5FSZA

Crystal structure of trypanosoma cruzi macrodomain
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
245
structure length
245
Chain Sequence
FVTYSTSEPAKLFGEAGRRSHFRARVLEATLSPLEKAIFDVPIEEWLTVDRSKFSGWRCAVPHPVTADELKPVDSSHDILRHIALYNGPVTDLQLDAIVNAANKTCLGGKGVDGAIHAAAGPLLVRECATFKGCDTGQCRLTKGYNLPARYVLHTVGPIGERPEELRSCYRSILSLAHRNRLRSIGFCCVSTGVYGYPLIPATRIAVDETIEYLKQHFSAFDLCCFACFKLEEYNAYTDCLRAWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords MACRODOMAIN
total genus 81
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fszA00
2J9AA 5DUSA 3IIFA 5FSXA 1TXZA 2BFQA 4J5SA 2VRIA 3PEIA 3H8GA 3GPGA 3Q6ZA 4J5QA 1ZR3A 4R76A 4ZY1A 3EWOA 4KYBA 2ACFA 3KZWA 3V45A 4ABLA 4ETKA 1HJZA 3T8WA 3EWQA 3H8FA 3EWPA 3KQZA 2FG1A 4J4ZA 4ETJA 5FSZA 4GVVA 3GQEA 4JLLA 3VFQA 5CMSA 4TU0A 3JRUA 5E3BA 5CBMA 5D8NA 1LAMA 3KQXA 5CB5A 1VHUA 3KR5A 5HIHA 4J5RA 1GYTA 1SPVA 2FAVA 2BFRA 2DX6A 2AFCA 1BLLE 1YD9A 4UMLA 2XD7A 5CB3A 4GVWA 3H8EA 4JCAA 4X2TA 2FXKA 3EJFA 3GPOA 4GUAA 3GQOA 3EKEA 4R6TA 4ZI6A 4JVVA 3EWRA 2LGRA 4R7MA 5AILA 4D86A 2L8RA 1LANA 3V2BA 2X47A 4ZX9A 4K0CA 5FSYA 4IQYA 1LAPA 4ESSA 1LCPA 4ZY0A 5FSUA 2EEEA 3JZTA 3SIGA 4ZY2A 3SIJA 3EW5A 4JGKA 3SIIA 4ABKA 3ETIA 3GPQA 1NJRA 1BPNA 3Q71A 4ZYQA 3SIHA 3IIDA 2EWBA 4K3NA 4ZX8A 1BPMA 5HOLA 1TY8A 3KR4A 1ZR5A 4KSIA 3EJGA 5FSVA 3IJ3A
chains in the Genus database with same CATH superfamily
2J9AA 5DUSA 3IIFA 5FSXA 1TXZA 2BFQA 4J5SA 2VRIA 3PEIA 2KQVA 3H8GA 3GPGA 3Q6ZA 4J5QA 1ZR3A 4R76A 4ZY1A 3EWOA 4KYBA 2ACFA 3KZWA 3V45A 4ABLA 4ETKA 1HJZA 3T8WA 3EWQA 3H8FA 3EWPA 3KQZA 2FG1A 2JZFA 4J4ZA 4ETJA 5FSZA 4GVVA 3GQEA 2JZDA 4JLLA 3VFQA 5CMSA 4TU0A 3JRUA 5E3BA 5CBMA 5D8NA 1LAMA 3KQXA 5CB5A 1VHUA 3KR5A 5HIHA 4J5RA 1GYTA 1SPVA 2FAVA 2BFRA 2DX6A 2AFCA 1BLLE 1YD9A 4UMLA 2XD7A 5CB3A 4GVWA 3H8EA 4JCAA 4X2TA 2FXKA 3EJFA 3GPOA 4GUAA 3GQOA 3EKEA 4R6TA 4ZI6A 4JVVA 3EWRA 2LGRA 4R7MA 5AILA 4D86A 2RNKA 2L8RA 1LANA 3V2BA 2X47A 4ZX9A 4K0CA 5FSYA 4IQYA 1LAPA 4ESSA 1LCPA 2WCTA 4ZY0A 5FSUA 2EEEA 3JZTA 3SIGA 4ZY2A 3SIJA 3EW5A 4JGKA 3SIIA 4ABKA 3ETIA 3GPQA 1NJRA 1BPNA 3Q71A 4ZYQA 3SIHA 2W2GA 3IIDA 2EWBA 4K3NA 4ZX8A 1BPMA 5HOLA 1TY8A 3KR4A 1ZR5A 4KSIA 3EJGA 5FSVA 2JZEA 3IJ3A
chains in the Genus database with same CATH topology
2J9AA 5DUSA 3IIFA 5FSXA 1TXZA 2BFQA 4J5SA 2VRIA 3PEIA 3H8GA 3GPGA 3Q6ZA 4J5QA 1ZR3A 4R76A 4ZY1A 3EWOA 4KYBA 2ACFA 3KZWA 3V45A 4ABLA 4ETKA 1HJZA 3T8WA 3EWQA 3H8FA 3EWPA 3KQZA 2FG1A 4J4ZA 4ETJA 5FSZA 4GVVA 3GQEA 4JLLA 3VFQA 5CMSA 4TU0A 3JRUA 5E3BA 5CBMA 5D8NA 1LAMA 3KQXA 5CB5A 1VHUA 3KR5A 5HIHA 4J5RA 1GYTA 1SPVA 2FAVA 2BFRA 2DX6A 2AFCA 1BLLE 1YD9A 4UMLA 2XD7A 5CB3A 4GVWA 3H8EA 4JCAA 4X2TA 2FXKA 3EJFA 3GPOA 4GUAA 3GQOA 3EKEA 4R6TA 4ZI6A 4JVVA 3EWRA 2LGRA 4R7MA 5AILA 4D86A 2L8RA 1LANA 3V2BA 2X47A 4ZX9A 4K0CA 5FSYA 4IQYA 1LAPA 4ESSA 1LCPA 4ZY0A 5FSUA 2EEEA 3JZTA 3SIGA 4ZY2A 3SIJA 3EW5A 4JGKA 3SIIA 4ABKA 3ETIA 3GPQA 1NJRA 1BPNA 3Q71A 4ZYQA 3SIHA 3IIDA 2EWBA 4K3NA 4ZX8A 1BPMA 5HOLA 1TY8A 3KR4A 1ZR5A 4KSIA 3EJGA 5FSVA 3IJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9A A;  5DUS A;  3IIF A;  5FSX A;  1TXZ A;  2BFQ A;  4J5S A;  2VRI A;  3PEI A;  3H8G A;  3GPG A;  3Q6Z A;  4J5Q A;  1ZR3 A;  4R76 A;  4ZY1 A;  3EWO A;  4KYB A;  2ACF A;  3KZW A;  3V45 A;  4ABL A;  4ETK A;  1HJZ A;  3T8W A;  3EWQ A;  3H8F A;  3EWP A;  3KQZ A;  2FG1 A;  4J4Z A;  4ETJ A;  5FSZ A;  4GVV A;  3GQE A;  4JLL A;  3VFQ A;  5CMS A;  4TU0 A;  3JRU A;  5E3B A;  5CBM A;  5D8N A;  1LAM A;  3KQX A;  5CB5 A;  1VHU A;  3KR5 A;  5HIH A;  4J5R A;  1GYT A;  1SPV A;  2FAV A;  2BFR A;  2DX6 A;  2AFC A;  1BLL E;  1YD9 A;  4UML A;  2XD7 A;  5CB3 A;  4GVW A;  3H8E A;  4JCA A;  4X2T A;  2FXK A;  3EJF A;  3GPO A;  4GUA A;  3GQO A;  3EKE A;  4R6T A;  4ZI6 A;  4JVV A;  3EWR A;  2LGR A;  4R7M A;  5AIL A;  4D86 A;  2L8R A;  1LAN A;  3V2B A;  2X47 A;  4ZX9 A;  4K0C A;  5FSY A;  4IQY A;  1LAP A;  4ESS A;  1LCP A;  4ZY0 A;  5FSU A;  2EEE A;  3JZT A;  3SIG A;  4ZY2 A;  3SIJ A;  3EW5 A;  4JGK A;  3SII A;  4ABK A;  3ETI A;  3GPQ A;  1NJR A;  1BPN A;  3Q71 A;  4ZYQ A;  3SIH A;  3IID A;  2EWB A;  4K3N A;  4ZX8 A;  1BPM A;  5HOL A;  1TY8 A;  3KR4 A;  1ZR5 A;  4KSI A;  3EJG A;  5FSV A;  3IJ3 A; 
#chains in the Genus database with same CATH topology
 2J9A A;  5DUS A;  3IIF A;  5FSX A;  1TXZ A;  2BFQ A;  4J5S A;  2VRI A;  3PEI A;  2KQV A;  3H8G A;  3GPG A;  3Q6Z A;  4J5Q A;  1ZR3 A;  4R76 A;  4ZY1 A;  3EWO A;  4KYB A;  2ACF A;  3KZW A;  3V45 A;  4ABL A;  4ETK A;  1HJZ A;  3T8W A;  3EWQ A;  3H8F A;  3EWP A;  3KQZ A;  2FG1 A;  2JZF A;  4J4Z A;  4ETJ A;  5FSZ A;  4GVV A;  3GQE A;  2JZD A;  4JLL A;  3VFQ A;  5CMS A;  4TU0 A;  3JRU A;  5E3B A;  5CBM A;  5D8N A;  1LAM A;  3KQX A;  5CB5 A;  1VHU A;  3KR5 A;  5HIH A;  4J5R A;  1GYT A;  1SPV A;  2FAV A;  2BFR A;  2DX6 A;  2AFC A;  1BLL E;  1YD9 A;  4UML A;  2XD7 A;  5CB3 A;  4GVW A;  3H8E A;  4JCA A;  4X2T A;  2FXK A;  3EJF A;  3GPO A;  4GUA A;  3GQO A;  3EKE A;  4R6T A;  4ZI6 A;  4JVV A;  3EWR A;  2LGR A;  4R7M A;  5AIL A;  4D86 A;  2RNK A;  2L8R A;  1LAN A;  3V2B A;  2X47 A;  4ZX9 A;  4K0C A;  5FSY A;  4IQY A;  1LAP A;  4ESS A;  1LCP A;  2WCT A;  4ZY0 A;  5FSU A;  2EEE A;  3JZT A;  3SIG A;  4ZY2 A;  3SIJ A;  3EW5 A;  4JGK A;  3SII A;  4ABK A;  3ETI A;  3GPQ A;  1NJR A;  1BPN A;  3Q71 A;  4ZYQ A;  3SIH A;  2W2G A;  3IID A;  2EWB A;  4K3N A;  4ZX8 A;  1BPM A;  5HOL A;  1TY8 A;  3KR4 A;  1ZR5 A;  4KSI A;  3EJG A;  5FSV A;  2JZE A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 2J9A A;  5DUS A;  3IIF A;  5FSX A;  1TXZ A;  2BFQ A;  4J5S A;  2VRI A;  3PEI A;  3H8G A;  3GPG A;  3Q6Z A;  4J5Q A;  1ZR3 A;  4R76 A;  4ZY1 A;  3EWO A;  4KYB A;  2ACF A;  3KZW A;  3V45 A;  4ABL A;  4ETK A;  1HJZ A;  3T8W A;  3EWQ A;  3H8F A;  3EWP A;  3KQZ A;  2FG1 A;  4J4Z A;  4ETJ A;  5FSZ A;  4GVV A;  3GQE A;  4JLL A;  3VFQ A;  5CMS A;  4TU0 A;  3JRU A;  5E3B A;  5CBM A;  5D8N A;  1LAM A;  3KQX A;  5CB5 A;  1VHU A;  3KR5 A;  5HIH A;  4J5R A;  1GYT A;  1SPV A;  2FAV A;  2BFR A;  2DX6 A;  2AFC A;  1BLL E;  1YD9 A;  4UML A;  2XD7 A;  5CB3 A;  4GVW A;  3H8E A;  4JCA A;  4X2T A;  2FXK A;  3EJF A;  3GPO A;  4GUA A;  3GQO A;  3EKE A;  4R6T A;  4ZI6 A;  4JVV A;  3EWR A;  2LGR A;  4R7M A;  5AIL A;  4D86 A;  2L8R A;  1LAN A;  3V2B A;  2X47 A;  4ZX9 A;  4K0C A;  5FSY A;  4IQY A;  1LAP A;  4ESS A;  1LCP A;  4ZY0 A;  5FSU A;  2EEE A;  3JZT A;  3SIG A;  4ZY2 A;  3SIJ A;  3EW5 A;  4JGK A;  3SII A;  4ABK A;  3ETI A;  3GPQ A;  1NJR A;  1BPN A;  3Q71 A;  4ZYQ A;  3SIH A;  3IID A;  2EWB A;  4K3N A;  4ZX8 A;  1BPM A;  5HOL A;  1TY8 A;  3KR4 A;  1ZR5 A;  4KSI A;  3EJG A;  5FSV A;  3IJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...