5FSVA

Crystal structure of trypanosoma brucei macrodomain (crystal form 2)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
232
Chain Sequence
EFVTYSGEESPTRTRILSAALSPAERAIFDVPIEKWLSIDRSSLSGWKCAVPRPVTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLLLRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGERPDMLRKCYRSILSLALKNGLRSIGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
molecule keywords MACRODOMAIN
total genus 86
structure length 232
sequence length 249
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fsvA00
1TXZA 3PEIA 4J5RA 1LCPA 3H8FA 3V2BA 3IJ3A 4ZYQA 5E3BA 5HOLA 4ZY2A 2ACFA 5CBMA 3Q6ZA 3SIGA 2L8RA 1VHUA 4TU0A 3EWRA 5AILA 4GVWA 4GUAA 1NJRA 4KSIA 2LGRA 4ZY1A 2J9AA 3KZWA 3GPQA 5HIHA 2FXKA 4R6TA 3Q71A 1GYTA 5FSUA 3SIHA 2FG1A 4R76A 4J5QA 1BPMA 1LAMA 4GVVA 4R7MA 1LAPA 4ZY0A 2X47A 3KR4A 4IQYA 1SPVA 3KQZA 3V45A 2AFCA 5D8NA 3SIIA 3GPGA 3EJFA 4J5SA 2EWBA 4ESSA 5CMSA 1HJZA 2XD7A 5FSVA 5FSZA 4JLLA 5FSYA 2VRIA 3SIJA 4ZX9A 3IIFA 1ZR3A 1LANA 3EJGA 3JRUA 4ETJA 2BFRA 1BPNA 3IIDA 1ZR5A 2DX6A 1BLLE 3GQOA 3GQEA 3EWPA 4JGKA 3VFQA 3EW5A 3GPOA 4ABLA 4KYBA 3T8WA 2FAVA 3EKEA 5CB3A 2BFQA 4ETKA 5DUSA 3KR5A 3EWQA 4J4ZA 4UMLA 4ZX8A 3KQXA 4K3NA 1TY8A 1YD9A 3JZTA 5FSXA 4JVVA 3H8GA 4X2TA 5CB5A 2EEEA 3EWOA 4ZI6A 4ABKA 3ETIA 3H8EA 4JCAA 4K0CA 4D86A
chains in the Genus database with same CATH superfamily
1TXZA 3PEIA 4J5RA 1LCPA 3H8FA 3V2BA 3IJ3A 4ZYQA 2KQVA 5E3BA 5HOLA 4ZY2A 2ACFA 5CBMA 3Q6ZA 3SIGA 2L8RA 1VHUA 4TU0A 3EWRA 5AILA 2JZDA 4GVWA 4GUAA 1NJRA 4KSIA 2LGRA 2JZEA 4ZY1A 2J9AA 3KZWA 3GPQA 5HIHA 2FXKA 4R6TA 2W2GA 3Q71A 1GYTA 5FSUA 3SIHA 2FG1A 2JZFA 4J5QA 4R76A 1BPMA 1LAMA 4GVVA 4R7MA 1LAPA 4ZY0A 2X47A 3KR4A 4IQYA 1SPVA 3KQZA 3V45A 2AFCA 5D8NA 3SIIA 3GPGA 3EJFA 4J5SA 2EWBA 4ESSA 5CMSA 1HJZA 2XD7A 5FSVA 5FSZA 2RNKA 4JLLA 5FSYA 2VRIA 3SIJA 4ZX9A 3IIFA 1ZR3A 1LANA 3EJGA 3JRUA 4ETJA 2BFRA 1BPNA 3IIDA 1ZR5A 2DX6A 1BLLE 3GQOA 3GQEA 3EWPA 4JGKA 3VFQA 3EW5A 3GPOA 4ABLA 4KYBA 3T8WA 2FAVA 3EKEA 5CB3A 2WCTA 2BFQA 4ETKA 5DUSA 3KR5A 3EWQA 4J4ZA 4UMLA 4ZX8A 4K3NA 3KQXA 1TY8A 1YD9A 3JZTA 5FSXA 4JVVA 3H8GA 4X2TA 5CB5A 2EEEA 3EWOA 4ZI6A 4ABKA 3ETIA 3H8EA 4JCAA 4K0CA 4D86A
chains in the Genus database with same CATH topology
1TXZA 3PEIA 4J5RA 1LCPA 3H8FA 3V2BA 3IJ3A 4ZYQA 5E3BA 5HOLA 4ZY2A 2ACFA 5CBMA 3Q6ZA 3SIGA 2L8RA 1VHUA 4TU0A 3EWRA 5AILA 4GVWA 4GUAA 1NJRA 4KSIA 2LGRA 4ZY1A 2J9AA 3KZWA 3GPQA 5HIHA 2FXKA 4R6TA 3Q71A 1GYTA 5FSUA 3SIHA 2FG1A 4R76A 4J5QA 1BPMA 1LAMA 4GVVA 4R7MA 1LAPA 4ZY0A 2X47A 3KR4A 4IQYA 1SPVA 3KQZA 3V45A 2AFCA 5D8NA 3SIIA 3GPGA 3EJFA 4J5SA 2EWBA 4ESSA 5CMSA 1HJZA 2XD7A 5FSVA 5FSZA 4JLLA 5FSYA 2VRIA 3SIJA 4ZX9A 3IIFA 1ZR3A 1LANA 3EJGA 3JRUA 4ETJA 2BFRA 1BPNA 3IIDA 1ZR5A 2DX6A 1BLLE 3GQOA 3GQEA 3EWPA 4JGKA 3VFQA 3EW5A 3GPOA 4ABLA 4KYBA 3T8WA 2FAVA 3EKEA 5CB3A 2BFQA 4ETKA 5DUSA 3KR5A 3EWQA 4J4ZA 4UMLA 4ZX8A 3KQXA 4K3NA 1TY8A 1YD9A 3JZTA 5FSXA 4JVVA 3H8GA 4X2TA 5CB5A 2EEEA 3EWOA 4ZI6A 4ABKA 3ETIA 3H8EA 4JCAA 4K0CA 4D86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXZ A;  3PEI A;  4J5R A;  1LCP A;  3H8F A;  3V2B A;  3IJ3 A;  4ZYQ A;  5E3B A;  5HOL A;  4ZY2 A;  2ACF A;  5CBM A;  3Q6Z A;  3SIG A;  2L8R A;  1VHU A;  4TU0 A;  3EWR A;  5AIL A;  4GVW A;  4GUA A;  1NJR A;  4KSI A;  2LGR A;  4ZY1 A;  2J9A A;  3KZW A;  3GPQ A;  5HIH A;  2FXK A;  4R6T A;  3Q71 A;  1GYT A;  5FSU A;  3SIH A;  2FG1 A;  4R76 A;  4J5Q A;  1BPM A;  1LAM A;  4GVV A;  4R7M A;  1LAP A;  4ZY0 A;  2X47 A;  3KR4 A;  4IQY A;  1SPV A;  3KQZ A;  3V45 A;  2AFC A;  5D8N A;  3SII A;  3GPG A;  3EJF A;  4J5S A;  2EWB A;  4ESS A;  5CMS A;  1HJZ A;  2XD7 A;  5FSV A;  5FSZ A;  4JLL A;  5FSY A;  2VRI A;  3SIJ A;  4ZX9 A;  3IIF A;  1ZR3 A;  1LAN A;  3EJG A;  3JRU A;  4ETJ A;  2BFR A;  1BPN A;  3IID A;  1ZR5 A;  2DX6 A;  1BLL E;  3GQO A;  3GQE A;  3EWP A;  4JGK A;  3VFQ A;  3EW5 A;  3GPO A;  4ABL A;  4KYB A;  3T8W A;  2FAV A;  3EKE A;  5CB3 A;  2BFQ A;  4ETK A;  5DUS A;  3KR5 A;  3EWQ A;  4J4Z A;  4UML A;  4ZX8 A;  3KQX A;  4K3N A;  1TY8 A;  1YD9 A;  3JZT A;  5FSX A;  4JVV A;  3H8G A;  4X2T A;  5CB5 A;  2EEE A;  3EWO A;  4ZI6 A;  4ABK A;  3ETI A;  3H8E A;  4JCA A;  4K0C A;  4D86 A; 
#chains in the Genus database with same CATH topology
 1TXZ A;  3PEI A;  4J5R A;  1LCP A;  3H8F A;  3V2B A;  3IJ3 A;  4ZYQ A;  2KQV A;  5E3B A;  5HOL A;  4ZY2 A;  2ACF A;  5CBM A;  3Q6Z A;  3SIG A;  2L8R A;  1VHU A;  4TU0 A;  3EWR A;  5AIL A;  2JZD A;  4GVW A;  4GUA A;  1NJR A;  4KSI A;  2LGR A;  2JZE A;  4ZY1 A;  2J9A A;  3KZW A;  3GPQ A;  5HIH A;  2FXK A;  4R6T A;  2W2G A;  3Q71 A;  1GYT A;  5FSU A;  3SIH A;  2FG1 A;  2JZF A;  4J5Q A;  4R76 A;  1BPM A;  1LAM A;  4GVV A;  4R7M A;  1LAP A;  4ZY0 A;  2X47 A;  3KR4 A;  4IQY A;  1SPV A;  3KQZ A;  3V45 A;  2AFC A;  5D8N A;  3SII A;  3GPG A;  3EJF A;  4J5S A;  2EWB A;  4ESS A;  5CMS A;  1HJZ A;  2XD7 A;  5FSV A;  5FSZ A;  2RNK A;  4JLL A;  5FSY A;  2VRI A;  3SIJ A;  4ZX9 A;  3IIF A;  1ZR3 A;  1LAN A;  3EJG A;  3JRU A;  4ETJ A;  2BFR A;  1BPN A;  3IID A;  1ZR5 A;  2DX6 A;  1BLL E;  3GQO A;  3GQE A;  3EWP A;  4JGK A;  3VFQ A;  3EW5 A;  3GPO A;  4ABL A;  4KYB A;  3T8W A;  2FAV A;  3EKE A;  5CB3 A;  2WCT A;  2BFQ A;  4ETK A;  5DUS A;  3KR5 A;  3EWQ A;  4J4Z A;  4UML A;  4ZX8 A;  4K3N A;  3KQX A;  1TY8 A;  1YD9 A;  3JZT A;  5FSX A;  4JVV A;  3H8G A;  4X2T A;  5CB5 A;  2EEE A;  3EWO A;  4ZI6 A;  4ABK A;  3ETI A;  3H8E A;  4JCA A;  4K0C A;  4D86 A; 
#chains in the Genus database with same CATH homology
 1TXZ A;  3PEI A;  4J5R A;  1LCP A;  3H8F A;  3V2B A;  3IJ3 A;  4ZYQ A;  5E3B A;  5HOL A;  4ZY2 A;  2ACF A;  5CBM A;  3Q6Z A;  3SIG A;  2L8R A;  1VHU A;  4TU0 A;  3EWR A;  5AIL A;  4GVW A;  4GUA A;  1NJR A;  4KSI A;  2LGR A;  4ZY1 A;  2J9A A;  3KZW A;  3GPQ A;  5HIH A;  2FXK A;  4R6T A;  3Q71 A;  1GYT A;  5FSU A;  3SIH A;  2FG1 A;  4R76 A;  4J5Q A;  1BPM A;  1LAM A;  4GVV A;  4R7M A;  1LAP A;  4ZY0 A;  2X47 A;  3KR4 A;  4IQY A;  1SPV A;  3KQZ A;  3V45 A;  2AFC A;  5D8N A;  3SII A;  3GPG A;  3EJF A;  4J5S A;  2EWB A;  4ESS A;  5CMS A;  1HJZ A;  2XD7 A;  5FSV A;  5FSZ A;  4JLL A;  5FSY A;  2VRI A;  3SIJ A;  4ZX9 A;  3IIF A;  1ZR3 A;  1LAN A;  3EJG A;  3JRU A;  4ETJ A;  2BFR A;  1BPN A;  3IID A;  1ZR5 A;  2DX6 A;  1BLL E;  3GQO A;  3GQE A;  3EWP A;  4JGK A;  3VFQ A;  3EW5 A;  3GPO A;  4ABL A;  4KYB A;  3T8W A;  2FAV A;  3EKE A;  5CB3 A;  2BFQ A;  4ETK A;  5DUS A;  3KR5 A;  3EWQ A;  4J4Z A;  4UML A;  4ZX8 A;  3KQX A;  4K3N A;  1TY8 A;  1YD9 A;  3JZT A;  5FSX A;  4JVV A;  3H8G A;  4X2T A;  5CB5 A;  2EEE A;  3EWO A;  4ZI6 A;  4ABK A;  3ETI A;  3H8E A;  4JCA A;  4K0C A;  4D86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...