5FS5A

Breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNANSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5fs5A00
4AV5A 4AV0A 4AVJA 1ZE3H 3BFWA 5AALA 3ZL2A 1QUNB 4X50A 3JWNG 1KLFB 4XOAA 5IQNA 4J3OF 4CSTA 3ZPDA 5AAPA 4X5RA 4ATTA 4CSSA 1UWFA 4XO9A 3RFZA 4AV4A 3MCYA 3BWUF 4J3OG 4X5QA 4XO8A 5FWRA 5FS5A 5JQIB 4AUJA 1KIUB 3ME0B 5F2FA 4AVHA 3JWNE 4LOVA 2J2ZB 4AUYA 5LNEA 2WMPB 4XOEA 4XOBA 5CGBA 5FLUA 5IQOA 2XG5B 4AVKA 5AB1A 3SQBB 3JWNH 4BUQA 1TR7A 3ZL1A 1PDKB 5F3FA 4XOCA 4XODA 5IQMA 4CA4A 4J3OH 2UY7B 2VCOA 2JMRA 4AUUA 2W07B 5LNGA 2JTYA 3BFQG 1N12A 2XG4B 4X5PA 5ABZA 5FX3A 4AVIA 1N0LB 2UY6B
chains in the Genus database with same CATH superfamily
1ZT4B 3PAVA 1WZ1H 5JW5A 1R3JA 4X5WB 2AJSH 1DBKH 3L5XL 1AZUA 3JV4A 4LZKA 1A9BA 1YECH 1G7PA 4YHZH 3MLRH 3QPKA 5F3HB 2AKRB 1BSIA 4BUGA 2I9TB 1U8LB 4IIQA 3EYUL 4GW5B 4N2NA 3V95A 4JFDA 1KBKA 5HYJE 2HKHL 2D2OA 2FWOA 1LILA 2WCGA 2XWCA 1U8CA 3QA3A 4P4RB 5EC2A 1G1KA 4JEGB 3W1ZA 5AAPA 3WTVA 3IK2A 5CCKH 5CINH 5EH1A 5CEZL 3MYJB 4NN7B 2PR9A 4K7PX 4B96A 1MFBL 4XXWA 3PV7A 2IDFA 4PTTA 2AK1L 1AY1H 3IDIA 1GY1A 3QR0A 1JPSL 1U6AL 4U7KA 5I30L 5JW4M 3SCMC 4HFWA 1IX2A 1E65A 5DWPA 1MFEL 3CX5K 4HZLA 4AQ1C 5JXEC 4LAJH 4X80H 2NY5L 4JHAL 4LSRH 2Z31A 4NZRH 4LSVL 1HHGB 1JPFB 2X9ZA 3QDMA 3DUUA 1KIUB 4M7JL 5SV4A 1U8PB 2VDLL 3G5XB 4WFHD 3D39B 3EDDA 3ZBMA 5AUMA 3V6OA 1CBVL 5AG9A 4KH9A 4TVSa 4BIKA 4YPGA 4XP9H 3SJVE 5CZVH 3MTRA 1WAEA 1IGIH 4J7RA 1JI1A 3N2JA 4G80A 4JKLA 5AW8B 4M6NH 2AXFB 1NAML 2QVIA 1F11A 4XOBA 4ELKA 1XF5A 3HPLB 5BO1H 5FA4A 3NCYS 1NCUA 2XQBH 1EJ8A 4WAFA 3BAKA 3LS5H 4QTIL 4TVPD 4G6FB 1I1CA 4HV8A 1DVFD 2H1LM 2DY2A 4FZEL 3OWRA 4N2MA 3CLEL 2G0KA 3UTQB 5DZAA 2JK5A 3MRLA 1BZOA 2LFEA 1Q9OB 3S37H 3P9LB 3WV0A 2B8OT 3PWNA 1NCBH 4AYID 3BLPX 5L6YL 5DWUL 5F3FA 3FSOA 1X9QA 3WOVA 1SN5A 1II4E 5IHLB 1PSKL 4JO3L 1J0KA 4AOFA 2D73A 1HL4A 3D1MC 1BXUA 1FH2A 2VRKA 4XWOD 3T0ED 5DFVC 3ZE1F 2A74B 2F5BH 2H2SC 1JD7A 2XNAB 3P1VA 2JJWA 5JHLL 3HFMH 1G7MA 1EO5A 3ZKMC 5BVJA 4HLJA 3M8OL 4FFZH 1XF4A 4K9EC 4H26B 2WLIA 3L5HA 4JM2D 1HCZA 5B1KA 3SDAA 1RJZA 3U0WH 1VAHA 5IQ7H 4QRTB 4CW1B 4OQTH 1QPPA 4QRUA 2YXVA 1AD0A 4YDIH 3KPSB 1MFAL 3TA4D 1HHIB 3FCTB 2KZ1B 4PRBB 2OTUB 2GC7C 4FFTA 2GFBB 4HWBL 2KPNA 3HG1E 4TLSA 2CBOA 3OKLB 3GIZH 4XAKD 3SE9H 4Y1SA 5JDSB 2MCMA 4IKKA 4ERSH 3VCLB 5KJ7E 3U0PA 4ZTOL 2R4RL 5TE7H 3M17B 5BS0A 3CFEA 5DLML 1P53A 4LFHD 1IGYA 4L29A 4EMZA 4KQ4H 1B3JA 2YK1L 3HBZA 4N8UA 1JGDB 2WUBL 2OMXA 4NENB 4MNQB 5GRVL 4HU8A 3VTMA 2R29H 3ZKXB 2CBQA 3I9PA 3OAYH 5EF0A 4PJ8C 5BPPA 5C08B 2NR6C 3HZMB 4HOXA 1BEYL 4Q58C 4L3FA 1T5XB 4Y2DA 4Z78B 3DSFL 4D9QE 5KBDA 1IT9H 3GZPA 5I8KL 1P0SE 1RIUL 1ZK5A 1Z2KA 1SVZA 5J12B 2AQ2A 2APVA 1S7TA 2QTEA 2BJMH 1IGFL 3BH8A 4Q2ZB 1N59B 4IOFD 3UTSB 1EVTC 5HYIA 4E0RA 1JGEB 5KSAA 5DZOA 4RRPG 1UD3A 5TFSL 3VXRA 4PW4A 1SY6L 3FQTA 5T3ZE 4X4YB 4RQQA 2OK0H 3E3QC 3HAEG 5GS0C 4XH2A 1QO3A 2R1WA 4L5FH 4QYOA 1MY7A 1AO7E 4LPVA 4PS3A 5I74C 1BQHB 4XB8A 1OP3H 3RWEB 5FA3B 3N44F 2BVQB 1YG9A 3JWDL 3S34H 1J1PL 4LQFH 4P23D 4FTVB 4M1CC 4NQDD 5CBAA 4JFZH 5IB3B 3CDZA 3H42L 4G3YL 3TJHC 3AU0A 5C0AD 1HWHB 3ETBF 1PZUB 5EORL 2BOCB 1FFTB 2Z35A 4I1NB 4WK0B 4WF7A 3X1FA 4BCXA 3EJCA 2X4UB 3OG4B 4HSCX 3T6ZA 1TJHL 1E9PB 3MRJB 5BQ7A 5E8OB 5I5IA 1OGAB 1R19A 4XWGH 3PGDB 1KJ3H 2BO0A 2WQXA 4JFWA 2G3NA 4LDOB 4PGDA 3KYOA 1K6QH 3RUGE 4HJEA 5LLIC 4PB0L 4HBCH 2B3RA 3GS4A 4FG0A 4MLIA 4WUUA 3VG9C 3Q2CA 5D7JA 3A5VA 3RWFA 4AVJA 1GC1C 1ZS8B 4XNAA 3OKOA 2Y36L 3OR7B 4R5TA 3D85B 4RGMB 5HYJB 2A4CA 2NY7L 5G2NA 2QMJA 4GKSB 3OJVC 5AW3B 4GAYB 4NM8L 3FFCA 4IGBA 1FV1A 5IG7A 5DTFA 4EXKA 4NFCA 2ZICA 3Q9QA 4DNLA 1YEFL 4W1TA 2Z8RA 5I6XC 2VL4A 3NUKA 2BZCA 4HEMA 3KWUA 3RGVB 4MQXD 1ED3A 1DZ0A 3NCMA 1MG3C 3T0WA 1A1OA 3ISRA 3LKQB 3QULA 1N5AA 5IUCA 4UAOC 4UTAA 1X4XA 2Y07L 4Y2OB 4FL4B 3IXAB 4G1EA 3BZDA 3ZZ1A 3I6GB 4R97C 2ADJB 4I8DA 1XF1A 4Q6IC 2ITCA 1VFBA 2YXFA 4YNYA 2EH8H 1BLNB 2I85A 1EVUA 2DL9A 1MDTA 3ROOB 1OCRB 1SYSB 3N41B 4YDLB 5L4JA 4RCAA 4WEUD 5IBUG 1ASOA 3TV8A 5AVYB 3GXIA 3L17A 2LU7A 3CZFB 4QHMB 4XRCB 4NPKA 4OTXH 5K93A 3RWJB 3H4HA 4UDUA 4ZTPL 3KYNB 4F7EA 5AWNL 4KKBC 3FU3A 1KYAA 4OI9A 2PYFA 4PRPD 4LOUC 1NMCB 3IKKA 3BEWB 1NBZA 1U0QA 2NNAB 5DJCA 4HJUA 3TIDB 3V6FA 1A7NH 3S5LB 3BAYA 5HVGB 4ESKA 2EEDA 3AVEA 4IBZA 5AAWA 4MZIA 3SDYL 4NP4L 1UD8A 4N2HA 4Z6AT 3K46A 3SE8H 3STZA 3MRKB 1KF9B 1P1ZA 5GISL 4X6EA 5GS1A 1P5UB 3QEQA 2JNZA 2MSPA 3ULSB 3O8XC 3CDYA 1A1NB 1JN6A 4DF9A 4L1LA 4DW2L 4LLVB 2AW2A 3TCLA 3CSYB 3H3PH 1VZIA 4RBPH 4F58L 2EO7A 1FJ1A 2OXHB 3OB0H 5SWZD 3V2AR 3MX0B 5EZJA 5KVDH 4CA4A 2AMUA 1E4JA 2Q0ZX 3H9HA 5F70A 3M7OA 3QORC 5I6PA 2WY3B 3UAJD 2ENSA 4WTWA 3L95A 3QWNA 5EZOH 3VM7A 4PGCB 1YPZE 3HVNA 4ZMOA 2ZOLA 1NJ9B 3UG5A 5FC9A 4HIPA 4PJ7B 3GSVA 2AJUH 2GY7B 3MV9A 4WW1A 3Q8AA 4ZXBA 1WCBB 1P4UA 3ETTA 2YMXL 1W16A 2Y2TA 4FD0A 5GGUB 2BY2A 1D5XB 4LLWA 1COBA 3T4AC 2Q76B 1E7VA 4JQIH 3RWCB 2VR8A 3D0VA 3MV8E 2PXYB 3WNMA 3W37A 2JKLA 1AH1A 1HH6B 1YEEH 4ZFZB 3FW6A 4UM8B 4JZOB 3T8MA 3P2TA 3Q48A 2H6PB 1WFJA 3GRWA 3M1BA 3T6VA 4NNYB 2DEXX 4UT6A 4WK2B 1ID5I 3NT0A 1Q0XL 3SE3C 1G87A 4PJXB 5E9DD 2FZ3A 5MERA 3LD8C 2VITB 2HKFH 4UQEA 2BNRE 1B0WA 1HQ4B 4NQSB 5CUSH 1RAMA 5T1LA 2Q7YB 1QI4A 2WZ0A 1S9VA 1OPGL 1J8SA 2VZUA 4PRHE 1FZOB 4Z77B 1DCLA 3RNKB 3GMQB 3RFZA 5E2UL 4ELMF 4K4KA 1W80A 4KDVA 5CU9A 1W0WB 2WNXA 1XGZA 3PDOB 4NKDA 4BFFA 4OCRL 1Q9WB 4M7ZB 4IOSA 1FBIH 4PJCF 4LCIL 1LE9A 1JSYA 4GKZB 5DQJB 4D0BA 1BD2D 1P5VA 5DZPA 3HZYB 5HD8D 3HKZA 4TLKA 4ODVH 5LN8A 3WJJC 4D0CB 1E27A 2UWEE 2WINA 3RKPA 5CD5C 2WWNA 2CR0A 3OGCA 1FCGA 1TTGA 4XNYL 3F7RA 3MA9H 1VDGA 2WM0A 4YUEH 3II1A 1SBBA 2ITEA 2NTFB 3RAJL 4G6JL 3N55A 1G7LA 4LOVA 3VE0B 1F13A 1YYML 2Y1ZA 3RB5A 5I6KA 5L2JA 1C08B 3CUPA 5F0JB 2D9QB 4BDVB 2SEBA 3OKDA 3GBNL 2DM3A 1B88A 3BSGA 4IDJH 4KKLC 1JPEA 4YQXH 3KNBB 5HHOA 3TNMB 3WTXA 3RL2B 1PEWA 4HT1L 2C7FA 2AZUA 4TULL 3ZTDC 2X05A 4BH7B 4M6AA 4AYDC 1AO7B 3LZFH 3S36H 3O6KL 1KY7A 3QEHA 4TPRL 1UOLA 1CF8H 1FH5L 3RWGA 2VLRE 2A83B 4PRAA 1EDYA 3TBTB 5F3BB 3NCCB 3DURB 3PJLA 3VI4B 4WUKH 4A2MA 5E6YA 4QXUL 1BGXL 4EVNA 2PETA 2BERA 4AQZA 2QPSA 5AENA 4LCCC 4YSPA 3CVHB 2G5BA 2CO3A 1KJVA 3ARFA 1RV6X 3K6IA 1A7OL 2C1OA 3O3AB 3MNMA 1I8LC 3P0VH 3KAAA 1N4XL 4Y5YC 5CBEA 1O75A 3HC3L 2VRQA 3RUGB 3O9WD 2GT9B 5KSBF 3OMAB 1UXWB 1RZIB 1BFSA 1RUMH 4G42B 4P46C 3ZY7A 2HPTA 4ODTH 3WIHL 2AJXL 3ILQD 2WP3T 4NJAH 1S7RA 5J13C 1EDHA 2DRUA 1U4EA 1B6DA 1JVOA 3MXVH 5FKPA 5EU6D 3TBWA 4I3GA 4AV5A 2BRRL 4D2NA 4N5EC 4LVNB 3BPOC 4GSUA 2AJVL 3ZL2A 4TVPL 32C2A 4M1CD 1OLZA 1RQ5A 4JRFA 4JDTL 1DLFH 4Y8DC 2ZYRA 2Z6FA 1ZEAH 3KYKL 4QRPA 3SCMA 3TJHD 4Z0XA 4R7NB 3U4BL 3VU1A 3DX1A 3WUWB 3I02A 5IMOA 4PVBA 4ZZFA 2OXGB 5JXEA 1U3NA 4PUBH 5C0CD 2R83A 3ZO9A 4OAWA 5ICZB 3LRSB 4GQRA 4AEFA 3N40P 4ICWA 3FCGA 1HFUA 3VD5A 4HU2A 5H35B 2NTSP 3FKUS 3MJ9A 4OUUA 3P2DA 4X7SL 4JCLA 3VI3F 1NLBL 3LPWA 5C7XL 3UYOD 1KOAA 2LFGA 2N1TE 2Q86B 5HGHB 4EQ2A 2D8KA 1H3TA 4Z3GA 3GINA 3H3KA 4MXVF 2DZEA 3MKGA 3SQRA 4F7MB 3S8WA 1PCSA 4GQQA 4I48B 3WJMA 5JIHA 5IM7A 4HOZA 4BSVA 4WFFD 5ECGA 2D2CC 1T0NA 5HYSA 1NEPA 1V7NL 2X89D 1PX3A 4J1UA 2IH1A 5EN2B 4IEFB 1F18A 5JHDE 2XY1A 4JO2L 3EH3B 5FGSA 1UM4H 1CFQB 4B9IA 3FUJA 4ONHA 5FYJH 4KV5E 5HDQH 2X4PB 5INDA 2WJ5A 3MBWB 2CJUL 3E0GA 5IMLB 1HINL 3STBA 4BWUA 2HH0H 5CCHE 9PCYA 5EDXA 1QEWA 4U33A 5C0DA 4NRXA 2QQLH 5EF3A 2ADGA 4WO4C 2HLEB 2DQHL 3MRHB 5GRWA 4N0UB 1E5AA 3GPEA 3L81A 2D9CA 4P5KA 1GA2A 4EN3B 1FAIL 1DJWA 2ZNXA 5BZDB 3P4OA 8CGTA 2WTOA 2ALAA 2F53E 2H1PH 5C8JA 3KYMB 2DKUA 4JY6A 3H9SE 1HYSC 5L0QB 1PLGL 2VRAA 2BZDA 4IU2B 3BAEH 4MB4A 1N0XL 2NDFA 4E9WA 1A66A 2GTWB 4LOUD 2VL5A 4OZFB 3BPCB 1BOGB 1AQKH 1SXSA 3FT0A 5DD0H 2F6AA 3D18A 1LK3L 3EH4B 3NABH 2E4FA 4PG9B 5IMKA 1P6WA 5I73C 2IBZX 2NOYA 3HCVA 4HHAB 1OTSC 2I69A 4RZKA 3MV8B 3T2QA 3QWOA 5H4ZA 4MA8H 1C16B 1PW3A 3HNSL 4OM1H 1EHLH 1SPDA 3VFVB 4TNFA 3UBXG 4M62L 1KCKA 4MHHI 4AJYV 2EADA 4N1EA 1JPGB 3O8XD 4QI3A 2WBJC 4P2RE 3MBXL 4L3EE 4ZUWA 1RIVH 3VXQB 1MNUH 1WIUA 1R9FA 2FX8L 1T20A 1TYEB 2FUTA 4OZGA 4C59B 2VZ1A 4ALAH 1Q38A 1P7QD 2HVKA 3L7EB 4CSTA 2QZ5A 2X6AA 5E7BA 4PQXA 3TIEA 1VJSA 3PWUB 3QHFH 1S7VB 4X9YA 2ZWSA 3QORD 4PRHB 3ELQA 1A1MB 3WMQA 1O7DC 3DDFA 2ZF8A 1EEZA 1FNLA 4IRZA 2BCKB 1KIRA 1U8JA 5E7FA 4YDVB 4PJ8A 4HS3B 4QY8B 4APQB 1JZHA 1L9OA 1RFDH 3OSVA 3GMPB 4NKOB 4UQIM 5I2IA 2XN9A 4WFEE 1JNHA 1EUTA 4DGIL 4WSJA 1N67A 2ZWYA 3BPNC 3BZ5A 3D51A 3QFGA 1WAAA 2BX5A 1HCFX 1P7KB 1NDGA 2WB1A 4OUOA 1DFBH 1ECZA 4S1QL 4I0PA 2EH7L 3P3TA 5KYWB 2IDSA 2EECA 4K23L 2VZVA 4TQ8A 3TZVB 4MCZA 1U8QB 1F4YH 3LZOA 2VJ0A 4GS7B 5IEKB 2DEWX 3IT8D 2XFGB 2Z4QB 2ZCHH 4HJJH 4LL9A 4PI0A 1GZQB 1B3IA 3IJ9A 2KQMA 2PN5A 3L3DB 2XKNA 1UURA 2QHLA 3IU3A 4BM7A 2ZZUT 1BMGA 5D7SH 1HKFA 3QSKB 1MCWW 1QSFA 3ESOA 3MLWL 1FO0A 3VB8A 2YWYA 3BWUC 3NGBC 1WHPA 4GMSL 5DXWA 1Y6NR 1X7QA 2VLRB 4IK6A 2P80D 4D94A 1BM3H 1B2YA 1ZV9A 4JE0A 3I6KA 2FL5A 4JS7A 4M3JA 5AZEH 1MJ7H 3QP3A 4YVNA 1Q1JH 4WWPA 1WH0A 5A2AA 4GG8A 3GSNA 5E2WH 3Q1SL 5TK2A 3UTZB 2DBLL 1DBAH 1SDAB 2PP8A 3QXAA 4L8SB 3PFQA 3V4PL 2GTZA 5CD5D 3DRTA 1LP9A 3UZEC 2X44D 1RPKA 5D7LE 3IJSA 2GABA 3QUML 5CHNB 3NPZB 5DYOB 2WQVA 4M1DL 4U49A 5DI8B 4JN2B 4CU8A 5ICYA 5TH2A 1XBDA 4L1BA 1JOIA 4KKLD 4XPFL 5IT2H 4O5LL 4NHUA 1NMAH 2H0JA 3T8XA 2JLPA 3UBFA 3U7WH 3DIDA 4XPTL 4Y4KD 4AYGA 5GXBB 2EXTA 3TVMB 4TTDC 4PI2A 3UBHA 1ZGLM 4A7SA 3QAZC 1BVKA 1JZ7A 2XSKA 1N9PA 3GSOB 3WBDA 1AIZA 4JREB 3CHOA 2CUIA 5SX5H 2V4LA 5JR1L 1KTDB 3WL9B 4GSRA 5EZLB 3NQIA 4JFED 3LEYH 4YPJA 4EZKA 5I28A 2HRPH 1G7IA 3MBED 4HPYL 4ZODA 3S0PA 2IMNA 4NZUH 4HH9B 4HQQH 4V33A 4TQEH 1S9XA 5D72L 4EIGB 4BEIA 3GTTA 1HNGA 3GPSA 1W8NA 4G7YL 1ODUA 5GZOD 5C3IA 5E99L 4MCYB 1KPRB 2L3BA 3V79C 2ZG1A 2N4IA 1MXDA 4HS6A 2P8LA 4Z7UA 2BP3A 2PCYA 5FHAH 4PGBA 1VFUA 2WC7A 5IFHH 4FNLH 4P46D 4X8JB 2FJFB 3ZDZE 5FS5A 2J88L 4K07A 5C0NC 1TQWA 5F9DC 1T6BX 3TN0C 3NAAH 2IQ9L 1Y07A 2LOEA 3B5HA 5I75B 1WIOA 1M4KA 4NZFA 1IM9D 3OMZA 2A99A 3FHQA 4RA0C 3I6SA 3BGFB 4Z95H 1AGCA 4LPXA 3PJSA 1L7IH 1DBMH 4RMBA 5DUPL 3WN6A 4E41D 4XCYA 1F4HA 1KZQA 5IVXE 2F7OA 4FXGC 3BEVA 1XF2B 1NCJA 5IBTL 4B0MM 1K8DA 2XZCH 4OF0A 1A2YB 5JHDB 5C0RH 3ZN6A 3PWPD 1UXSB 3AS1A 5IHWA 4B3VA 5C07D 2W1NA 3DDGA 3RB7A 3U2JA 5GRYA 3R0NA 4HKXB 1JHKL 1FYHB 3D2UD 4MDIB 5DFTA 4Q9RL 1HQRA 2QSCH 4NO3B 5BV7C 5FB8A 1TSHA 5IK3B 4KRPC 3GC3A 2PKDA 3TXAA 1KIPA 3UO1L 2P5WA 1FC1A 1OPOA 1RZFH 2EIJB 2B39A 3GYRA 2IADB 2LU4A 5I5MA 2IAMA 4X7CC 2F53B 2XXCB 3DTUB 5INCB 4FFYL 5FIEA 3H9SB 3HHMA 1ITBB 1QFHA 4DKAA 1ET5A 4FQXC 3SO3B 4WZ9A 5HY9B 4AZ8B 4PJ5A 5C09E 1AD9B 3ULVH 4WI4A 2XZQH 1IL1B 1QQDA 3QDGE 1NTDA 3EDKA 4XN2A 3H3BC 1CC3A 2OR9L 5C6TL 3QJZA 2X2JA 2VM4A 4YDZA 5D1QC 4W9IC 4XP6L 1ECYA 4JG9A 4GKOA 4M4RB 1J9TA 1XH3A 3L9EA 1DLHA 1KB5A 5HVWA 5FKAA 2PPDA 2QSVA 2NLJA 4P2RB 5DJDA 1JS4A 1KEMH 4JO5A 1WWBX 3MLSH 3QUKB 4MAYB 3L4WA 4YZFF 2P3YA 1ZVSB 1J1OL 5D6DA 4LCUA 3ZO0A 4Y19D 4R7DA 5KOVC 3IDGA 2YO3A 2ZF9A 3ZT5A 3J27A 4YWGH 1MAJA 2DQIL 1U9KA 2N01B 4L1DA 1E6JL 2EICA 1C5DA 1IKFL 2PO6D 4Q0XH 5KJ4A 4R83A 5DT1L 3POCA 1BWWA 3EJZD 1M71B 5GGQH 3GK8L 4NRYB 1J48A 1OK0A 4Q74A 2QQNH 1K8IA 1QRNA 1IEHA 4YO0B 5I17A 3T4YB 2VE6A 3B1TA 4U1LA 1MWAH 3UTTE 1S46A 2AV7B 3GIVB 3OKNB 4BXSV 5FK9B 3RZCA 1UJTA 2XWZA 3VRLF 1IEBA 2OCCB 2OL3L 1U93B 5JYMA 2VLKE 3FH8A 1J0IA 3CN1A 4DQOL 5FM8A 1DQLH 3JUYA 4DEPC 3T2PA 5CLWA 1G7QA 2NY4C 1MSPA 4Y5XC 2MKWA 3APCA 3C87A 1KT2A 5B8CB 4PD4J 3CDCA 4HIEA 5DC0A 3KPMA 4MMXC 4YFLF 3GSUA 4ZFOB 1KYOK 3P40A 2WW8A 4DZBA 2P44B 2AJYL 5AD0A 2APBA 2R2BB 2WBKA 3ARGD 4QHKI 3U9UB 1PZDA 4XNQA 3L4CA 4UIMB 1BZ7A 3LEVL 1F02I 4QRFA 3D87B 4KO7A 1I1AC 2R1XA 1VADA 2GHZA 5T1KA 15C8L 3MLYH 1EMTL 5HGAA 1Y1DA 3QQXA 1IBHA 2VAJA 5IW1A 3SPHA 1BECA 5H94B 4BZ2H 1HYRC 5E8NB 5A16B 3TC9A 3X12B 3ZJAA 1H3VA 1U8IB 1LVEA 2OKMA 4UOW1 4P07A 1AGBB 1IE4A 1HXMB 1IIKA 3OKKB 3CFDB 4F80A 2I07A 2R8SH 4EEEA 3QH3A 3CFJB 1KNOA 2K8MA 4WTZG 4ODXB 5HHVL 3R06A 4ADIA 2PW2A 4MA3A 1G6VK 2FEEI 3RUGF 3MLVH 3SYQA 5IR1A 2WBXA 1PY0A 4QEGA 3D9AH 4FERA 1MCRA 1CGVA 1AZZC 3UIZA 1R5VA 1IE5A 3BUQA 1KTCA 1T7VA 2IGFL 2I60H 2PCPB 3OXSA 3EBGA 5SWSE 2ZXBA 3F84A 4NQEA 3WS6C 2YLHA 1ZHLB 1PKQE 2WXQA 4TLUA 4ZPTA 2Q8BL 3MV7A 1S2EA 4J39A 2QADB 2ITDB 2PYEA 3K71A 3GI9H 1B0GA 4NGHH 4KK5C 1ORQB 2APTA 1E9OA 2VXQA 4C83B 4MJID 2OSXA 1MW1A 3AG4B 5ELIA 4I88A 1N8OE 2B16A 1Q9KA 1SMDA 4F93B 3QJHB 3HS0C 5LB1A 5JHMA 1XT5A 2FX7H 3N85H 4WY7H 4QMEA 3TV3H 4MAUL 5T3ZH 4XNZB 3FQRA 2IANB 1GVIA 1QASA 4PBWD 1K5NB 2AEQL 5CILH 4ANVA 3CDGB 2Q10A 3EFDH 4LRNH 2AFNA 4I2XB 4KRNA 4M6MH 2Z91B 4PHZA 4R8WL 3VYPA 3D07A 5DA0B 4DO4A 2DWSA 3PQYE 5HGGS 1UWFA 5JIQA 3CN3A 1NL0H 1KPVB 3TH2T 3RGBA 1PDKA 4E68A 1DVSA 4O9HH 2JB6A 5J57B 3ZDZB 1ZLWH 5B39A 1EBPA 3EYVB 2GJ6D 3LPGA 1BAFH 2J6WA 5DEGB 2XIIA 1NUNB 2WVUA 3MRCB 4GRWF 1A4CA 3A47A 2DIEA 3BAJA 4TTDD 4WGVB 3L5XH 5F9AC 3V6ZB 4ZUVB 43C9A 1KZYA 4NNXB 5IVZA 5IVXB 5MEOA 3EYUH 1IVTA 5JUEH 2HKHH 2Y22A 2NXYC 2HLFD 1WSST 3VD3A 4HX1A 4DERA 3ABMB 1PZ3A 2WTRA 1RJLA 2ESVD 5CMAB 1NKOA 1S7WB 4WO4A 2FVNA 3C8HA 3QHZL 5CEZH 2O26U 2FT6A 2FIKB 2VLJE 1CLYL 3VXME 1MFBH 3H6JA 5C92A 2AK1H 4B5ZA 3QXWA 1ETA1 1JPSH 1U6AH 1C8QA 5TE7L 5I30H 5IQOA 4ZMQA 4J3VA 4IQHA 2KLTA 4JL1A 2ATKA 3ZYJA 1MFEH 1YPZF 4EOWH 4ZUTB 1WHOA 5C0ND 2NY5H 2CO6A 2RD0A 1RZKL 4JHAH 3TN0D 4TL4A 1AAJA 4EUPB 1Z6JT 4I87A 2YD9A 3CGTA 4LSVH 4M7JH 5MENE 2GCYA 2VDLH 4NUJA 5C09B 1CBVH 2EO1A 3GKWL 4NN5B 5TDPB 2C3VA 2EVFA 3QDGB 1KBBA 1YEWA 4KMLB 5DHVH 1DVXA 3M45A 3PHOB 4X98A 5GGTA 1D7FA 1WBXB 4LOFA 5DQDL 4X8CA 1SJHB 2KYIA 3A23A 4IRJC 5EBWA 1FL5B 2Z7UA 2O72A 2WBJA 1NAMH 1WF5A 2UZYA 3DA0A 2JMRA 4WEBH 3RVUC 1QSED 1QTSA 4WLCA 3D4GA 3WFDL 1RUQH 4F9LC 1G9MC 4QTIH 1UWEL 4YE0A 4W6YB 1YJDL 4YFEA 3CSTA 3QCTL 4MD4B 1FF5A 4OKVB 1JVLA 4FZEH 4XC3L 1X44A 1KJ2B 4HCGA 1BBJB 3CLEH 4GRWH 4MJ2A 4ZUUB 2AJZB 5JOPE 4QXTA 3CPLA 3B9KD 4IBUA 3SPVB 3DI2B 2OI9B 3EJSA 3KG5A 1QUPA 4FQ1L 5L6YH 5DWUH 3K5SA 4PJAE 3TS8A 4X6CA 2YOCA 3H9ZA 3HB3D 1PSKH 3KPRD 4JO3H 1OTUC 3RY6C 1U92B 3BUYA 3PWJB 3GMLB 4YGVB 1NMCC 2FWUA 1JUFA 4R4NC 3NIFE 2UWEF 2WXHA 3O4LA 4YC2B 4PJGA 3LNIA 2Z9TA 2J6EA 3IJYB 5D1QD 5JHLH 3QWQB 1FFPA 2VLKB 1MUJA 4JHVA 3M8OH 1NPUA 3GSQA 4DETA 4K7FA 5HHNB 2MTPA 1QACA 2VSCA 1QEXA 2JH2A 3FHEA 4JPIB 5HJBA 4U6TA 2NY1D 4H2CA 4QRRB 5L8LB 4N86A 3SGEH 4L18A 4TUJA 4YHPB 3L3GB 4PJBE 2DWTA 2YIHA 3IKCA 1MFAH 5EPMB 2IIJA 3VD7A 2YBRA 2OJ1A 3UPRB 1QKZL 2ZXEB 4HH8A 3DV6A 4HWBH 4L4TB 1NOFA 4JNXA 1KC5L 1B0RB 1QZ1A 1TKWB 1Z0NA 3OPZL 1OWRM 5L2KA 2DDQL 1Z9LA 3TJEL 3DPBA 4ZTOH 5E8DL 4Z8FL 2R4RH 2EVJA 2GITA 1H8LA 4HJTA 3DUSB 1MFUA 2NYZA 5DLMH 3PWVA 2R69L 1GAFL 3IEAA 4IOIA 3IFLL 4U1GB 3UJTL 3LKSA 2YK1H 2BP0A 1OSZA 2ZG2A 4NCC1 3AQDA 2WUBH 3OLIA 4HXAL 5JORB 3V4VL 4MBOA 3VDBA 1FWXA 2Y2WA 4UT7H 2TRYA 5E4EC 1QA9A 2J3SA 2YQGA 2WHVA 4NS0A 5D2LA 2GHWB 1FG9C 2F9BT 2OCFD 4E2OA 2DJUA 5C0BB 5FECB 5K69A 1R3HA 5J5EA 3WE6A 1BEYH 1TQVA 4QRQA 3NPSC 2GIXA 3O2DL 3DSFH 4JB9H 5I8KH 2ZKXA 4HBQA 1RIUH 2AXGB 2JCCE 4N90E 5FDWB 1NBVL 3CC5B 3D3VD 4JVUA 4Q6YA 2LVEA 2VN5A 3VSVA 5LHDA 2NYKA 1FVDB 3VRIA 3ASWA 3B9DA 5FCSH 5A43C 5TFSH 3QIBD 1SJEB 1SY6H 1UB5A 4DTGL 1N8ZA 3O45B 3T1FB 3MA7A 4CNIA 2CUMA 4YBLC 4GKNA 1JK8A 1YEDA 4FQJL 4APXB 4L9LB 3GDBA 2VMDA 4FMKA 1EQWA 2PTTA 4UQDA 3AG3B 3JWDH 1NAKL 1J1PH 2UXFA 3MJ7B 1E2WA 4PJFA 3LPPA 4UZUA 1WE5A 3R4DA 2WN2A 1PTZA 1R17A 2WKLA 2EQDA 3H42H 4XP5L 5JDJA 1QPKA 4XNUL 1YO4A 5EORH 4HKBA 3PQYB 5KW9L 1DQQB 3CCHA 2K45A 1QYGL 3UH8A 1CD8A 4RZCA 1SXBA 4H5SB 2X3BA 2WANA 2BC4B 4PVMA 1ZHBA 2VJXA 3EKCA 3ATFA 4RISL 4KMTL 1TO5A 2IQAA 4KK5D 4FXGA 2P24A 1YMMA 2BSSA 1KEGL 2XC8A 3SOTA 3HBPA 1P9MC 3H7BB 2OYPA 2CHWA 3PPEA 4KV5F 4QKTA 4HIHA 4R0LA 2Y36H 4H88L 1LWHA 5FDYA 1I3RA 3IMBA 3AU1A 2NY7H 5DVMA 3PU7A 3DRQA 1FL3A 4E9VA 3CK0H 4G71B 4NM8H 4QHLB 4YHIA 4CSZA 5KSUA 2OV0A 1Z3GL 4RRPM 7PAZA 1ZT4A 5AW9B 3U83A 2VLJB 1YEFH 2K1MA 4X5WA 1TENA 3WGUB 3US9A 4P57B 2WQWA 4X9BA 5F3HA 2AKRA 3QUZB 1PZ5A 2I9TA 3EGXA 1U8LA 2Y07H 4WDIB 4ABVA 5EU4B 4F8LA 4GW5A 4FQXA 2WXMA 1T0MA 1OHQA 5DVKA 2ADIB 4G1MB 2A6JB 2VAAA 5FM4A 5L4IA 4UQ3A 5JOFA 4RSYA 1EZVY 2ILLA 4FNRA 3MYJA 1WGVA 5MENB 2J44A 4HCIA 3NCJL 2NXZD 5G4OA 1XCQB 4M48H 3F5WB 1J9RA 4ZTPH 5FO2A 3UGUA 2XLLA 5D2NC 4LU5L 2J8UE 5AWNH 2NXYD 4OIIH 2UVEA 4KITB 2J56A 4JJ5B 1MI5A 3NA9L 2BIHA 3EG9B 4FA8A 2Y1VA 2Q87A 1HHGA 1JPFA 1U8PA 3G5XA 1RPQA 3DROA 3I9IA 4MRBA 3SDYH 1U3JA 3C09B 4NP4H 4NQCB 4M4PA 3SDXE 4KI5E 2FLRT 2BXYA 4WKXA 4ZS7L 2NY3B 1O9VA 1LO3H 2LU5A 2Y06L 1UZ6E 2X2YA 2E9JA 5FUCC 5GISH 1T0OA 4K3DH 3UEZA 5KBPA 2P26A 1ZCRA 3HPLA 5FGCE 3AJ7A 4U1NB 5SWQA 5AALA 4PJAB 4F5CE 1E30A 2ZT9C 4DW2H 5K5YA 4MCNA 2Q6WB 5CZXC 2XACC 5D7JD 3LH9A 5FOBA 5C7ZA 2Y7QB 4F58H 2ZP0T 4G7RB 3H56A 5CEYA 5I76A 4Y5VB 3CAFA 3NIFB 1JWSB 2XN2A 3NCWA 2L7JA 1RXLA 3NQKA 4I18C 4GKLA 3K2UH 4F20A 8FABB 4WJ5B 5GSRB 3WJLA 3UTQA 3WY4A 1E90A 4HMEA 4IRJD 3D08A 4PJEE 1Q9OA 1BEXA 3P9LA 3RPKA 1IBDA 1RL1A 4BWWA 3DX0A 1EA9C 2J2ZA 2YAQA 3RVUD 4AMKL 4FNTA 2XWTB 4YHOH 2YMXH 4WK4B 2CXGA 1WCQA 3EO0B 1I1AA 1OZUA 4GUQA 5CXPA 2Q3XA 1Z0MA 3JWNC 2VN6A 4DPAX 2XNAA 1T1ZB 4HK0B 3EIFA 3V0AC 3VXPB 3INOA 5IW3A 5I1CL 3UC0L 3DYMA 1Q0XH 3VM5A 2IGTA 2YD0A 5D7IF 4H26A 4ZYKB 1J5CA 1JZIA 4JKKA 4PRDB 1F90L 1NZRA 3GEWB 4QRTA 5HHXL 4XVTL 3VXTA 3DX4A 3SYOA 4R4ND 2IXQB 1OPGH 1XMEB 3FT2B 1F5WA 3FS9A 4N2EA 4F37K 5E2UH 3KPSA 4D9RD 1T66C 3KJ4C 4LCWD 1HHIA 4PRBA 2OTUA 2RIKA 5J9PB 2BSED 3HC4L 3TTSA 1D5BB 3DARA 5DU7A 3WS6A 2R2EB 4LCIH 4UV7L 3OKLA 5JDSA 4L3AA 4M7KL 4KTEH 5KBMA 5E08H 2YAHA 5DUML 4B5EA 4UB0L 1E6OL 3CFBA 4JFXA 3IAPA 1T6VN 3M17A 3EAKA 5HYSG 3UACA 2GKIA 4RBPK 4U1SB 3ATDA 3SBRA 1J0JA 2MQ3A 4LDLB 3RAJH 3ZGIA 4G6JH 5F6HI 1EHAA 2H6OA 2WBWB 5T3XE 1VCAA 3QCUH 1YYMH 4JGJA 4RMWA 2YN3A 4J2XA 1NDTA 4Y1AB 2KUTA 2VR3A 3V10A 4CSPA 3GBNH 4NDMB 4R26H 3VO0A 3IE4A 2BS9A 1FLRL 5D1ZI 4HT1H 4KROB 4NB7A 4TULH 4LXFA 2L04A 5C08A 3HZMA 3ZL4H 4BGLA 4XX1G 2O6CA 4AQOA 1T5XA 4A2HA 3O6KH 1BQKA 2JJTC 4TPRH 4V2CB 3WIIL 3HE6B 2GIYA 2CU9A 1H8NA 4GW4B 1N59A 4Q2ZA 3T6XA 3UMNA 3UTSA 3OQ3B 1JGEA 8PAZA 4GIPD 1HAUA 1CGUA 1KGCD 4QXUH 1F0LA 1UWXH 4LMQI 5JW4R 1BGXH 4BFKA 4NT6A 5F0PB 2YUVA 5CCGE 5FGRA 5JOEA 3RNQB 1AZVA 4GS7C 3W0WA 4PJDB 4QLRA 1A7OH 4LKCB 1EJFA 5DRWA 4JHZA 1BQHA 1RZ8B 3O41B 1HE7A 5FA3A 5IROA 3PP3K 1N4XH 3RWEA 2BVQA 4QO1B 3HC3H 1RUAL 3DVNB 4XMTA 2G4GA 4FTVA 1XL4A 2YXWA 5L4MA 5IB3A 3P0YL 3QDJE 5DMIH 2F7QA 4JFHE 4ANWA 5FW8A 4GT0A 3R4RA 1U8HB 3WIHH 2AJXH 3MCYA 3QEGL 1FNHA 2BOCA 4OV6F 4ZT1A 3WIFB 4N26A 1PJ9A 5EV7A 1JHLH 5DD5L 4FP8L 1PU0A 2AEPL 1E9PA 1TITA 3MRJA 4J12A 2BNUB 1OGAA 2BRRH 3GSRA 4J3SA 5D1ZB 3PGDA 4OR1A 5E8OA 2OMWB 3EJQA 4F15C 2AJVH 4TVPH 2V2WA 1H3GA 1TG8A 4JDTH 4DP6X 2JI2A 3KYKH 4QAWA 4F37F 4AKOA 3AWFA 3U4BH 5CZRA 2VDPL 3BVUA 4LSSL 4XNMB 5DEJA 3W9DB 4OGQC 1J9CT 3RY5A 2VM9A 3MOQA 2AK4D 1ZS8A 3V0FA 5B3SB 1W72B 5IKCB 2VISB 1FG2A 3D85A 3N5AA 4XI5D 3VYOA 4CADB 5HYJA 1A4BA 4GKSA 1HT6A 4GAYA 2DI7A 5KZCB 3Q7JA 4NSKB 4X7SH 3D30A 2AAAA 1WWAX 2D7OA 1NLBH 5C7XH 1FE8L 3V8CA 1XEUA 3JVGA 4K5LA 1L0QA 1OAXL 5I26A 3LKQA 2YAFA 3QQDB 3OF6A 4Y2OA 2V5SA 3GJFH 3IXAA 2A6DB 3NEXA 5GGVL 2ADJA 5I8OL 1UT2A 1QLRB 2DIJA 4P9HL 5FW7A 5I0WA 2J55A 3ROOA 3ZDYB 1SYSA 1N68A 3BAIA 1E8ZA 1BHGA 1IAIL 1RCYA 1V7NH 2XA8L 5DVPA 4BE6A 4NP9A 3L5IA 2TRHA 4NLAA 3CZFA 4JO2H 4QHMA 4XRCA 2EDOA 3COOA 3SDXB 3RWJA 4IBVA 3QR2A 3KYNA 1H19A 4U4IA 2GUYA 2CJUH 3T65B 3NCBB 4DKEH 1HINH 3JT0A 4BQ9A 1A4AA 5FGCB 3RJDA 3FB5B 4KDTA 2NNAA 4J28A 3TIDA 2DQHH 4FADA 5ANME 2MNJB 1YZZA 4N6QA 4P5TC 2XETA 3R8QA 1FAIH 1PG7W 4CJ1A 2BW5A 3BGFC 4WW2C 3WKML 4M56A 2ZYIA 4OIBA 4L48A 5KANI 1I8AA 5K9OB 4QAMB 5D1XE 1YNTB 4HIIB 2NX5D 3CIQA 3S4SB 4AYSA 1BQLL 3MRKA 1PLGH 5ESAA 4KX8A 4PJEB 5D5ME 4GG6E 1P5UA 1N0XH 1BPLB 2OZ4A 4B97A 3ULSA 3H54A 4ATTA 4N2GA 1A1NA 1UYWL 5C0GB 2AQNA 4LLVA 4EDWL 5J1TC 3OX8B 3CSYA 1LK3H 2OXHA 2UXGA 1KCLA 3MX0A 4D7PA 2DD8L 3LXUX 1MWAB 4MJ5B 3HNSH 1UACL 4FCAA 2R0WL 1B2WL 3FC8A 4M62H 3TH4T 4PGCA 1OP5H 5JO5B 1P4IL 1NJ9A 2EC8A 3L4VA 3MBXH 4U3CA 5FYJU 4PJ7A 1GGBL 1J05B 4GXFA 4ZAKC 3Q8EA 2FX8H 3LKRA 3MNVB 4OZHE 5CZXD 2G9HB 3U7YL 1WCBA 3JYCA 2ED9A 3CPUA 3GZQA 1CDJA 3ARSA 5FEBA 5GGUA 4Y9BA 1D5XA 2BSCA 5F9OH 3N91A 2Q76A 5HDOA 3RDTB 5C71A 4FKEA 1U8OB 1M7XA 4ZFZA 1FFNB 4UM8A 1ZLVH 2H6PA 1DVZA 2HJFA 4NNYA 1MRFL 4B9YA 4KGLA 4PJXA 1NGYB 5FLUA 2WLHA 2Y1AA 4DGIH 2VITA 4YDKL 4AMWA 4P04A 1HQ4A 3P11L 2KZKA 4NQSA 3TO4D 4MAYC 3EDEA 2ZWNA 1FZOA 4Z77A 3RNKA 4XBGB 1ODAA 3GMQA 3MUY1 2D7TL 4YHYB 4LDEB 4S1QH 2EH7H 2JKJA 4R2GB 4K23H 3CFIC 5AOLA 1PPIA 3PDOA 4QCIA 5F7YC 5LBSA 5C97A 3G6JE 1Q9WA 3SDCC 5D55A 5KYYA 4Y0GA 2LTQB 4MDJB 1IMHC 1BMWA 2MJWA 1DSFL 1MW2A 1TZAA 2NZIA 3QUYC 4I3RL 3MGAA 3F7VB 4BK8A 5J3HC 5K9JL 3L3OC 3FYIB 1Y18A 2KDGA 1M7UA 3WU1A 4JFFA 3MLWH 1T66D 2AABL 4XP1L 2B77A 4I4WB 5HHPA 3OB8A 4GMSH 3FT4B 3KLAB 2V7HB 3QBTB 4ZW7A 3VE0A 5DK2A 2LQRA 3SDDC 1M6OB 5J11B 3U4EB 2QGCA 4BDVA 2JKXA 2R56L 4U6HB 3LSOB 2WXJA 1WQVT 2X10A 3KNBA 4TUKL 4B53A 3Q1SH 2P7TB 3RL2A 5B8CC 2DBLH 4FMFA 3H2QA 4U7MA 1S9WB 3V4PH 4Z7QE 4PPTA 2ZXWB 1AO7A 2XRAL 4OD1L 5BNXD 5D71L 2HPOA 4QTHB 4N8VB 4M1DH 2A83A 1VACB 3QDJB 3TBTA 2YC1B 4CC4C 4DP4X 5AVUB 5F3BA 4B9KC 3BVNB 3DURA 3SPIA 3VI4A 5BUPA 4CSSA 1P2CB 4XPFH 4O5LH 1U58A 3CVHA 3QI9B 2PPAA 4TNWF 1MJJA 1OK8A 4X9HA 5TQ2L 3IPEA 3DTXB 5AOIA 2I26N 3WTWA 4XPTH 1EX0A 3O3AA 3VW3L 3QIUD 1WJ3A 3O0LA 4KVPA 4UQ9A 1NOLA 1CR9L 1QZNA 4F33B 4LSPL 3BXNB 2VKXA 1TCRB 2GT9A 3IDJB 2DH2A 3RURA 1HHJA 5JR1H 2BM3A 1RZIA 4ZMLA 4L1TA 2FO1A 4HPYH 3B2XA 4PFEA 3GMNB 3NFPB 3IE9A 4OFQA 5D72H 2X2UA 2ZP8A 2J5LB 4L4VD 4G7YH 1TF4A 1E4KC 2Y4SA 4CC0A 4JFDE 5E99H 1ILSA 4NWUL 5EUOE 4OZIA 1CGYA 4PJ9B 4NXSA 2ZSVA 4FA7B 2E4TA 2GSGB 1DQML 2WWOA 3F00A 1J88A 1TTBA 3NCXA 2J72A 4LPYA 4R7NA 2XTJD 5D2NA 2Z64C 3WUWA 3MNZB 2E74C 3B5TA 4KKAC 2J88H 2OXGA 4UIKL 1RHFA 4GSXA 5ICZA 3ECQA 4QGTA 4JO4L 2IQ9H 1FQ9C 1FYTE 1BVLA 3HZKB 5FR3A 4L37B 1CT8B 5H35A 5DUPH 5EZIL 3MRNB 4CAGA 1Y1UA 1YHPA 2VDLB 4DN4L 1OD9A 5F88B 5IBTH 1SJXA 2ARJQ 2ERJB 3C60C 2NY0B 3O0RL 5DHVB 2Q86A 5HGHA 5EHFA 1X5AA 3HR5B 3GO1L 1KN4L 1JHKH 4PJAF 1IO4C 4Q9RH 4JZJC 1VSCA 1HCVA 3FCBA 3CXHK 1NIEA 3NZUA 4I48A 4NLHA 3S2AA 3K91A 4TRPL 3NIFF 3UO1H 4C4UA 2UZIL 2DV6A 1R24B 3CHQA 3SGEI 1OSPL 5EN2A 1LYQA 3QJQB 4FKKA 4IEFA 1Q0YL 2IALB 4XX5A 3GSWB 4HJ0C 3RI5F 4J8RB 5CSZB 1CFQA 4FFYH 5D1XB 3IMRA 1ICTA 3IM1A 4W68A 1O5DT 1QI3A 2X4PA 3R18A 3MBWA 4EZLA 5IMLA 5D5MB 4GG6B 5LGHL 1S7UB 5EBLA 2JWYA 4EI5B 3B9AA 1DQJB 1JK9B 1NLDL 1J5IA 2M2DA 3CJJA 5E95B 4P4KC 3MRHA 1JF1A 2OR9H 4LB8A 1GCYA 1NPJA 4N0UA 4PJBF 4JRLA 1INQB 3CZLA 4FULA 4EN3A 2OTPA 4XP6H 5BZDA 1IVLA 2EXWD 4FZ8L 3EDFA 3BW9B 3BQUC 2BWDA 4DO5A 3AREC 3KYMA 3CG8A 1JZ2A 3VD2A 4IU2A 3ZHLA 2WLNA 2NSMA 3DJRA 1RKRA 3D8MA 2GTWA 4OZFA 3BPCA 4OJFL 2P1YA 1BOGA 1J1OH 3L3IB 3MYZA 3OKEB 3HTLX 2X4OB 4P5TD 3TBYB 1S78C 4MA1B 3FSAA 4M93B 5AW0B 4HHAA 2DQIH 4F9PA 3DO4A 4ECNA 1UADC 3AY4C 1C16A 1IKFH 2BSDA 4F24A 5CJQL 5ACMA 5DT1H 3VFVA 2HVJB 2K4AA 1UD5A 4JO1L 5B39G 1JPGA 3GK8H 1J0ZA 2XYBA 3NTCH 3V0VA 1PEZA 3VXQA 4AUYA 4G8GD 4MMYA 5EUKB 3REVA 5FYKD 4BUHA 2JCCF 3L7EA 3E80A 2OL3H 4UT6L 1MRDL 3PWUA 1S7VA 2XV2A 2Z93B 4H0HB 4XBMA 4DQOH 1QWNA 1OM3L 5BS0E 1GOFA 2IV9A 3ZMEA 2NYYC 2BY3A 1MCCA 1NICA 2DMBA 4XPHH 2IAAC 1FN4B 1ZJAA 4YDVA 4EQ3A 4APQA 1XXDC 4HS3A 2HT2C 5KWYC 1AR1B 1A9EB 5KVFE 2X4QB 3GMPA 4MMZB 4NKOA 4V1DA 4RFNB 4WTQA 4ZAKD 5FAAA 2WZPA 3RTQC 2AJYH 4I85A 2YOAA 4EKJA 5EU5B 2IAMD 5F96L 3LEVH 5IMMB 2EILB 3FF8A 4UDTB 4BCYA 3RX7A 3KMDA 1KPUB 1H6UA 1J8HB 5DRXB 4LVHB 1KLUA 1TZIB 4NO5B 15C8H 1EMTH 1P7KA 1QTYT 2NY6C 3EJJX 3ZU8A 2Z92B 3T6QC 3S37X 3CXDH 3PFUA 5KYWA 2XQYA 3ZRFC 5CF3A 2DMCA 3REWB 3TZVA 3NJVA 5I71B 1U8QA 3HBGA 4HWEH 1UC6A 4K3JL 1CWVA 1TQTA 5E2TL 2YRLA 3BWSA 4TQIA 1ACZA 2C3WA 5HHVH 2RHEA 4Z7QB 4CVXB 3QG6A 2A4ZA 3NJNA 1I4FA 1U3HB 5HDLA 4UZGA 3VDCA 3B2PA 5F44A 2JIXB 5HHME 4ZQKB 1ZJBA 1BQSA 3HMXL 5EBGA 2VLRA 1UB6B 2IGFH 3PUCA 3QQNA 4S11A 3SDCD 3WIAA 3Q43A 5DHMC 2CO7B 4ENEC 1NCHA 2WQ8A 1SHSA 1UWYA 1A9VA 3SKMB 4NEHB 2Q8BH 4AQ8C 2JKIS 3UTZA 3QUYD 1GJUA 4N24A 3BHBB 1ZSHA 5AAMC 4L8SA 4ORZC 2JI1A 4PY8I 1TLMA 3C8DA 5HDWA 4F8TA 4GRLC 1MQKL 2IOOA 1QFWM 4L23A 4Y2NA 4OB5L 4RGNC 2P43B 5CHNA 1EO8L 5DYOA 5F7MC 1CD1A 2VLLB 4WNQB 1USZA 5DI8A 1B9KA 1X9LA 3L6FB 4WUUE 3JV4B 5DD1L 5T5FA 5C1MB 5FYLD 4MAUH 3APFA 1OIOA 3H85A 1IAIM 2AEQH 4HUCA 5EUOB 1FZJB 1SJVA 5LKNA 2H41A 3B8SA 4R8WH 4XMXA 2WD0A 5DS1A 3GSOA 3KLHC 3BO8B 3QUXB 4NBZB 2FT7A 2X0UA 1RK0B 5LN4A 1KTDA 2EXYD 2FNWA 5AYQA 3WL9A 2EVHA 1ZT1B 5FM5M 2J8UF 2E9BA 5E9AA 5FV2A 4HEME 4NZ8A 4HH9A 1VGKB 4ETQB 3DVFA 3ZSSA 4WENB 2JELL 1FYTB 1OAUL 2NUPB 4X7FC 1B4JL 1K4CB 1UZGA 4MCYA 3AS0A 3KCPA 2H8PA 4PEEA 5BW7C 5HI3C 1KPRA 3BH4A 3P30L 3HS9A 4NO2B 2Z31B 1F6FB 3ZE0E 4ZG1A 5JPMC 3TEUA 4YXKL 3VFNB 2WO3B 1EEUA 1WLHA 4P06A 4OCXL 1ZGLB 2OM5A 4PN6A 1HU8A 2FJFA 3PNWB 4UZSA 2EDJA 2QPDB 3MJ9L 1JWUA 3EOBB 3QHZH 4WWOA 3Q2VA 2WTPA 4W9DC 5LAXB 3T0BA 4XO3A 4RLDA 5J8OA 2CO2A 1F11B 2Y3NA 1CDUA 4QRAA 5GRZA 1ZIAA 4NZJA 5F1KC 1HL9A 1IAKB 2KLSA 4P2YA 3TYFB 3WTUA 2AQQA 1XF2A 4YDMA 4XMKL 5EULV 3EJTA 4AIOA 1A2YA 1BJ8A 5JHDA 4M9PA 2AANA 2GTQA 1E8XA 2AQTA 2PWGA 4UWQB 1PLAA 2V2XB 4HKXA 4E9SA 2BHUA 1GIGL 1MREL 4MDIA 4CN1A 4JFTA 2AGJH 1IBFA 1ZE3H 5DSCB 2GYSA 3QEQE 4NO3A 3GKWH 3PWNB 4R5VA 5IK3A 4AJ0A 1HOEA 3MLTA 4X8GA 3QDHA 4K3GA 2NY2B 4UM9A 1PF3A 3JV0A 1MHHB 1SF5A 5DQDH 3VFSB 1HNYA 5IQNA 2IADA 2E7MA 1RU9L 4ODUA 4P5MA 2BSTB 2F53A 2HRGA 1NMBL 2TSBA 5INCA 2X6VA 3DOIA 2QPEB 2ZOWA 3C5ZB 3QT2A 3QVAA 3WFDH 4JKMA 4B0MB 3ARUA 3BUDA 2JKSA 4IMLB 4LHJB 5HY9A 1JYXA 4AZ8A 1UWEH 1KCRL 3QPQD 1AD9A 1XIWD 1YJDH 1G6RB 2L7EA 3QCTH 4XC3H 3MV9E 2IOIA 1F45A 4FRWA 3VH8B 3QNZB 1A4KA 1YMHB 3BH9B 4U0RC 4HJ0D 5I6NA 3IGFA 1TZGL 4FQ1H 1WDAA 1KY6A 3LN5B 3WLWD 3KR3L 3DETC 4Z7VE 1MJUL 1YUHB 2CH8A 2YKLL 5EEZA 3VXSB 4KPHL 4P2RA 2PR4L 3STLB 3QUKA 4MAYA 4J4PA 2WWKT 2BFVL 1ZVSA 4P4KD 2P45B 3BT2L 3TA3B 2XV6B 4N2BA 3ZDXF 4E9YA 2R59A 4FQPA 4PJHE 3CWGA 3C09C 4I5BA 3BQUD 4R90L 1KGYE 1UEMA 1JV5A 3CFEB 2OSWA 3LPOA 2RA1A 2HT4D 4IJ3C 4OLUH 3ULUE 5C0AE 1M71A 4HAKA 3GXFA 1OCCB 1QW8A 3WENA 4ES8A 4MXWL 4NRYA 3NEOA 4HDIA 3UG3A 1XGTB 3O2WL 4J6RH 4KH2A 1VEOA 4YO0A 3PGFH 3T4YA 2UZXA 1QSVA 3L3OA 4RMTA 5CJOL 5GPRA 2AV7A 3GIVA 3OKNA 1RUPL 2QBWA 3O11A 4IRZL 3GUTB 3D12B 4LLQA 3E2HC 4JFPB 2VDML 5JIDA 3QB7C 1QKZH 2CR6A 1U93A 4N2LA 4WU5B 1KDIA 2XVBA 3SDDA 4K8RD 2CNZA 2K70A 1I82A 4ALAC 3CC1A 1KC5H 1XWVA 1O6VA 3OPZH 1NQBA 3GJEA 2FWSA 5B8CA 5G4NA 3TJEH 5A7EA 4MSWB 4NAJA 5E8DH 4YSAA 4ZFOA 4Z8FH 4YN3A 3QZOA 3TBCA 3V55A 4HKJB 3V4UH 5KSAB 4IDLA 3PHQB 1VKXB 2R2BA 3FAXA 3U9UA 2R29A 3QJXA 4K0OA 5HHOE 2R69H 1GAFH 1VFOA 4WHTA 3FQTB 3IFLH 3UJTH 5AG8A 3NZSA 3DJSA 3S35X 3VD9A 4N2OA 1QO3B 4G6KH 3SKOB 4QYOB 4C56A 4G9FD 4CC4A 4HXAH 5AZUA 2NYYD 5GHWL 3RA7L 2ENJA 4KJWD 2W9EL 2DW5A 2VLME 1MCLA 4G8IA 5H94A 1BLIA 2F8VA 5E8NA 3X12A 5A16A 4GQPH 1WISA 1U8IA 3U9PL 5KBKA 3RTQD 1HXMA 1XCTB 3OKKA 5KVGL 3CFDA 5BRZD 3O2DH 2HFGL 1FO0L 1XSIA 2KZWA 3CFJA 4W70A 5BOZG 4ZMPA 4ODXA 4UMGA 5BMFL 3WO4C 1NBVH 1IBGL 1GZPB 3S2CA 2Y7NA 5A2JH 2O6DA 5BQ7B 5IB2B 4G11A 4QHUB 2NY6D 4EN2A 2J7LA 3GSNL 2HTLC 2C4XA 3AM8A 3ARBC 3EZ8A 4HC1L 4XO9A 4DTGH 3EYQC 5FHBL 2WQRA 1RVFH 1VENA 2MOQA 2VC2L 4OFVA 2QKIC 4IMKC 4Q6KA 2JI3A 3SGKC 4FQJH 1BZ9A 1AQHA 3GZKA 5ABAA 1UASA 1H6FA 2A9CA 2ITDA 1NAKH 5D96B 3LRKA 3BZEB 2DM4A 3ESUF 1IKNA 1L5GB 3SPJA 4F8QA 4JLRB 5AZ2L 1ORQA 3O6MH 3EDJA 4XP5H 4C83A 4NYLB 4XNUH 4Q52A 1Z9MA 1FI8C 3H53A 3B7TA 5FCUL 3RDJA 5KW9H 1WFMA 3QJHA 2WV3A 1FV1B 1QYGH 2CMRL 1QBML 1KBGL 4QRPE 4YJZL 4FKHA 3LMJL 2D3NA 2EDLA 3QULB 3TPUB 3F7YB 4DGYL 2IANA 1SXZA 2WMPB 3KDMB 4RISH 4A2EA 4KMTH 3D4YA 4GRLD 3CDGA 3A6CL 1KEGH 2ITCB 4I2XA 1OT1A 3C60A 4LOEA 4YNYB 3BJLA 2Z91A 3AACA 4XBEL 3WNJA 3ZXAC 3FUHA 1OL0A 2GVYA 4YSCA 1KPVA 2QGDA 3EYVA 2NUTB 4DZ8B 2ODIA 3KXFE 3FRPB 3GJFB 1Z3RA 1Z3GH 5DEGA 4MB3A 3S36X 5LGYA 4HULB 3MRCA 4JM2B 1AS8A 3V6ZA 4ZUVA 1ZDQA 1B90A 3VGGA 3SIKA 2X4TB 5GZND 5DJCB 4NNXA 5AVXB 4JM4L 4CN4A 5CD3B 4JPKL 5IVXA 4XPBL 1E50A 3RG1C 2LU3A 4PRID 3GS0A 1I31A 5GRUL 4BKSC 2VO8A 3VXUD 3IPFA 3BMVA 5CMAA 5I19L 1S7WA 4CMHB 2DQGL 1ZHNB 1BXAA 5FYKL 3MOBL 1BZ8A 3SGJC 1DQIA 4J3BA 3NCJH 4N1HB 2WKOA 4XX1E 4TLTA 3AREA 5F9WC 1CQYA 2WVVB 4HXBL 4QPEA 1KCVL 1TMQA 5EIIA 1AS7A 4LU5H 4WI5A 5CFAA 5T1DL 4ZUTA 5GQBA 2CALA 1WS8A 4ZMZA 2X0WA 3NA9H 3W39B 4DP7X 2LW3A 3K4AA 2X2IA 4B41A 1EXGA 4OZHF 2CGRL 3RKDC 1D5ZA 1JF5A 4P2AA 5D8JL 4ZDHB 1UENA 3FPYA 3MRPB 3FHAA 1E28B 1P4LA 2RTTA 3E7JA 5TDPA 4GT7A 3ZYOA 1JXJA 3QDGA 1V3KA 2DLHA 2W0FB 1ZD6A 3AY4A 3MMEB 3PHOA 1QR1B 4ZS7H 1WBXA 4JY5L 4DP5X 2UUDK 2Y06H 4LGRB 5ANHA 3D25B 4KXZH 2EUVA 5F7HA 1CICC 3NFNA 5D7EA 4OU3A 2L8AA 4HUWB 3N50A 1UCTA 4Z7VB 4FMVA 3VD4A 3MFFB 1UOWA 1WC7B 3D48R 2QR0B 4ZK8A 5JPNB 1AMYA 3NP4A 4MD4A 4OKVA 2NT0A 4URKA 2YAOA 1BBJA 1F3DJ 1KB5L 4S1DD 4X6DA 5CKGA 4YHML 5E6IB 4ZUUA 3OZ9L 2AJZA 1NINA 2YEVB 3AY2A 1DJSA 3FUMA 1NCAH 4J3UA 4PJHB 4HG4J 4P23B 1F58L 1BYPA 4AMKH 3G6JF 4Z5RB 1WS7A 5DURD 3RL1A 5B4MC 1MHCB 1ML0A 5C0AB 1U92A 4MS8C 3PWJA 5FYJD 3GMLA 1U3ZA 4GBXC 4NKDB 1TTCA 4H1LG 2XN9E 1K5WA 2EIEA 3L5JA 4LNRB 1FP5A 1OT4A 1P5VB 2XI9A 3IJYA 4UOW0 4UV4L 3QRGL 1ASQA 3C9NB 5DVOA 5E1QA 5I1CH 3PWLB 3UC0H 2DM2A 5HHNA 2G0LA 2PP9A 3DETD 1T83C 5AYTA 1F90H 1LMIA 1X5XA 5FYLL 5HHXH 1LM8V 4XVTH 4H25B 1CDYA 4Z7QF 3E3QE 4BFGA 4QRRA 1A8ZA 3CVBA 3GRBA 2VN7A 2SEBB 2P5ED 4YHPA 3ZE2E 3L3GA 5HHOB 3T1WA 5EPMA 2H26A 3FUFA 3UPRA 5HDRA 2GBAA 1K9TA 1RUKL 2NPLX 1UFGA 3HNTL 3HC4H 5IP4A 5IEHB 4L4TA 2CD0A 3GXDA 3D39D 4I77H 4NAMA 1B0RA 1TKWA 4AQ8A 3BYTA 2C4FT 2Y72A 4M7KH 1MVUB 2JJVA 5DUMH 2JCWA 1KG0B 4UQ2A 4UB0H 4PRAB 1E6OH 1LO5B 4P3DB 4XVSL 1SMAA 3V0WL 5DGQA 2JQZA 4PJIB 4EVNB 4YHKL 3QXUA 3UTPE 1MLBB 1OF0A 4KUZL 2WWMC 1KJVB 2Y0SA 2C1OB 1E4WL 5JORA 2QLYA 4PCSA 1QPXA 1X6NA 1HVXA 2H0EA 4WHCA 4A7GA 1FLRH 3GMRB 2HB0A 1X5JA 4JJHA 5C0BA 5DDHB 1WIPA 4OT1L 3WNIA 4AZUA 3S5LG 3NIDB 1YNLL 5CIPB 4PS8A 3LS4L 1IZJA 1S7RB 2AXGA 4PRPB 5FDWA 4DPRA 3CC5A 3WIIH 2X3CA 5FKPB 4KTYA 1FVDA 2JV6A 4MA7L 5AW5B 32C2B 2ZUWA 1SJEA 3SBPA 3QJTB 3O45A 3N43B 4Y9CA 3T1FA 1L0XA 5LJYH 1RZPA 2CCWA 3EH1A 3SCMB 1QHOA 2LTQC 4QJ3B 1KB9K 2VXQL 1L9PA 4APXA 4LCYB 4AQ1B 5IMOB 5LWYH 2ZUSA 4FYSA 4U1KA 3L1FA 1RUAH 3HRZC 3MJ7A 2OYMA 4JE4B 4P2QD 4PJCA 5A40E 2O6FA 3P0YH 2G5RA 4KK9C 2RACA 1UVQB 1KYUA 4NOBA 2HTLD 3SE4C 3AGWA 5SWZB 1I3UA 2G3ZA 3QEGH 3PQYA 1DQQA 4OVVA 2NSXA 5DD5H 3ATEA 3QFJA 4FP8H 4Z7UE 3WI9A 3ARDC 3FSWA 3KHQA 4H5SA 1NCGA 2MMXA 3KXFB 3TGXA 3RBGA 1EPFA 1XDTT 9CGTA 5HPMB 2BC4A 1RZJL 5A2BA 1F42A 3N0PB 2OSYA 2IH3B 5GGVY 2W59A 4PWEA 2VDPH 4LSSH 2DLIA 3OLDA 4JVPA 5IM7B 1PY4A 3D5OF 3ENEA 3H7BA 3ZSTA 1HZLA 4MX7B 2DL2A 2RB8A 4RFOL 2FGWL 3VSTA 3VQ1C 1XGYL 2YGPA 5TPWL 4Q4EA 4ONFH 5D7KD 5HYEA 4QHLA 1E8WA 1KENL 4L8DB 3GM8A 1HCYA 5E9DB 4QWWC 1ZK9A 5INDB 2YZ1A 4MNQD 1F56A 1FE8H 2XN1A 3FT3B 3OJMB 2G60L 4U3SB 4BV1A 1QFWH 1QFPA 4F57L 7TAAA 2PPFA 4P57A 1M57B 2WQAA 5C2BL 1E7UA 3QUZA 3OKMB 1WBZB 2P5WE 4HWZB 4WDIA 5EU4A 5GGVH 1JNLL 2Z7WA 5I8OH 2ADIA 2WLKA 4G1MA 3P4OB 4LEXL 2A6JA 4B9FA 4P9HH 2J1KA 2XZAL 3BSHA 3D06A 1QLFB 2E7DA 1X3DA 4Z18A 1IAIH 2XA8H 3FQ1A 1WFOA 2GEEA 4U6YB 1BD2B 5CO1A 3P3SA 4PJ5E 3GFUA 4N28A 5ALBL 2VL5B 4ZZKA 1C5BL 4AGOA 5BOJA 2C9RA 1XCQA 3F5WA 4K8RL 3D18B 4A6YB 5IMKB 1OAZL 4KKRA 2LT9A 3AXLB 2YAEA 1LL1A 2XVKA 1L6ZA 3FSZA 3S35L 5E0QA 3NDYE 1YY8B 3U6XA 2APSA 5J1AB 1L9SA 4HJGB 3VFGH 5EF1A 1KCBA 2NY5C 1H0DA 3WKMH 1NC2D 4NQCA 5LDSA 4D7BA 1T20B 1BQLH 2E9GA 4OFYA 2AV1B 3ZYIA 3CH8A 3T2LA 3U1PA 3FB6B 4HALA 2HVKB 3ARYA 5E8EB 5IOKA 4QDGA 4U1NA 1UYWH 3RU8L 2QSQA 2BW4A 3W81A 4EDWH 3GDCA 2Q6WA 2WIIB 3RKDD 3DPDA 2Y7QA 1U8JB 1BFOB 5I15H 4PJ8B 3U1QA 4ZO9A 2DD8H 4G6ML 1JWSA 1QRNE 2F68X 5F1NB 2XN9B 4H8WL 1D2PA 3P3RA 4FQHB 4PAZA 3VWJC 8FABA 1HHKB 1UACH 1NCTA 4WJ5A 3N04A 5GSRA 5DFAA 2R0WH 2CWRA 3FNKA 5AB1A 1P4IH 2Z4TA 3VXOB 2BIQA 1G4RA 1W15A 3O9WB 2Y6TE 1AANA 5FGBA 1GGBH 5JA8B 3BUTA 4IHOB 5E6UB 2DWDB 2WK2A 5EC1B 3U7YH 3MUJA 3RGVD 4XP4L 5K9QG 1ZPLA 4KK8C 1TR7A 4HMDA 2OMYB 4F7TB 3S3JA 3SN6N 3EO0A 4JN1H 5JQHC 5EU6B 1Q94A 5FOJA 5I74B 1JGVL 4AXWB 1T1ZA 3QNXB 4EIBA 2CUAA 4UNTA 1ZY9A 3IU3B 3VXPA 5TQ0L 1MRFH 2MKLC 3PABB 5IW6B 4YAQB 2R9HC 1MPAL 4A63A 4ZYKA 5B4MD 5EA0L 5EWIL 4MS8D 3SJVD 4YDKH 3P11H 4GBXD 5C0CB 4M5SA 4M1GL 4Q56A 2B4CL 2BNQA 2IXQA 2C1PA 5F8QC 3FT2A 3U7AA 3VGHA 1P1VA 1BAGA 2D7TH 2K0RA 2UY6B 2X7LB 3N06B 1F8TL 5E1HB 4EZJA 3ARBA 4BZ1A 1JAEA 4M93C 4DCQB 3E6FB 5AW1B 2XIDA 1D5BA 4K7PY 1MIEL 2R2EA 1I8IB 3AADB 4H20L 4BE5A 3IJSB 1DSFH 1L0PA 1T2JA 4R84A 2OP4L 2VT0A 2X53A 4NN6B 1XHHA 1Q1PA 3K72B 2P49B 3RTLA 4HAFA 5K9JH 5KYNA 4MB5A 3BE1L 3MV7E 4K2UL 4XP1H 2JKWA 5A2KH 3HI6L 3T8XB 4OGXL 2C8NA 2PYEE 3U36B 4YDNA 2MHAA 2YARA 3V9FA 4Y1AA 2C9AA 5I6XB 2R56H 4NDMA 4TUKH 4DPBX 3PWPE 1JDDA 4UAOB 4HVBA 2XPGB 5D93C 2XRAH 3Q5YA 4R97B 3X14B 1QLEL 4OD1H 4Q6IB 4BSJA 3BRFA 3B2UC 3N6YA 5D71H 1MCHA 1S9XB 4KKPA 3S7GA 4XN4A 5FUZL 3HE6A 4GW4A 1H8OA 3IGKA 1EAJA 2EDBA 2AEIT 3ZE0F 2VXVH 3NN8B 1T03L 4X83A 3T3MF 3HI5L 2DQTL 2NT1A 2PXYD 5TQ2H 4FYRA 3RNQA 1U4FA 1KCUL 4PJDA 4H4NA 1TEYA 3VW3H 4M29A 1RZ8A 1NWOA 2VZOA 2ZCKL 3O41A 5ES4B 1AOHA 1CR9H 1Z9NA 3HG1D 4LSPH 4WWKC 3L2LA 2YEZB 3OHXC 5DEFB 5EO9B 2VQUA 4R3SB 3FUKA 3ILDA 4X6BB 2DYPD 3MRMB 5GJTL 3QZWG 4GLRH 3H1ZA 3P4NA 1M7IA 4EZMA 4NOFA 2IPKB 4B6ZA 3HLAA 3AB0C 5D1ZA 3T3PE 2BNUA 1EJ6A 1CUOA 2OMWA 3SD2A 4NWUH 5E56A 3O8XB 1XGQB 3B4NA 1F4WL 3SSGA 3G3LA 1IM3D 1DQMH 5EU3B 1BG9A 1HSBB 5G4MA 4KK9D 5ISZA 4XNMA 3W9DA 1P7QB 3MJ8B 3DGGB 3WDHA 1AE6H 4UIKH 2ZD0A 1JZEA 1M42A 3ARZA 5F0LB 2JQAA 1W72A 3QORB 4FFWD 2VISA 2APFA 2Q3ZA 4RX4D 3GGWB 3D0LA 2W9DH 4D9QD 3ARDD 4JO4H 1J5HA 5F7AA 1XR9B 3DMMC 4A7VA 4CADA 1GL4B 1J8KA 3ZKNC 5DRNA 2DMHA 2MWCA 5TJWK 1NANH 4NSKA 3OZKA 5DJ2B 3UADA 2QFPA 4GIAA 5EZIH 4HLEA 1AG6A 2R1YB 1O5PA 4DN4H 4FQLL 4GAAA 1KBVA 5JIKA 4GOSA 5T3ZD 4KX7A 4PJ5B 1J10A 5AEAA 1OP4A 3O0RH 3T4AB 2AC0A 1JFQL 1XTMA 1CICA 1AO7D 3GO1H 1KN4H 5T1JA 4Z7OE 2DBJA 2N59A 2A6DA 2P52A 3WEXA 2H0PA 4AC4A 2ZCLL 3ME0A 3O6LH 4LPWA 1QLRA 3I9GL 3WMSA 4BFBD 1M7DB 4TRPH 1KGUA 2FJGA 4QWWD 1KGIA 1I75A 2UZIH 4QXVA 3JTBA 2QPUA 3MRIB 3QUGA 4F1SA 3BWAB 1OSPH 2VXUL 5I6MA 3AXIA 2HYMA 3SHSA 4AKPA 1Q0YH 3OAZH 4XO8A 2BVUA 2R0ZH 1EANA 3JV5A 4HUVB 3SPCA 1O7DE 4XC1L 5IWLA 1CLCA 3MR9B 3T65A 2CIIB 5LGHH 3BKYL 3FU7B 1AI1L 2KI6A 1C5DB 3FB5A 1AC0A 4HUMB 4OFDA 4G8FB 3W5NA 4L9DA 4XO5A 3BVWA 4X6CE 1FRGL 4XCCL 1JPTL 4RWYL 1QRNB 2XWBB 1C1EL 4FZ8H 5I17B 2V6HA 2VE6B 5K9OA 2PP7A 3S4SA 4HIIA 3W3BA 1AG0A 3HC2A 4AYBA 4PJGE 3VTTA 4PJEA 3VTAA 1UWGL 3SE6A 4HJIA 5C6WH 3UO8B 3LNHA 5C0GA 4U6XB 1LTXA 1F4XL 1ROCA 2PF6A 3D34A 1ORSB 4LAQL 4UTCA 3ULAB 2XTSA 5DRZB 2FYVA 2EDYA 4NRZA 4H13C 1EV2E 2E59A 1KT2B 4JMXA 4HIEB 1R3KB 3HLKA 1QRKA 2GSIB 3BFOA 1MWAA 3TWCL 2D3JA 5AD0B 1NUGA 5CJQH 1FVEB 4MD5B 4G70B 1BZ7B 5JO5A 3PPSA 4JO1H 4ZBJA 2B2XL 2YS4A 3HBQA 5GIRB 1KACB 3ELAT 5KBNC 4ZS6C 1XGPB 2D0HA 5T1KB 5IB4B 3CD4A 3MNVA 2G9HA 5IW1B 1KJMA 4IBQA 4JFEB 5L2KE 4C4KT 4LCCB 3MROB 4OJYA 3QJVB 4UT6H 4I0CC 3RDTA 1MRDH 3VWJD 2J8HA 1JD9A 4N2IA 5E51A 5LNGA 1OM3H 1U8OA 2JTYA 4KK6C 3BI9X 1FFNA 4Y5YB 4O2CB 4XN8A 2F54A 4DK6A 4MA3B 5K39A 3X1EA 4IKIA 5DJAB 1NGYA 3PY9A 3F3HA 4P46B 2GBTA 5CSGA 2BFGA 4KK8D 5EZPA 5F96H 5D2LE 4X50A 4S2SB 1WT5C 4ZOEA 3DX7B 4XBGA 1IM9B 4WI2A 4DGUA 4JUSA 1MOEA 3LV3B 4IRSC 1ASPA 5LQBL 2I9LA 1E9OB 3AT0A 4K3JH 3WG7B 3QK0A 4MDJA 2X1OA 3NBNA 3GLZA 1ZANL 5E2TH 3PWPB 1DBJL 3V0EA 1WICA 2DN7A 3V8OA 4N5UA 2RQ8A 2PWFA 2IG2L 2ESVE 5CWSB 3F7VA 3D2UB 3CX5J 3SYCA 4HWNA 4JGUA 3ECBB 4NQXB 4HLZG 1B0IA 3SE4A 1UH3A 4OLXL 3FT4A 3HMXH 2V7HA 2YRBA 3KLAA 3EJYD 4PJFE 4N0RA 4YXLL 3KW7A 4B3EA 1M6OA 3IFNL 1DANU 3UFIA 3U4EA 4AIEA 1FPTL 3P4MA 4U6HA 1TYJA 2DB8A 4K5OA 2YN5A 1N10A 3MV8D 1S9WA 1BVNP 1Z5YD 3HE7C 3BKCL 4KVCL 5ACLA 1MQKH 2JB6B 3AG1B 3C6LD 4CGTA 3FQNB 4HEPA 4OB5H 1RJYB 1V27A 4QTHA 1EO8H 3TT3L 4N8VA 5FLVA 3FUDA 1VACA 5TGBB 5CS7A 2QV2A 1RD6A 2YC1A 3ZGHA 2BNRD 3BVNA 3EO9L 1P2CA 1YMME 2CLVB 5F0MB 5DD1H 3ZMRA 1X5GA 4HAGA 4BK5A 5KS9B 3QI9A 3GRGA 4PRHD 3M86A 2VZ3A 3T3PB 4JVWA 2JKRM 3EUDA 3VFWB 4ZMNA 4KO6A 3G9AB 3BIAX 3B2UD 3DI3B 3Q2NA 1G1CA 4APQD 3CN0A 1MF2L 1BQRA 2YLKA 4F33A 3CZKA 1NCCL 4FI8A 3RIAK 1TCRA 4WO4B 3EGSB 3IDJA 3SKJL 1N7MH 1TZHB 3X1GA 5FFOA 2R4SL 3EOTH 4ZJ9A 5DO8A 4F8NA 4PWKA 2RJMA 2J4WL 5A2CA 2NNCA 4PS4H 4KXZI 4AUUA 3HOGA 2JELH 4LSQL 4NBXB 2ATKB 5F7BA 1B4JH 4TQHA 3KPRE 4PJ9A 4X7DC 2H3XC 2GSGA 3I50L 3NSDA 1C12B 3F7LA 2NW3A 2FATL 4YXKH 3B9EA 2PCXA 3SYPA 4OGYL 4OCXH 5I73B 3ZW3A 3MNZA 1DVFC 3EJUA 2L7QA 1GH7A 3MJ9H 5AOJA 1LE5A 1X5FA 4Z7OB 4X98B 3WSQL 4UANA 2FNBA 4LLUB 4Q89A 2HMIC 5EEVA 2VLRD 1HX0A 1R33A 3HZKA 2WLJA 1NUDA 2WBJB 4FX5A 2UZYB 4L37A 1MI5E 5DJYA 4P48A 3MRNA 4UQBA 2EEFA 1HSAB 1WA0X 3ARGB 5F88A 4OZGF 5JXAL 4K71C 4XMKH 3UPCA 5J6GA 5IJDC 4Z76B 5DHVA 4XWOC 3T0EC 4DVRL 1L6PA 1NFDB 2Y9RT 3G04B 3HR5A 3WEOA 3BPLC 1GIGH 1MREH 1DQDH 3IVKB 3DMMD 3KBFA 1BPVA 4MQTB 1NAMA 3WFZA 4BQ6A 1GSMA 4FG2A 1OAYL 3DX3A 3K74B 1SOKA 2VWEC 3FRUB 4JM2C 1R24A 5LBVA 3BUYB 1RU9H 2VDRH 2IALA 4RIRB 3BPNB 1HI6B 3FN9A 1NMBH 2WYIA 5CSZA 3MI6A 1WAAF 5HDBB 3TVMD 1XB6A 2J1YA 5D5MA 1S7UA 1UGKA 3S6CA 4EI5A 1KCRH 3N3EA 1DQJA 1FFPB 3QCVL 3Q44A 4E5XA 5EEUA 4NUQA 5DVNA 2ID5A 5CGBA 1NCDL 4CMHC 3UCRA 3VFMB 3ZE2F 2ED6A 1INQA 1UH4A 4JL2A 2V5TA 3RFRA 1Z9OA 2OTWB 1TZGH 5BOPA 5LO7A 1TFHA 3D69B 3KR3H 5JHLA 1WZKA 3NGBB 5TDNB 1MJUH 2YKLH 4IKLA 4KPHH 3BN9C 4R96A 2PR4H 2FYYB 2V2TB 2O30A 4W93A 3R1GL 1CYWA 2BFVH 2ZUXA 2EC9U 3L3IA 5H37A 1AP2B 3OKEA 1G9NL 2E6PA 3UJJH 2X4OA 3QYNA 2VQ1A 3TBYA 1JHTA 2AHIA 4DEUA 1JGIA 1I9RL 1LP9F 3K8MA 5F7FA 1KFGA 4HPHA 2ZAGA 3MCLL 4QNPE 2HVJA 2DQEL 2IDUA 2WO2B 4MXWH 4S0HA 4EKXA 3BFQG 3CVDA 2B1AH 2CLRB 1ACYL 3O2WH 4IOFC 3ZMNA 4FNPA 2H45A 4X5PA 2H32B 5CJOH 3AFLA 3BCDA 1B9ZA 1RUPH 5GRJH 4IRZH 4DZBB 3GHPA 2GJ6B 3FOLB 4PRNB 5F1IB 2VDMH 1S7SB 2B59B 3WNOA 3B8YA 2Z93A 3WE6B 3V0IA 2EYSB 1QFOA 2EDFA 5IJKC 3C08L 1BX2B 4P59L 2EIBA 1XTLA 1R34A 4OCLC 1FN4A 5TD4A 4P23C 2WLZA 2F74A 2X4QA 2V17L 4MMZA 3E9TA 1U42A 4NCC2 3VRIB 3L3KB 4AL8L 2F8OA 5IV2B 4DKDC 5EU5A 2F53D 1UB5B 5IMMA 4UDTA 5HI5D 2XJLA 4LLMB 1KPUA 2ESVB 3H9SD 4LRIC 1J8HA 2X9YA 3NSXA 5DRXA 1IJ9A 4J3OG 1TZIA 2DQDL 2YPVL 4NO5A 4AEHH 4JRXE 4KK6D 5GHWH 3RA7H 2Z92A 3OC8A 2W9EH 1OW0C 1T0PB 1IAMA 3REWA 1YQ2A 4PJFB 5KVEH 3U9PH 2J1ZA 3JZ7A 4Z7UF 5KVGH 5BQDA 4M9OA 4EUPG 2HFGH 1EIBA 1FO0H 3O3DB 1ET8A 1SY6A 5I0ZA 4HKBB 1YN7B 1GJIA 1I7TA 2AZAA 5BMFH 4OCSL 5EO0A 1LK2B 1IBGH 2MTAA 4CVXA 1YEKL 4WWKA 3TN0B 3W0WE 3OHXA 4HZ1A 1U3HA 3GMOA 2EVGA 2EDWA 3GSNH 4ZQKA 4P2RD 4L3ED 1GYVA 1QFWI 1VRSA 1UB6A 4HC1H 5LNEA 5FHBH 3NK4A 1A6TA 1JZ5A 1NCNA 2AXJA 2X9XA 4POUB 2P24B 1YMMB 4OKDA 1GGIL 1OGTB 1TTAA 4PV1C 3BP7A 3L45A 5CP7B 2AEWA 3MV01 2I25N 2JTDA 3BHBA 4H7VA 4YGAB 4HIHB 1FL6B 1QSEB 4HUNB 5AZ2H 1ZA6B 1OGAE 2NSQA 5BV7B 1IAII 3CVHL 1U21A 2VUOA 1AQDB 4O51B 4WFED 3WN5C 3ZL1A 1SOSA 1KELL 2VLLA 4WNQA 5KVMC 2CMRH 1OOAA 1QBMH 1KBGH 3L6FA 3DVIA 1KULA 3IRPX 3CH1B 1CLZL 1I9IL 3LMJH 5F89A 2E0PA 2W0KA 4DGYH 1PZ5B 3B56A 3EGXB 3HE7D 4BGDA 4NQVB 4FQXB 1T0MB 2CHXA 5EUOA 1FZJA 3KPRB 4CC1A 2AEOA 1ZWIB 2VAAB 3B83A 3FO0H 4UQ3B 5JOFB 4XBEH 3FMGL 3BO8A 4KQ0A 3OXRA 3QUXA 4Y4HD 1RK0A 2VZTA 5B3JE 1OWWA 3QG7L 1CGXA 1I7ZB 1ZT1A 4XB3A 5D1QB 1J8RA 5CZKA 1JNJA 5ICXB 1VGKA 1SOXA 2I7SA 4YL9A 3DIFB 1MJ8H 4ETQA 3P73B 2ENQA 1FYTA 3FO2B 4F91B 3GM0A 2NUPA 4LSUL 1K4CA 4PG2C 1U3YA 4L8BA 1J5DA 1MI5B 2FB4L 4JM4H 1MHPL 4LSDA 4JPKH 4NO2A 1BWMA 3VFNA 3MHZA 3DROB 1ZGLA 3PNWA 4GAJL 5GRUH 3HMWL 4WEMB 2CA3A 4ZD3H 2JJSC 4XPGL 2XWDA 2Y5QA 3EOBA 3UAJC 5I19H 4BFNA 2DQGH 5D7LD 3KLQA 4P8QA 5LAXA 2FE0A 3HN8A 1J11A 3VGBA 3GKZA 3MOBH 5FYKH 3JTSB 5HVHC 2YHGA 5KAQG 3KVDD 2HCZX 4MCMA 4AG4L 5SWQB 2A1WL 4JW3A 4MNGA 5AVQB 1IAKA 3TYFA 4RFEB 3K1DA 3MLZL 3OAWA 3T0DA 5FOBB 1KCVH 2ZKHL 5B1JC 4YLQT 3EBHA 5CEYB 2QADD 4KGJA 5I76B 3P3UA 4KQ3L 5T1DH 4AK2A 4NO0A 1TQBC 5I16A 4XTRC 3VFPA 1OE1A 2V2XA 2FQFA 4DEPB 1AFVH 2CGRH 1QSZA 2NY4B 4Y5XB 4BRJA 3UROR 1DEDA 4E9XA 5I1IL 2HMID 5DSCA 4CU7A 4PWFA 4JAMB 2N3JA 3ARWA 3ROLB 3C8KB 4MMXB 4JUTA 2J2ZB 1XR8B 5CGTA 2ZOTA 4N68A 1WTLA 1AR2A 1TVDA 4JY5H 1MHHA 3VFSA 3GZOA 3RY4A 4UOQA 1P6FA 2BSTA 1I1AB 3D3VB 4LIQH 3S88H 3C5ZA 1NEZA 4IMLA 2B9BA 4JRYD 3U6XS 5I1LB 3K8KA 4UINL 1CXFA 1G6RA 4H8UA 5DCCA 5I1JL 4PJ7E 4WV1B 1MY5A 1WA1X 1KB5H 1MVFA 4GO9A 3VH8A 4OF5A 3QNZA 3OZ9H 1YMHA 1X4ZA 3MO1B 3ZTNH 3BH9A 1CZ8L 1UKTA 3VXTB 4XODA 5HD8C 4WJG3 1F58H 3MODL 3L1OH 3LN5A 3WD5L 2VOTA 4A1RA 1YUHA 3BVTA 3RQ3A 3VXSA 2R23B 3NH7L 3STLA 3KWTA 4OCWL 1WT5A 4PJXE 3TA3A 3BP4B 3FPXA 3WNLA 1XL6A 4E9QA 4UV4H 2W92A 2IH8A 3CFBB 4JFXB 4IRSA 5CCJA 3MQIA 2OLDA 1T5WB 4JCMA 2ZUUA 3X1BA 1MLCA 3DBSA 3BN9D 5FYLH 3HS0B 1SZNA 1XGTA 1F6AB 1Y6KR 2FTAA 4M03A 5EO1A 3BMWA 4PP2A 1D3CA