5FSZA

Crystal structure of trypanosoma cruzi macrodomain
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
245
structure length
245
Chain Sequence
FVTYSTSEPAKLFGEAGRRSHFRARVLEATLSPLEKAIFDVPIEEWLTVDRSKFSGWRCAVPHPVTADELKPVDSSHDILRHIALYNGPVTDLQLDAIVNAANKTCLGGKGVDGAIHAAAGPLLVRECATFKGCDTGQCRLTKGYNLPARYVLHTVGPIGERPEELRSCYRSILSLAHRNRLRSIGFCCVSTGVYGYPLIPATRIAVDETIEYLKQHFSAFDLCCFACFKLEEYNAYTDCLRAWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords MACRODOMAIN
total genus 81
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fszA00
4GVVA 3IIDA 2ACFA 3EKEA 3T8WA 3EWRA 3H8GA 5CB3A 3VFQA 4JCAA 5D8NA 3PEIA 3EWQA 3IIFA 3EW5A 3GQEA 4J5QA 4ZYQA 5FSUA 4GVWA 4R6TA 4JVVA 4J4ZA 4ABKA 1TY8A 4JLLA 3V45A 4ESSA 3SIJA 2J9AA 3EJFA 3H8EA 4ZX8A 2LGRA 4IQYA 4GUAA 5FSZA 5FSVA 3V2BA 4J5SA 4D86A 5CB5A 3GPOA 4R76A 5E3BA 4TU0A 4KSIA 1TXZA 4J5RA 4ZY0A 3GPQA 1BPMA 5AILA 1LCPA 2FG1A 4KYBA 3SIHA 3SIIA 1YD9A 5FSXA 4ZY1A 1ZR3A 4ZX9A 3KQZA 3KR4A 1LAMA 5CBMA 1NJRA 1SPVA 4ETJA 3JZTA 2AFCA 4K0CA 2FXKA 3H8FA 1VHUA 3GQOA 4ETKA 2FAVA 3Q6ZA 3KQXA 2L8RA 2XD7A 3GPGA 5DUSA 2EEEA 2BFRA 4R7MA 4ZY2A 1LANA 3SIGA 5HIHA 4X2TA 4K3NA 1HJZA 2EWBA 5CMSA 4ABLA 3EWOA 3ETIA 3JRUA 3EWPA 1BLLE 2VRIA 5HOLA 1LAPA 2BFQA 3Q71A 3KZWA 4JGKA 3IJ3A 5FSYA 1ZR5A 2DX6A 1GYTA 3KR5A 3EJGA 1BPNA 4UMLA 4ZI6A 2X47A
chains in the Genus database with same CATH superfamily
4GVVA 3IIDA 2ACFA 3EKEA 3T8WA 3EWRA 3H8GA 5CB3A 3VFQA 4JCAA 5D8NA 3PEIA 3EWQA 3IIFA 3EW5A 3GQEA 4J5QA 4ZYQA 5FSUA 4GVWA 4R6TA 2JZEA 4JVVA 4J4ZA 4ABKA 1TY8A 2JZFA 4JLLA 3V45A 4ESSA 3SIJA 2J9AA 3EJFA 3H8EA 4ZX8A 2LGRA 4IQYA 4GUAA 5FSZA 5FSVA 3V2BA 4J5SA 4D86A 2W2GA 5CB5A 2JZDA 3GPOA 4R76A 5E3BA 4TU0A 4KSIA 1TXZA 4J5RA 4ZY0A 3GPQA 1BPMA 5AILA 2KQVA 1LCPA 2FG1A 4KYBA 3SIHA 3SIIA 1YD9A 5FSXA 4ZY1A 1ZR3A 4ZX9A 3KQZA 3KR4A 1LAMA 5CBMA 1NJRA 1SPVA 4ETJA 3JZTA 2AFCA 4K0CA 2FXKA 3H8FA 1VHUA 3GQOA 4ETKA 2FAVA 3Q6ZA 3KQXA 2L8RA 2XD7A 3GPGA 5DUSA 2EEEA 2BFRA 4R7MA 4ZY2A 1LANA 3SIGA 5HIHA 4X2TA 4K3NA 1HJZA 2EWBA 5CMSA 4ABLA 3EWOA 3ETIA 2RNKA 3JRUA 2WCTA 3EWPA 1BLLE 2VRIA 5HOLA 1LAPA 2BFQA 3Q71A 3KZWA 4JGKA 3IJ3A 5FSYA 1ZR5A 2DX6A 1GYTA 3KR5A 3EJGA 1BPNA 4UMLA 4ZI6A 2X47A
chains in the Genus database with same CATH topology
4GVVA 3IIDA 2ACFA 3EKEA 3T8WA 3EWRA 3H8GA 5CB3A 3VFQA 4JCAA 5D8NA 3PEIA 3EWQA 3IIFA 3EW5A 3GQEA 4J5QA 4ZYQA 5FSUA 4GVWA 4R6TA 4JVVA 4J4ZA 4ABKA 1TY8A 4JLLA 3V45A 4ESSA 3SIJA 2J9AA 3EJFA 3H8EA 4ZX8A 2LGRA 4IQYA 4GUAA 5FSZA 5FSVA 3V2BA 4J5SA 4D86A 5CB5A 3GPOA 4R76A 5E3BA 4TU0A 4KSIA 1TXZA 4J5RA 4ZY0A 3GPQA 1BPMA 5AILA 1LCPA 2FG1A 4KYBA 3SIHA 3SIIA 1YD9A 5FSXA 4ZY1A 1ZR3A 4ZX9A 3KQZA 3KR4A 1LAMA 5CBMA 1NJRA 1SPVA 4ETJA 3JZTA 2AFCA 4K0CA 2FXKA 3H8FA 1VHUA 3GQOA 4ETKA 2FAVA 3Q6ZA 3KQXA 2L8RA 2XD7A 3GPGA 5DUSA 2EEEA 2BFRA 4R7MA 4ZY2A 1LANA 3SIGA 5HIHA 4X2TA 4K3NA 1HJZA 2EWBA 5CMSA 4ABLA 3EWOA 3ETIA 3JRUA 3EWPA 1BLLE 2VRIA 5HOLA 1LAPA 2BFQA 3Q71A 3KZWA 4JGKA 3IJ3A 5FSYA 1ZR5A 2DX6A 1GYTA 3KR5A 3EJGA 1BPNA 4UMLA 4ZI6A 2X47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVV A;  3IID A;  2ACF A;  3EKE A;  3T8W A;  3EWR A;  3H8G A;  5CB3 A;  3VFQ A;  4JCA A;  5D8N A;  3PEI A;  3EWQ A;  3IIF A;  3EW5 A;  3GQE A;  4J5Q A;  4ZYQ A;  5FSU A;  4GVW A;  4R6T A;  4JVV A;  4J4Z A;  4ABK A;  1TY8 A;  4JLL A;  3V45 A;  4ESS A;  3SIJ A;  2J9A A;  3EJF A;  3H8E A;  4ZX8 A;  2LGR A;  4IQY A;  4GUA A;  5FSZ A;  5FSV A;  3V2B A;  4J5S A;  4D86 A;  5CB5 A;  3GPO A;  4R76 A;  5E3B A;  4TU0 A;  4KSI A;  1TXZ A;  4J5R A;  4ZY0 A;  3GPQ A;  1BPM A;  5AIL A;  1LCP A;  2FG1 A;  4KYB A;  3SIH A;  3SII A;  1YD9 A;  5FSX A;  4ZY1 A;  1ZR3 A;  4ZX9 A;  3KQZ A;  3KR4 A;  1LAM A;  5CBM A;  1NJR A;  1SPV A;  4ETJ A;  3JZT A;  2AFC A;  4K0C A;  2FXK A;  3H8F A;  1VHU A;  3GQO A;  4ETK A;  2FAV A;  3Q6Z A;  3KQX A;  2L8R A;  2XD7 A;  3GPG A;  5DUS A;  2EEE A;  2BFR A;  4R7M A;  4ZY2 A;  1LAN A;  3SIG A;  5HIH A;  4X2T A;  4K3N A;  1HJZ A;  2EWB A;  5CMS A;  4ABL A;  3EWO A;  3ETI A;  3JRU A;  3EWP A;  1BLL E;  2VRI A;  5HOL A;  1LAP A;  2BFQ A;  3Q71 A;  3KZW A;  4JGK A;  3IJ3 A;  5FSY A;  1ZR5 A;  2DX6 A;  1GYT A;  3KR5 A;  3EJG A;  1BPN A;  4UML A;  4ZI6 A;  2X47 A; 
#chains in the Genus database with same CATH topology
 4GVV A;  3IID A;  2ACF A;  3EKE A;  3T8W A;  3EWR A;  3H8G A;  5CB3 A;  3VFQ A;  4JCA A;  5D8N A;  3PEI A;  3EWQ A;  3IIF A;  3EW5 A;  3GQE A;  4J5Q A;  4ZYQ A;  5FSU A;  4GVW A;  4R6T A;  2JZE A;  4JVV A;  4J4Z A;  4ABK A;  1TY8 A;  2JZF A;  4JLL A;  3V45 A;  4ESS A;  3SIJ A;  2J9A A;  3EJF A;  3H8E A;  4ZX8 A;  2LGR A;  4IQY A;  4GUA A;  5FSZ A;  5FSV A;  3V2B A;  4J5S A;  4D86 A;  2W2G A;  5CB5 A;  2JZD A;  3GPO A;  4R76 A;  5E3B A;  4TU0 A;  4KSI A;  1TXZ A;  4J5R A;  4ZY0 A;  3GPQ A;  1BPM A;  5AIL A;  2KQV A;  1LCP A;  2FG1 A;  4KYB A;  3SIH A;  3SII A;  1YD9 A;  5FSX A;  4ZY1 A;  1ZR3 A;  4ZX9 A;  3KQZ A;  3KR4 A;  1LAM A;  5CBM A;  1NJR A;  1SPV A;  4ETJ A;  3JZT A;  2AFC A;  4K0C A;  2FXK A;  3H8F A;  1VHU A;  3GQO A;  4ETK A;  2FAV A;  3Q6Z A;  3KQX A;  2L8R A;  2XD7 A;  3GPG A;  5DUS A;  2EEE A;  2BFR A;  4R7M A;  4ZY2 A;  1LAN A;  3SIG A;  5HIH A;  4X2T A;  4K3N A;  1HJZ A;  2EWB A;  5CMS A;  4ABL A;  3EWO A;  3ETI A;  2RNK A;  3JRU A;  2WCT A;  3EWP A;  1BLL E;  2VRI A;  5HOL A;  1LAP A;  2BFQ A;  3Q71 A;  3KZW A;  4JGK A;  3IJ3 A;  5FSY A;  1ZR5 A;  2DX6 A;  1GYT A;  3KR5 A;  3EJG A;  1BPN A;  4UML A;  4ZI6 A;  2X47 A; 
#chains in the Genus database with same CATH homology
 4GVV A;  3IID A;  2ACF A;  3EKE A;  3T8W A;  3EWR A;  3H8G A;  5CB3 A;  3VFQ A;  4JCA A;  5D8N A;  3PEI A;  3EWQ A;  3IIF A;  3EW5 A;  3GQE A;  4J5Q A;  4ZYQ A;  5FSU A;  4GVW A;  4R6T A;  4JVV A;  4J4Z A;  4ABK A;  1TY8 A;  4JLL A;  3V45 A;  4ESS A;  3SIJ A;  2J9A A;  3EJF A;  3H8E A;  4ZX8 A;  2LGR A;  4IQY A;  4GUA A;  5FSZ A;  5FSV A;  3V2B A;  4J5S A;  4D86 A;  5CB5 A;  3GPO A;  4R76 A;  5E3B A;  4TU0 A;  4KSI A;  1TXZ A;  4J5R A;  4ZY0 A;  3GPQ A;  1BPM A;  5AIL A;  1LCP A;  2FG1 A;  4KYB A;  3SIH A;  3SII A;  1YD9 A;  5FSX A;  4ZY1 A;  1ZR3 A;  4ZX9 A;  3KQZ A;  3KR4 A;  1LAM A;  5CBM A;  1NJR A;  1SPV A;  4ETJ A;  3JZT A;  2AFC A;  4K0C A;  2FXK A;  3H8F A;  1VHU A;  3GQO A;  4ETK A;  2FAV A;  3Q6Z A;  3KQX A;  2L8R A;  2XD7 A;  3GPG A;  5DUS A;  2EEE A;  2BFR A;  4R7M A;  4ZY2 A;  1LAN A;  3SIG A;  5HIH A;  4X2T A;  4K3N A;  1HJZ A;  2EWB A;  5CMS A;  4ABL A;  3EWO A;  3ETI A;  3JRU A;  3EWP A;  1BLL E;  2VRI A;  5HOL A;  1LAP A;  2BFQ A;  3Q71 A;  3KZW A;  4JGK A;  3IJ3 A;  5FSY A;  1ZR5 A;  2DX6 A;  1GYT A;  3KR5 A;  3EJG A;  1BPN A;  4UML A;  4ZI6 A;  2X47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...