5FS5A

Breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNANSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5fs5A00
3RFZA 4X5RA 4XO8A 4XO9A 5ABZA 5AB1A 1UWFA 2XG5B 5IQNA 1N0LB 3MCYA 3ZL2A 4AUYA 3JWNG 3ZL1A 5IQMA 4XOCA 4XOAA 2UY6B 5AALA 5FX3A 4CA4A 4XOEA 4AVIA 4AVHA 5JQIB 4AVJA 3JWNH 4BUQA 3BFQG 5F3FA 3BWUF 4LOVA 4X50A 4AV5A 4X5QA 2XG4B 4XODA 4XOBA 2J2ZB 1KIUB 5AAPA 2WMPB 5FLUA 4CSTA 1N12A 4AV0A 2VCOA 2W07B 2UY7B 5LNEA 4CSSA 4J3OF 2JTYA 4X5PA 5FS5A 1TR7A 5IQOA 4AUUA 4AUJA 1ZE3H 4J3OH 1KLFB 5LNGA 5F2FA 4AVKA 4J3OG 4AV4A 3ME0B 4ATTA 3SQBB 2JMRA 3ZPDA 5FWRA 3BFWA 5CGBA 1QUNB 3JWNE 1PDKB
chains in the Genus database with same CATH superfamily
4QKTA 3C6EA 2OYKA 3KPMB 2MQCA 2EIEA 2VE6A 4GT0A 1NBVH 4GFXA 1J0YA 1PF3A 4UOW0 1PU0A 5KVEH 3LS5H 5ESQA 3TFKD 1KEML 1QX1A 4BSVA 4W9JC 2KMWA 4XMLH 4DPAX 2ZUXA 1IGMH 4MQXD 5B7FA 1HXYA 4JZJC 3F7YA 3CLFH 4HAKA 5GZND 5A7EA 1NAKL 2R0ZL 3QEGL 5AW7B 2F8IA 1F8TL 1KB9J 4WUUB 3GSNH 5EA0H 1T21B 3O2WL 2IGLA 2VLKB 4XC3L 1BFOB 4S1QL 4U1LB 5DJDA 4FLOA 4GQPH 2AQ3A 4OZHB 4XOEA 2BNUB 4Y9FA 3X3GH 2OX5A 4HJTA 1EJFA 1H6UA 1RZJH 2EVJA 4KV5E 2VDMB 1U93A 1YYLL 4H1LA 3UPAA 3HC3H 3N9GH 3QWOA 4FAAB 4JFED 4HJEA 3QK0A 1UJ3C 1IEBB 4FTVD 1TQSA 3FCSB 1T2QH 4GBXA 4PRPA 1VCBC 3HAEH 1QR1B 2IFFL 3WIAA 3FHQA 2NZ9D 1B88A 1XGQA 3OWRA 4LF3B 4N0RA 3KPTA 1WZ1H 5FA3A 2EECA 3QR2A 5EUKA 2EIDA 3I75A 1BQRA 1QI4A 2UX6A 2UUDH 3NZ8A 3DBXB 4AYEC 4Z7QB 3QI9C 4F8NA 1R24A 2DIJA 2R69H 1JFQH 3H42L 3VI4A 2ZCHL 2LVEA 4NO3A 3QDGA 4XZ4A 1MQ8A 4G1EA 3GSQB 1MKFA 4ERSH 3VFMB 5BVJB 4D0CB 1RZQA 2Z64C 4PLKC 5CN2A 5DD3H 1I7ZB 4LVHB 5BVPL 3VFVA 4C4BA 1QTSA 2WXQA 3FT2B 4Y4HC 5DR5L 3EZ8A 4JY6B 4J3OF 3PQYD 5ICXB 3ZZLA 2NNCA 5D7LD 3VMPA 5DUML 1KLGA 1HSAA 4IGBD 2YQGA 2L7JA 3G5ZA 1WAAA 3QJXA 4JE4B 1NCAL 1BSIA 4GUCA 3IJHB 3NJNA 3MYJB 3BQUA 2AZUA 1F3RB 1ZLSH 1X5YA 2AEQH 5IBLD 3B3IA 5KS9F 5J12B 1R3LB 3CFJB 2JJWA 1ZDSA 2P7TB 3WTUA 3TN0B 1CF8H 2NY1B 4OZFA 3HI5L 5CEZL 1MCOL 5I1KL 5JNYA 3LNIA 3L9BA 1X5JA 4PJIE 3HN3A 2ZX9A 1GS6X 1NDGB 4M6NH 3QZWB 1SVZA 3D06A 4UTBH 4ELMB 3IT8D 4V11A 3BP6B 4P2QE 2VISA 2YSTA 1HESA 2AJSH 1ZSDA 3BAEL 3PL6C 3WS3B 1H3UA 2Z7UA 2YMXL 4XXCA 1WTGT 1H0DB 4RX4A 3QJTB 3QUKA 4W9ZA 3Q2CA 1BPLB 5D7JB 3IDNB 3GGWB 3IAGC 3FO9B 4PJGF 2GBUA 3CSPA 3OAWA 1J0ZA 3P4LA 4RZKA 1RKRA 1L9SA 4S1SL 2Y1VA 4FKKA 5LXGH 1MFEH 1JV2A 1I31A 3MUGA 4PJAB 3AS0A 1RZPA 3X1NA 1MCBA 2IGFH 5ABDE 2WCGA 3UTZB 4W6YB 2VC2B 4ICXA 1KJ3L 1XR8A 5ISZD 4HKXA 4OV5A 3RZCC 3MAWA 1MCFA 1QNZL 4GXVH 4NN7C 2HPTA 1XH3A 4A38A 4HISA 2NXYC 1Q9WA 3UOAB 4JHAH 1UGKA 3O8XB 1L3NA 1I7TB 5DK3A 3QEQB 1CTMA 4Y4FD 3VH8A 4X8JB 1FO0B 2PYEE 1I85C 4X42A 2WLKA 1D3CA 4RAUA 4GG6F 5I6XC 3RRQA 2YRLA 2FT6A 1G7QB 4XMZA 3V0VB 2QVMA 3W11C 2DQDH 5EF3A 1F56A 1R5VA 4FMFA 4V1DB 4Z7VE 4JPKH 4RGMC 3WE6B 2G2NA 1DQLL 1IAKA 5I73B 1IJNA 2X4QB 1ACZA 1SMDA 3D9AL 2XPYA 3FAWA 1HT6A 3PP3H 1NUNB 5IOKA 4QWWC 1Q0YH 3SDDA 2F54D 3O0RL 3N43B 5F9WB 4JM2C 1U58A 4BXVA 4XNXL 2J8HA 1O6SA 3HPLB 4A68A 4P23A 5HYJA 2WVVB 1N6UA 1ADWA 4WNQB 1DQVA 1UXWB 2C26A 5HYQB 5LN8A 1VGKB 2L04A 2F5AL 3CFCH 4OFIA 1XX9C 3BT2L 2NQ3A 1Z9SB 4BQ6A 5E6SB 2KBGA 2APFA 4KTEH 4Y9CA 4YSQA 3FMGL 4BZ1H 2W07A 4LCVA 1GHFL 4I0PA 4OGZA 2ATPB 1FBIH 1QLFB 1UM6H 3IYLW 4DETA 4K73A 1T22A 2DOCA 3AS2A 3EO1B 1SF3A 4P4KA 5GS2D 1G7IA 2MPVA 3APNA 5D1QB 3HI6L 4QGYA 3IKCA 4JM2D 4L8CB 1L7TL 3TO2A 1GVIA 1T7YA 2Z9TA 4U4BA 3ZGIA 3S2CA 3QNYA 1YEGL 4GQZA 1E4HA 1EDQA 2DH2A 2I60H 2XFXA 3L5WA 3MNWB 1G7PB 3K74B 3L4CA 5F9DC 3MLXL 2J25A 2EO7A 3LKOA 1KJ2B 1T5WA 4G9DB 4X5XB 4YK4C 3CFIC 5HY9B 3BAYA 4ZYKB 5JHDB 2QQQA 1KPUA 1WEJL 5FO9A 3EJTA 4FG2A 1SQ2N 4F7EA 4AYDC 4HJJL 3N44F 4FL4B 4QHLA 1NEZG 5DQ9A 4YLCA 1RZFL 1YEKH 3AU1A 3WKMH 1TETL 3R18A 1I8AA 1AFVH 2F58H 2NTFA 3MV7E 3OLGA 3C08L 2CUIA 3EYOB 4JVPA 4LVOC 4FQIH 3MJGX 1RZKH 5DS8A 5SV4A 3LCYA 5DA0B 4K8RL 5FGCB 3O9WB 2K7QA 2YAFA 4JRXA 4Z76A 8PAZA 4LLMA 1UXLA 4NP4L 4WKZB 3IDXH 3GBLA 5C08D 4OR1A 4ZUWB 4XGZA 1SDAB 3ARSA 2V7HA 3L3GA 4P23C 4LLUA 4WTWA 5KVMC 4PRIE 4YO0B 3SKNA 4IRJA 1EPFA 2J6EH 2OL3L 4IIZA 4Y5VC 4UDTB 5DHMC 4W9FC 5DUBA 1T03L 2IANE 4GIOA 5CR1A 1VGEH 1SJHA 1X9UA 1CXFA 3MODH 1RUAH 3FUJA 3MGTA 4I0PC 5FW7A 3PIQB 4HK3J 5E2WH 4LOEA 5D72L 4KMTH 3ROLB 1MLBA 2BHUA 5HJDA 3D18B 3R1GH 2KLTA 1ZLVK 2WNXA 4TUKH 4AG4H 4P4KC 4JFPB 4L3EB 2DQTL 3BKCL 3PP4L 4NI3A 2WZ0A 4LPYA 5HDOA 4I13B 4JAMA 4LRNL 2NX5B 1WK0A 4GFTB 1FGVL 3FQWA 2IPKB 4NQCD 5DMGC 1O9VA 4QYAA 1XXDC 5AD0B 3LKQA 2E74C 4MXVF 2BRQA 1QBBA 1RZIB 2WUCH 4DQAA 1CBVH 4AEFA 5CZKA 1PX3A 4R8WH 4UV7H 4YXKL 1RHFA 5FUOH 5T5FL 5DHEA 4BFEA 3KLLA 2Y07H 1QLEB 4K7FB 4NDMB 5E9DB 1MFAH 3BLKA 4MD0A 1L3WA 5IM7A 3MJ7B 1QFWI 2GJ6A 3S5ZA 2NUTB 1WVZA 3FU5A 3MBWA 1DQKA 4F2ME 1YUHA 1KYFA 3MROA 1T5XA 4G6MH 4QOKE 1AGFB 5CSGA 1S7TB 1OLLA 1UH2A 2QHRL 3QFDA 1C16A 1OW0A 4M8VA 3OJDB 4A37A 3SZKC 4MZ3A 1OAJA 4KUCD 3BSZH 3SBPA 4A7TA 4PV9B 1TZGL 2PR4H 2PXYA 4H20H 2Z93A 1T7VA 3D85A 4ZFZB 4L1SA 4YFLF 5AAMC 4UZGA 3AJ7A 4OTXH 3L5JA 1AQDA 2IC2A 5IEHB 4PJBE 1GZQA 3IJYB 3HFMH 1XCXA 1DE4B 1T20B 3S7GA 5A2KH 4FQ2H 4FQHA 5D9SA 1NPNA 5FEBA 2JK5A 3NMEA 3AGWA 4EE2A 2IQAA 2J1XA 2J6WA 1U8OB 5EU6A 2VH5H 3LZFH 4F9LA 2G9HA 4M7LH 5SWQB 2BOBB 4LE8A 4UMSA 3GLAA 2BP0A 1NGYA 2ZXEB 4NSKA 4O2FB 5EBMA 3VXRE 5T1LB 1AKJD 1UEYA 1VEPA 3HG4A 5ESAB 4EDXA 3TGXA 3T3PF 2W0LA 1PFOA 4XWGL 1XV8A 5CO1A 3GLZA 4KVPA 1UWGH 5AVYB 4WEBH 3UTOA 2F0CA 1A7BA 4K71C 5HI3C 5KYWA 2O93L 4N9GB 1PDKA 3OB8A 4ZMLA 2GFBA 2WWOA 2XACC 4P2CG 5DVKA 4IBWA 3MV9D 2W0FB 5DMYA 5KYUB 4ADJA 2VRKA 4UWQB 4LKXA 2IAMD 1JWMA 3I6LE 1LEIA 2DWXA 1Q9OA 2I27N 1KOAA 5HYSG 1QVOB 3UYRL 2AJYH 3TBVB 3K4ZA 1JCKA 4G5ZH 4JANB 1GAFL 4MXWL 3KR3H 4XODA 4LCYA 4MAZA 2ZUTA 2QFRA 1NEZB 4FXGA 4FDWA 4KXZI 3FF7A 5DJ0A 3NIGF 4UT9A 1U8PB 3FOMA 5T1MA 3ZKQD 3M7OA 2R2BB 4YQXL 1F3JB 1JGEB 5IWLC 1SXAA 2A5UA 3KL3A 4J7RA 3ATFA 2O5NA 1PZCA 2EJ1A 4OM0H 4XN8A 3DOHA 2V0AA 4WFFD 3P4MB 1S5IL 1UENA 2RHEA 1BAFL 1JI2A 2J8UB 1M7XA 3STBA 2AXGA 1NEUA 4PJDE 3MNZA 5JIIA 3BDYH 4PU2A 5DUJA 5I5MA 3LNEA 4KDTC 1IGFL 3CFEA 1HXKA 3C2AL 1P2CB 5AEAA 4F57H 5JTWA 2E75C 2HT4C 4LSVH 3P77B 1WF5A 3HBQA 1F1GA 1X9RA 2QGCA 1JZ6A 1L9OA 2O26U 1KLFB 2E4FA 4NC1E 2FHBA 3ESPA 1XZ0A 2A9BA 3FTZA 3JWNC 4TLTA 4X5WA 4Y0GA 3RA7H 4EI6B 2W94A 3D39E 5IVXE 3MBXL 3PYCA 3NA9L 2D4DA 1N67A 3BFWA 1N4XL 5ALBL 1B0GB 1RUKH 1JAEA 5I1GL 3U9PL 5LWYL 2DB8A 3MRGA 2JVUA 1ZJAA 5L88H 2I7SA 1SF5A 4PUBH 3GT6A 5GRJH 1D6EB 4OFVA 4DQOL 3UTSD 3AGVA 2J1ZA 4GG8B 4FN0A 3MRDB 5FCSH 1Q9KB 3V4UL 4LLWB 4EQ2A 3VD2A 1A1MB 1TTBA 3H0TB 3K8KA 3G6JF 1CZ8L 3ARGA 4XPAL 2JB5H 3QISA 4M4PA 2CUHA 4PGCB 4XE0A 4EBQL 5HHVL 3Q44A 2C4XA 2YFOA 3QP3A 4JFFA 4R7NA 2Q7AA 2ZNWA 4PJFF 5L0QB 3UO1L 4F2FA 1LWRA 3OGCB 3N85H 5AQ0A 4JFOA 5DWUH 2R59A 5EU4A 4FCAA 4XO5A 5PAZA 1DLHB 1KYUA 3UTPD 3H9YA 4JG0H 2FLMA 3S3PA 4OZIB 2AK4B 4CNIA 5GS1B 4KTGA 4Y5XA 3VWJB 4DFHA 5FYJH 2ZUQB 3OSVA 5GHWH 1KIRA 2XKNA 2YEZA 3ZSSA 3EHBD 2ZOLB 4I88A 2VERN 2WP3T 4YPJA 2VMDA 3FSZA 2H9GB 5IJVB 1MIMH 5C0FA 4U1KB 4XBEL 3DX4A 4Z18A 5KSUB 3EFOB 3EADA 1ET5A 4XB3A 4FS0A 1JPFA 3L4WA 3VM7A 3ARDA 1T0PB 2JWYA 3I2CH 4R3SB 2Q0ZX 3PDDA 2QVIA 3H9HB 4X83A 5CJBA 1KPVB 2HRPL 4XX1G 1I8MB 4Q97A 1SEBB 3N1QC 3QQDA 2VZ1A 3QW9A 4OIIL 4KKZA 2QGEA 4IJ3B 3U46A 1WJ3A 2DWEA 4MTMA 3UAJD 3HHSB 5JW4R 1TOXA 3JXAA 1F97A 3GXNA 3PGCB 3JV4A 1YJDC 5GS3A 1VRSA 3Q8BA 4O2CB 1BDYA 2XWTB 4N8UA 5EF2A 2GEQA 2KZKA 4I85A 3CZJA 3ARGC 3QXTA 4MD5A 5KVGH 4RA3A 3Q43A 4YE4L 1AS6A 4MMXC 1UM4H 2GT9A 5I0VA 3EYQC 3LZPA 1NGQL 4YVNA 5KS9E 4UCFA 1JXGA 4WHCA 1YQVH 1ZDQA 3UROR 3ZTDC 1ACXA 5KBNC 2O6FA 2C9QA 4KPHH 4ZMWA 3GWJA 2R7EB 3D05A 1JNLH 2R2HA 3P11H 4W70A 3UBHA 1Y0LB 5I1JH 3WLBB 1HH9B 2EIBA 1FG9C 4PRBB 3HG1E 2XWCA 3ASNB 3CXHK 4Z3HA 1EZLA 4G59C 2WGXA 4GRLD 4PJ9B 3ZU8A 5LLIC 2I25N 4FCHA 3ABKB 4AYFA 1LO0L 1OAZH 4KXAA 3D69A 1OAYL 1MRCH 1M6OB 1TTCA 4HALA 4X6EB 1OSYA 4Y2DB 4M8QA 4JR9L 5E94B 4BCYA 2BIMA 3FQUA 3ZN6A 3ZYJA 3UJTL 4K9EC 3EYQD 4PJGE 4QUOA 1XL6A 3VXTB 2CK0H 1P5VB 3DK2A 2A73A 3DPBA 1XIWB 3FB5A 3DJTA 1PZ5B 1HI6B 3I50H 3LRSA 4I2XA 4PW9A 5DRWB 1G9MC 5T1KD 2HMIC 1G6RL 1NMBL 2APSA 2V9RA 1ZEAL 5E2UH 1HQRA 5BZDB 2H4EA 2F5BL 4FZ8H 4NO0D 4EVNA 4XRCA 1WITA 1THAA 2OI9B 1FJ1A 1F4XH 1HNGA 4Z0XB 3OXRA 2WLMA 1SEQH 2EH7H 5J1SC 4IIQA 5HGHB 3HRZB 4APQB 3L4ZA 4JKWA 3I02B 2ADIA 3NJVA 2ZWNA 4AQEA 2WLIA 4D9QE 4GG6E 3BVTA 2EDEA 5D1XC 1Q94A 1CLZH 1FVDB 2JJTA 2WXFA 3DA0A 1PIFA 3QT2A 2A38A 4HEPA 4IYKA 1TCMA 4LPVA 2XTJE 4X9YA 3TO4B 4OI7A 4X6BA 4UZSA 2QDWA 2DQJL 4Z7UB 5HDLA 4FTDA 2G5RA 3VG0H 4CADA 1FPTL 5MEND 1YO4A 5K1NA 1AE6H 3MRBA 1AXSB 1VZIA 4K23L 4KJQC 1KZQA 3M1BA 2I85A 3QYMA 4UV4H 5DZNA 5I76A 3ULUD 1NFDB 1OM3L 5LVEA 4HKJA 2C3VA 1JTPA 1VESA 32C2B 3C6LA 4OLXH 4IRZL 6TAAA 4B9PA 1LEGB 2EE6A 3TO4A 1ZS8B 2MRYA 1OSZA 1SYVA 2XQYA 3TF4A 1FNEA 2XWJB 1FZMB 2H3KA 5F7NC 1M1SA 3ILPB 1EMTH 5GS0D 1KIPB 5TDNB 3VRJA 2OXGA 4ZI8A 1ZMYA 2P44B 1U92B 2MHAB 1J8HA 2CG9X 4ODXB 1R5WB 4QXGL 4C8XA 2ICES 2UZPA 3GM8A 1XSOA 2AVFA 1JRHL 3RJOA 4Z3TA 3IMSA 1HAWA 1UD8A 5CSZB 2QVKA 3TJHD 1CFVL 4BA0A 4JO3L 4CN4A 3U30B 3DXAA 1RVFH 2R2EA 3CLWA 4R26L 5I0DA 4Q7DA 1CLOL 4KY1L 1L9TA 4MCNA 5CU9A 3ZPDA 1KFAL 3UAEA 1J5OL 3B2DC 1PLGH 2B77A 3AREC 4G1MA 2CDGA 1JL8A 3I74A 4OCRH 4WIQA 5DRZA 4DGIL 2X28A 4MNQB 3SDCC 3VMNA 4IIQC 1IIIA 3VGHA 1F2QA 4I5BA 2R4RL 2C4FT 3LN5A 3F58H 1E28B 3K6DA 2PP9A 1JP5A 1F1AA 3KWXA 2H3NB 4MA3A 1YMHB 4NWTL 4H0HB 3FO2A 1ZVHA 2CLRB 4JDTL 3B9KA 4J8RB 1T0MA 3UPRB 2L7EA 4KI5F 2BSED 4ACTA 3BUQA 2YAPA 3KCPB 3ULAB 4OLWL 1U3HB 3FU7B 4N8CL 2C9AA 4E68A 4IK6A 1KFGA 1TEGA 3T0VA 4MZRA 5CCGE 3ZQXA 4UQIM 2AXJA 3QXWA 3RB5A 1MUJA 1TDQA 3C6LC 2YR3A 4H5SA 5CIPA 2DMCA 3SDCD 2Z35A 4R90H 2ZJSH 3ZIMA 5JW4M 2HCZX 4CMMB 5MHSE 3Q8AA 4PI2A 3OB0K 3TNNB 2OPCA 1Z0NA 3VQLA 2FWSA 4PIBA 3TURA 1SLUA 3MLZH 4MZIA 3ZKNC 1KJMA 2QLYA 4OZHF 2WLJA 1GYUA 2IGTA 4XWOC 3VGGA 5I74B 3VFPA 5KBMA 3EDFA 3DUUB 4WWKB 2F8XC 2ESVB 3C5SB 1WS8A 1YDPA 3T09A 1OTUD 1V8HA 2XPZA 4MSWA 4XNMB 5BZZA 5ACZB 1Q0XH 3EYVB 3A5VA 3WXWL 2H2SD 3CN4A 1U8CB 2LR4A 4TVPL 1MFCL 5E6YA 1WZMA 3K4DA 3TBSB 4JLRB 4F7PA 1LXMA 2YPLE 4JRYA 2MPAH 5D2NC 3VFOA 5L7XL 3S4SA 3A4DA 5DCCA 2BY1A 1K6QH 2IFGA 4Z7QF 4H8UA 4TULL 4MXVE 1T83C 3O6FC 3WO3B 1XGZA 3FW6A 3ZGHA 4WI6A 2AS5M 2G75B 4U1SA 5DMKA 5TF0A 3QUXA 1N12A 2J3SA 1SGKA 4NGHL 3OHMB 2FBJH 3II3A 3KPRB 4KX8A 2ITCB 5GGSY 3ZRSA 5HP5A 3NPSC 1TQVA 2BNRA 3QUZD 3ZZSA 1O9WA 1UXMA 2ZOKB 2B9AA 2NY0C 4YGAB 4AQAB 5I15H 2A0LC 2PMZA 2J20A 4CU8A 1R75A 5FECA 1IGJA 2G30A 1CF1A 1L6XA 2YGQA 3BKJH 5E4EC 1FL6B 5C7XL 1JPTH 5FYLH 2A9NH 2GBTA 3LSOA 1OP3H 2ZAHA 1RFDL 1AZUA 3QA3B 2EYSB 4AYSA 2CHZA 4PJIA 2VOTA 1OAXH 1HQ4B 2DQFA 4U0RC 4L4VB 3WGUB 3NYKA 2OQJA 3RFZC 1AZNA 1F42A 4P2QA 2VDLB 1TZHB 3BH9A 4O2EB 4LASH 3OAYK 1Y6KR 5HDQL 2R8SL 3ILEA 2HTLC 2NY0D 4XNUL 4ELMF 5BRZE 3FUMA 1CG9B 5DJXB 3G6AB 1GYVA 2PTTB 4N86A 3WKYA 3HNVH 1MCEA 3NJIA 4ZAKD 4L48A 1MHPH 3QO0A 3VAEA 5JPNC 2WINB 4HCRL 4IKNA 3LZOA 5E95B 1C5DB 2GI0A 5IQNA 3P9MA 3ESUF 2GIYA 4MJID 1MFBL 1J05B 4N0UE 5CEXA 2IWFA 4PJAF 4B97A 1BX2B 2PO6B 4EUPH 4JKPH 5LAPA 4KDVA 3EDEA 3LDBB 2ZX6A 3T3PE 1KENH 4D7BA 2AK1L 1S9XB 1VERA 4I1NB 4XH2B 5DHDA 5CD3B 4TPRH 2R23B 5L8KB 4GUPA 2H0FA 1DBMH 1ZXKA 5E00A 2NY3B 3EJUA 2PYEA 1DP0A 4QRTA 3GPEA 2C7FA 1SXZA 4I4WA 1EHNA 1KXQE 1S7WA 1XF2A 1MCNA 3O4LD 2XZAH 2CHDA 4NQDE 4HGWB 3SGJC 1FN4A 1SHMA 4XNQA 3BJ91 2EXYC 3HUJB 4KAQL 2D73A 3CMGA 2PW1B 3T4AA 5A2CA 3FT4B 4WKXA 5L2KE 1UM5L 5FCUH 3M1CA 4YNYB 1AANA 4G6AC 4X6DB 4P5KB 3DVFA 3HZMA 1DQQA 5DQJA 1M56B 1VB9A 1O0VA 5LO7A 1J5CA 1E5CA 2QPEB 3NIGE 4WWID 2J12B 2VKWA 5DVOA 3DVIA 4OF8A 4X80H 3GXDA 2YLKA 1RD6A 4TNFA 1P53A 1KULA 2R4SH 1BLNB 4FQJH 2WZPA 4P9HC 4OM1L 5E6UB 1PSKL 2QGDA 4BFOA 5IV2A 1AMYA 4GSDL 3PLYA 1W72A 4HWBL 3AG3B 2I07A 4QCIB 2A6JA 1ORSB 1KGXA 4AWJC 2YAOA 1KEMH 5J1AA 4A1RA 2YGOA 3GLEA 2CO3A 4OIBA 1B3JA 1EEUA 1P7QD 1LDPL 4DPRA 3PWLA 1QLEH 1OAUL 3NRPA 4MNGB 2WMPA 5DJZA 5FDWB 8FABB 2IXQB 1RUPL 3QJFA 5JO5B 1NAKH 3QEGH 3VCLA 1VACB 2P24B 2TSBA 1F8TH 4XXWA 2E59A 4XC3H 3CSGA 1MWAL 3X14B 2BWQA 1LILA 4B9YA 3AACA 4QTIL 2XWXA 2XYBA 4YHLL 3C75A 1OT2A 4PJ6A 2VDKL 3WTWA 3LQZB 1OQOA 3SE3C 2FJHB 1LE9B 1YYLH 5C2UB 2BHYA 1PZDA 3K0WA 3E6HA 4NRYB 4S0HA 3I9AA 5CS7A 3AITA 3GRBA 5J56B 3N42B 3G6JE 4Y1TA 5T3XD 3MGOB 4MS8D 5CGYD 3TIEA 2AEIT 2BVPB 3MCYA 3B5TA 2IFFH 4Q2ZB 3UYOD 2BY2A 3D08A 3U0PB 1P5UB 3MRPA 2QMJA 1SVBA 1UA6L 3DRTA 3SPCA 2NNAA 3BSGA 4CW1A 4PJFE 3KYNA 4JPIA 2G3ZA 1A6TA 1NDMA 1I9JL 4FHJA 3HG5A 4MD4B 4XHQA 3H42H 4PRIA 5IT2L 2FL5B 2ZCHH 4D0DA 3HI1A 4JDZA 3AWFA 5E5RB 3U4KA 4DOHB 1FLTX 5H94B 3V4PA 4CBZA 3FU8A 4N2OA 3K6FA 4NKMB 5K33A 2L0DA 1M3IA 5BVPH 1OTTC 4N2MA 1Z9NA 4MXQC 1LQSR 5DR5H 1CXHA 1ZHKB 2CJ3A 2XSKA 3MREA 3FB6B 5DUMH 5GRWA 3FFCD 5FO7A 3D5OF 5H4YA 3FQNB 4B3EA 1NCAH 5GXBB 2V8LA 3PHOB 4KRLB 4ZX6A 3JVGA 1T3FB 5J6HA 4AV5A 2XNAB 1DSYA 5KBPA 3O11B 1A64A 4GSXA 1Z2KA 2Z0UA 1ZLUK 1AGCA 1NFIB 4BM7A 3CBKB 4Q9CA 3SYAA 4AGQA 5CEZH 1MCOH 5I1KH 2OYMA 3BZ4B 4AKOA 2NUPB 1F6LL 4XXWC 3QQ9C 1X5LA 1ZSHA 4OQTL 1OTTD 4G8EB 4OGYH 1WO2A 1HWHB 1BW8A 5DS2A 3KVQA 4U1HB 4APXB 4PD4J 4PRNB 4F2MA 1ROCA 3IDGA 4OJYA 1OM9A 2EIJB 4QOKA 4OLUH 1RJYA 1RLWA 3PG2A 3QIBC 1KCVL 4EI5B 4LU5H 2Z0BA 1CLVA 3GJEA 3OAZH 3BGAA 4GH7B 3UEZA 1N5AB 1PPIA 4N0FB 2XWBB 4S1SH 3SYOA 4D8OA 4S2SB 5EPMA 1OO2A 1CL7L 1DVSA 5IZ7A 4QR7A 4YSEA 5E8OB 3LTVA 2VSMB 4NKDA 4ZO8A 2BCKA 3DDFA 3VFUA 5E2TL 4A55A 1KJ3H 4WU7B 2IH9A 3ARZA 2LHAA 4ODUA 3ZHKA 3OR6A 4BZ2L 3GRGA 1U8IA 4F7CB 4MMZC 4GO8A 2G5BA 4H26B 5IQ9B 2CHWA 2QGBA 2ZQKA 1KPRA 4U1JA 1XFPA 1DDTA 4QXTB 4G9FE 4H8VA 4P5RA 3T0EC 3MRCA 3FYEB 4YDZA 2XQBL 5LBSA 3SOTA 3VXRA 3V8OA 4I3SL 4ODSL 1YYMH 2Y5EA 3U2JA 4HU8A 3B2PA 5B4MD 4JQIL 1DQLH 1EZUA 5C8JB 5D7EA 1JPGA 1XF1A 2FDBP 4B9GA 3NJJA 3D9AH 3FQRA 3IMWA 3RIFK 3UBXG 1J7VR 4AJVA 4AL8L 1K8IA 5GQBA 3SKMA 5AW9B 3O0RH 1IQWL 3WDHA 2F74A 4XNXH 3LV3B 5HYEA 4QXUL 5FUCE 4HHGA 1E5AA 4Y7MA 1DVFA 2PN5A 3IJ7A 2ODIA 3X11A 3ZYOA 4C56D 1JWSA 2F5AH 2FTAA 3CN2A 3BT2H 1S7UB 2N1TE 1F4YL 3A23A 5E7BA 2PYFA 3FMGH 2H0EA 1FSKB 1GHFH 3MCKB 4IRSD 4K94L 1BA9A 1I9IH 1XMEB 3GB7A 4MYPA 2FUQA 3REWA 2FO4A 1I3RA 1KXVA 2ARWA 3ZXAC 1DVYA 4OFDA 3C12A 5KVFL 3HI6H 4PVMA 3WFCL 1S8DB 4LPUA 1KTJA 1L7TH 3HMXL 3QORA 3H7BB 4H1LG 2CLZB 1YEGH 2EYTB 2GITA 3LRGA 4JFDB 2X10A 4OY9A 5KOVC 4FLRA 4GUOA 3EFDL 3BEVB 5I6LA 2X44D 3MLXH 3W81A 4E0RB 4EXPX 4HFWB 2KHAA 3EO0B 2Y1AA 2HJKB 2AQSA 2WLZA 4DP4X 1WEJH 4XE5B 5B1AB 1WZAA 3OZKA 4PJDA 2CPCA 3ULSA 4Z3FA 3ISYA 3E9TA 3ASWA 4H13C 3KPSB 2WXOA 4HJJH 3SJVB 2X89A 3K5SA 5F7HA 2NSXA 4ZMYA 3V9FA 4P07A 3Q05A 3NQIA 5HGAA 3BVWA 4NNYA 3ZRFC 1NPUA 1TETH 1OALA 1AP2A 1KG0A 2OMZA 3C08H 2YC1B 5E5UB 1I53A 3THML 1IBFA 1K72A 3CHOA 5E8PB 1S9VA 4UBDC 2ZG3A 5HI4D 5K9JL 5F7LB 2VQ1B 3D39A 5H35B 5B1JC 3SKUD 5IVXA 4L8SC 5MERA 2TAAA 4K8RH 3BHBA 3RGVB 3IGFA 4POUB 3T6QC 1PNCA 1AYOA 2VZVA 3GKZA 3G04A 4ATTA 4ALAC 2A77L 4NP4H 4IW4C 5K9OA 3QQ3A 3QFJB 2CUMA 1NCCH 4JQVA 4Y16C 3W0WB 2WTRA 4JB9L 3A22A 5GGQL 3OKNA 2OL3H 4OGXL 3UH8A 2YGNA 3PWJA 7PAZA 1WQVT 3U36A 4ZDHB 1T03H 5E6IA 5H2BB 5ANHA 4I9WE 2GB2A 4OZFG 2JSFA 1CBJA 5D72H 1QSFB 2BDNL 4UMGA 2LABA 4PBDA 4UBDD 1S7VA 2GUOA 4KI5E 1T66C 4FTVB 1AXIB 4NAMA 1YEHL 2LU3A 4NO5B 2DQTH 3BKCH 1E4KA 3PP4H 4Q8BA 4M1DL 5SWZB 4AENA 5J3HD 4NO2B 4HDIB 4JZJB 4TQPA 4OAWB 1XDTT 2AEPL 5EBWB 1FGVH 1TU2A 1JFHA 1CVSC 2XIIA 1A8JH 2WBJA 4ZSOB 5C0EA 4HKZB 3H3KA 5DS1A 3ARYA 4YXKH 4HUWB 5T5FH 3UGXA 4YHNB 1LHZA 1MRFL 2VLRD 3MA9H 4OZIF 3BN9D 3CFBB 4F1ZA 1F4HA 4WJ5B 1T1WA 5E03A 4PMFA 2BW5A 4WI3A 2NY7L 4M9PA 3GMNA 3HE6C 4OZHE 4JZNA 1VADB 1E6OL 3Q8FA 1UJ3B 3D0LA 1CDYA 1M2VB 2ZSVA 2NZ1A 2WB7A 5D7LB 2Z34A 5LKNA 2CO2A 4I87A 5HHOD 1UUSA 3CFKB 2FATL 1P7KA 2BFVL 2QHRH 4LCCA 1MNNA 4PJ5B 5KJRL 5GRVK 1QQDB 2FJGA 4MCMA 2GUYA 3NCBB 3N40P 1CI5A 5IF0B 3VH8G 3QI9B 5DVMA 4MKMA 3RHWK 5I8EA 1TZGH 3CPLB 2HT3C 1WG3A 3CPUA 2X1OA 2RFXB 1FHGA 2C9RA 4RMBA 2EEDA 4Z7QE 2BERA 3GUTB 1HAUA 1FZOA 1KZYA 2NYZA 1U95A 3Q6FB 3L9YA 3JV0A 3AWGA 1P9MA 3UBXB 5AB0A 4Y4HB 5TK2A 3UBGA 3VJ6B 3CZFA 2FSEB 2YMOA 3GFUA 2EDTA 1IE5A 4WK4B 1WBXB 3RWGA 3S96A 4ODHL 2HLEB 4N22A 1CT8A 2K3HA 3Q3GB 4JGUA 3I6KB 4P2OD 4JREC 2P5WD 4BFRA 4OJFL 1VPOL 4YS4A 1OT4A 2V7NA 6FABL 5K69A 1B3IA 5KS9A 4BSVB 3AQZA 4HS6B 1SN0A 4UB0L 2BRRH 1G7HB 3MA7A 1E4XI 3WJLC 1A25A 5E2JA 4AXWA 2HT3D 1HXYB 3F3HA 5A16B 1YC8A 5T3ZD 4QXWA 1F4WL 5B3NA 3MRHA 3ZO0A 1V54B 5LXVA 2KQMA 4XWGH 1DLFL 2LTQC 3HG1A 1JG9A 4E5XA 1EFXD 2JQMA 1BQSA 1QUNB 2AV7A 3CDGA 4IOSD 4TQHA 5GRYA 12E8L 1A4KB 4IS6A 5ISZB 1TTUA 4Y4KD 2OX5B 4PGDB 1G7LB 3MV01 4YR6A 1WCBA 3R8QA 3PL6B 4ELME 2NYKA 2K8MA 4F37F 3VXMB 3QJHA 3GK8H 1U41A 3CX2A 4PJGA 3GSNA 4AYBA 4DEPC 7TAAA 1H3XA 2LU4A 2N1KA 3QCUL 4P5TA 3NCYP 5B21A 1CIDA 3SYPA 3MBED 2AEWA 2HLFD 3UYRH 5C9JA 4BWWA 4XP1L 4JCMA 4LCCC 4HHAB 1GAFH 1MELA 1XGQB 1YSOA 5FA3B 1B6UA 1QMUA 5CLXA 1NAMA 4M62L 2LV4A 3DMMC 4JHVA 4PJAE 4XOAA 5G5DA 1WFOA 3BWAB 4PRAA 1F11A 3HAEA 3ISRA 2Y7SA 3RZCB 2VAAB 5J4MA 4NN7B 2VL5A 4HAGA 4PJCF 1U4EA 3PWPB 4PCYA 4YQXH 1B4JL 2K78A 2NXYB 4RMRA 1P9MC 3IDMA 3VFVB 3ABLB 2C3GA 4J1UB 3L4VA 4KKQA 4GG6A 3DIFB 3KG5A 2K4WA 4BJLA 2XZZA 3V5DA 1MHEA 1S5IH 4YAQA 5I6XB 2X9YA 3TPKA 1BAFH 3NCJL 4NCC2 5CGMA 3UTTB 5ITFA 2NR6D 4MJJA 3CJJA 4TSAL 4NN5C 3DYMA 3LRMA 1IGFH 4RGMB 1SJVA 4B7LA 3LAFA 2YFNA 3GLDA 3C2AH 3QZNA 4QRQB 4Z7UF 3QCTL 4L5FL 4V1DE 1NBZB 1GZPB 1K3IA 4JHUA 1KTLB 2DF3A 2GJZB 3MRMB 5HHPB 4H8PA 1FVCA 4XPBL 4MDJA 3T1FA 4OCNC 3TEUA 3BIAX 1BHGA 4QDGA 1OF2A 1NFDF 3MBXH 5CAYB 3NA9H 2WVTA 3ZY7A 1I7RA 1N4XH 5ALBH 2VISB 4KK9C 5D7KD 4CKVX 5I1GH 1XBRA 1ZHNA 3U9PH 4AJ0A 5LWYH 3FB8A 3KAAA 4F5CE 5ILTL 1SHXA 5I5RA 2IO5A 4PJ7F 2GKIA 3BKYL 1DVXA 2BVQA 1BJMA 4GS7C 4DQOH 3VM5A 4RVBA 2Q86A 4KHXL 3V4UH 3KEHA 1ITBB 3IMUA 2AW2A 2VXTL 1NJ9A 1CZ8H 5EEWA 1YA5A 1RZJC 4XPAH 1A6AB 1P4UA 4EBQH 1I9EA 4KKBD 4FLHA 5HHVH 4D9LL 4JO8A 2MOGA 2VGLM 4U7SA 2NY4D 4GBXD 4PRPD 4U2ZA 3TPUA 5D1QE 3TIDB 2KZ1B 3UO1H 4DKAA 3VRIB 5I17A 3L16A 4OV5B 2W60A 4U1MB 5IJCC 3WN5C 2YD6A 3SYCA 1Y1DA 1XH3B 2CCLA 3W5NA 4YK4B 3K81A 3RVVD 1E9QB 4UAHA 1QRKA 3IGUA 1NWOA 1WFUA 2YD7A 4QAMB 4HULB 3EGDB 5C6TL 2V2WA 2CXKA 3KS0H 4LIQL 4BSJA 3QDGD 1YY9D 5JHDE 5I8KH 1ADQL 4LQFL 2HA1A 3T2LA 3UAFA 2HJFA 2OMUB 1PY9A 2Y69B 4XBEH 3BP5A 4YDLC 5C07B 5DU7A 4NENA 4LVOB 3TBWA 1TJGL 1J0KA 4FQXA 3TOPA 4KY2A 4FNQA 2VDLH 3L3DA 3EUDA 4FXKA 3KHQA 4BFJA 5EIIA 3C5ZA 1R3JB 2QADD 6CGTA 1PQZB 2AXHA 1AIFB 1ZCRA 3U48A 3L3HB 2WC7A 4GQRA 5FGCE 4JGNA 2HRPH 4P23B 4AK1A 4JJ5A 3D0VB 5F89B 1JWUA 3CLEL 4GI6A 4OIIH 2WSDA 3O6LL 3QDJD 2BLFA 4GXFA 1SXNA 4XP6L 4Y5VB 4ZUTB 5GZOA 3UBFA 3H1ZA 4XT1C 2DD8L 1IVTA 5FUZL 4BUQA 3GINA 4YHKL 2YKLL 1PBYA 2JIXA 4I0PB 4A7UA 3DX7A 1MH5A 1EIBA 4KX7A 5TE7L 5KWYC 1DO6A 2WQUA 2VN5A 1G0YR 3H6AA 1UA3A 4E9WA 2Z1KA 4P4KB 1Z3GL 4YE4H 4AMKL 3VXSB 4NCDA 2YPLA 2OR8A 3V4VA 2QPSA 1NGQH 2VMFA 1ZT1A 3SYQA 4NRZA 4KZEL 4PCKA 2KT6A 4ODWB 1DJGA 1ZT7A 2NX5E 1C08A 4QRPA 3DX1A 4M7KL 4WW2C 2BIOA 4PSPA 4PRHA 2DI8A 2BY3A 1KPUB 2CK2A 2PP8A 1JE6A 3D09A 2VDPB 1IQDB 4P8QA 5GRXG 4F7EB 1CYWA 4N8VG 3VXQB 3IU3B 1OAYH 2W65A 2L7UA 4BFFA 1CFTB 1HHHB 4QHLB 5ESVB 3LKPB 4ZW6A 5DQ9B 1PG7W 5F9JA 3UJTH 2Q76B 1HHGA 4NS0A 3QNXA 1SXSA 1IM3B 3X1EA 1PZAA 3ULUL 3FTGB 5EOCL 4ZFFA 3C5ZC 2X9XA 4HG4J 2EAEA 4YSRA 4YSSA 2KC0A 1G6RH 1KT2B 1RLBA 1NMBH 5MEQA 2AQTA 4PTUA 2RMNA 5C97A 4QHKI 1ZEAH 1EVTC 2XIDA 3VDCA 3OKOA 5BRZA 1V10A 2F5BH 3KGTA 3SKNB 4WK2B 1SY6A 4ZUVB 4X7TA 1QASA 2X4OA 1OHQA 3T0BA 3P4NB 4QY8B 4QRRD 4BH8A 3SDDD 1BOYA 3EJSA 1RK7A 4KHTL 4EMZA 5DUBB 1S3KL 1J86A 4HOXA 1NUFA 5HYJD 3DROA 4LFHG 3MGTB 5L2JB 4ZPVA 4WSGA 1LGVA 4DP0X 1YEDA 4YSDA 2DQCL 4D9RE 4DGYL 3DO7A 4MS6A 4N0UA 4EIGB 1X7QB 3UYPB 4AUYA 1PKOA 2DQJH 3B2VL 1FPTH 3RJQB 3V55A 2LFGA 4KKRA 4OGQC 1JGUL 1ONQA 3M86A 2NY2C 3QYCA 4DCQA 3A6CH 3FB7A 2XRAL 1GC1L 4HUNB 3BQVA 4K23H 3FPYA 5J11C 3LKQB 1JNNH 2ZXBA 1OM3H 1OHZA 2UZYB 4UIMA 1QFHA 4HLZG 4LRIC 4IRZH 4LPWA 4K71B 4OGAD 2DLIA 4PBWD 4PJXF 4E9SA 1MIEL 2A6DB 4ZOEA 1KXQA 4HFUL 1T1XB 2GEEA 4TRPL 3FSWA 3LVEA 1I1YA 3BMVA 5IMOA 4X4XA 4ZQTA 1P1ZB 1MXGA 4XNYL 4PRDA 4JPQA 1CGYA 3Q2VA 5D4JA 3WMPA 1YUHB 5BQ7A 3F7VB 3MJWA 43CAA 3KWWA 5L2KA 4WY7L 5KUMA 3K0YA 3HUJF 4QXGH 1KSRA 4X5QA 1JRHH 5CCHE 1E3XA 3LKSB 4KJWC 5CLZA 1AR1D 2ZP9A 1N5YL 3LNGA 3TC9A 1CFVH 3J2PA 5LAXB 4JO3H 2AXFA 2JKLA 2X0WA 3QXAB 3BKML 1NOFA 2OMBA 3M45A 4JDVA 4R26H 4U33A 1RURL 1CLOH 4BD4A 4KY1H 2PETA 3D3VE 3F5WA 2ARJQ 3HOGA 3RWDA 5IB5B 3TVMA 1KFAH 1NKRA 1RZKC 3VQ1C 1BD2D 1J5OH 1E8ZA 5DLML 1W8OA 4JRXD 3BSZA 3QYNA 4DGIH 2X0VA 1B2WL 4AYGA 3NSFA 3W39A 5HVGB 4X4ME 4HUXA 4CVZB 2Y06L 1QOKA 4IRJD 3PY9A 2OSXA 1KLUB 4GAFB 4NWTH 2LVCA 5DJAA 1FFPA 5LDUA 4JDTH 2GC4C 5G55A 3MNDA 5IGXL 2J8UE 3VFNA 1MQKL 3DETC 2NXZC 4WHDA 2ENPA 2NSQA 1NGYB 4NSKB 3MHZA 3VYNA 1IUZA 1NCBH 3CUPB 3EF4A 4JO4L 4WCYL 2ZUYA 4OLWH 1R3HB 1WLHA 2VXQA 1MW1A 2ATKB 1ZVYA 4G8FA 4BFNA 4PP1D 1UURA 4O02L 3POCA 2ICWA 1NANH 1XEDA 5FKPA 4EN3A 1PDKB 3EJZD 2EVHA 1H3GA 3TYGL 1JI1A 2H3XC 1WC7A 5C9KA 3B7UX 1KJVA 1FAIL 5ANMA 3OLEA 4R7DA 3WEXB 3ZHDA 1JWMB 5MI0C 4MMYB 1TSRA 5AVQB 3KYKL 4M1GH 1BQHA 4NHUB 3BVNA 3M7FB 1A3RL 4RFOH 1QACA 4NBXB 4KKLD 3L3OA 2DYPA 3HW7A 1ZHLA 4MAYC 2ZYRA 3T4YA 1N0LB 2PTVA 5I6MA 4N8VB 1A4JA 1VEOA 2GJ6D 3N42F 4JKLA 3WXWH 3RIFF 1KN4L 1MFCH 2G4EA 5C0BB 3GEWB 5IIEA 1H8LA 3RWJA 1E3FA 3EOTH 2BVOB 3LXCA 4MAUL 5L7XH 4ACPA 2MCMA 3H2PA 3ENEA 2YD5A 5C0DA 4DK6A 4P2YA 3WFBL 3K2UL 4IM8A 3EW3B 2YA1A 3FRUB 4RGND 5AVZB 2PXYD 4NGHH 4Y19D 3D85D 3O45A 1U8JB 4K2UL 4OZIE 2AK4E 2O5YH 1N59A 5HI5D 1DN0A 4N68A 3KXFA 5IMKA 1WCQA 5LGJA 2VB5A 1V5JA 1IGCL 5IMLA 4MJ5A 3LNHA 3DX0A 4WV1C 3CFEB 2DLEA 1IE4A 3CMOL 4JCWA 1QFWL 3FQXB 3MCG1 2VRAA 3QUYA 2IH3B 4G3YL 4ZW8A 4NNPL 5IUCA 5JHLL 5EU6D 5C7XH 1OSEA 2C1OA 3QO1A 2H26B 4HUVB 1RFDH 5E8NB 4G42A 1S4IA 4R83A 3CU7A 5DF0A 3DGDA 4NUGL 1MLCB 4DPCX 1CS6A 1I1AC 4R5XA 3VFGL 4HIEA 4GLRI 1ET7A 4IBVA 5C1MB 2ROYA 3FQTB 4HEPG 2YQBA 1HC1A 3PV6B 3BH8B 2ZNXA 4PVBA 4A2FA 1FI8C 4XNUH 2R8SH 4HKBA 1UQSB 4NKIL 1INQA 4OJCA 5A3IC 4N8PA 4KGLA 1FL3A 3AXHA 1UB6A 3GBDA 3SCMA 3F00A 3QPKA 1UEMA 4R97B 3ARGB 3NIDB 3PHQA 2CO6A 3GMPA 4HCRH 4BGDA 4PS4L 1TNMA 2AQRA 2RCSL 4MMXB 3MLTB 2XQYG 1DDHA 4NAQA 5C09A 5JLZA 2ZOUA 4JFFB 2XZCL 1MFBH 3HBPA 5J6SA 3CWGA 1XD1A 4X98B 2XY1A 4FEMA 5I8OL 2HVJA 4M4RA 4OCSH 3L7EA 4GW5B 4HS3B 5FC9A 1Q9LA 2L4OA 3KH3A 4WLCA 5JORA 3VI3B 2J4WL 4HOMA 4KK5C 1KIRB 3KJ6L 4X99B 4G9FA 1AY1L 4W4OC 2IDFA 4JGJA 4YDVB 2Y7MA 3HG2A 4PB0L 2AFNA 3CVHB 5FW6A 5C0FB 3FRPA 1G4MA 4PS8A 2CLVA 1MCLA 1UG9A 3LPOA 3OKMA 4KAQH 4M6OL 4QRSA 4UM9B 4MCZA 5SWSB 3QUYC 4K3JL 4DAGH 1DTUA 1S46A 1ZA3A 1MW2A 2W95A 2YO3A 5MENB 4Y1AB 1TEFA 3ZTJG 1JK8A 3LPPA 4BE6A 2FSDA 2WJ5A 1EBAA 4YL9A 3VGAC 1TMQA 3B43A 1XD0A 4Z0BL 1XQ4A 3JBG7 1E4WL 3KLKA 4KBPA 1CFQA 2AEOA 1SOSA 4OM1H 5T3XL 1YEWA 4ADGA 4N3UA 1HKLL 4WI5A 1PSKH 5D1XB 1HJCA 1BVKB 1IC4L 3K46A 4GSDH 4O51A 3Q9PA 4HWBH 3FCTB 2WQAA 1IL1A 2UV3A 4OI9A 5IW1B 5EH1A 2XWZA 3QXDA 4Z7UE 4EPSA 1LDPH 2BS8A 2X4RA 4N2HA 3NFSL 1OAUH 1ZE3C 3OX8B 1TKWA 2ZXWB 1RUPH 3IGLA 3H2QA 4G2AA 4FGMA 2HJLA 1NFDE 4HD9A 4HP5A 3V0FA 3HCVB 3SPGA 1RIVL 1YY8B 2E86A 2BNQB 5CBEA 1MWAH 1AZBA 1HOEA 2PCPA 3GIVA 3ZZ1A 4QTIH 4YHLH 1M53A 3E9UA 4FNLL 2VDKH 3RDTC 3T77A 3GMQA 3II2A 5AW3B 4PJ7E 2XWRA 4MDIA 3VFWB 1CDCA 2ZAGA 4N2BA 2G3NA 1ZPLA 3MV8A 2P47B 3S4SG 3DV4A 2JKSA 3E6FB 5GRUL 2JLLA 2A73B 5TQ0H 4DFIA 3HNSH 3QZPA 3UGEA 4I2XB 4JFZL 3HB3D 3VFSA 4YHIA 4ZMVA 1UA6H 1A1NA 3STLA 1HJBC 1FLRL 3LEYL 1OK0A 3EJQA 2Z8SA 3ARDD 4DP5X 1I9JH 4W81A 4AE0A 4XRCB 4FFYA 1FJ1B 3GSRA 3OXRB 3AREB 3DOSA 2BPBA 1DFBL 4IBQA 1H15B 1AHWC 3RDTD 3SDCB 3MNMA 4ENEC 2E47A 3ATDA 4IIQB 2EIKB 2OMYB 4XC1L 2NW2B 2ADIB 4U6XB 4MNQE 4AQEB 2WLIB 3MRQB 5FFOA 3SD2A 4FFVC 1CE1L 1ECZA 4XX1E 4EJ1C 5CINL 5AOIA 3OBAA 3DX3A 1THCA 4CADB 1WHOA 4XMVA 2AV1B 1KB5B 1JZJA 2J43A 1XTLA 1BZQK 2WBKA 2Y1ZA 1ZANL 4XNAA 1O5DT 3C6LB 3B9AA 3LNFA 4YHYC 2VSDA 1SHSA 4WUUA 4ENED 2QLVB 1T21A 5EEUA 2VLKA 2R83A 3A21A 2FVNA 2AAVA 3E7JA 2HVKB 3Q0HA 4U1LA 4WI8A 5JIKA 1A3QA 4DGUA 1QAWA 2V37A 4OZHA 2BNUA 2OXHA 4NNXB 4YH6A 3MFFB 4Q9RL 2OXGB 5IHWA 1GZHC 1RQ5A 4EZLA 5I6OA 5FO2A 1DEEB 5GGSA 2WQSA 1IEBA 1KCVH 3ESMA 4K3DL 3BUTA 3FCSA 4I18C 3FUEA 4U31A 1QR1A 1V3LA 2RALA 3ULVD 2EDJA 5F7UA 3B56A 4Q9BA 1H6TA 2ESVE 4LARH 4PJ8C 1QTYT 4LF3A 4K5PA 1CL7H 2UY6A 2C3HA 3BW9B 4HJ0D 3ARBC 5J06A 1QFOA 5FGRA 3NZHL 1L5GB 3DBXA 5D2NB 2WSPA 4LKCA 2EEAA 5D96C 2J7LA 5E2TH 3GNML 4F8PA 4TSBH 3O6FB 2A83B 4LEBA 3GSQA 5BVJA 1NSNL 2UY7B 1MRDL 5AVVB 2XFGB 1FH5L 3FHEA 2MNWA 3V52L 3VFMA 3ZT7A 5C0AD 3F6LA 4D0CA 4BZ2H 2AGJH 3NPSB 4H88L 3FT2A 1MJJB 1FYTA 3LN5B 4JY6A 4W1TA 2DBLH 2B4CL 5ICXA 3KPRE 2F53A 2NY0B 4ZNCD 2AQPA 3LB6C 2UXTA 4F8OA 5GS2H 3IJHA 3MYJA 3R4RA 5EWIL 3S5LB 2XQBH 3VD5A 3ZMRA 4GJTB 5E4EB 4AGNA 4HPHA 1X5IA 4I3SH 1R3LA 3CFJA 3JV6B 3CZEA 4JQIH 2P7TA 4B9CA 3TN0A 1TNNA 3HS0C 2N0MA 4U0RB 1E5UI 2HFEB 2C9XA 3T2NL 4MJIB 2V4LA 3SKJH 2GJRA 2AITA 2JJSA 2H1XA 2P28B 3OMIB 4H5SB 4AL8H 2A9DA 1SFHA 5F6IC 4ANUA 1HINL 4PB9H 3RFZB 5FM5M 1NDGA 3L81A 1XH1A 4B9KC 4QI3A 2OZ4L 4QXUH 4ELMA 1VFOA 3BP6A 5DDHB 1E8WA 4ZFOA 4NQSA 4CN1A 3D12B 3QDMD 4PN6A 1MCWW 2JKWA 4GW4B 1D9KC 3DOIA 3M8OH 4LDEB 3CXDL 3WS3A 5DZPA 3TO4D 1L7IL 1H0DA 1Q8MA 5D7JA 2WNKA 3CAFA 1F4YH 3QQ4B 3IDNA 3GGWA 3FO9A 1VAHA 5JPNB 2DEXX 4K94H 3O4LB 5K39B 3DIVA 2FLBT 4A7SA 4PJAA 2AJVL 4XCYB 1NC4A 1O7SA 1J8HD 5KVFH 3RVXC 3UTZA 2XJLA 3WFCH 3SDAD 3HMXH 4AT6B 2VLJA 1IKNC 3BJLA 5CZVL 3SODB 2KDGA 2JE8A 3DXAD 4U1SB 5GGRB 3EFDH 1X5XA 4PJXE 4CU6A 1OD7A 4H40A 5AWNL 1SDYA 1E3ZA 3O8XA 1I7TA 2XQYK 3UPCA 3QEQA 5AVRB 3I3EA 1FO0A 3KJ4C 4WHTA 3ELQA 1T7XA 2XG5A 2P3YA 4C4KO 1MCWM 1G7QA 1WAAF 3V0VA 3WIFB 1E4JA 2VDOB 2O5ZL 3WOVA 5FO8B 5GRVL 1AAJA 1FFQA 3HUJE 2R29L 4V1DA 5EO9B 4AH2B 1M7UA 3OC8A 4M93C 3WE6A 5IJKA 3THMH 2X4QA 3R7RA 3BDBA 3B9KD 3U4BL 3WIHH 1KWKA 4WW1A 3UZQB 2NOYA 1Q4NX 1QBMH 4ZS6C 3MR9B 1P7QB 2YKKA 1TITA 2RACA 3COOA 4U7MA 2A77H 2VITB 2X1PA 3EJYC 4F5CA 3IPFA 4S1DC 2ERJC 3CN3A 1UXWA 5HYQA 2BP3A 2IV9A 4JB9H 5HHXL 4F9PA 3KBFA 4OGXH 1Z9SA 3KM1A 3GI9L 2B2XL 1PVHA 4WK0B 2F7QA 4OVVA 2AJZA 2UYLB 2XN0A 1DSWA 4V2CB 3D0AA 4OCXH 2ATPA 3OHXC 1NBCA 4G6FD 5BV7L 1QLFA 2BDNH 1NCTA 1YMMB 4ELKB 2Z7ZA 2WXNA 3BVUA 1XSKA 3EO1A 3V0AC 3D48R 5D1QA 5CEXB 2Z4QB 4YSPA 1YEHH 2XZQL 4ZS6D 1S9KC 4M1DH 3A6BL 4L8CA 5C0IB 2VDNL 5K5YA 7CGTA 1KEGL 1IT9L 4U1GC 2AEPH 3MNWA 4OZGB 3X3FL 1L0YA 4MNGE 1G7PA 3C5JB 4A7VA 3C60C 5CEYB 4KJPC 2EACA 4QHMB 4DP6X 4X5XA 1KJ2A 4G9DA 4OD3L 4QRTB 5HY9A 4EUPA 5I19L 4KQ0A 4ZYKA 4K15A 1MRFH 4Y89A 1XF2B 3BYYA 1AJ7L 2NY7H 4OT1L 3BWZA 3QUXD 3Q2LA 5F7FA 2WW8A 1E6OH 4GT7A 4H2CA 4MYWB 3C9NA 3S3CB 3IXTB 5T3ZL 1BFSA 2FATH 3NCMA 2DM3A 1F02I 3OR7A 5KJRH 2H41A 2K7PA 4GKZB 3A67H 1FIGL 3PU7A 3NP4A 4PPTA 3O9WA 4Z7AA 1S9WA 1F58L 1KYDA 1TEYA 1EJ8A 4GPVA 4QO1B 2E9JA 1X5ZA 1EEZB 3H54A 4WKZA 4ZUWA 1XGPB 2QV4A 1A3LL 3SEPA 4LPTA 5JXED 4KKCD 1ASQA 4YO0A 2FEEI 1UWXH 4C83B 2X38A 1FNFA 2OMXB 3SQOL 4UDTA 4F9PC 4LSTL 5CD5C 1IZKA 1W15A 4P2QD 1GGYA 3VXOA 4Z8FL 2NCEA 1EO8L 1LEKA 1LL1A 4AW7A 1IAIM 3PIQA 2Q10A 4FG6C 4KK8D 5D7IB 5FYKU 2O72A 4ODHH 3ROLA 2DQGL 1HHKA 1WD9A 2D2CC 3D18A 4I0KA 6FABH 4OJFH 1VPOH 4NLAA 4JFPA 2V3DA 4L3EA 3MRFB 3ATBA 4JFYA 4UB0H 4MJHA 2UZIL 2H6UA 2NX5A 3PUUA 2WMPB 1TQCC 1FCCA 4KWUA 1F4WH 2K1MA 4QRAA 2IPKA 3P9LB 5FB8B 4R0LC 3VCLB 1B4TA 4JKMA 4KO9A 3SGEH 5AD0A 3KMDA 1DLFH 1IAMA 4AKPA 1DJXA 3NK4A 4LNRB 1UXSB 4XI5D 12E8H 3VFRB 4K7FA 5E9DA 3B83A 5AKVA 3MJ7A 3CDFA 3K1KC 5F1KC 2QSVA 3QIBB 2NUTA 1YCSA 2PYED 4J39A 3QCUH 3NCCB 3IMVA 5EMYA 3TIEB 1XCTB 3QGVA 1WHPA 1S7TA 4XAKE 4PWEA 2JI2A 2WXLA 4XP1H 5E1GA 3MRPB 3V0WL 5BUPA 1X44A 1XB6A 2AQNA 5AW8B 2CCWA 2NNAB 2UXFA 4MBRA 4M62H 3KYNB 4JPIB 3H7LA 4QTHB 1WA1X 1NIAA 5AL8A 4ZFZA 3KEDA 2DW5A 1I8UA 2OA9A 2WKOF 4M1CD 4NUMA 4L4TE 3VYOA 4HLEA 4H7VA 1D5ZA 1E2VA 3EYSH 3Q7JA 4EQ3A 3BAKA 4OJEH 4KRNA 5IEHA 2LGNA 3IJYA 1B4JH 1SHWA 1DE4A 3K5RA 5HYIA 1T20A 2HT2C 4H44C 4MMZB 5GSVB 4DWHA 5K9KB 1S7RA 3BPCB 3RIAK 1J48A 1CIUA 1S78D 3X13A 3CG8A 1WBYB 3QRLA 4RIRA 5FO7B 3S36L 4I0CC 1U8OA 3T0EB 4FD0A 1CYGA 3NCJH 5CGTA 4M43H 4XTRD 2WZPD 5DO2C 5CBAB 2B3IA 5SWQA 4TSAH 3RTQC 2BOBA 4GO9A 5F21B 2W92A 5KVDL 2E7DA 2XN9B 3ZQ9A 4G8GB 4O2FA 4WI4A 2F7IA 4JZOB 5T1LA 2E7BA 3QCTH 5ESAA 4L5FH 2HX9A 3M6DA 1CB4A 3QDHA 5D6CB 5EIVA 1URLA 4W4NA 2Q5BA 2D8KA 4XPBH 3WS6C 2ZCLL 3V0EA 4FI7A 4KZDL 1Q1PA 4HK0A 4N9GA 4IQHA 1ND0B 3UIYA 1G1OA 1OLZA 4KK6C 2W0FA 1RU9L 3QZBA 2GPZA 2Q3ZA 5AVSB 5KYUA 3ZE0B 2B16A 3I3BA 4M5TA 3VNZA 4J4PC 5ILTH 5DO2D 3BKYH 1IC5L 2ZSWB 1SXCA 3WSQL 3RY6C 1NM4A 3GJEB 3SSGA 3BCFA 4KHXH 3TBVA 5M7QA 2XG4B 3DHPA 3KW8A 3DV6B 5CJQL 2VXTH 3B5GA 4JANA 3AY2A 1KGCE 3MV7D 2EDRA 3T8MA 4IBUA 1M42A 4D9LH 1MHCB 1ZV9A 1GCYA 1D5MB 3VGBA 3W56A 3QHTC 3VFUB 2Z7YA 3RURA 1ORQA 4PBVC 3WUWA 1U8PA 1H9DA 5D6DA 2XICA 1XF5B 4NUJA 1WISA 2R2BA 1F3JA 4Q0XL 3QUMB 4JFDE 1RJLB 1T04B 4X4MA 5AAWA 4OV6F 2ZYIA 3B7SA 3NSCA 1EHAA 3VW3L 2P43B 4G83A 4PRID 4WSKA 5C6TH 4LIQH 1KPRB 3P4MA 3KYOB 1U3JA 4H8QA 2J8UA 4WZ9A 2IAND 1ADQH 5D5MB 2XC8A 2GTZB 1DVQA 4LQFH 4KKNA 3KPSE 3SJVE 5HPMA 4QEGA 4ZMAT 3B2UD 5KSBA 1TQUA 4J3BA 1TJGH 5KYNA 1P2CA 2OW6A 4ZNEE 3P77A 4RBPK 4AK2A 2Y3AA 4NWUL 2OK0H 3H9ZA 4J3OG 4O00A 1KLFA 1OL0A 3HE7D 4L8SB 1L9MA 4UQ3B 4EI6A 2WN2A 3QSKB 3QUHA 5FDYA 5D1ZA 4Y16B 2XA8L 2VR7A 1B0GA 2CUAA 2TSAA 3CLEH 3QFJE 3W0WE 1B4RA 3O6LH 4HIJB 3D2UD 4XP6H 3WJMA 2Q7NA 2P45B 1EO5A 3MI6A 4H25B 1A9EB 2DD8H 2XXFA 1D6EA 3IJSB 3WHE1 1HEZA 1YAZA 4GG8A 2VXSL 2WZAA 3MRDA 3SO5A 1Q9KA 4LLWA 2ZX8A 3GDBA 5TE7H 3H0TA 5KYYB 5F1NA 2FO4B 2VDRL 1I3RB 2FWUA 4E5XG 4PGCA 1QSFE 3HMWL 1IU1A 1Z3GH 4AMKH 3AUWB 3MOBH 2BOCA 3N40F 3NUKA 4EI0A 5SWZE 3S35L 4KZEH 1HZLA 5C3IA 1BZ7A 4D3CH 4D94A 2GITB 4NZUL 4L8DB 1BBDL 2EDBA 2EXSA 3BT0A 3KLQA 4QJ4B 1DLHA 4M7KH 4DUXA 4WFEE 3C6SB 2D9CA 3GSWB 4OZIA 4GRWH 5E7FA 5GS1A 3VWJA 5CCKL 4ZSOE 1G5GA 1RI8A 2D7TL 2VDQL 2YPKB 4M02A 4HLJA 5L4FA 3HE6B 5F3FA 1EZVY 3TJPA 2ARJB 1TZOA 2YBGA 2ZWYA 3TCLB 2WIIB 2H9GA 5IJVA 3ZR5A 3L9RB 2BJML 4U1KA 4YSAA 2JCCB 4OU3A 3HHRB 3EFOA 5AOMA 4YX2L 2OMZB 1VJSA 3HAEG 5KSUA 3RKDD 3BVVA 4ORGB 3ULUH 3A6OA 1GTNA 4WRLA 4R3SA 5EOCH 1BWWA 4PJ5E 5CLWA 3VXRD 4OF5A 4KITB 4P9ML 3H9HA 1KPVA 5K9OB 2D7OA 4QRFA 5D1ZC 4ZMPA 1I8MA 1HILB 1SEBA 3M07A 5GS0H 3WL9A 2HKHH 1L4IA 2F7OA 1X5MA 4WTZA 1T0OA 4PJEB 1D5IH 4KHTH 3HHSA 3L1GA 1S3KH 4LVNC 1F45A 4R2GD 3HN8A 5AW4B 1B4LA 4Y9BA 5EZOL 1H3PL 1NIDA 1DVFD 3VACA 1TQWA 1YZZA 4U0QB 3I6LD 3ZR6A 3RB7A 4JREB 2RGSA 2DQCH 2RTTA 4DGYH 1C9SA 1VZHA 3NIDF 2WLYA 4XO3A 4KJYB 3TYFB 4DKTA 3MLYL 4EZJA 2ICWI 3B2VH 2CGZA 4EKJA 1JGUH 3G5VB 2XRAH 1GC1H 2LTQB 1W0VB 2R7EA 5F93C 1Y0LA 3WLBA 1HH9A 3OL2A 1MIEH 2DMHA 3BC9A 4HFUH 4PJ9A 4TRPH 2PCFB 5DA4A 4DF9A 3FUNA 3HZVA 1WYJA 1CFMA 2Y6TE 5IROA 2AZAA 2XVGA 4Q6YA 3FO0L 4DEPB 4XNYH 5CWSB 4BK5A 5IW3A 2ZSVB 4Y2DA 5E94A 3VXME 1MCJA 1OP9A 5T5FA 3VXTA 1JZ4A 1AVAA 4LCCB 3F65A 2ENYA 1GPOL 1XIWA 4HEME 1HI6A 2X89D 5DRWA 3DMMB 1S9YB 2D7MA 3EYUL 3MUY1 3QJZA 4W9IC 5K1VA 1FQ9C 2WKLA 3BKMH 1BQLL 2SEBB 4PVNA 5I8EB 3QIUC 1RURH 4HXBL 2FD6L 2OJZL 5BZDA 4AVIA 1RY7B 1JGDB 1H8OA 3D39D 3MC0A 5I8CB 5DLMH 4ZOAA 4LLDA 4K8RC 1GY1A 3PWPE 4JFSA 1B2WH 3OPUA 2VJ0A 2ZWKA 4P2RB 4MX7B 2DYSB 3I02A 2Y06H 5EIIG 4LOVA 5ENWB 2WYHA 1FVDA 1WAAE 1D5XB 2DEYX 3BOVA 2P1YA 4NN5B 5IGXH 3UTTE 1SJXA 1MQKH 5E6ID 4Z7UA 2DH3A 1EDYA 4JO4H 1M9WA 4WCYH 5EUOA 1UWEL 1AXSA 1UGNA 3ECQA 1EUUA 5I1LB 1TZAA 4L3AA 1HZHL 1NFDA 4LP5A 3KBPA 5KJ4A 3P0VH 2DMGA 4ATWA 2VJ8A 3NEEA 1Z32X 2YD2A 2EZ0C 2MKLC 3R0NA 2O61B 1LEGA 2F1BA 2JJVA 1ZS8A 4AQ8A 4BKLB 1VLXA 4IS6B 3TYGH 4YR6B 2D0GA 3O4OC 4JM0A 5IROC 2XWJA 5GJSH 4R4FL 5LGHL 4LPXA 1FAIH 3RBGA 3ILPA 2WBJD 3QJHB 5DHXB 1KIPA 5TDNA 3KPPB 4GS7B 5DSCB 1QG3A 1OZUA 3DYOA 3KYKH 1U92A 2MHAA 1A3RH 2IBZX 5EOCJ 4KROD 2ZWZA 4M03A 1UACL 1R5WA 2N7BA 3B2MA 3ZTEA 2CJUL 2CIIB 4Q74A 2EEBA 4C58B 3SPIA 5CSZA 1JXDA 5KZCD 1JUFA 2DZEA 4HWEL 4TSCL 1XO8A 5LQBL 3FFDA 4ZXBC 2IDSA 1NWPA 1KN4H 1TYJA 4K7PL 2IOIA 2QL1A 3L95B 4N4YB 3HAEB 2O1AA 2VIRB 5E70A 4MAUH 4M6ML 5BMFL 3WN5B 4JKNA 4XAWL 2FQDA 4LSSH 2CM6A 3WFBH 1KDIA 3K2UH 4L9LC 1OGTB 4B50A 4PY7B 3WAKA 1Z9PA 1F90L 4OZ4B 4MNQA 1KN2L 2LU7A 1ESOA 3EYFB 2D9QB 4QRUB 4K2UH 2ZX5A 4YAQB 4UILH 5EO0B 4OFQA 1E28A 1YMHA 4J3OD 5IOPB 1RPQA 2CLRA 3PHAA 4J8RA 4YDLB 3UPRA 1IGCH 1O75A 3P30L 4M5YL 3IFLL 1R6VA 3KCPA 3CMOH 1QFWH 1SJEB 5C07E 3TEYA 1U3HA 5JHLH 1J5HA 4NNPH 3MKKA 4MDJB 3FHAA 2OS7A 4AKQA 4NUGH 5KSAD 4JMNA 4UT9L 3TFBA 3RWEA 3VFGH 4CMMA 2BSSB 3TNNA 1ZHNB 4LL4A 3H8NA 1T5KA 3HG1D 2EO1A 2DWDA 2R0LH 4WJKB 2BVQB 5FFGA 1Y6NR 5FGBA 2QBWA 2QQKL 4E36A 3DUUA 2B8OT 3N91A 4WWKA 1E5BA 1OB1A 3HS8A 4Z77B 2ESVA 2WLNA 3C5SA 2COQA 3TA3A 5IUSA 5KG9A 3IJ8A 1RZ7L 4PS4H 4ZO6A 4XNMA 1BPVA 3MLRH 5ACZA 3EYVA 4P5TD 4WHYG 1QZNA 1U8CA 2XZCH 4DJMA 3VXSE 4JLRA 2WWMC 3OMZA 3GSUA 3GXTA 4RZCA 5F9OL 1ANUA 1VFMA 3ZUCA 2W60B 3CSBA 3P3YA 1E4XL 1ZJBA 4WW2B 1HK6A 2BW4A 4RMSA 2G75A 5L9DL 1I8LC 3WELA 1QWUA 2J4WH 3KPRA 1DANT 2ITCA 5KJ7E 1OGAB 1QSEA 2ZOKA 2BFGA 2XX0A 4QRRB 1I1FB 4AQAA 4MWFA 2DJMA 4P06A 3V9EA 3ZLQC 3BP5B 1NCJA 2W91A 5DD0L 4M6OH 2OCFD 4D9QD 3TBWB 2OZNA 1JHLL 3FU6A 1FL6A 1ZAGA 4K3JH 2XTJD 4N5ED 4LLQB 5IB2B 5JIMA 2FGWL 3LIZH 3VDBA 2DQIL 2YWZA 1J12A 2EYSA 3C5ZB 3QA3A 3Q8EA 4QRBA 3RNQB 4P9HH 1JDAA 4L4VA 1EANA 1KY7A 1H5BC 1YPZB 4BDVB 1UD4A 3HFFA 6PCYA 4HW6A 5LHDA 3FO1B 4N20A 4Z0BH 1TZHA 4O2EA 1PKQA 1N6QL 1A4CA 1T6BX 5D71L 5FV1L 1PYWA 4KXZH 1E4WH 3SQRA 3T6VA 2DIEA 5DZAA 3VXPA 3AM8C 3ABGA 1CG9A 3MRIB 1AOZA 5DJXA 2UUDK 3G6AA 5T3XH 4G7YL 2PTTA 5I16B 5L4MA 1BV8A 1HKLH 2BO0A 3NCXA 4KO7A 5TTRA 4IOFC 1IC4H 3TA3C 1C5DA 2X5PA 1A0QL 4BWTA 2YD0A 2ED6A 1J05A 2VWEC 4PTTB 4DZ8A 5TF1L 1BX2A 2NY2B 2PO6A 1G7JB 1XT5A 1ZTXL 5J11B 1IEAB 5CD3A 1S9XA 1LK3L 3NFSH 4XH2A 1C08B 4UM8B 5C0NC 4QRPB 2R23A 2H2PC 1BQHG 1EERB 5CU5A 4W9HC 5I28A 4AGMA 4UUJB 5DJCB 2O5XL 4NERA 4PRHB 2H32B 3U6XA 2P9RA 1NBQA 2HFFB 4OLZL 4CC4A 4HZAA 4HIXL 2DTSA 4FNLH 3GXFA 4BWUA 1YQ2A 3ZKMC 1UH3A 2D31B 4HGWA 2IOOA 1MJ8H 1WIUA 2PW1A 2OMWB 3RX8A 1T4WA 5GRUH 2ZCKL 3IWUA 3QULB 5HD8C 1A9BB 4JFZH 1UZ6F 1J9QA 2V5MA 3OQ3B 4P5KA 4X6DA 5CMAB 1KYAA 4ZFFB 1FZJB 5EC2B 3HIZA 1PAZA 2KLRA 4XB7A 3RU8L 1FLRH 5JW5B 3LEYH 4FQXD 1KXHA 2LLGA 1QA9B 2JKIS 4MA7L 4UTAH 2CH8A 4BKTC 4OJAA 1P6WA 1O9ZA 1DFBH 1IBGL 4LO9A 1MG3C 3NGBC 5MHSD 4FLQA 1XH0A 2KLSA 4I9XA 4IBTA 4XC1H 2A6IB 3DROB 1QLRB 1DJYA 2QSTA 4ZPVB 5FS5A 3VFTB 5BO0D 3ULVL 5GZOD 1CE1H 1BG1A 3DVGB 1MAJA 5CINH 2NXZB 2F19L 1HCZA 1ORSA 3CFMA 2K6YA 1MI5B 2JIXD 4ONOA 1N10A 2M26A 1LNUA 2XUWA 1OY3B 3TV3L 4MNGA 2VO5A 4UQBA 8FABA 3BDXA 4F33B 2IXQA 5FDWA 1ZANH 5I66B 3VO0A 4C54A 3JWNE 2YPLD 1VACA 2P24A 2QSCL 3QEUA 4OZGF 3VXUB 5IFHH 3JSSA 1J5IA 3X14A 3C8DA 2E9WA 5IMOB 1F41A 2DQHL 4X4XB 5IVNA 1VFBB 2NTSP 4NZDA 4WO4D 5T33L 5D70L 4PRDB 4CSZA 5MI0B 4Q9RH 2FJHA 2WLHA 5IVZA 1LE9A 3GMRB 3CHQA 5BQ7B 5IBTH 3REVB 1XHHA 4NRYA 2R1YA 4K3DH 4MAYB 3N55A 3OG6B 3MGOA 3SBQA 5ID1A 2Q1EA 2WTOA 4Q2ZA 2XXGA 3U0PA 1NKOA 1P5UA 1XSJA 5J6GB 5I71C 3H55A 2CD0A 4NQEB 3NZHH 1R1CA 2FHCA 3F5WB 4MD4A 1KCWA 2X3CA 3GSXB 5C0BE 4CA4A 3GNMH 3POHA 5H94A 3FRPG 1KCUL 3LIUA 1ID5I 4JY4B 1NSNH 2P49B 1MRDH 3V52H 1FH5H 4NKMA 1QHQA 3RWIA 4H88H 2ZP0T 4HUXB 3MRRB 5JDSB 2B4CH 2P80A 3P40A 1ZHKA 5BRZD 1XAKA 3LH9A 4LAQL 3FB6A 2VLLB 2V6HA 3BZ5A 5L4IA 4AE1A 3KPLB 3FQNA 4UQ9A 1FFPB 4MBOA 3FUHA 1SN5A 3PHOA 4HOZA 1T3FA 4WV1B 5EWIH 4M29A 4YJZL 5D7IF 1EK3A 2XNAA 1RCYA 3VSQA 2DM7A 2EICA 3O11A 3V5HB 1AKPA 1NFIA 1A9VA 4J8QA 2PF6A 3AB0C 4PS7A 2FX9L 3AABA 4XN5A 3T2NH 3OQRA 4FG4A 1ZLWH 3BZ4A 4RWYL 1I1AB 4WJG3 2MCPL 2NUPA 3UZEC 4X9IA 1HINH 5GSRA 4CL7A 4LCWB 4G8EA 4UANA 2OZ4H 1MPAL 3WIIL 4XPHL 2WK2A 3LHAA 1ZKAA 4GQQA 4U1HA 5ANMB 5M95B 4NPYB 4GEIA 4APXA 4PRNA 3ZKND 1IARB 4KC3B 1BQHB 3CXDH 3SE8L 4P04A 1L7IH 1NCOA 4HX1B 3FN0L 3P54A 1Z6JT 2ZCZA 1L9PA 3VD4A 2ZICA 2ILLA 4NQDD 2X4SB 2G3XA 1N5AA 3HG0A 4KQ3L 2KZBA 2XWBA 4N0FA 5F2FA 3ZDYF 5BCAA 1HCFX 5LNGA 1SVCP 1PLCA 3NIDE 4L37B 1VZGA 2AJVH 5EZLA 2Z91B 1TCRB 5I1HL 5L2KD 1QBLH 2XV0A 3MV11 5E8OA 3RWJB 4HPOL 3APMA 4JFFE 1CDIA 4XCNA 3DJZA 4PR5B 4P46D 2AKRB 1DZBA 1AS7A 1CFBA 4WU7A 1VF5C 3B5HA 5CZVH 1K85A 2CPUA 5IB3A 4KXCA 4E41B 1PZBA 5AWNH 3UG4A 4F7CA 1MXDA 2B1AL 4H26A 4Q9QL 2F8VA 3KLSA 3VI3E 5IQ9A 3WENA 3TVMD 1N59B 4TN9A 3QIWC 3KXFB 1DVUA 4QXTA 5IMKB 1FFTB 1MNUL 1O7DE 5ICUA 2V8MA 5LGJB 2X4PB 4FYRA 3TEZA 2FO8A 4Z3JA 3APDA 3HZKB 3I9IA 2O5ZH 1O7VA 3HKZA 3QUYB 1M3JA 2R29H 1E40A 4OIAA 1NA8A 2YD4A 5C8JA 1IM9B 5SWSE 2CAKA 3U4BH 1X5HA 2PPFA 2WOYA 1JBJA 2Z31C 2FHFA 3VGAB 2I9LB 4Y1AE 3BEWB 2JELL 3GXMA 5ADPL 3LV3A 4EXKA 1U8HA 1A7QL 2DDQL 3QIWD 3H3PL 1G87A 3NJGA 4HKBB 4JKKA 5DTFB 5HHXH 2CBQA 2Z1PA 4FA8A 1S7UA 1JYXA 2B2XH 1FL3B 3ZE0F 4EN3D 3BLPX 1N8ZB 3KNBB 3MCKA 1C12A 4Z5RB 4ODTL 3LZQA 3VU2A 2LLLA 2ZWSA 5BV7H 5D1XE 5C70A 5C09B 4WWOA 3BPNC 4U6HB 4PGBB 2DYPD 2XZQH 2G2RB 5JOPE 3A6BH 1S8DA 2PPCA 2VDNH 4FYSA 4ZMNA 1L9RA 1GCFA 1KEGH 1IT9H 2CLZA 2EYTA 3G5YB 1Z3RA 1YRKA 4JFDA 3SGDH 3X3FH 4MA8L 1QR4A 3NTCL 2YZ1A 1J8RA 4POZC 5J9PB 4HFWA 4OD3H 2Q8BL 5AB9A 2HJKA 3DK0A 5I19H 4AYID 4PBXA 2BNQE 5I26A 3RDTB 3WNKA 3WEMA 4XVOA 1AJ7H 4HSAC 4YBLC 5F9AC 2Y6SD 2Q3AA 3SJVA 3FRPB 2CLVB 3OKMB 3F7PC 4YC2C 4GKSB 2ITEA 1DL7L 5D5MF 4ZNEA 1YC7A 1N18A 4XVSL 4GP8B 2Y7LA 2HVBA 5T3ZH 3ARVA 3IJ9A 1R17A 3RNKA 2XBTA 1IJ9A 5E8PA 4YBQC 1HH6B 3VD9A 4P59L 2VQ1A 2VR8A 1AYRA 1FIGH 3NVQA 4I2XE 5EB9A 5H35A 2VKXA 3RGVA 2OP4L 1F58H 4POZD 4TVPD 3EFFB 3F62A 5HVFB 5FYKL 3W0WA 3MOQA 1A3LH 1NGXB 1SBBA 2O4EA 1AHWB 1JTTA 1CFQB 1TTRA 4GIPD 3SQOH 4LSTH 1IB5A 1PZSA 3ARQA 4W9DC 5BO1L 4ZDHA 1GR7A 4Z8FH 5H2BA 3UCQA 1EO8H 1CTOA 4O51B 1G1YA 4PGJA 4MVBD 3UX9B 1QSFA 4LSDA 5F7YC 3KLHD 4BXSV 3PAVA 3WY1A 4FTVA 3EOBB 3ARFC 4ABQA 4NO5A 2CA3A 4P48A 5SWZA 3SCMD 1WFJA 2DQEL 4NO2A 1NC2B 3JT2A 4HDIA 2UZIH 4OAWA 5BS0B 2WCSA 2X0UA 4HWBA 5EBWA 4YHYB 3E1ZA 4YGVB 2ENSA 5TFSH 5AZEL 3U1PA 4ZSOA 2Y23A 4LCUA 4R7LA 4ZK8A 3TTYA 4LP8A 1ULVA 2EXWC 2PCPB 4HUWA 2I32A 4YHNA 1JPST 3QHFL 3CFBA 4WJ5A 4KRPD 5EZPA 1JZ2A 1A2YA 3P73A 3GEFA 1VADA 5DWPA 4ISVB 4Z3EA 3MV8B 5DFVC 1Y6MR 5D7LA 1W72L 4G9FD 4I18B 4ZUUB 3ECVA 2OJ1A 2J5LC 5AVXB 1JSYA 3CFKA 3WO4C 1BXUA 1XGYL 1AIZA 3AQXA 4PJ8B 4PJ5A 1AOHA 3V0WH 1QKZL 1QQDA 3UC0L 1KXTB 4G7QB 3ARBB 1TO5A 2E46A 5IFJB 3LZLA 5IF0A 4LNVA 4DO6A 4RMVA 3QJVB 5D96B 2CHNA 4MQXC 2PUQT 3CPLA 5BUGA 3LMJL 2RFXA 2W9LA 3WMQA 4NEHB 5GZNC 3GUTA 1HEJC 1IX2A 1WWWX 2WWKO 2CKNA 3RVTD 1OP5H 3Q6FA 3MLPA 4ZTPH 1KELL 4Y4HA 1KTKE 5TK4A 5KANI 5D4IA 5DFVD 3VJ6A 3Q48A 4L3CB 2FSEA 4HPYL 3MMEB 1WBXA 4RISL 3S36H 2APVA 2CBOA 4H1LH 3EJJX 1JZ7A 4GINA 4N6QA 1EJ6A 4PWJA 3Q3GA 4HWNA 3I6KA 5E6RB 1CGUA 3LQAL 4N2LA 3IMTA 4HS6A 5BZXA 2EUXA 4GKNB 5KVDH 1G7HA 4Z23A 5D1ZI 2P42B 4KKAC 1UOKA 1DEDA 3IE9A 3HS0B 5A16A 2NZ9C 2Z8RA 2A4EA 2J88L 1MW3A 4XP4L 4KZCA 4FXTA 2CDFB 5F6IB 3DYPA 2ZCLH 2HTKD 4P3CL 1QUNA 4V2BA 2XV2A 1YEEH 2NY6D 2E7LC 1MF2L 4NKQB 3V4PL 5A6IA 3TLRA 1A4KA 5ISZA 3H9SD 2OXHB 3PWVB 4PGDA 1G7LA 4J3UA 1D9KB 1QWNA 3PL6A 1RU9H 2YAHA 2OSWA 1NOAA 3VXMA 3FDWA 3L54A 5GGSB 2DQ6A 1IC5H 1JZ8A 2CR6A 5TQ2L 4F7KA 3GMMB 3TT3L 3WSQH 3LPGA 4IGBC 4HEMA 1RL1A 4KKAD 2E7CA 1ZRUA 1J10A 3NJXA 4LDLB 4J28A 5DEJA 5CJQH 3PJSB 3CH1B 4HHAA 2CM5A 4NQXB 1ZT4B 2UY6B 4FJZA 5IBLC 4QMEA 4EUPG 2IV8A 3UXFA 4WWNA 3SB3A 2X1WL 4LKCB 3BWAA 4OZFH 4B53A 3IGAA 4U49A 3GBML 1BQKA 4JRYE 3BIBX 3MUHL 3RZCA 2VAAA 2Z8VC 1A5FL 3FTWA 3MO1A 4GEJA 3PWPA 3LRLA 1XF4B 3EO9L 1SLXA 5GIRA 5AUMB 1XR9B 2H6OA 1FYTB 2XHNA 4J1UA 4PV1C 1MCCA 4ADIA 3VW3H 3KJ4B 4C4KT 2F53B 1I85A 3DIFA 3V7MA 1DZ0A 2D2OA 4X4YA 1JTOA 2BNRE 4MJ4A 3UG3A 3UTTA 1DR9A 2E8ZA 2HXAA 5CLTA 4O4YH 5HHNB 1AZRA 4I9WD 2Y7QB 1ES0B 4BZ2A 4X9BA 1G6VK 1QRNB 4M93B 1ZV5A 5KYXA 3GTTA 3BRDA 4BSWB 4QRQA 4K5MA 4YIQA 1N64L 4KI5D 1UZ6E 2O30A 1NBZA 1GZPA 1KTLA 2GJZA 3MRMA 4WSJA 1CC3A 5HHPA 3G9VA 5DD1L 3UADA 1R47A 2CIKB 4PJHB 4TLSA 1EAJA 4JM2A 3UDWC 3AC0A 1LJMA 3JWDL 4Z6AT 2XA8H 2ERJB 4ZFOB 3KL5A 3RWHA 3WY2A 4NQSB 1DUZB 1FVEB 2JTYA 5BZWA 1BEYL 4X4KA 4AIZB 3G3LA 2P52A 4ORZC 2XCMC 4X5PA 3ZL4L 1T0NA 4Y4FC 2VXSH 4F15C 4OCYL 2DLHA 2OLDA 3OHXB 3GO1H 3IDIB 3IXAB 1ZA6B 1W0WB 3CDZB 2EVGA 5LBSL 2H47C 2VDRH 2FR4B 3O6KH 1A6AA 1NC4B 2RQ8A 3HMWH 5IBUB 1YMME 5E9AA 4L3FA 2B3RA 3TIDA 3S35H 4U1GB 2VLJB 1NBYB 3VRIA 3X17A 4LOUC 1NLBL 4NZUH 4JVUA 3ECBB 1BBDH 4U1MA 3ZE1B 5I1AB 3C60B 4ZUSB 1BWMA 3PCYA 1J9SA 5FYKE 5EOQL 4OZGE 1E9QA 2BM3A 3B8YA 4XO9A 5CCKH 2MQGA 3EGDA 1I7UB 4WHTB 5DFWH 2D7TH 2XG5B 2VDQH 4HJGB 1IO4C 2CDEB 5JUEL 2FK9A 2APTA 2HFGL 1JVOA 3VE0A 2BJMH 2OMUA 2AF2A 5C07A 2FEDC 3OJ2C 4X0NA 2OULB 1RK1B 1Z9MA 1PX8A 4LOUD 4UAOC 3CZNA 4WW1B 1R3JA 3OM3B 4Y8DC 4BQ9A 1PQZA 1AIFA 1WA0X 1U8KB 2B08A 3L3HA 4FQLL 4P9MH 4B6ZA 3FNKA 1A6UL 4JL1A 3U7AA 3B2XA 4IMKC 2M2DA 3K8MA 3D0VA