5FSNA

Mth1 substrate recognition: complex with a aminomethylpyrimidinyl oxypropanol.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
154
Chain Sequence
b'ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Mth1 Substrate Recognition--an Example of Specific Promiscuity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 40
structure length 154
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5fsnA00
3X0LA 3AC9A 5FSKA 3I7VA 1VRLA 2A8PA 5GHMA 1V8WA 5DEQA 1V8MA 3FSPA 1V8NA 5C7QA 1PPWA 2B06A 2JVBA 2KDVA 1VK6A 3R03A 4KG4A 4JZVA 3X0QA 2DSDA 3EESA 2DUKA 4NFXA 5FSLA 2I8UA 2I6KA 2B2KA 5FSMA 3SMDA 2A8QA 4C9WA 3GWYA 4S2YA 3DUPA 4ICKA 5ANUA 1MK1A 2XSQA 3F6AA 1K26A 1V8YA 3O69A 3FFUA 2YYHA 3GZ6A 1F3YA 1VIUA 4MPOA 3J7Ye 3Q4IA 2QJOA 3BM4A 2YVNA 2CL3A 3X0KA 2R5WA 4DYWA 2FMLA 3F13A 3P6YA 1HX3A 3I7UA 1SZ3A 3O52A 2DHOA 4IJXA 3MDIA 1V8IA 2FVVA 1Q54A 2GB5A 1TUMA 3A6VA 1Q27A 2GT4A 3X0OA 5IW4A 5BS6A 5CFJA 3BAPA 3KVHA 2VNPA 5ANSA 3QSJA 5C8LA 5IW5A 4JZUA 2PNYA 4S2VA 3WHWA 1X83A 2J8QA 5ANWA 1PVFA 2AZWA 1MQEA 1V8VA 3X0MA 4N1TA 2KDWA 3FJYA 1G0SA 3X0IA 1SOIA 3GZ8A 5FSIA 4S2XA 3GG6A 5GHOA 1NQYA 1PUNA 3G0QA 1VHGA 4HVYA 3SHDA 1V8SA 3Q1PA 3RH7A 3FCMA 4KG3A 3X0JA 1V8LA 1Q33A 3X0NA 1PPXA 2O1CA 2G73A 1R67A 3A6UA 4KTBA 3X0RA 1HZTA 3DKUA 1SU2A 2I8TA 2ICJA 4C9XA 3HHJA 1XSBA 2VNQA 4K6EA 5C7TA 1PUSA 5GHPA 1VC8A 3MGMA 4YPRA 3ZR1A 3ACAA 1KHZA 1V8RA 4NFWA 2G74A 3H95A 1RRQA 2W4EA 1KT9A 1JRKA 4S2WA 1XSAA 1MUTA 5GHQA 2ICKA 5ANTA 3X0PA 1X51A 5I8UA 1MP2A 2YVMA 4ZG0A 5DD4A 2YVPA 3MCFA 1PUQA 3ZR0A 3EF5A 3SONA 1NFSA 3Q93A 2DSCA 5DDGA 4KYXA 3N9UA 5CFIA 5GHNA 1K2EA 1PPVA 1VIQA 3O8SA 1NFZA 5GHJA 5GHIA 3E57A 3OGAA 1OW2A 5ANVA 3MDGA 2YVOA 3CNGA 3COUA 1JKNA 3EEUA 3Q2TA 1RYAA 3O6ZA 3FK9A 2A8RA 3N77A 2A8SA 3U53A 1MQWA 4JZSA 3BHOA 3ID9A 4JZTA 4N1UA 5FSNA 2QJTA 2O5FA 3I9XA 2A6TA 1MR2A 5BONA 1QVJA 1V8TA 3P5TA 4YPHA 1RRSA 1SJYA 3A6TA 5DPKA 3Q91A 1IRYA 1GA7A 3X0SA 1U20A 1V8UA 1VCDA 3HYQA 3O61A 2RRKA 3Q2SA 5FSOA 2DSBA 3GRNA 3GZ5A 4ILQA 5ISYA 1NQZA 2GT2A 1X84A 3EXQA 2Q9PA 2A8TA 2PQVA 2QKMB 1I9AA 1VC9A 2B0VA 4V14A 4HFQA 5LPGA 1G9QA 4YOQA 3A6SA 1KTGA 2O5WA 1VHZA 1XSCA 5HZXA 3L85A 2FKBA
chains in the Genus database with same CATH superfamily
3X0LA 3AC9A 5FSKA 3I7VA 1VRLA 2A8PA 5GHMA 1V8WA 5DEQA 1V8MA 3FSPA 2CZRA 1V8NA 5C7QA 1PPWA 2B06A 2JVBA 2KDVA 1VK6A 3R03A 4KG4A 4JZVA 3X0QA 2DSDA 3EESA 2DUKA 4NFXA 5FSLA 2I8UA 2I6KA 2B2KA 5FSMA 3SMDA 2A8QA 4C9WA 3GWYA 4S2YA 3DUPA 4ICKA 5ANUA 1MK1A 2XSQA 3F6AA 1K26A 1V8YA 3O69A 3FFUA 2YYHA 3GZ6A 1F3YA 1VIUA 4MPOA 3J7Ye 3Q4IA 2QJOA 3BM4A 2YVNA 2CL3A 3X0KA 2R5WA 4DYWA 2FMLA 3F13A 3P6YA 1HX3A 3I7UA 1SZ3A 3O52A 2DHOA 4IJXA 3MDIA 1V8IA 2FVVA 1Q54A 2GB5A 1TUMA 3A6VA 1Q27A 2GT4A 3X0OA 5IW4A 5BS6A 5CFJA 3BAPA 3KVHA 2VNPA 5ANSA 3QSJA 5C8LA 5IW5A 4JZUA 2PNYA 4S2VA 3WHWA 1X83A 2J8QA 5ANWA 1PVFA 2AZWA 1MQEA 1V8VA 3X0MA 4N1TA 2KDWA 3FJYA 1G0SA 3X0IA 1SOIA 3GZ8A 5FSIA 4S2XA 3GG6A 5GHOA 1NQYA 1PUNA 3G0QA 1VHGA 4HVYA 3SHDA 1V8SA 3Q1PA 3RH7A 3FCMA 4KG3A 3X0JA 1V8LA 1Q33A 3X0NA 1PPXA 2O1CA 2G73A 1R67A 3A6UA 4KTBA 3X0RA 1HZTA 3DKUA 1SU2A 2I8TA 2ICJA 4C9XA 3HHJA 1XSBA 2VNQA 4K6EA 5C7TA 1PUSA 5GHPA 4J7GA 1VC8A 3MGMA 4YPRA 3ZR1A 3ACAA 1KHZA 1V8RA 4NFWA 2G74A 3H95A 1RRQA 2W4EA 1KT9A 1JRKA 4S2WA 1XSAA 1MUTA 5GHQA 2ICKA 5ANTA 3X0PA 1X51A 5I8UA 1MP2A 2YVMA 4ZG0A 5DD4A 2YVPA 3MCFA 1PUQA 3ZR0A 3EF5A 3SONA 1NFSA 3Q93A 2DSCA 5DDGA 4KYXA 3N9UA 5CFIA 4J7HA 5GHNA 1K2EA 1PPVA 1VIQA 3O8SA 1NFZA 5GHJA 5GHIA 3E57A 3OGAA 1OW2A 5ANVA 3MDGA 2YVOA 3CNGA 3COUA 1JKNA 3EEUA 3Q2TA 1RYAA 3O6ZA 3FK9A 2A8RA 3N77A 2A8SA 3U53A 1MQWA 4JZSA 3BHOA 3ID9A 4JZTA 4N1UA 5FSNA 2QJTA 2O5FA 3I9XA 2A6TA 1MR2A 5BONA 1QVJA 1V8TA 3P5TA 4YPHA 1RRSA 1SJYA 3A6TA 5DPKA 3Q91A 1IRYA 1GA7A 3X0SA 1U20A 1V8UA 1VCDA 3HYQA 3O61A 2RRKA 3Q2SA 5FSOA 2DSBA 3GRNA 3GZ5A 4ILQA 5ISYA 1NQZA 2GT2A 1X84A 3EXQA 2Q9PA 2A8TA 2PQVA 2QKMB 1I9AA 1VC9A 2B0VA 4V14A 4HFQA 5LPGA 1G9QA 4YOQA 3A6SA 1KTGA 2O5WA 1VHZA 1XSCA 5HZXA 3L85A 2FKBA
chains in the Genus database with same CATH topology
3X0LA 3AC9A 5FSKA 3I7VA 1VRLA 2A8PA 5GHMA 1V8WA 5DEQA 1V8MA 3FSPA 2CZRA 1V8NA 5C7QA 1PPWA 2B06A 2JVBA 2KDVA 1VK6A 3R03A 4KG4A 4JZVA 3X0QA 2DSDA 3EESA 2DUKA 4NFXA 5FSLA 2I8UA 2I6KA 2B2KA 5FSMA 3SMDA 2A8QA 4C9WA 3GWYA 4S2YA 3DUPA 4ICKA 5ANUA 1MK1A 2XSQA 3F6AA 1K26A 1V8YA 3O69A 3FFUA 2YYHA 3GZ6A 1F3YA 1VIUA 4MPOA 3J7Ye 3Q4IA 2QJOA 3BM4A 2YVNA 2CL3A 3X0KA 2R5WA 4DYWA 2FMLA 3F13A 3P6YA 1HX3A 3I7UA 1SZ3A 3O52A 2DHOA 4IJXA 3MDIA 1V8IA 2FVVA 1Q54A 2GB5A 1TUMA 3A6VA 1Q27A 2GT4A 3X0OA 5IW4A 5BS6A 5CFJA 3BAPA 3KVHA 2VNPA 5ANSA 3QSJA 5C8LA 5IW5A 4JZUA 2PNYA 4S2VA 3WHWA 1X83A 2J8QA 5ANWA 1PVFA 2AZWA 1MQEA 1V8VA 3X0MA 4N1TA 2KDWA 3FJYA 1G0SA 3X0IA 1SOIA 3GZ8A 5FSIA 4S2XA 3GG6A 5GHOA 1NQYA 1PUNA 3G0QA 1VHGA 4HVYA 3SHDA 1V8SA 3Q1PA 3RH7A 3FCMA 4KG3A 3X0JA 1V8LA 1Q33A 3X0NA 1PPXA 2O1CA 2G73A 1R67A 3A6UA 4KTBA 3X0RA 1HZTA 3DKUA 1SU2A 2I8TA 2ICJA 4C9XA 3HHJA 1XSBA 2VNQA 4K6EA 5C7TA 1PUSA 5GHPA 4J7GA 1VC8A 3MGMA 4YPRA 3ZR1A 3ACAA 1KHZA 1V8RA 4NFWA 2G74A 3H95A 1RRQA 2W4EA 1KT9A 1JRKA 4S2WA 1XSAA 1MUTA 5GHQA 2ICKA 5ANTA 3X0PA 1X51A 5I8UA 1MP2A 2YVMA 4ZG0A 5DD4A 2YVPA 3MCFA 1PUQA 3ZR0A 3EF5A 3SONA 1NFSA 3Q93A 2DSCA 5DDGA 4KYXA 3N9UA 5CFIA 4J7HA 5GHNA 1K2EA 1PPVA 1VIQA 3O8SA 1NFZA 5GHJA 5GHIA 3E57A 3OGAA 1OW2A 5ANVA 3MDGA 2YVOA 3CNGA 3COUA 1JKNA 3EEUA 3Q2TA 1RYAA 3O6ZA 3FK9A 2A8RA 3N77A 2A8SA 3U53A 1MQWA 4JZSA 3BHOA 3ID9A 4JZTA 4N1UA 5FSNA 2QJTA 2O5FA 3I9XA 2A6TA 1MR2A 5BONA 1QVJA 1V8TA 3P5TA 4YPHA 1RRSA 1SJYA 3A6TA 5DPKA 3Q91A 1IRYA 1GA7A 3X0SA 1U20A 1V8UA 1VCDA 3HYQA 3O61A 2RRKA 3Q2SA 5FSOA 2DSBA 3GRNA 3GZ5A 4ILQA 5ISYA 1NQZA 2GT2A 1X84A 3EXQA 2Q9PA 2A8TA 2PQVA 2QKMB 1I9AA 1VC9A 2B0VA 4V14A 4HFQA 5LPGA 1G9QA 4YOQA 3A6SA 1KTGA 2O5WA 1VHZA 1XSCA 5HZXA 3L85A 2FKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0L A;  3AC9 A;  5FSK A;  3I7V A;  1VRL A;  2A8P A;  5GHM A;  1V8W A;  5DEQ A;  1V8M A;  3FSP A;  1V8N A;  5C7Q A;  1PPW A;  2B06 A;  2JVB A;  2KDV A;  1VK6 A;  3R03 A;  4KG4 A;  4JZV A;  3X0Q A;  2DSD A;  3EES A;  2DUK A;  4NFX A;  5FSL A;  2I8U A;  2I6K A;  2B2K A;  5FSM A;  3SMD A;  2A8Q A;  4C9W A;  3GWY A;  4S2Y A;  3DUP A;  4ICK A;  5ANU A;  1MK1 A;  2XSQ A;  3F6A A;  1K26 A;  1V8Y A;  3O69 A;  3FFU A;  2YYH A;  3GZ6 A;  1F3Y A;  1VIU A;  4MPO A;  3J7Y e;  3Q4I A;  2QJO A;  3BM4 A;  2YVN A;  2CL3 A;  3X0K A;  2R5W A;  4DYW A;  2FML A;  3F13 A;  3P6Y A;  1HX3 A;  3I7U A;  1SZ3 A;  3O52 A;  2DHO A;  4IJX A;  3MDI A;  1V8I A;  2FVV A;  1Q54 A;  2GB5 A;  1TUM A;  3A6V A;  1Q27 A;  2GT4 A;  3X0O A;  5IW4 A;  5BS6 A;  5CFJ A;  3BAP A;  3KVH A;  2VNP A;  5ANS A;  3QSJ A;  5C8L A;  5IW5 A;  4JZU A;  2PNY A;  4S2V A;  3WHW A;  1X83 A;  2J8Q A;  5ANW A;  1PVF A;  2AZW A;  1MQE A;  1V8V A;  3X0M A;  4N1T A;  2KDW A;  3FJY A;  1G0S A;  3X0I A;  1SOI A;  3GZ8 A;  5FSI A;  4S2X A;  3GG6 A;  5GHO A;  1NQY A;  1PUN A;  3G0Q A;  1VHG A;  4HVY A;  3SHD A;  1V8S A;  3Q1P A;  3RH7 A;  3FCM A;  4KG3 A;  3X0J A;  1V8L A;  1Q33 A;  3X0N A;  1PPX A;  2O1C A;  2G73 A;  1R67 A;  3A6U A;  4KTB A;  3X0R A;  1HZT A;  3DKU A;  1SU2 A;  2I8T A;  2ICJ A;  4C9X A;  3HHJ A;  1XSB A;  2VNQ A;  4K6E A;  5C7T A;  1PUS A;  5GHP A;  1VC8 A;  3MGM A;  4YPR A;  3ZR1 A;  3ACA A;  1KHZ A;  1V8R A;  4NFW A;  2G74 A;  3H95 A;  1RRQ A;  2W4E A;  1KT9 A;  1JRK A;  4S2W A;  1XSA A;  1MUT A;  5GHQ A;  2ICK A;  5ANT A;  3X0P A;  1X51 A;  5I8U A;  1MP2 A;  2YVM A;  4ZG0 A;  5DD4 A;  2YVP A;  3MCF A;  1PUQ A;  3ZR0 A;  3EF5 A;  3SON A;  1NFS A;  3Q93 A;  2DSC A;  5DDG A;  4KYX A;  3N9U A;  5CFI A;  5GHN A;  1K2E A;  1PPV A;  1VIQ A;  3O8S A;  1NFZ A;  5GHJ A;  5GHI A;  3E57 A;  3OGA A;  1OW2 A;  5ANV A;  3MDG A;  2YVO A;  3CNG A;  3COU A;  1JKN A;  3EEU A;  3Q2T A;  1RYA A;  3O6Z A;  3FK9 A;  2A8R A;  3N77 A;  2A8S A;  3U53 A;  1MQW A;  4JZS A;  3BHO A;  3ID9 A;  4JZT A;  4N1U A;  5FSN A;  2QJT A;  2O5F A;  3I9X A;  2A6T A;  1MR2 A;  5BON A;  1QVJ A;  1V8T A;  3P5T A;  4YPH A;  1RRS A;  1SJY A;  3A6T A;  5DPK A;  3Q91 A;  1IRY A;  1GA7 A;  3X0S A;  1U20 A;  1V8U A;  1VCD A;  3HYQ A;  3O61 A;  2RRK A;  3Q2S A;  5FSO A;  2DSB A;  3GRN A;  3GZ5 A;  4ILQ A;  5ISY A;  1NQZ A;  2GT2 A;  1X84 A;  3EXQ A;  2Q9P A;  2A8T A;  2PQV A;  2QKM B;  1I9A A;  1VC9 A;  2B0V A;  4V14 A;  4HFQ A;  5LPG A;  1G9Q A;  4YOQ A;  3A6S A;  1KTG A;  2O5W A;  1VHZ A;  1XSC A;  5HZX A;  3L85 A;  2FKB A; 
#chains in the Genus database with same CATH topology
 3X0L A;  3AC9 A;  5FSK A;  3I7V A;  1VRL A;  2A8P A;  5GHM A;  1V8W A;  5DEQ A;  1V8M A;  3FSP A;  2CZR A;  1V8N A;  5C7Q A;  1PPW A;  2B06 A;  2JVB A;  2KDV A;  1VK6 A;  3R03 A;  4KG4 A;  4JZV A;  3X0Q A;  2DSD A;  3EES A;  2DUK A;  4NFX A;  5FSL A;  2I8U A;  2I6K A;  2B2K A;  5FSM A;  3SMD A;  2A8Q A;  4C9W A;  3GWY A;  4S2Y A;  3DUP A;  4ICK A;  5ANU A;  1MK1 A;  2XSQ A;  3F6A A;  1K26 A;  1V8Y A;  3O69 A;  3FFU A;  2YYH A;  3GZ6 A;  1F3Y A;  1VIU A;  4MPO A;  3J7Y e;  3Q4I A;  2QJO A;  3BM4 A;  2YVN A;  2CL3 A;  3X0K A;  2R5W A;  4DYW A;  2FML A;  3F13 A;  3P6Y A;  1HX3 A;  3I7U A;  1SZ3 A;  3O52 A;  2DHO A;  4IJX A;  3MDI A;  1V8I A;  2FVV A;  1Q54 A;  2GB5 A;  1TUM A;  3A6V A;  1Q27 A;  2GT4 A;  3X0O A;  5IW4 A;  5BS6 A;  5CFJ A;  3BAP A;  3KVH A;  2VNP A;  5ANS A;  3QSJ A;  5C8L A;  5IW5 A;  4JZU A;  2PNY A;  4S2V A;  3WHW A;  1X83 A;  2J8Q A;  5ANW A;  1PVF A;  2AZW A;  1MQE A;  1V8V A;  3X0M A;  4N1T A;  2KDW A;  3FJY A;  1G0S A;  3X0I A;  1SOI A;  3GZ8 A;  5FSI A;  4S2X A;  3GG6 A;  5GHO A;  1NQY A;  1PUN A;  3G0Q A;  1VHG A;  4HVY A;  3SHD A;  1V8S A;  3Q1P A;  3RH7 A;  3FCM A;  4KG3 A;  3X0J A;  1V8L A;  1Q33 A;  3X0N A;  1PPX A;  2O1C A;  2G73 A;  1R67 A;  3A6U A;  4KTB A;  3X0R A;  1HZT A;  3DKU A;  1SU2 A;  2I8T A;  2ICJ A;  4C9X A;  3HHJ A;  1XSB A;  2VNQ A;  4K6E A;  5C7T A;  1PUS A;  5GHP A;  4J7G A;  1VC8 A;  3MGM A;  4YPR A;  3ZR1 A;  3ACA A;  1KHZ A;  1V8R A;  4NFW A;  2G74 A;  3H95 A;  1RRQ A;  2W4E A;  1KT9 A;  1JRK A;  4S2W A;  1XSA A;  1MUT A;  5GHQ A;  2ICK A;  5ANT A;  3X0P A;  1X51 A;  5I8U A;  1MP2 A;  2YVM A;  4ZG0 A;  5DD4 A;  2YVP A;  3MCF A;  1PUQ A;  3ZR0 A;  3EF5 A;  3SON A;  1NFS A;  3Q93 A;  2DSC A;  5DDG A;  4KYX A;  3N9U A;  5CFI A;  4J7H A;  5GHN A;  1K2E A;  1PPV A;  1VIQ A;  3O8S A;  1NFZ A;  5GHJ A;  5GHI A;  3E57 A;  3OGA A;  1OW2 A;  5ANV A;  3MDG A;  2YVO A;  3CNG A;  3COU A;  1JKN A;  3EEU A;  3Q2T A;  1RYA A;  3O6Z A;  3FK9 A;  2A8R A;  3N77 A;  2A8S A;  3U53 A;  1MQW A;  4JZS A;  3BHO A;  3ID9 A;  4JZT A;  4N1U A;  5FSN A;  2QJT A;  2O5F A;  3I9X A;  2A6T A;  1MR2 A;  5BON A;  1QVJ A;  1V8T A;  3P5T A;  4YPH A;  1RRS A;  1SJY A;  3A6T A;  5DPK A;  3Q91 A;  1IRY A;  1GA7 A;  3X0S A;  1U20 A;  1V8U A;  1VCD A;  3HYQ A;  3O61 A;  2RRK A;  3Q2S A;  5FSO A;  2DSB A;  3GRN A;  3GZ5 A;  4ILQ A;  5ISY A;  1NQZ A;  2GT2 A;  1X84 A;  3EXQ A;  2Q9P A;  2A8T A;  2PQV A;  2QKM B;  1I9A A;  1VC9 A;  2B0V A;  4V14 A;  4HFQ A;  5LPG A;  1G9Q A;  4YOQ A;  3A6S A;  1KTG A;  2O5W A;  1VHZ A;  1XSC A;  5HZX A;  3L85 A;  2FKB A; 
#chains in the Genus database with same CATH homology
 3X0L A;  3AC9 A;  5FSK A;  3I7V A;  1VRL A;  2A8P A;  5GHM A;  1V8W A;  5DEQ A;  1V8M A;  3FSP A;  2CZR A;  1V8N A;  5C7Q A;  1PPW A;  2B06 A;  2JVB A;  2KDV A;  1VK6 A;  3R03 A;  4KG4 A;  4JZV A;  3X0Q A;  2DSD A;  3EES A;  2DUK A;  4NFX A;  5FSL A;  2I8U A;  2I6K A;  2B2K A;  5FSM A;  3SMD A;  2A8Q A;  4C9W A;  3GWY A;  4S2Y A;  3DUP A;  4ICK A;  5ANU A;  1MK1 A;  2XSQ A;  3F6A A;  1K26 A;  1V8Y A;  3O69 A;  3FFU A;  2YYH A;  3GZ6 A;  1F3Y A;  1VIU A;  4MPO A;  3J7Y e;  3Q4I A;  2QJO A;  3BM4 A;  2YVN A;  2CL3 A;  3X0K A;  2R5W A;  4DYW A;  2FML A;  3F13 A;  3P6Y A;  1HX3 A;  3I7U A;  1SZ3 A;  3O52 A;  2DHO A;  4IJX A;  3MDI A;  1V8I A;  2FVV A;  1Q54 A;  2GB5 A;  1TUM A;  3A6V A;  1Q27 A;  2GT4 A;  3X0O A;  5IW4 A;  5BS6 A;  5CFJ A;  3BAP A;  3KVH A;  2VNP A;  5ANS A;  3QSJ A;  5C8L A;  5IW5 A;  4JZU A;  2PNY A;  4S2V A;  3WHW A;  1X83 A;  2J8Q A;  5ANW A;  1PVF A;  2AZW A;  1MQE A;  1V8V A;  3X0M A;  4N1T A;  2KDW A;  3FJY A;  1G0S A;  3X0I A;  1SOI A;  3GZ8 A;  5FSI A;  4S2X A;  3GG6 A;  5GHO A;  1NQY A;  1PUN A;  3G0Q A;  1VHG A;  4HVY A;  3SHD A;  1V8S A;  3Q1P A;  3RH7 A;  3FCM A;  4KG3 A;  3X0J A;  1V8L A;  1Q33 A;  3X0N A;  1PPX A;  2O1C A;  2G73 A;  1R67 A;  3A6U A;  4KTB A;  3X0R A;  1HZT A;  3DKU A;  1SU2 A;  2I8T A;  2ICJ A;  4C9X A;  3HHJ A;  1XSB A;  2VNQ A;  4K6E A;  5C7T A;  1PUS A;  5GHP A;  4J7G A;  1VC8 A;  3MGM A;  4YPR A;  3ZR1 A;  3ACA A;  1KHZ A;  1V8R A;  4NFW A;  2G74 A;  3H95 A;  1RRQ A;  2W4E A;  1KT9 A;  1JRK A;  4S2W A;  1XSA A;  1MUT A;  5GHQ A;  2ICK A;  5ANT A;  3X0P A;  1X51 A;  5I8U A;  1MP2 A;  2YVM A;  4ZG0 A;  5DD4 A;  2YVP A;  3MCF A;  1PUQ A;  3ZR0 A;  3EF5 A;  3SON A;  1NFS A;  3Q93 A;  2DSC A;  5DDG A;  4KYX A;  3N9U A;  5CFI A;  4J7H A;  5GHN A;  1K2E A;  1PPV A;  1VIQ A;  3O8S A;  1NFZ A;  5GHJ A;  5GHI A;  3E57 A;  3OGA A;  1OW2 A;  5ANV A;  3MDG A;  2YVO A;  3CNG A;  3COU A;  1JKN A;  3EEU A;  3Q2T A;  1RYA A;  3O6Z A;  3FK9 A;  2A8R A;  3N77 A;  2A8S A;  3U53 A;  1MQW A;  4JZS A;  3BHO A;  3ID9 A;  4JZT A;  4N1U A;  5FSN A;  2QJT A;  2O5F A;  3I9X A;  2A6T A;  1MR2 A;  5BON A;  1QVJ A;  1V8T A;  3P5T A;  4YPH A;  1RRS A;  1SJY A;  3A6T A;  5DPK A;  3Q91 A;  1IRY A;  1GA7 A;  3X0S A;  1U20 A;  1V8U A;  1VCD A;  3HYQ A;  3O61 A;  2RRK A;  3Q2S A;  5FSO A;  2DSB A;  3GRN A;  3GZ5 A;  4ILQ A;  5ISY A;  1NQZ A;  2GT2 A;  1X84 A;  3EXQ A;  2Q9P A;  2A8T A;  2PQV A;  2QKM B;  1I9A A;  1VC9 A;  2B0V A;  4V14 A;  4HFQ A;  5LPG A;  1G9Q A;  4YOQ A;  3A6S A;  1KTG A;  2O5W A;  1VHZ A;  1XSC A;  5HZX A;  3L85 A;  2FKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...