1MFCL 3FUFA 5C7XL 1MCRA 1Q0XH 1VACA 4OQTA 1QFUH 1R1CA 3BSZA 3Q8CA 4N2KA 4DGVL 2C9AA 2CUMA 4XO9A 2HKAA 4WNJA 3QC6X 2CMRH 4Z7VA 2NXYB 2G9HA 2WXMA 1VRSA 1RPUA 1ETB1 5AYUH 2ZKHH 4AUYA 2IALB 3BT2L 1GJWA 4XN5A 3DX7B 1ZT4A 5H37H 3APMA 3T8XA 4Y2NA 1ZGLM 1QQDB 5EU6A 1HCYA 3TFBA 4FQIH 3KPQB 3ALWA 2VM9A 4OCSH 1IL1A 4IRZL 4LQFH 1NGWB 1CICC 5EU5B 4BH8A 4UQ2A 5AVYB 3W82A 4XVJL 3TESA 4Q56A 4KXZI 4LOUD 3IDNA 3HNTL 3RKDD 1CK0H 4MD5A 4N90E 1FE8L 1WCQA 4JFFD 5E0QA 4TUKH 3R4RA 1WZMA 1FDLH 1XD0A 3KXFA 3PDDA 4L3ED 3QZWA 5D7LB 1PDKB 3N41F 4FEIA 3Q8AA 4W1TA 3MGTB 2Y9RT 5MERA 3LKPA 3TXAA 4K5OA 3T8VA 9PCYA 1MNUL 4WNSA 3T71A 5I73C 5IB1A 1T89A 3MREA 2VSMB 1ZVSB 2P26A 2VE6B 4TQEH 1TJIH 2WXKA 5D2LF 2QJDA 2XTJD 4WDIA 3JV0A 4WV1C 5KS9E 2LT9A 5DHEA 2DI9A 3B2XA 3LEVH 4PBDA 4L8SA 2WXLA 1FZOA 2V5TA 4FXKB 3WJJA 5AZUA 3BP7A 1S5HA 3RWFA 5C0CD 1FC2D 3F65A 3GJFA 2DMBA 4BFFA 5C0AA 3B5GA 4GKZB 2N56A 2VN7A 4FZ8H 3WEXB 1I8LA 4JCMA 1H3WM 2O6FA 5LGHL 4IMLB 3BUQA 4UM8B 5I82A 5CCHE 3H56A 4NP4L 3SPIA 1UACL 5A2AA 5KG9A 1RH8A 4FG4A 4KDTC 1WBYA 2LTQB 1AXSA 2DV6A 2VL5A 1G6RA 1Q0XL 1QFUL 4QTIH 4X4KA 2HVJA 5J3HC 2RQ8A 2CMRL 4QHKI 2XKSA 3N43B 2ZKHL 5GJSH 2BC4B 1U93A 1MZZA 3FJTA 2NXZD 3GPEA 1HVXA 4IKKA 2M83A 3HAEG 4ZFGH 2CKBH 2R4SL 2EE9A 4FQIL 1ND0A 4M9OA 3SY0A 1DUYB 5GZND 3QZPA 3TT3H 4JM0A 1PY9A 4OCSL 5EU3B 5EOQH 3C09B 2KDGA 1FO0H 5H8DA 4LQFL 3AUWB 5DJYB 3ULUE 2PPAA 2ZKWA 4HK3N 3HS9A 1CK0L 4YSRA 4PW4A 2DMHA 4PLKC 4TUKL 1FDLL 5D6CA 5I6MA 4XVSH 3PIQA 4K15A 1X44A 4D8OA 3MLUL 1ZHBA 4GKSA 1URIA 3MLTB 3OWRA 4UU9A 1HEJC 1FYTE 3C6LA 5F7HA 2HT3C 5C0FB 1CE1H 1WAAE 3OF6A 5DK2B 1ZIAA 1JF1A 3IFOB 4Y9FA 2ZUVA 3TM6A 2ZYHA 5F72S 1MXDA 3O4LE 1THCA 1CWVA 2DYSB 4TQEL 3MVSA 1MCDA 1VDGA 1F6LL 3MPCA 3WCYA 3ROOA 5A40E 3TA3C 1OTTC 5FKAA 3LEVL 4AYSA 5IW6B 4YFLI 1FNAA 4BUQA 3MRLA 1NIAA 1XZ0B 5A2JH 2PW2A 1QLRB 1T6WA 2H2SD 1UJ3A 4E68A 4NC1E 1KLUB 1YY8B 3NIDE 4PJFB 3IGAB 3EDFA 3PQYE 1KPRB 3MBEB 4FZ8L 2IH3A 4GKOA 3FQXB 4KTGA 1KTCA 4RZKA 3OB8A 4LBEB 5DD3H 1GGCH 7FABH 3DI2B 4YAQA 2Z31B 5ANMB 3F00A 3KPMA 1ZHLB 2WM0A 3Q2VA 4J12A 1DBKH 5JYLA 3QEQA 1XGPA 4N1EA 2PPFA 1I1AD 4AQOA 4W93A 4MMZA 3O4OC 2ITFA 1ECYA 2Y0SA 4RX4A 1TTGA 5FKPA 4FKKA 4UBDD 3PFQA 3V7MA 2Z1PA 4G6MH 3UYRL 2W0FB 2AK4D 1BEXA 1CLOH 1IAII 1T0MB 4KMTH 3KVQA 5JORA 1ADQA 5LGJB 4FLOA 4ZFGL 2CKBL 1RZ8B 4KRLB 1AVAA 5ESQA 3AVEA 5CZXC 4LSVH 1UKTA 3TT3L 3S4SB 3L17A 5EOQL 3M17B 3TL5A 1FO0L 1XSKA 3VXSE 1XB6A 4GUQA 1WTGT 3WGVB 2A1WH 2P9RA 2WWMD 4MBRA 5KSBA 4QNPF 3FTWA 3ESUF 3AG4B 4PTTA 4C4KO 1AACA 5I0WA 3SYPA 4G11A 4CUCA 4JFSA 2WGNB 2VWEE 2QGDA 1NUNB 2W92A 4F5CA 3FT4B 3K0WA 3ILQD 2ZX7A 4JDTH 1YEGH 5C0BD 3N6YA 2I25N 1PU0A 1BXXA 2JJTC 3FU7A 4YIQB 3SE6A 4PJXE 4A6YA 1E3FA 1X5YA 1NGXA 1CE1L 2LE9A 4ODUA 4PJFF 3K6OA 2ZCLH 4XPBH 3GXFA 3CHRA 1R5IA 3TPUA 1B3IA 4LE8A 2XWJA 4PGCB 1MCEA 1T0NA 1UJTA 4I48A 5GS0C 5FCSH 3X1FA 2E6JA 4RSVA 1WRFA 5B1CA 1T80A 4N0UB 1YPZB 3AG2B 3HB3B 1G9NC 1N0XH 1KFGA 1KPVB 4PJDB 1J0KA 1RAMA 2DQCH 1UD4A 2OXGB 1GGIL 1OGAB 3GBLA 4MLSA 4LVNB 4MDIB 4PY8J 2VDNB 4N2BA 5GJTH 1UOLA 2WXOA 5EU4B 4YEEA 1QVOB 1WC7B 3ABZA 1JDAA 4ODSH 4MRCA 5DD3L 1GGCL 1FFRA 2BIMA 2JKIS 3EJTA 2YSTA 3Q2CA 1OZTG 3P0GB 4PM1A 2ZYSA 2B16A 3F5WB 3L4UA 2XPYA 2KZKA 5DQDH 4KRMB 2Z8RA 4AIEA 4PI2A 2ZSVB 5E6IB 5HYJA 5KJ7E 3QFJA 4U1MA 2Q5BA 1A6WL 2AQQA 1VENA 4OZIE 4MQTB 5E7BA 3K7UA 4XX1E 4XWOC 3RVUD 3G5ZA 5DYOB 1CLOL 4KMTL 4C8XA 3PF2A 1NIDA 2F1BA 4U1JB 4XC3H 2H3KA 3JUYA 4GAAA 2ICES 2VC2H 4K5PA 3WY3A 3Q1SH 1NFIA 4RGNC 5T1KB 1A6ZB 2HJLA 5C3LD 5I1LA 2AV1A 3FO1A 4K8RH 4U3HA 4DN3H 4HBCH 1XF2A 4ZG1A 4H25A 4CKVX 4RAVB 3QHTC 2A1WL 2H32H 1E9QA 2UV3A 2R56L 2ZX5A 3ETTA 1SJMA 3GUFA 4MMXA 4WFHE 5TGBA 1HL9A 1DQQB 5FLVA 4QRSA 1SY6H 4JHZA 2CXGA 5ENWA 4IOSD 3VTTA 2OKMA 4JDTL 2NNAB 3S7GA 4Q0XL 4P46A 5JIDA 1YEGL 1U3HA 1YPZF 5BZZA 3ZMNA 3C75A 2XQYG 3UAJA 3ARDD 3UX9B 1G6VK 3MRBA 2WMPA 1VGEH 4JPVH 1YJDH 3ARFB 1L0PA 2ZCLL 5CS7A 4XPBL 1VFAB 5IHHA 1WCBB 1I3UA 2H8PA 3FB8A 4GG8B 4G1EB 1W6WA 1A66A 3QNYB 3GM0A 4TUJA 3Q1EA 1YEDA 2KYIA 5CJOH 2V9TA 2N7BA 1IILE 4PTUB 1DLHA 4WUKH 5DJXB 3CSYB 2Z35A 5D1XD 2ZZUT 4X6CE 4XPTH 5EIIA 2NR6C 3BIKA 1OHQA 1RERA 5C0GA 4HXBH 1DLFH 2I27N 1G87A 1X5LA 2ROXA 3ISYA 4H7VA 3QAZC 3QUYA 2AV7A 2VABB 1O0VA 4KMLB 1E6OH 4QD2E 5GJTL 4BH7B 1TQUA 2GVYA 3PGFH 3D05A 4N8UA 5DJ0A 3TV8A 5BOJA 5D7IA 3MRPB 1HT6A 3D85B 3R7QA 4L4VA 5E1GA 3BZ5A 4IKJA 3RIAF 3D3VB 4CJ1A 4ODSL 2YPVA 1UD8A 5FYKE 4ECNA 5EPMA 3ABLB 4YN3A 3AABA 1T1ZA 3T0DA 3RE0A 3VFUA 1YYLL 4B53A 5FOJA 5IBUB 5KSAC 1IKFH 2GAZA 3QZOA 1AQDB 3LDBB 3KM2A 1KXVA 1A4BA 4X98B 3NSJA 3MJ9H 3DX9A 3FN0H 4Q74A 3EO9H 3OB0K 5EF0A 2NY1D 5A3ID 5CXPA 1LDSA 2KPNA 3BWAA 4H4NA 2MNUA 1DJZA 3I2CL 3FF8A 3FFOA 2HN7B 2JI1A 1B3JA 4OD1H 4LRIA 4XC3L 2BSTB 3ZDYE 1NC2D 3QBTB 2GK0A 4GAYA 5F8RC 1BVOA 2VC2L 1P6AB 3Q1SL 6FABL 5HHOA 4LHUD 4Z7OE 2V5RA 4K8RL 4DN3L 1XCXA 4HBCL 1XH0A 1R24A 4LHUG 2GITA 3D09A 4ZAKA 4RFNB 1Q9OB 5EU7C 3PAVA 3QIBD 4OZFG 3S36H 3SQOH 5C97A 2QADD 3QPQC 3WD5H 3H9HB 2Q86B 5FFGA 1RPQA 5MI0C 4P2CG 3KLSA 2VDKH 3IRZA 2V2WB 1G5AA 1ZRUA 4K8RD 1UXWA 4R5TA 4AENB 5I76B 1N6UA 2VZ1A 3VGGA 4Z77A 3U0TA 3WNKA 1VGEL 4JPVL 1YJDL 3V0FA 1CICB 3HC0B 2XXGA 4LPTA 2Z3FA 4M4RA 4C83A 5T3XE 4BKLB 3PLYA 1HCVA 3A6CH 4OM1H 5AAWA 3ZJAA 5DQ9A 1G7JB 3FTGB 1L7IH 2Y06H 4PD4K 5CJOL 4F2ME 3O6FA 4HS3A 4GSQA 1Y6KR 3QRGL 3FRPA 1F6FB 3HI1B 1BBDH 3ULSB 1UD6A 3KPSA 2H26A 4LOEA 4XPTL 4HOWA 5IEHA 4NENB 1E5AA 4HXBL 1DLFL 4TS6A 4XCEA 3SN6N 1B0WA 3D25A 3RWCA 5LBVA 2VOTA 1E6OL 3PGFL 2X6AA 3V5DB 3FCBA 1NBYB 4I9WE 3UBGA 3V8OA 4PJBB 1X9LA 2WVSA 4M1GL 1KYDA 3MMEA 4NQSA 5ICXB 5C92A 5F7DA 2MKWA 3FRUA 3FYEB 1KCSH 3EFOB 2VXQA 2XJKA 4PS4H 1IKFL 3CFDB 1KBKA 1GMIA 3VXUA 3N50A 4ICXA 1P7BA 4Q58C 1DQJB 3OLEA 1NCNA 3TVMB 1YZZA 4OVUA 3MJ9L 2BP0B 3FN0L 5AVTB 1A6PA 3EO9L 1Q9KA 1BZDA 1LE9B 3NFSL 2W1NA 3CFKB 3VFWA 4FFZA 2ADJB 1O9ZA 3THMH 2JLPA 1CE6B 5SWSA 5D2NE 1JL8A 4OD1L 3MBXH 2MSPA 2YWZA 5FGBC 3ZDXE 4BZ1H 2ENPA 3BAJA 4FCHA 4L9DA 5E6ZA 3CDYA 1KCBA 3MUGA 4QCIB 4PCSA 4LKCB 2C9SA 1MFUA 3S36L 2NY0D 1KN4H 5A1AA 3U2IA 4OAWB 1KGXA 4OD3H 3WD5L 3NG5A 4XP9H 1G94A 3RWHB 3HZKB 4P5RA 5KVMC 2VDKL 3DURB 3TFKC 1N6QH 3LHPH 5ACZB 1XH1A 5JOFA 3IJSB 1XGRB 3MJ8A 1P7QA 4IW4C 1BOYA 4NXKA 1WH0A 4TNVF 4BA8A 4TSAL 1NINA 2AANA 5DO2D 5KBDA 1WLHA 4L5FE 2VZ3A 4PJEB 4PJBF 4PRPE 1M53A 4OM1L 2C9RA 4QF1B 4WW2A 2P52A 2ALWA 3B3IB 2V7HA 1L7IL 3ME0A 2Y06L 3KYNB 3MRNB 3FBQA 3TH2T 3H3PH 3UG5A 3IAQA 3MFFB 2QMKA 5DURD 5GRYA 1IB5A 1BBDL 4PB9L 3L2LA 1F3JB 2JELH 2IAMA 3LQAH 3NP4A 2H6PB 2PWFA 3RKPA 1ZLVH 1N7ML 1TZIA 5DC9B 4ZSOE 5I6NA 1DN0B 3MYJB 5C0IB 3WMPA 1I8KA 2N0MA 4NNPH 1BIIA 3OC5A 3VVVA 3IXAB 3BZFB 4QHKJ 5FDWA 5E5UB 4RAHA 1Z0MA 4YSAA 1RSYA 1HXYB 1IARB 3MCG1 2WYHA 3TA3B 2Z9TA 3SGJC 4JFZH 1KCSL 5IOPB 3T2LA 1GZPA 4PS4L 3MA7A 4Z7VE 1YVLA 5CSGA 4OLXH 1I82A 2WOYA 4RSYA 1GYCA 3K5SA 3KD4A 2JXMB 5DD5H 2J73A 1XXDC 3GZKA 1GYWA 2QSQA 1M71B 1UWEH 3KS0H 5CEYA 1BX2B 1S7SA 3VMNA 4AY0A 4HUNB 5EU6E 4J1UA 1ZTMA 5EBMB 5IJVB 3C6SA 1H3GA 4ZRGA 1KLFB 4S1DC 3THML 2R7EA 3IWUA 4I3SL 1E4XH 1EMTH 5MP6L 4ONFH 3BRGC 4BZ1L 2GI7A 4ZZKA 5DD6A 5I8EB 5HP5A 4UTAA 2F58H 3F7VA 3KXFE 3O4OB 3VSVA 3WJLA 4PVMA 4BK5A 4PJEF 3UROR 4QRQB 2QVKA 3H9SB 4ZO6A 1KN4L 2XN1A 3MR9B 3QNXB 4I3GA 2ATKB 3JBG7 4KJPD 3CFBA 4CN4A 3GJEA 4HLZH 2DWXA 3LRSA 2BZDA 1E5CA 1N6QL 4NQCB 5DHMC 3O9WD 1ITBB 4AGOA 3NJJA 1FUNA 3UTZB 4XAKE 5AW5B 5FEBA 4WFFD 3TASA 2L0DA 1VHPA 1SEBA 1L7TL 2CO6A 2YD9A 1E4XI 3CU7A 4YR6B 3EBAA 3D4CA 3H7BB 3MA9H 4WWKA 5ERWB 1JPFB 2X0UA 1MWAA 1B4LA 1X6LA 1Y0LA 2YKLL 4BGLA 2HFFA 2XICA 3H3PL 1UZGA 2FEEI 2LU5A 5GSVB 3NJXA 1YEEL 5C0AE 2G4GA 3VD1A 2JELL 1D2PA 3HHSA 3UGUA 43C9A 4Z7IA 3LQAL 5IROD 3UC0H 4NAQA 3RJDA 4WTZA 3SCMA 3SEPA 4A66A 5E8EB 3PWPD 4EI5D 1JRHH 1AKJB 1M2OA 4NNPL 4S0HA 5D1ZB 3G6JA 3DNKA 3P3TA 2QSCH 1JS4A 3ES6B 4GP4B 1ROWA 1YO4A 1I7TB 1FIGH 2D73A 3DVNA 3KAAA 5I2IA 4OH2A 1AGBA 1F4XH 4NFDA 2BVQB 5I8CA 5D1QA 4ZUWB 1GY2A 3G6AA 4JFZL 5LUMA 1TJGH 4OLXL 3SE9H 5DD5L 1WICA 5F6HI 1JZDC 1D5IH 2DQGH 2N3JA 3B5HA 1UWEL 4RESB 3CVIL 1KCRL 1YMHB 5CILH 4U1GB 2G5BB 1A8JH 2KL6A 1A7BA 2IAAC 1EUUA 3FYIB 4IJ3B 5JTWA 1D5ZA 1LGVA 1E4XL 1EMTL 5KS9B 2J3SA 4ONFL 3UTTD 1O9VA 4U1NB 3ROLA 3W0WA 3ARGC 1E9OA 1CGSH 1O6TA 2VDRH 4O5LL 3SDCB 1GR7A 3D6GA 2VXUH 5H94A 2FEEL 4WQOA 2F58L 2AKRA 3FB6A 3TZVA 1WHPA 2J88L 4QYAA 4QHLA 3I3EA 1P69B 2Y1AA 4X5WB 1AIFB 1A14L 1QO3B 1SHMA 1X5XA 3B9EA 1VJSA 2YFOA 3S96A 5HD8C 3MROB 1HL5A 3TBBA 1VZGA 4XBPA 5M94B 4RGNB 1MLCA 2X4TA 4WSGA 5AW9B 4M7JH 2Y25A 3DO3A 2BY0A 4PJGA 4X99A 1YYMH 4OBRA 4AJ0A 2EXWC 2HP4A 1HEZB 4HCGA 4D0CB 1QRKA 2R59A 2D03L 5H2BB 4JMNA 4XE0A 3MA9L 5D7LD 5JPMA 1CTNA 4KKCC 2DEWX 2WLLA 1MCSA 2GJZA 3AGVA 1MW3A 1R3LA 4XE5B 5TJWK 4HLZG 5IMMA 4E9QA 1XR9B 1T04B 2YXWA 4MJID 3FT3A 2L04A 3TBTB 1KJ2B 4HYTB 3V0JA 3ZUNC 3RDTA 4F7PA 5JZ7D 3N42B 4P5TC 1B9ZA 1JRHL 3DO4A 4PGDA 3BSGA 4FQXC 4ELMA 1R5VB 5EZIH 4JJHA 3TURA 1U3NA 2GSGA 2QSCL 2IAND 3QQ4B 1N68A 2EYTA 1FIGL 1YNTB 5KS9F 3QEQE 4XMKL 1F4XL 1DANU 1M7DA 3WTSA 3E9TA 2MOGA 3GBEA 1LK2B 4XP5H 2MJWA 2FR4A 5DHVB 1UVQA 3SB3A 4XPHH 1J8HA 3O11B 1D5IL 2DQGL 3AT8A 1D6EA 4I18B 1CU4H 2ICEB 4XHQA 5I8KL 3BJLA 3VWJC 5BMFH 1SJXA 4J3XA 3B83A 3SGKA 5B38B 2D31B 4IU2A 4V1DD 1T4KB 2TRYA 3D2UB 3GMNA 3IDYC 1TEFA 3MJWA 3W37A 3CE1A 4KO5A 2Y7QA 1CFSA 3V0HA 1X5IA 4XVUC 4JN2B 2JKLA 1LD9A 5KSBE 5KSAB 2VDRL 3F12B 1EAPB 2O26U 2XNAB 2QR0B 1AG6A 4U2YA 4UI2A 4O00A 4YLBA 5DUBB 3P9LB 1T5WB 1JHKH 4F5CE 4BWUA 3CBKB 1JZIA 4F20A 4NS0A 3PQYB 1KEMH 4GI8A 3DXAB 4TQHA 1XGYH 2FT8A 4X5XB 1U92B 1NCGA 2FAUA 1KIUB 4IKNA 4DO5A 2UY6B 5C0RH 1QA9A 3HTLX 5KBPA 3BVNB 4K7FB 3K2UH 3H0TA 4AYFB 4D8PB 3BDXA 1O5DT 4J4PA 3N42F 5DUPH 3S5LB 3ULUF 1YYML 1ML0A 1GW0A 2BIOA 3QJHB 4JFHD 1AGFA 3JUZA 2BXZA 1DJHA 3BQUC 4M7LH 3Q0HA 4AJWA 3D18B 4WWID 4WK2B 1WUNT 3CN2A 5FO9B 4N0CC 1YN7B 2CXKA 3BAIA 1ACCA 2PN5A 2F74A 2YA1A 4XPAH 5I6XC 3ML8A 3ETBF 4X7SH 2XFXB 3IS1X 5AUMB 2F1AA 1WAAF 2XN2A 2IADB 2V5YA 1S7QA 2MTPA 2OR7A 3RVWD 4WIQA 1WBZB 3O3AA 3OX8B 2VDNH 5EZIL 2N59A 3BOVA 3MLYH 2BFGA 4FG6D 4JHAH 4TLTA 5HYJE 4UF7C 3I9PA 2Q8BH 3WJJC 4M8UA 3QFJE 4XP5L 4F7EB 4FAAB 1SLUA 1HTYA 4FLRA 3RZWA 2XVKA 2EDOA 2UVFA 3DROA 1CDUA 2L7JA 3QUKA 4XPHL 2UUDH 4BQBA 2XN9D 2NZIA 1LEKA 3NIDF 5BMFL 1IT9H 4PS8A 3QORC 1S78C 4DQAA 2BCKA 2PPDA 4EMZA 1IGYB 3AS2A 1MFBH 4H2AA 1HWGB 2KLRA 1OXYA 3X1EA 4A7GF 3N44B 3MRIB 3IJHB 2OR9H 2AJVL 5BW7C 3QDMA 1EJOH 3BAKA 1OGTA 3VFSA 5IMOB 1FL6A 1HDMA 1DJGA 2Y23A 1I8MB 4MNQD 4QXTB 1WBXB 1PZUB 1FVCA 3O45A 4Z9KB 3LEXB 2CM6A 1KEML 3HC2A 3PXHA 3MRFB 4LEOA 3OZKA 3NBNA 1XGYL 4BCZA 1AOHA 4GW5A 4NN5B 3T6VA 2YHGA 3S37H 5C0RL 2NY5H 2P49B 3HZ3A 3K2UL 1GKEA 2VLJA 3S4SG 1HH9A 1FV1A 5DUPL 1NCHA 2WOBA 3L3GB 2DQDH 2Y6SD 1Y6NR 4PHXA 5K1VA 1L9QA 1UQSA 3SKMB 4OLUH 2K1MA 5FF6B 1HYSD 4DT2A 3TOPA 2QSVA 4ODVH 4MCNA 5I1JH 1INQA 4M7LL 4OZIB 1ACYH 1NPJA 1PLCA 2FJFA 2NQDA 2AERT 3SDXA 1OW0A 4XPAL 4X7SL 4PJXF 1VFBA 4IBUA 1J88A 2OMUA 1Z0NA 2Z93B 5D7IE 1Z3GH 3N0AA 4L4VE 5EULV 1MZYA 2N01B 3GLAA 3ZQ9A 4ZQTA 1T4WA 4ADIA 4IIQC 5BZXA 1Z6JT 1ONQB 2VDNL 1B4JH 5HYFA 1JUFA 3MLYL 4F33B 4JHAL 1U91B 3N44F 4XNZC 2PO6D 2Q8BL 1JK9A 2Y2YA 3LH2H 3P40A 4XI5C 5DJ8A 3EGSB 4Z7AA 1UJ3C 4D0DA 5J8OA 4K0OA 3BPOC 3LPPA 1IAOA 5DRWB 1GC1C 1OGAD 1OSZB 4G42A 4Y0GA 3WEOA 1IT9L 4DKTA 4AVJA 2ZP9A 5DJAB 4GRMA 4WI0B 1DE4B 4N2NA 3AY4A 4GRWE 4G6AC 1MFBL 3TTSA 3GRGA 5HHOE 3W5NA 3OMIB 4P99A 2WIMA 2YN3A 5J1TC 1J18A 3IDJB 5SX4H 1SYSA 2OR9L 3VTMA 4ORZC 5GGRY 1R3HB 5EF2A 4X6CB 2RCSH 1EJOL 5HYQA 2CSPA 2P8LB 3QO1B 2AAAA 5K9QI 4OZIF 2B15A 1V8HA 2N7SA 3EIFA 1UB6A 1DEEB 3QFGA 4KI5E 3U4BL 4AT6B 3LN4A 5TDPA 4U1KB 5DHDA 1TKWA 3NN8B 3ZVVA 1V7NH 2K4AA 4D3CH 5T1KD 4D7PA 5BV7H 3VFPA 1E4HA 4H1LH 3S37L 2NY5L 3VMPA 1A6UH 1NC4D 1AZCA 1QPKA 1Q9WA 3QP3A 2DQDL 4Z7UA 5DI8B 2EXSA 5F7WC 2J8OA 4MQ7A 3FUHA 4R26L 5B1JA 5I1JL 3SO3C 2A77H 3GHEH 2P7TB 3IN0A 4MAYB 5HJ3B 3KPSE 1ACYL 1ES0A 1SUJA 2FLRT 4MYWB 3U7YH 2X6VA 1DVFA 2EIBA 5HGDB 1SJEB 4AV0A 2VRQA 4HH9B 4AYMC 4AWJC 5KBKA 3JWNH 2VN3A 2HFEB 3ARFD 5BRPA 1X5JA 2OAAA 3DUHA 3U79A 5I30H 4Z7OB 2KS0A 1Z3GL 3L6FB 3LNGA 1A9VA 4KXBA 1A3RH 2F8OA 4W9HC 1LWHA 1RZKH 2JKNA 2YUXA 3PL6C 3K6DA 1MVYA 3OAZK 1B0IA 1U42A 1KTDA 2DYPD 3A4AA 3LKRB 3NZSA 1B4JL 3CIQA 3NJKA 1S7TB 2QDVA 4W4OA 1EXUB 3VXUE 3GSWB 2JJWA 4G80A 3LH2L 4FQHA 3U6XS 3WDHA 1EXHA 3IAPA 4AEEA 4X6CF 4DP9X 4Z7QE 1M05A 2MWCA 5ISZA 4HUVB 5D6DA 2AQ1A 4GW1B 2XA8H 4J6IA 1EBAA 3AAZA 2D3NA 3E9UA 5SWSE 4UNVA 5E1HB 3D85D 1YMMD 2ZXBA 1SQMA 1UA3A 5D72H 4QJ5B 4F2MB 4XNQA 3ZDZE 5CCGE 1QBMH 3U0PB 3T2QA 1P84J 5IBUG 2C3WA 2ZOOA 2A83A 3OMNB 5MEPB 3SDAA 2RCSL 4YE4H 2JQAA 3ZZLA 2OLDA 5EF3A 1BMZA 2O6EA 1YG9A 4NUJA 2NTFA 2AQNA 2D9QB 3FUMA 4WU7A 1U8OA 3BDBA 3VXOB 3L81A 2FX9H 3SOTA 3RY5A 4D3CL 4WEBH 3KYOA 5ELIA 5BV7L 3ARGB 2WK2A 3ZDYF 4CVXA 3DC0A 3LN5B 1IM9B 2K6ZA 5AL8A 2OJZH 5KYWA 1A6UL 1K5NB 4Z7OF 3ZX1A 2A9BA 3FCTB 4YSEA 4J3BA 2MRYA 2IMNA 2FBRA 1OP3K 4Y9CA 2Z64C 4MZIA 4BZ2A 3RJQB 2RIKA 1MSPA 2A77L 4I4WA 2NYYD 2E7CA 3PE9A 3ZHLA 3IE9A 3U7YL 1BM7A 5CEZL 1SN2A 5DFVC 3TWYA 4YBQD 5AG8A 2ZF8A 4EN3C 1AZUA 1J8KA 1GY1A 4JQIH 3ZDXB 3W57A 2R1XB 2UY7A 4Q8BA 5I30L 3PNWA 4P07A 5CZRA 1A3RL 4GMTH 4IS6B 1RZKL 3VWKB 1QSEA 1XWVA 1TZHB 5EG6C 3KL0A 4FFVC 5CGYC 1HWHB 4HIJA 5F1IA 3GSUB 3VRJB 4PRAB 4HMEA 4KPHH 2QQNH 1TMQA 5KANI 1H8SA 1PKOA 2EC8A 2YD8A 5DC0A 4L2YA 3CHOA 3P73A 1P7KB 2GPZA 4ANUA 4FQXB 2E6PA 4BA0A 5AKVA 3MCLH 3I02A 1JE6A 2CBTA 4N20A 6CGTA 3CHPA 2MPAH 4Z3FA 3DHUA 3GXMA 5D72L 5PAZA 2WIIB 1RIVH 2XWEA 1N19A 3JTBA 1TLKA 1K72A 1QBML 1OSYA 3DSFH 1GA2A 3TVMD 4ZQKB 4Y1SA 4F80A 4ZO9A 1TZAA 2ZCZA 4YE4L 1OOAA 1DBMH 3LVEA 4ZSOB 2O6PA 4UM9A 4H13C 4E9LA 4R90H 3DHPA 1QZ1A 1T5XB 1KCWA 4KNQA 4IGBC 3IDYB 2AEWA 2FX9L 1OSPL 2AGJH 4OGYH 2FWUA 1E42A 2GABA 4WEBL 1LE5A 1VACB 3ZDXF 4PYGA 3FOMB 2OJZL 3PPEA 4Z7VB 5FYKU 2G9HB 2X2JA 3D48R 1UH2A 2GFBB 3GZQA 4QJ4B 4CC1A 5FHBH 4NNXA 4YFDB 1ZT4B 3T8XB 2W9EL 4Y5XA 2MCAA 1RZQA 3AXLA 5EU6B 2E3VA 2WXQA 1CR9H 4POZC 3AACA 2NY2B 2CKNA 4JDZA 3LIZA 2NY6C 3KW7A 4Q6IC 1IL1B 2ADGA 4KGLA 4JQIL 4BH8B 5BS0D 4UQ2B 3OG6B 2VERA 1FHGA 3G6JE 4QY8A 2OZ4H 4JRFA 3IDNB 1CD8A 2Z7UA 1QI5A 4MD5B 4PREA 4QHNA 1BWMA 2HCZX 4FTVA 2XZAH 1XZWA 4GMTL 5CIPA 5AAWC 3KXFB 5D1QE 5E1AA 3MBWA 3QZWB 4A2HA 4NKMB 5IREA 1MCQA 3BPLC 5FK9A 5EC1A 4CL7A 3KE0A 3P02A 1WZ1H 5MERB 1U4FA 2WCSA 3U7WH 3LKPB 1VADA 4GBXA 1OM9A 4G8AC 1W6LA 2FK9A 1E9PA 2JF1A 3MSPA 3QA3B 1DUZA 4KPHL 4ANXA 2PKDA 3FUJA 4XHJC 2QQNL 2WVVA 2BIHA 3FULA 4QXWA 2Q6WA 4Z23A 5IB1B 1MCLA 5SV4A 4DW2H 2IMMA 3MREB 4JO4H 2PCPA 4U1IA 4WDIB 3MX0A 1KJ3H 3MCLL 4PRDB 3W0WE 4ZX4A 1FI8C 4PWGA 1WA1X 4L8SB 4XP6L 3OJVC 2WINA 2XG5A 1E8YA 1RIVL 1S5HB 3BP7B 3RWFB 3S8WA 1INDH 4Z7VF 1SJHA 3TN0C 1NCWH 2DRUA 3OXSA 1UKQA 2WXJA 2A0LC 4UTCA 1A3QA 3DSFL 1BG1A 5C0AB 5GRVK 1GZHA 4NOBA 4P23C 1XTMA 1TVHA 1OM3H 1FNHA 3KLAA 3PGCA 4D0BA 5IF0A 2QHLA 2AJUH 4UQDA 1DBML 4B9JA 3FBKA 2ZOKA 3EZ8A 2J57A 4R90L 4E9RA 2QQQA 1PZ5A 2W80C 3U0WH 5EZLA 5KG9B 3G08A 1L6ZA 2AGJL 1AXSB 3P54A 4OGYL 2VL5B 1G6RB 4X6BB 4PJGE 1CF8H 3T65A 3H6AA 3KHQA 3A5VA 3CH1A 2HVJB 2WZ0A 2BPBA 4BHUI 1SPDA 1IQWH 2Z7WA 2XIBA 2XVLA 1NAMH 3GXPA 3IFLH 5FHBL 1U93B 3PWVA 1BQLH 4Q9CA 2GJJA 4JG9A 3HE7C 3OLDA 1QZNA 5F7EH 1ND0B 4P49A 3SY0B 3H7LA 4J3SA 3MNDA 4Z7NB 1Q9LB 3EG9A 3RI5K 3RUGA 3QIWC 3V52H 2QLYA 4XMPH 2MOQA 4EQ3A 4ELME 4KK8C 4L3AA 1KJ2H 2IFGA 2OZ4L 1X7SA 1DO5A 1LHZA 1D5BA 3I50L 4UANA 4WW2C 5LBSA 5D6CB 3IE4A 3MNVA 3ULUH 1S9KC 2QV2A 4ZD3H 3PIQB 3RYMA 2EICA 2QGCA 1ZHBB 4GKSB 5C07A 3NFPA 5JIHA 1WZ1L 4UU9B 1J8HE 3P69A 3Q3GB 4K3HA 3C6LB 2IAMC 5LAXA 1C8PA 1JF1B 2VLMD 5DHVH 1P0SE 4R5XA 4DW2L 1R9FA 1AKJD 2NUPA 1HCFX 1JZHA 4HJTA 4JO4L 1G0DA 2A7BA 4LLYB 5D1ZD 1J0YA 1NCOA 4IIQB 4NZTH 1KJ3L 1HAUA 4N90D 1N2RA 4HSAC 3WXWH 2IOMA 2LLNA 4KU1A 5FKAB 5HI3C 3MRLB 4W4NA 4D2NA 5H4YA 1F56A 2DIBA 3B2PA 1INDL 1UJ3B 4FMFA 1Q90A 1NCWL 2YGNA 3V4PH 3LB6C 4A55A 4F7CB 1ZGLA 1OM3L 2CBQA 1JN6A 1F1DA 2AJUL 3KPTA 3OJMB 1D9KC 4N2MA 5ALCH 2JB6A 3MOQA 5FA3A 3U0WL 2ZP0T 1JK8A 4YAQB 3TH4T 3GYRA 3SD5A 3C8DA 3QUMH 4L3EA 3ZZSA 1XGPB 4EIZC 4ZX3A 1CF8L 3B56A 5F9JB 1DVTA 5D93B 4ZNCD 3T0AA 4M02A 4MMZB 1AGEB 4AGLA 1KBWA 4BK5C 4YXHH 4WI4A 1IQWL 1PZ3A 5IFAH 4LF3A 5EIVA 5FKPB 4NZFA 1NAML 5DEGA 3IFLL 1N9PA 3OAYH 4QRFA 1QLEH 4DUWA 2CLRB 1BQLL 4KTDH 2CJUH 1A6AB 1NCAH 2DQFA 4NAJA 1KEGL 5JORB 1AZRA 2Z92A 5F7EL 3CFQA 5ESQB 3IRCA 1Z1WA 1NH6A 5HHQA 2HYMA 3RG1C 1WWWX 1KXHA 1TQTA 5LNDA 2EVHA 2XG4A 1BQSA 3H42H 3QI9A 3RY6C 3BZ4A 4ZOAA 1IGIH 3ZTJH 2NY7H 5ICZA 2GW5A 1MY5A 2R23A 3ULUL 3HG2A 2C8NA 3DJRA 2IPKA 4ZD3L 3SO3B 5J57B 3HZVB 2XTSA 3FU7B 1TOXA 4A6YB 5GGSB 1J86A 2YSSB 1OCWH 1AC6A 1NGXB 1N59A 4ZMVA 3K71B 3VNYA 2CG9X 2I07A 3SIKA 4U6XB 4WLCA 4KZ0A 4JFTA 2EYRA 2K45A 1R5IB 4GPVA 3TPUB 2EDTA 1HHHA 2HX8A 1J87A 2B8OT 2XWJB 3BKYH 3GSQA 1T0NB 3PL6B 2WLZA 2WO2B 4I48B 3CD4A 1JWSA 3VACA 4NZTL 4CKQA 3WXWL 4PWIA 1MCNA 4D9LL 4QGTA 4UZGA 4FMKA 4BWTA 5JHLA 4KKBC 3QDME 3ZIYA 5KVGE 3S3SA 3CDCA 2C3XA 2DYRB 2I9LA 3V4PL 1FYTD 1FNFA 4C4BA 2FIRT 4R2GC 4LVHB 3NDZE 3K1KC 3O4LD 4QUOA 5ALCL 4AV4A 5B38G 2VMFA 5H37A 2XWBA 3CFTA 5EIQA 3ZBMA 4AEFA 2VLJE 3MLSH 3QUML 2X2IA 3IK2A 5HHME 5DC4B 5HYJB 1FFTB 5KSBF 1RJLA 2OYLA 3QFJB 2X4SA 4U1MB 3TZVC 1OT2A 4YXHL 3K4DA 5IFAL 4KKLC 3T04D 4MJJA 4IOIA 1JNJA 1B6DA 3IVKA 1QLEL 2JB5H 4JFWA 2RTTA 2CJUL 3G5ZB 1ANUA 3BD4A 2WQRA 1NCAL 4JRWA 3SDXE 3QT2A 1WZKA 4FJZA 4AEHH 1Q1JL 4A2LA 2BINA 4ZTEA 4JKLA 1NFIB 5KYYA 1KWGA 2HJLB 5I1LB 2AV1B 3FO1B 3SPCA 1XF2B 2BOCA 5B4MC 4H25B 4OLVH 4LKXB 4G6JH 3KBFA 1BM3H 4N2HA 1E9QB 1ZAGA 3MO1B 3WEMA 1QX1A 2CNYA 3C2AH 3ZHFA 3OXRA 3HVNA 3ZTNH 2LLLA 4ZMZA 1IGIL 4MMXB 5TGBB 3S5LG 1A5FH 2NY7L 4O58H 5JPMC 4QRSB 2VDPH 2P44B 5ENWB 3ESVF 1ZT1A 4JG5A 1R3JB 4UOZA 4GSRA 1U3HB 1BXAA 1XCWA 3CFCH 3MRQB 1WFMA 1OCWL 3MRBB 1MUJA 2WMPB 2Y7NA 4NWTH 4HKXA 4PW3A 2KPWA 4LU5L 4B97A 5JIQA 3RFZA 1MCPL 4PG9A 5D7EA 3GO1L 2YC1A 3VXSD 2H8PB 3FB8B 3BKYL 1ZJBA 3ZTJG 1EFXA 4TUJB 1WE5A 1AZZC 3L3OA 1YEDB 3CCHA 5IV2B 1T2JA 2P80D 3BAEH 2PYEA 3DETC 1DLHB 4LGPB 3VFNA 5E7FA 3WU1A 2Z35B 4UILH 4WWPA 3K1DA 3MRHA 4MX7A 5EIIB 3FO9A 4HCRH 1IEHA 1NBZA 3BIKB 5ABAA 5C0GB 5J12C 3FZUD 2LHAA 4Y4KD 3QUYB 2AV7B 2C1OA 3IYLW 3GPSA 3K81A 5L4MA 2M1KA 1UOWA 3ARQA 3HG0A 4K5MA 5DJ0B 1RZJC 2O5XH 4BE6A 4HPYH 5D7IB 3D87B 1RIUL 2WLHA 5F1SA 1PNCA 5EPMB 2WYZA 4QKXB 3BVXA 2ARJQ 4N1HB 3V95A 2AQSA 3VFUB 3DECA 2DQJH 2GAZB 5IWLA 3FU0A 1K2DA 4Z7UE 1J9TA 5E99H 3L7FA 5C0BA 2G0LA 1CUOA 3QHFL 4LLAA 4N2AA 3RFRA 2HH0H 2OCJA 3FXIC 3QUXD 4B3VA 3BWAB 4OFDA 1NA8A 3T4AA 2JB5L 3GZPA 4I0CC 1QMUA 2BWQA 3DX6B 4L29A 1M56B 5HDLA 4IGBB 4A38A 4PS3A 4AEHL 3BCDA 2GK0B 4GAYB 3EOAA 4GRWB 1KY6A 3F7YA 5HHOB 4WHYG 3ET9F 3I9IA 2Z7YA 3D12B 1CDGA 1R24B 2CU9A 1EDQA 3D1MC 3NZHH 4G6JL 1BM3L 3HG3A 4ZAKB 1J9RA 4FERA 3SJVA 3O2VH 3ZTNL 4GH7B 3R8QA 3H2WA 2E9WA 1A5FL 4O58L 1SOSA 2BRQA 4E9WA 2VDPL 1MCKA 2NY3B 3AFLA 4KQ3H 4KVCH 4BSWA 4B9ZA 1BFTA 5EUKB 4MKTA 3Q13A 3PG2A 4IMKC 1LO3H 2GKIA 3CFCL 4QO1A 1UXWB 3UZVA 4B7LA 5ISZE 4I88A 4XX1G 4L1DA 4Q6IB 1ZOXA 4Z77B 3U0TB 5F7UA 1R0AL 1I31A 4NWTL 2MTAA 4JM2A 4P2RD 1WGVA 5ESVA 5B1AB 4M4RB 2BOBA 5IBLC 1NEZA 5D7IF 3GTNA 4AK2A 4C83B 2F61A 2DEYX 4GSDH 5ILTH 2X38A 4FNSA 3MRJB 5DQ9B 4MHHI 2UXGA 5ITBH 5C6TH 3BPLB 4R0LC 3BAEL 1TZ8A 3BP5A 5T3XH 3FRPB 4FLQA 4NCC2 3KPSB 1I9RH 1ZK5A 4UILL 1W2KT 2H26B 2ZWZA 4HCRL 2EVJA 5IEHB 4CU6A 3HNSH 5F6IC 3G5YA 4AXWA 5B1KA 4NZDA 4DP5X 5EOTA 4F8OA 2V3DA 2A74A 2FHFA 3IETA 3ZKMC 4R7VA 2YKKA 2GJ6D 4PBWD 5DMGD 1X5MA 1T20A 4HPYL 1BDYA 4MD0A 3T0WA 5IFJA 3HN8A 2CIKA 4JUSA 3MMEB 4NQSB 5BRZA 3B2MA 4EUPB 3E8UL 3FFCA 5F7DB 3FRUB 3DDFA 4HEPG 5SV3A 1JHTA 5FS5A 5IVZA 2LW3A 1K3IA 1EEYA 1GL4B 5CD5D 2DQJL 4X2UA 1OPOA 2HTKD 3VXUB 1OP5H 3NSXA 4NNYB 2AEPH 3B9KC 2DQIH 3IJYA 2HH0L 1Q9KB 4Z7QB 2HKHH 2VCOA 4LVEA 4ZI8A 3VFWB 4MQSB 1QPXA 1EDYA 4F15B 4Q9RH 5SWSB 1ZPLA 4X5RA 1NMAH 3AB0C 3LXBA 5GZOD 5I5MA 4J5VA 3V7AG 4KI5F 1A7QH 5BRQA 2Q0ZX 5TF0A 1T7ZA 5HTSA 1NCJA 5TDNA 1JTOA 4DPRA 3JVGA 5HI4C 3NZHL 3V5HB 1QSEE 3IU3A 2X4PA 1YEJH 4MCMA 5G5DB 4AEIH 3O2VL 2DWEB 4PH8A 4Z5RA 1WQVT 2HMIC 2WBJC 2DN7A 2HFTA 4WTXA 4W68A 4K23H 5CWSA 2ITCB 4KQ3L 4KVCL 1WWAX 1WWCA 1C1EH 1LO3L 2EXYC 4WUUA 4JFVA 2VJ0A 3SE3C 4JVWA 2VJXA 5JOFB 2EP6A 2BS9A 4GLRH 4NZRH 4QTFA 4F37K 3OHXC 4ZW5A 3MJ8B 5CZKA 1J8RA 1P7QB 4X7DC 3GXNA 3QQ3B 4KTEH 2VDOL 4AQ1C 1T03H 4GSDL 4WW2B 2WJ5A 2XHNA 1TENA 1VB9A 5ILTL 1AP2A 2V7HB 5ITBL 5E8NA 2FD6H 3ZKXC 5C6TL 3FPYA 4WO0A 3F7KA 4L5FH 5KBMA 1OF2A 2GEEA 2F7RA 5E9DA 1I9RL 5HVHC 2IAMB 1QSVA 5DT1H 4JQXC 1TNNA 5I1DA 1TZIB 4P2AA 3GBNL 4Z7QF 1I8KB 4HIHA 5EN2A 1GOHA 4CBPA 4FJ6A 4FRWA 2AEQH 3D39A 5T3XD 5IJDC 1F13A 5HVFB 2VJ8A 3LKNA 2E56A 1GZPB 3PJSB 5CMAB 3MA7B 1T21A 2NNFA 3ULVE 4BM7A 1FZJA 4FN0A 4H8VA 1X9QA 4N0YH 4KX8A 4OQTH 3GS4A 3ZDZF 2H1LM 2W59A 4WJG3 2CRMA 3KJ6H 5IW3A 1FRGL 4N2CA 1XVSA 2AEPL 5CEYB 1S7SB 5IJCC 2DQIL 1FFNA 3WNJA 5JO5A 2HKHL 4J1UB 3BESR 3C6SB 2H32A 3I6GA 3CBJB 2NY4B 3Q9QA 3PWUA 1K8DB 3CN0A 3HC4L 3RTQA 4Q9RL 2L7QA 2X44D 2A73A 1I3GH 1NMAL 3TO2A 5K9OA 2DDQL 1IFRA 5I6PA 3SZKC 3KCPA 3VGAC 2Z0BA 1A7QL 1ED3A 3OZLA 1DVXA 3QEGH 5DD6B 2XWZA 3U82B 1A3LL 4ENZA 4FTVE 5LHDA 1AYRA 1BZ9A 1E2ZA 3LRLA 3P77A 3F7VB 4X9YA 4AZ8B 5DC2A 2H1XA 1YEJL 1CS6A 5J6SA 4PLNC 5T1MA 4X7CC 4PGZA 3VD5A 4EKXA 4OCRH 4HFWA 4K23L 3CFBB 3D9AH 4JG1H 1SVZA 5IGXH 2AVFA 2BCMA 1TITA 1UD3A 3AS0A 5JXEA 2IF7A 4LSDA 5JIIA 1ZMYA 2GK2A 3O3UN 1C1EL 3LRSB 1WITA 2CA3A 2HT2D 1HL8A 3OLIA 3WIAA 3IM1A 3QEUA 1G7PA 1QEWA 3BVUA 3AXIA 4NZRL 1B9KA 2NX5B 4JVUA 5T5NG 4FYRA 1GJUA 4K9JA 2RQEA 1EK3A 4FABL 2R1WA 4HH8A 3F7RA 1JXDA 3DUSA 1MFDH 2CO6B 4KTEL 1S46A 2AJZA 3L16A 3R0NA 3VWKD 1T03L 2ZXCA 4WWKB 4HAFA 5CN2A 3TO4C 3WS3A 5CJXA 1MWAB 1MW2A 2WYIA 2FD6L 3PGDA 2HFFB 4AE0A 1E40A 4R3SA 4TV3A 1EX0A 4XPFH 2F7OA 1G7MA 3WFZA 2ZICA 5CJ5A 3BSHA 4QXUH 1XH3A 3WN5A 5DT1L 4HJIA 2EE6A 3SCMB 2BMKA 3VX0A 2PYFA 3GJFH 2XETA 1COBA 2OFQA 3ABMB 4G8EA 3S8FB 2DIAA 3UMTA 1J7VR 3G6JB 1VFUA 1I85A 3WS6A 2OPCA 3JWOH 1UWGH 2AEQL 2I69A 3DVNB 3UABA 5I8CB 1AGBB 1TVDA 4PRPD 3GF8A 4XH2A 3G6AB 3II3A 5JW4R 2KERA 3T3PE 2ZJSH 1G6RH 4N0YL 4OQTL 1AQ8A 1NBVH 2X3CA 3HI6L 4FFYA 4JDVA 4NQXA 5L0QC 2I60L 2CUAA 3NRPA 3OAUH 4ODWB 3WL9A