5FT6A

Crystal structure of the cysteine desulfurase csda (s-sulfonic acid) from escherichia coli at 2.050 angstroem resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
399
Chain Sequence
MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTEINE DESULFURASE CSDA
publication title Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 142
structure length 399
sequence length 400
chains with identical sequence B
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5ft6A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ft6A01
1TATA 4JEXA 2VMRA 2C7TA 2JG2A 4RM1A 1GC3A 3WGCA 2R5EA 1I43A 1OHWA 3W1HA 2D7YA 3OP7A 3EZSA 4E3QA 4TV7A 2VI8A 1Z3ZA 3AEOA 2VMTA 4Q6RA 1O69A 4XJPA 4ZDLA 4AO9A 2HOYA 1CZCA 2HUFA 1WYVA 1E5EA 2D66A 1ECXA 1WKGA 2VMSA 2Z67A 2AATA 1W23A 1C9CA 2X8UA 2DGKA 4EU1A 1SZKA 2VMOA 2BI1A 4U1TA 3QN6A 4R5ZA 1CQ8A 3NU7A 2ZY4A 2CTZA 4XQ2A 2D7ZA 4RKCA 1BJOA 4ZWVA 3A2BA 4Y0DA 1BS0A 4ZWMA 1KL2A 2VMYA 3FSLA 2C0RA 3B1CA 3JTXA 4EB7A 5EIGB 1YJSA 3E2ZB 4EFFA 2EZ1A 2ZJGA 1DTYA 2E7JA 2W7KA 2EGYA 2HORA 2VMWA 4MY5A 3D6KA 9AATA 1WSTA 1AY5A 3ELPA 1AIBA 2QB2A 3DXVA 4OCAA 3WGBA 2W7EA 1D2FA 2AY6A 3LG0A 3MADA 3NUBA 4UOYA 5G2QA 4WP0A 1WKHA 1X0MA 2CANA 1GD9A 3IF2A 4MQRA 4A0GA 1AY4A 2BWPA 4RAEA 2YKYA 5HXXA 5G4JA 2ORDA 1ZC9A 2JJFA 1D7SA 1W7LA 1UKJA 3FKDA 2D65A 2YRRA 2ZUKA 1OXPA 3MC6C 3NTJA 4JF1A 1ELUA 2FYFA 2YKVA 4QGRA 4A72A 2VMVA 1RVUA 3KGXA 3PAAA 3FZ8A 4OMAA 5M4BA 1ASLA 1N2TA 2HP1A 1GC2A 3DC1A 2CY8A 4Y0IA 1O62A 2Z9VA 2CJGA 1AHYA 1S09A 2CH1A 1J32A 5G09A 4A0HA 1VJOA 1CL1A 3DODA 2E54A 4JEVA 4MGRA 3AEJA 3RBFA 3BWNA 1LC8A 4NOGA 1MAQA 2DKJA 1I29A 2VIBA 4W91A 1AJRA 4FFCA 3N5MA 4N0BA 2C44A 3ZRQA 1V2FA 2YHKA 3CAIA 3F6TA 3WX9A 3FQ7A 4MKKA 5M49A 4ZSWA 3BWOA 3RUYA 1ARTA 1ASMA 4IY7A 4JEYA 5FT8A 2DR1A 3JW9A 3AOVA 4ZSYA 4ITGA 2XH1A 1CQ7A 1IAYA 4XEWA 1BQAA 1M0QA 5EIGA 3WLXA 1C7NA 3E2ZA 4RJYA 2VIAA 5E3KA 3FVXA 2W7GA 4MSOA 3QM2A 3FCRA 4M2MA 3RQ1A 4K2IA 1KL1A 2QBTA 5EFSA 2VGWA 2WKAA 1XI9A 2HUIA 3HLMA 2AY7A 3PA9A 3B46A 1LS3A 1OHVA 2ZY2A 4OC9A 4ADCA 2X5FA 4XK1A 3FQAA 4OYTA 3DR7A 3AEPA 2W8JA 4KYOA 1AHGA 1TOKA 2EPJA 4MQQA 1W7MA 4HVKA 3TQXA 4E1OA 2HOZA 1ASNA 2GMSA 2W8TA 2GSAA 1V2EA 1H1CA 4AH3A 3I16A 1M4NA 3LVJA 5K8BA 1C0NA 1YNUA 1AMRA 4F5KA 1LC7A 3DZZA 5J8QA 1M0NA 2C81A 3CQ4A 1GC4A 4WLJA 2Z20A 1DKAA 4IYOB 2AEVA 3EI9A 3NDNA 2PB0A 4I8AA 4IXOA 2FQ6A 1TPLA 2BI3A 2BYLA 3A9YA 3LV2A 1M0PA 4WYEA 5G0AA 1B4XA 1TASA 4UHMA 1ASGA 4WYDA 1CJ0A 2HUUA 1GEYA 2OATA 2EO5A 5EAAA 1DJEA 3RBLA 2YKUA 3FVUA 2AY8A 3ATHA 3L8AA 1V2DA 2D64A 1M32A 4Q31A 5F9SA 4R5FA 1YIZA 2Z9XA 1QJ3A 1C7GA 2CINA 3H14A 3AOWA 1LKCA 5E5IA 1W3UA 1C7OA 1KMJA 5EAVA 2AY1A 3GJUA 4O6ZA 3MEBA 4AOAA 5D95A 2D5YA 1ASFA 1AKAA 4L0OA 1IAXA 2JJHA 1I41A 1VEFA 3L44A 2BYJA 3WCOA 5TF5A 4E77A 4OBUA 2JGTA 2R5CB 2VMZA 4LNLA 4A6RA 4PFFA 4RKDA 3RI6A 1E5FA 1O61A 2HP2A 3EIBA 3JWBA 3ACZA 4XAUA 2Z9WA 3P6KA 3MBBA 1YAAA 2W7LA 4WBTA 4WYCA 1AMQA 1FC4A 1T3IA 2WK9A 8AATA 5I92A 4LNJA 1QITA 1MAPA 1AIAA 3DRDA 1UU2A 1QGNA 3PIUA 4R2NA 1ORDA 2PO3A 2WK7A 3B8XA 4XJOA 2GMUA 3PGYA 1DGEA 4UQVA 4Q76A 1I48A 1CL2A 1B8GA 1EG5A 4W5KA 5LHAA 3AENB 1ARSA 1TARA 1GEXA 2NMPA 3EIAA 3WKRA 1AICA 4A00A 1GC0A 2X5DA 3FDDA 1XEYA 4U2HA 4W1WA 2DOUA 3MAUA 4ZM3A 3AEMA 3II0A 2AY3A 1OATA 2JJEA 3QI6A 4ZLVA 3OKSA 2X3LA 3ASBA 3BS8A 3EI7A 4JE5A 4IYOA 3VAXA 3NX3A 4R8DA 2YCNA 2W8UA 3ECDA 1ARIA 1Y4IA 4ZDPA 1N8PA 3TFTA 4LNMA 2BKWA 2QA3A 3GZDC 4TMRA 2O7CA 2Z9UA 4F4EA 3R9AA 4WYFA 4FL0A 1SZUA 2XBNA 1MLYA 3WKSA 4CVQA 1SZSA 4KAMA 4UHOA 4WYAA 1BJ4A 4XJLA 3A9ZA 1KKPA 2DGLA 4WB0B 5M46A 1PG8A 3QHXA 4J8LA 2BWOA 4J5UA 1IUGA 3NNKA 3GR9A 4RJ0A 1SFFA 4K2BA 3HL2A 1BJWA 3HT4A 2BIGA 3BV0A 3NYUA 4ZM4A 3KKIA 4F5HA 2ZSLA 4XJMA 2BWNA 5FT5A 3GWPA 2R5CA 2W7IA 1M7YA 3FVSA 2BIAA 4A0FA 1JF9A 4F5IA 1CQ6A 4CBSA 5C6UA 1ZOBA 1D7UA 4BA5A 1QISA 2TPLA 3H7FA 4W8IA 3K7YA 3VP6A 3VK4A 1JS3A 4MKJA 4GRXA 5JAYA 2BHXA 4F5GA 1GBNA 4N0WA 3UAKA 1FG7A 3BCXA 3N75A 1ASEA 1X2AA 1AAWA 1SPAA 5DX5A 4LC3A 2Z1YA 3BC8A 1CZEA 3FFHA 2DGMA 1AMAA 4CBRA 2FNUA 3DR4A 4ITXA 3AENA 4A0RA 1TOGA 2VGUA 3JU7A 3LY1A 2ZP7A 4PVFA 2VMNA 4H51A 4IW7A 5DJ9A 5EQCA 1AHFA 4DQ6A 1D7RA 4HF8A 1TOJA 4ADDA 1S07A 2FM1A 3LVKA 4AO4A 1GDEA 5EUEA 4P7YA 4BA4A 5BJ4A 1QZ9A 4JE5D 2W7MA 3DU4A 2DKBA 4ISYA 1IVRA 3JWAA 1JG8A 1MGVA 3W1JA 2FNIA 1AJSB 3COGA 3UWCA 4BHDA 4F5LA 3CBFA 1IBJA 1RVYA 4GDYA 5F8VA 4EMYA 3ZRRA 3ZZJA 3A8UX 2BI2A 4ADBA 2W7JA 1OXOA 3N0LA 3NU8A 2D61A 4MQPA 2FN6A 3HQTA 3ISLA 2HZPA 2VYCA 3MKJA 3P1TA 4RITA 4WB0A 2W7FA 1BW0A 1DGDA 1AMSA 1LC5A 2CJHA 4KXKA 4ATQA 1DJ9A 3MAFB 5E4ZA 5M4DA 1S06A 2ZYJA 3BCBA 3E77A 1S08A 1ASCA 4RIZA 2AEUA 1DJUA 2VMUA 2OKKA 1LW4A 1ASDA 1BKGA 4DBCA 2VGVA 5EUDA 4GSAA 1YJYA 3AV7A 2E7IA 4IX8A 3GSBA 5EUNA 1AHEA 3R4TA 1B9IA 4ZDOA 1YIYA 1GEWA 1QIRA 3EI6A 3RCHB 3PD6B 3LVMA 1PMOA 3AATA 3B1DA 4LW2A 5AX8A 1S0AA 3ZRPA 1V72A 2EZ2A 5HDMA 4M2KA 4LW4A 2CH2A 1P3WA 2VGZA 1WYTB 4IXSA 3WZFA 3FRKA 3WY7A 4Y0HA 3HDOA 1B9HA 4ADEA 2ZC0A 1MDOA 5FT4A 3NUIA 4F5MA 3PDBB 1RV3A 3UE8A 2VMQA 2ZY3A 1SVVA 1G7XA 2VGSA 3AEMC 3I4JA 2PB2A 3EI5A 3TCMA 2YCPA 1M6SA 1WYUB 1G4VA 4RLGA 2Z1ZA 1IX6A 3PDXA 4W1XA 3JZLA 4ZAHA 3E6GA 3GBXA 2OQXA 2OGEA 2O1BA 2YOBA 3FTBA 3ZZKA 2R0TA 1AJSA 2VMPA 1UU0A 2CJDA 5DB5A 4B98A 4UHNA 1ARHA 5G4IA 2VMXA 3AEJC 4JEZA 2W7DA 3BWNC 3E2YA 3DXWA 1N31A 2OGAA 3VK2A 3FD0A 1LW5A 1Z7DA 2RFVA 4OBVA 4TN4A 2E7UA 4WLHA 3LVLB 2G6WA 4BMKA 3F9TA 4OTLA 4GE9A 3IHJA 1VP4A 4CXQA 2EH6A 2YRIA 2Z61A 2BIEA 3ASAA 3KGWA 3MAFA 1TOIA 3QGUA 1EJIA 3EUCA 4DGTA 1UU1A 3ELEA 2Q7WA 4B9BA 1AAMA 2R2NA 1ZODA 2CSTA 4WXBA 1AHXA 3MC6A 2QLRA 1G7WA 2GB3A 3GETA 1OHYA 3QBOA 1J04A 1BQDA 2O0RA 3EI8A 5G2PA 4A6TA 1ELQA 4F5FA 1GCKA 1MLZA 3Q8NA 4BQ0A 4A6UA 2V1PA 5D5SA 2F8JA 2W8VA 1ASAA 1B5OA 3VOMA 4CXRA 1IX8A 3G7QA 3GZCA 3HMUA 1EQBA 1KKJA 3M5UA 3RCHA 1D7VA 3FZ6A 3GZDA 3FFRA 3PD6A 3B1EA 4JF0A 3CQ5A 5DJ1A 3TFUA 3QPGA 2VI9A 4PIWA 1H0CA 1MDZA 4JEWA 1WYVB 1BT4A 3F0HA 1WYTA 2HOXA 3CQ6A 4P3MA 2QB3A 1ARGA 4WXFA 3NYSA 1AKBA 1PMMA 3E2FA 3E9KA 1U08A 3FZ7A 1ASBA 1X28A 3I5TA 1C4KA 3LWSA 3PDBA 4WD2A 1JS6A 5HHYA 3USFA 2W7HA 3FDBA 4W1VA 2BI9A 2JISA 3KE3A 1TOEA 1WYUA 3HVYA 2VLFA 4GE4A 5LH9A 2OKJA 1YOOA 3K28A 1BJOB 2AY9A 3FQ8A 3PJ0A 4M2JA 4F5JA 4OT8A 2ZSMA 1AX4A 2WK8A 3T32A 4EB5A 7AATA 2W8WA 1FG3A 1PFFA 2AY5A 2CB1A 3BN1A 2YKXA 1X29A 2AY4A 4IXZA 5FT6A 2VGTA 2V0YA 4PFNA 2AY2A 4WXGA 1AY8A 1RV4A 1IX7A 1MDXA 3PPLA 4K2MA 2BI5A 4ATPA 1M0OA 3TATA 3EZ1A 1YJZA 1DFOA 1W7NA 3W1IA 3K40A 4GEBA 3BCAA 1KMKA 3G8MA 2QMAA 4WYGA 4AZKA 2CFBA 1AKCA 2GQNA 3NYTA 3AELA 2ZY5A 1SF2A 3G0TA 1LK9A 3NRAA 3DYDA 3A9XA 2YCTA 4Q75A 3HBXA 5IWQA 1QJ5A 2JJGA 4GE7A 4AZJA 1O4SA 1CS1A 1IJIA 4ZASA 2D63A 1B5PA 2VLHA 3BB8A 1G4XA 3WCNA 5BJ3A 1BJNA 4E3RA 3VK3A
chains in the Genus database with same CATH superfamily
1TATA 4JEXA 2VMRA 2C7TA 2JG2A 4RM1A 1GC3A 3WGCA 2R5EA 1I43A 1OHWA 3W1HA 2D7YA 2A1VA 3OP7A 3EZSA 4E3QA 4TV7A 2VI8A 1Z3ZA 3AEOA 2VMTA 4Q6RA 1O69A 4XJPA 4ZDLA 4AO9A 2HOYA 1CZCA 2HUFA 1WYVA 1E5EA 2D66A 1ECXA 1WKGA 2VMSA 2Z67A 2AATA 1W23A 1C9CA 2X8UA 2DGKA 4EU1A 1SZKA 2VMOA 2BI1A 4U1TA 3QN6A 4R5ZA 1CQ8A 3NU7A 2ZY4A 2CTZA 4XQ2A 2D7ZA 4RKCA 1BJOA 4ZWVA 3A2BA 4Y0DA 1BS0A 4ZWMA 1KL2A 2VMYA 3FSLA 2C0RA 3B1CA 3JTXA 4EB7A 5EIGB 1YJSA 3E2ZB 4EFFA 2EZ1A 2ZJGA 1DTYA 2E7JA 2W7KA 2EGYA 2HORA 2VMWA 4MY5A 3D6KA 9AATA 1WSTA 1AY5A 3ELPA 1AIBA 2QB2A 3DXVA 4OCAA 3WGBA 2W7EA 1D2FA 2AY6A 3LG0A 3MADA 3NUBA 4UOYA 5G2QA 4WP0A 1WKHA 1X0MA 2CANA 1GD9A 3IF2A 4MQRA 1KAFA 4A0GA 1AY4A 2BWPA 4RAEA 2YKYA 5HXXA 5G4JA 2ORDA 1ZC9A 2JJFA 1D7SA 1W7LA 1UKJA 3FKDA 2D65A 2YRRA 2ZUKA 1OXPA 3MC6C 3NTJA 4JF1A 1ELUA 2FYFA 2YKVA 4QGRA 4A72A 2VMVA 1RVUA 3KGXA 3PAAA 3FZ8A 4OMAA 5M4BA 1ASLA 1N2TA 2HP1A 1GC2A 3DC1A 2CY8A 4Y0IA 1O62A 2Z9VA 2CJGA 1AHYA 1S09A 2CH1A 1J32A 5G09A 4A0HA 1VJOA 1CL1A 3DODA 2E54A 4JEVA 4MGRA 3AEJA 3RBFA 3BWNA 1LC8A 4NOGA 1MAQA 2DKJA 1I29A 2VIBA 4W91A 1AJRA 4FFCA 3N5MA 4N0BA 2C44A 3ZRQA 2WB6A 1V2FA 2YHKA 3CAIA 3F6TA 3WX9A 3FQ7A 4MKKA 5M49A 4ZSWA 3BWOA 3RUYA 1ARTA 1ASMA 4IY7A 4JEYA 5FT8A 2DR1A 3JW9A 3AOVA 4ZSYA 4ITGA 2XH1A 1CQ7A 1IAYA 4XEWA 1BQAA 1M0QA 5EIGA 3WLXA 1C7NA 3E2ZA 4RJYA 2VIAA 5E3KA 3FVXA 2W7GA 4MSOA 3QM2A 3FCRA 4M2MA 3RQ1A 4K2IA 1KL1A 2QBTA 5EFSA 2VGWA 2WKAA 1XI9A 2HUIA 3HLMA 2AY7A 3PA9A 3B46A 1LS3A 1OHVA 2ZY2A 4OC9A 4ADCA 2X5FA 4XK1A 3FQAA 4OYTA 3DR7A 3AEPA 2W8JA 4KYOA 1AHGA 1TOKA 2EPJA 4MQQA 1W7MA 4HVKA 3TQXA 4E1OA 2HOZA 1ASNA 2GMSA 2W8TA 2GSAA 1V2EA 3N4XA 1H1CA 4AH3A 3I16A 1M4NA 3LVJA 5K8BA 1C0NA 1YNUA 1AMRA 4F5KA 1LC7A 3DZZA 5J8QA 1M0NA 2C81A 3CQ4A 1GC4A 4WLJA 2Z20A 1DKAA 4IYOB 2AEVA 3EI9A 3NDNA 2PB0A 4I8AA 4IXOA 2FQ6A 1TPLA 2BI3A 2BYLA 3A9YA 3LV2A 1M0PA 4WYEA 5G0AA 1B4XA 1TASA 4UHMA 1ASGA 4WYDA 1CJ0A 2HUUA 1GEYA 2OATA 2EO5A 5EAAA 1DJEA 3RBLA 2YKUA 3FVUA 2AY8A 3ATHA 3L8AA 1V2DA 2D64A 1M32A 4Q31A 5F9SA 4R5FA 1YIZA 2Z9XA 1QJ3A 1C7GA 2CINA 3H14A 3AOWA 1LKCA 5E5IA 1W3UA 1C7OA 1KMJA 5EAVA 2AY1A 3GJUA 4O6ZA 3MEBA 4AOAA 5D95A 2D5YA 1ASFA 1AKAA 4L0OA 1IAXA 2JJHA 1I41A 1VEFA 3L44A 2BYJA 3WCOA 5TF5A 4E77A 4OBUA 2JGTA 2R5CB 2VMZA 4K05A 4LNLA 4A6RA 4PFFA 4RKDA 3RI6A 1E5FA 1O61A 2HP2A 3EIBA 3JWBA 3ACZA 4XAUA 2Z9WA 3P6KA 3MBBA 1YAAA 3N4RA 2W7LA 4WBTA 4WYCA 1AMQA 1FC4A 1T3IA 2WK9A 8AATA 5I92A 4LNJA 1QITA 1MAPA 1AIAA 3DRDA 1UU2A 1QGNA 3PIUA 4R2NA 1ORDA 2PO3A 2WK7A 3B8XA 4XJOA 2GMUA 3PGYA 1DGEA 4UQVA 4Q76A 1I48A 1CL2A 1B8GA 1EG5A 4W5KA 5LHAA 3AENB 1ARSA 1TARA 1GEXA 2NMPA 3EIAA 3WKRA 1AICA 4A00A 2QSRA 1GC0A 2EYQA 2X5DA 3FDDA 1XEYA 4U2HA 4W1WA 2DOUA 3MAUA 4ZM3A 3AEMA 3II0A 2AY3A 1OATA 2JJEA 3QI6A 4ZLVA 3OKSA 2X3LA 3ASBA 3BS8A 3EI7A 4JE5A 4IYOA 3VAXA 3NX3A 4R8DA 2YCNA 2W8UA 3ECDA 1ARIA 1Y4IA 4ZDPA 1N8PA 3TFTA 4LNMA 2BKWA 2QA3A 3GZDC 4TMRA 2O7CA 2Z9UA 4F4EA 3R9AA 4WYFA 4FL0A 1SZUA 2XBNA 5KTBA 1MLYA 3WKSA 4CVQA 1SZSA 4KAMA 4UHOA 4WYAA 1BJ4A 4XJLA 3A9ZA 1KKPA 2DGLA 4WB0B 5M46A 1PG8A 3QHXA 4J8LA 2BWOA 4J5UA 1IUGA 3NNKA 3GR9A 4RJ0A 1SFFA 4K2BA 3HL2A 1BJWA 3HT4A 2BIGA 3BV0A 3NYUA 4ZM4A 3KKIA 4F5HA 2ZSLA 4XJMA 2BWNA 5FT5A 3GWPA 2R5CA 2W7IA 1M7YA 3FVSA 2BIAA 4A0FA 1JF9A 4F5IA 1CQ6A 4CBSA 5C6UA 1ZOBA 1D7UA 4BA5A 1QISA 2TPLA 3H7FA 4W8IA 3K7YA 3VP6A 3VK4A 1JS3A 4MKJA 4GRXA 5JAYA 2BHXA 4F5GA 1GBNA 4N0WA 3UAKA 1FG7A 3BCXA 3N75A 1ASEA 1X2AA 1AAWA 1SPAA 5DX5A 2FKIA 4LC3A 2Z1YA 3BC8A 1CZEA 3FFHA 2DGMA 1AMAA 4CBRA 2FNUA 3DR4A 4ITXA 3AENA 4A0RA 1TOGA 2VGUA 3JU7A 3LY1A 2ZP7A 4PVFA 2VMNA 4H51A 4IW7A 5DJ9A 5EQCA 1AHFA 4DQ6A 1D7RA 4HF8A 1TOJA 4ADDA 1S07A 2FM1A 3LVKA 4AO4A 1GDEA 5EUEA 4P7YA 4BA4A 5BJ4A 1QZ9A 4JE5D 2W7MA 3DU4A 2DKBA 4ISYA 1IVRA 3JWAA 1JG8A 1MGVA 3W1JA 2FNIA 1AJSB 3COGA 3UWCA 4BHDA 4F5LA 3CBFA 1IBJA 1RVYA 4GDYA 5F8VA 4EMYA 3ZRRA 3ZZJA 3A8UX 2BI2A 4ADBA 2W7JA 1OXOA 3N0LA 3NU8A 2D61A 4MQPA 2FN6A 3HQTA 3ISLA 2HZPA 2VYCA 3MKJA 3P1TA 4RITA 4WB0A 2W7FA 1BW0A 1DGDA 1AMSA 1LC5A 2CJHA 4KXKA 4ATQA 1DJ9A 3MAFB 5E4ZA 5M4DA 1S06A 2ZYJA 3BCBA 3E77A 1S08A 1ASCA 4RIZA 2AEUA 1DJUA 2VMUA 2OKKA 1LW4A 1ASDA 3N4SA 1BKGA 4DBCA 2VGVA 5EUDA 2KFPA 4GSAA 1YJYA 3AV7A 2E7IA 4IX8A 3GSBA 5EUNA 1AHEA 3R4TA 1B9IA 4ZDOA 1YIYA 1GEWA 1QIRA 3EI6A 3RCHB 3PD6B 3N7NA 3LVMA 1PMOA 3AATA 3B1DA 4LW2A 5AX8A 1S0AA 3ZRPA 1V72A 2EZ2A 5HDMA 4M2KA 4LW4A 2CH2A 1P3WA 2VGZA 1WYTB 4IXSA 3WZFA 3FRKA 3WY7A 4Y0HA 3HDOA 1B9HA 4ADEA 2ZC0A 1MDOA 5FT4A 3NUIA 4F5MA 3PDBB 1RV3A 3UE8A 2VMQA 2ZY3A 1SVVA 1G7XA 2VGSA 3AEMC 3I4JA 2PB2A 3EI5A 3TCMA 2YCPA 1M6SA 1WYUB 1G4VA 4RLGA 2Z1ZA 1IX6A 3PDXA 4W1XA 3JZLA 4ZAHA 3E6GA 3GBXA 2OQXA 2OGEA 2O1BA 2YOBA 3FTBA 3ZZKA 2R0TA 1AJSA 2VMPA 1UU0A 2CJDA 5DB5A 4B98A 4UHNA 1ARHA 5G4IA 2VMXA 3AEJC 4JEZA 2W7DA 3BWNC 3E2YA 3DXWA 1N31A 2OGAA 3VK2A 3FD0A 1LW5A 1Z7DA 2RFVA 4OBVA 4TN4A 2E7UA 4WLHA 3LVLB 2G6WA 4BMKA 3F9TA 4OTLA 4GE9A 3IHJA 1VP4A 4CXQA 2EH6A 2YRIA 2Z61A 2BIEA 3ASAA 3KGWA 3MAFA 1TOIA 3QGUA 1EJIA 3EUCA 4DGTA 1UU1A 3ELEA 2Q7WA 4B9BA 1AAMA 2R2NA 1ZODA 2CSTA 4WXBA 1AHXA 3MC6A 2QLRA 1G7WA 2GB3A 3H9XA 3GETA 1OHYA 3QBOA 1J04A 1BQDA 2O0RA 3EI8A 5G2PA 4A6TA 1ELQA 4F5FA 1GCKA 1MLZA 3Q8NA 4BQ0A 4A6UA 2V1PA 5D5SA 2F8JA 2W8VA 1ASAA 1B5OA 3VOMA 4CXRA 1IX8A 3G7QA 3GZCA 3HMUA 1EQBA 1KKJA 3M5UA 3RCHA 1D7VA 2G7JA 3FZ6A 3GZDA 3FFRA 3PD6A 3B1EA 4JF0A 3CQ5A 5DJ1A 3TFUA 3QPGA 2VI9A 4PIWA 1H0CA 1MDZA 4JEWA 1WYVB 1BT4A 3F0HA 1WYTA 2HOXA 3CQ6A 4P3MA 2QB3A 1ARGA 4WXFA 3NYSA 1AKBA 1PMMA 3E2FA 3E9KA 1U08A 3FZ7A 1ASBA 1X28A 3I5TA 1C4KA 3LWSA 3PDBA 4WD2A 1JS6A 5HHYA 3USFA 2W7HA 3FDBA 4W1VA 2BI9A 2JISA 3KE3A 1TOEA 1WYUA 3HVYA 2VLFA 4GE4A 5LH9A 2OKJA 1YOOA 4H63Q 3K28A 1BJOB 2AY9A 3FQ8A 3PJ0A 4M2JA 4F5JA 4OT8A 2ZSMA 1AX4A 2WK8A 3T32A 4EB5A 7AATA 2W8WA 1FG3A 1PFFA 2AY5A 2CB1A 3BN1A 2YKXA 1X29A 2AY4A 4IXZA 5FT6A 2VGTA 2V0YA 4PFNA 2AY2A 4WXGA 1AY8A 1RV4A 1IX7A 1MDXA 3PPLA 4K2MA 2BI5A 4ATPA 1M0OA 3TATA 3EZ1A 1YJZA 1DFOA 1W7NA 3W1IA 3K40A 4GEBA 3BCAA 1KMKA 3G8MA 2QMAA 4WYGA 4AZKA 2CFBA 1AKCA 2GQNA 3NYTA 3AELA 2ZY5A 1SF2A 3G0TA 1LK9A 3NRAA 3DYDA 3A9XA 2YCTA 4Q75A 3HBXA 5IWQA 1QJ5A 2JJGA 4GE7A 4AZJA 1O4SA 1CS1A 1IJIA 4ZASA 2D63A 1B5PA 2VLHA 3BB8A 1G4XA 3WCNA 5BJ3A 1BJNA 4E3RA 3VK3A
chains in the Genus database with same CATH topology
1TATA 4JEXA 2VMRA 2C7TA 2JG2A 4RM1A 1GC3A 3WGCA 2R5EA 1I43A 1OHWA 3W1HA 2D7YA 2A1VA 3OP7A 3EZSA 4E3QA 4TV7A 2VI8A 1Z3ZA 3AEOA 2VMTA 4Q6RA 1O69A 4XJPA 4ZDLA 4AO9A 2HOYA 1CZCA 2HUFA 1WYVA 1E5EA 2D66A 1ECXA 1WKGA 2VMSA 2Z67A 2AATA 1W23A 1C9CA 2X8UA 2DGKA 4EU1A 1SZKA 2VMOA 2BI1A 4U1TA 3QN6A 4R5ZA 1CQ8A 3NU7A 2ZY4A 2CTZA 4XQ2A 2D7ZA 4RKCA 1BJOA 4ZWVA 3A2BA 4Y0DA 1BS0A 4ZWMA 1KL2A 2VMYA 3FSLA 2C0RA 3B1CA 3JTXA 4EB7A 5EIGB 1YJSA 3E2ZB 4EFFA 2EZ1A 2ZJGA 1DTYA 2E7JA 2W7KA 2EGYA 2HORA 2VMWA 4MY5A 3D6KA 9AATA 1WSTA 1AY5A 3ELPA 1AIBA 2QB2A 3DXVA 4OCAA 3WGBA 2W7EA 1D2FA 2AY6A 3LG0A 3MADA 3NUBA 4UOYA 5G2QA 4WP0A 1WKHA 1X0MA 2CANA 1GD9A 3IF2A 4MQRA 4A0GA 1AY4A 2BWPA 4RAEA 2YKYA 5HXXA 5G4JA 2ORDA 1ZC9A 2JJFA 1D7SA 1W7LA 1UKJA 3FKDA 2D65A 2YRRA 2ZUKA 1OXPA 3MC6C 3NTJA 4JF1A 1ELUA 2FYFA 2YKVA 4QGRA 4A72A 2VMVA 1RVUA 3KGXA 3PAAA 3FZ8A 4OMAA 5M4BA 1ASLA 1N2TA 2HP1A 1GC2A 3DC1A 2CY8A 4Y0IA 1O62A 2Z9VA 2CJGA 1AHYA 1S09A 2CH1A 1J32A 5G09A 4A0HA 1VJOA 1CL1A 3DODA 2E54A 4JEVA 4MGRA 3AEJA 3RBFA 3BWNA 1LC8A 4NOGA 1MAQA 2DKJA 1I29A 2VIBA 4W91A 1AJRA 4FFCA 3N5MA 4N0BA 2C44A 3ZRQA 2WB6A 1V2FA 2YHKA 3CAIA 3F6TA 3WX9A 3FQ7A 4MKKA 5M49A 4ZSWA 3BWOA 3RUYA 1ARTA 1ASMA 4IY7A 4JEYA 5FT8A 2DR1A 3JW9A 3AOVA 4ZSYA 4ITGA 2XH1A 1CQ7A 1IAYA 4XEWA 1BQAA 1M0QA 5EIGA 3WLXA 1C7NA 3E2ZA 4RJYA 2VIAA 5E3KA 3FVXA 2W7GA 4MSOA 3QM2A 3FCRA 4M2MA 3RQ1A 4K2IA 1KL1A 2QBTA 5EFSA 2VGWA 2WKAA 1XI9A 2HUIA 3HLMA 2AY7A 3PA9A 3B46A 1LS3A 1OHVA 2ZY2A 4OC9A 4ADCA 2X5FA 4XK1A 3FQAA 4OYTA 3DR7A 3AEPA 2W8JA 4KYOA 1AHGA 1TOKA 2EPJA 4MQQA 1W7MA 4HVKA 3TQXA 4E1OA 2HOZA 1ASNA 2GMSA 2W8TA 2GSAA 1V2EA 3N4XA 1H1CA 4AH3A 3I16A 1M4NA 3LVJA 5K8BA 1C0NA 1YNUA 1AMRA 4F5KA 1LC7A 3DZZA 5J8QA 1M0NA 2C81A 3CQ4A 1GC4A 4WLJA 2Z20A 1DKAA 4IYOB 2AEVA 3EI9A 3NDNA 2PB0A 4I8AA 4IXOA 2FQ6A 1TPLA 2BI3A 2BYLA 3A9YA 3LV2A 1M0PA 4WYEA 5G0AA 1B4XA 1TASA 4UHMA 1ASGA 4WYDA 1CJ0A 2HUUA 1GEYA 2OATA 2EO5A 5EAAA 1DJEA 3RBLA 2YKUA 3FVUA 2AY8A 3ATHA 3L8AA 1V2DA 2D64A 1M32A 4Q31A 5F9SA 4R5FA 1YIZA 2Z9XA 1QJ3A 1C7GA 2CINA 3H14A 3AOWA 1LKCA 5E5IA 1W3UA 1C7OA 1KMJA 5EAVA 2AY1A 3GJUA 4O6ZA 3MEBA 4AOAA 5D95A 2D5YA 1ASFA 1AKAA 4L0OA 1IAXA 2JJHA 1I41A 1VEFA 3L44A 2BYJA 3WCOA 5TF5A 4E77A 4OBUA 2JGTA 2R5CB 2VMZA 4K05A 4LNLA 4A6RA 4PFFA 4RKDA 3RI6A 1E5FA 1O61A 2HP2A 3EIBA 3JWBA 3ACZA 4XAUA 2Z9WA 3P6KA 3MBBA 1YAAA 3N4RA 2W7LA 4WBTA 4WYCA 1AMQA 1FC4A 1T3IA 2WK9A 8AATA 5I92A 4LNJA 1QITA 1MAPA 1AIAA 3DRDA 1UU2A 1QGNA 3PIUA 4R2NA 1ORDA 2PO3A 2WK7A 3B8XA 4XJOA 2GMUA 3PGYA 1DGEA 4UQVA 4Q76A 1I48A 1CL2A 1B8GA 1EG5A 4W5KA 5LHAA 3AENB 1ARSA 1TARA 1GEXA 2NMPA 3EIAA 3WKRA 1AICA 4A00A 2QSRA 1GC0A 2EYQA 2X5DA 3FDDA 1XEYA 4U2HA 4W1WA 2DOUA 3MAUA 4ZM3A 3AEMA 3II0A 2AY3A 1OATA 2JJEA 3QI6A 4ZLVA 3OKSA 2X3LA 3ASBA 3BS8A 3EI7A 4JE5A 4IYOA 3VAXA 3NX3A 4R8DA 2YCNA 2W8UA 3ECDA 1ARIA 1Y4IA 4ZDPA 1N8PA 3TFTA 4LNMA 2BKWA 2QA3A 3GZDC 4TMRA 2O7CA 2Z9UA 4F4EA 3R9AA 4WYFA 4FL0A 1SZUA 2XBNA 5KTBA 1MLYA 3WKSA 4CVQA 1SZSA 4KAMA 4UHOA 4WYAA 1BJ4A 4XJLA 3A9ZA 1KKPA 2DGLA 4WB0B 5M46A 1PG8A 3QHXA 4J8LA 2BWOA 4J5UA 1IUGA 3NNKA 3GR9A 4RJ0A 1SFFA 4K2BA 3HL2A 1BJWA 3HT4A 2BIGA 3BV0A 3NYUA 4ZM4A 3KKIA 4F5HA 2ZSLA 4XJMA 2BWNA 5FT5A 3GWPA 2R5CA 2W7IA 1M7YA 3FVSA 2BIAA 4A0FA 1JF9A 4F5IA 1CQ6A 4CBSA 5C6UA 1ZOBA 1D7UA 4BA5A 1QISA 2TPLA 3H7FA 4W8IA 3K7YA 3VP6A 3VK4A 1JS3A 4MKJA 4GRXA 5JAYA 2BHXA 4F5GA 1GBNA 4N0WA 3UAKA 1FG7A 3BCXA 3N75A 1ASEA 1X2AA 1AAWA 1SPAA 5DX5A 2FKIA 4LC3A 2Z1YA 3BC8A 1CZEA 3FFHA 2DGMA 1AMAA 4CBRA 2FNUA 3DR4A 4ITXA 3AENA 4A0RA 1TOGA 2VGUA 3JU7A 3LY1A 2ZP7A 4PVFA 2VMNA 4H51A 4IW7A 5DJ9A 5EQCA 1AHFA 4DQ6A 1D7RA 4HF8A 1TOJA 4ADDA 1S07A 2FM1A 3LVKA 4AO4A 1GDEA 5EUEA 4P7YA 4BA4A 5BJ4A 1QZ9A 4JE5D 2W7MA 3DU4A 2DKBA 4ISYA 1IVRA 3JWAA 1JG8A 1MGVA 3W1JA 2FNIA 1AJSB 3COGA 3UWCA 4BHDA 4F5LA 3CBFA 1IBJA 1RVYA 4GDYA 5F8VA 4EMYA 3ZRRA 3ZZJA 3A8UX 2BI2A 4ADBA 2W7JA 1OXOA 3N0LA 3NU8A 2D61A 4MQPA 2FN6A 3HQTA 3ISLA 2HZPA 2VYCA 3MKJA 3P1TA 4RITA 4WB0A 2W7FA 1BW0A 1DGDA 1AMSA 1LC5A 2CJHA 4KXKA 4ATQA 1DJ9A 3MAFB 5E4ZA 5M4DA 1S06A 2ZYJA 3BCBA 3E77A 1S08A 1ASCA 4RIZA 2AEUA 1DJUA 2VMUA 2OKKA 1LW4A 1ASDA 3N4SA 1BKGA 4DBCA 2VGVA 5EUDA 2KFPA 4GSAA 1YJYA 3AV7A 2E7IA 4IX8A 3GSBA 5EUNA 1AHEA 3R4TA 1B9IA 4ZDOA 1YIYA 1GEWA 1QIRA 3EI6A 3RCHB 3PD6B 3N7NA 3LVMA 1PMOA 3AATA 3B1DA 4LW2A 5AX8A 1S0AA 3ZRPA 1V72A 2EZ2A 5HDMA 4M2KA 4LW4A 2CH2A 1P3WA 2VGZA 1WYTB 4IXSA 3WZFA 3FRKA 3WY7A 4Y0HA 3HDOA 1B9HA 4ADEA 2ZC0A 1MDOA 5FT4A 3NUIA 4F5MA 3PDBB 1RV3A 3UE8A 2VMQA 2ZY3A 1SVVA 1G7XA 2VGSA 3AEMC 3I4JA 2PB2A 3EI5A 3TCMA 2YCPA 1M6SA 1WYUB 1G4VA 4RLGA 2Z1ZA 1IX6A 3PDXA 4W1XA 3JZLA 4ZAHA 3E6GA 3GBXA 2OQXA 2OGEA 2O1BA 2YOBA 3FTBA 3ZZKA 2R0TA 1AJSA 2VMPA 1UU0A 2CJDA 5DB5A 4B98A 4UHNA 1ARHA 5G4IA 2VMXA 3AEJC 4JEZA 2W7DA 3BWNC 3E2YA 3DXWA 1N31A 2OGAA 3VK2A 3FD0A 1LW5A 1Z7DA 2RFVA 4OBVA 4TN4A 2E7UA 4WLHA 3LVLB 2G6WA 4BMKA 3F9TA 4OTLA 4GE9A 3IHJA 1VP4A 4CXQA 2EH6A 2YRIA 2Z61A 2BIEA 3ASAA 3KGWA 3MAFA 1TOIA 3QGUA 1EJIA 3EUCA 4DGTA 1UU1A 3ELEA 2Q7WA 4B9BA 1AAMA 2R2NA 1ZODA 2CSTA 4WXBA 1AHXA 3MC6A 2QLRA 1G7WA 2GB3A 3H9XA 3GETA 1OHYA 3QBOA 1J04A 1BQDA 2O0RA 3EI8A 5G2PA 4A6TA 1ELQA 4F5FA 1GCKA 1MLZA 3Q8NA 4BQ0A 4A6UA 2V1PA 5D5SA 2F8JA 2W8VA 1ASAA 1B5OA 3VOMA 4CXRA 1IX8A 3G7QA 3GZCA 3HMUA 1EQBA 1KKJA 3M5UA 3RCHA 1D7VA 2G7JA 3FZ6A 3GZDA 3FFRA 3PD6A 3B1EA 4JF0A 3CQ5A 5DJ1A 3TFUA 3QPGA 2VI9A 4PIWA 1H0CA 1MDZA 4JEWA 1WYVB 1BT4A 3F0HA 1WYTA 2HOXA 3CQ6A 4P3MA 2QB3A 1ARGA 4WXFA 3NYSA 1AKBA 1PMMA 3E2FA 3E9KA 1U08A 3FZ7A 1ASBA 1X28A 3I5TA 1C4KA 3LWSA 3PDBA 4WD2A 1JS6A 5HHYA 3USFA 2W7HA 3FDBA 4W1VA 2BI9A 2JISA 3KE3A 1TOEA 1WYUA 3HVYA 2VLFA 4GE4A 5LH9A 2OKJA 1YOOA 4H63Q 3K28A 1BJOB 2AY9A 3FQ8A 3PJ0A 4M2JA 4F5JA 4OT8A 2ZSMA 1AX4A 2WK8A 3T32A 4EB5A 7AATA 2W8WA 1FG3A 1PFFA 2AY5A 2CB1A 3BN1A 2YKXA 1X29A 2AY4A 4IXZA 5FT6A 2VGTA 2V0YA 4PFNA 2AY2A 4WXGA 1AY8A 1RV4A 1IX7A 1MDXA 3PPLA 4K2MA 2BI5A 4ATPA 1M0OA 3TATA 3EZ1A 1YJZA 1DFOA 1W7NA 3W1IA 3K40A 4GEBA 3BCAA 1KMKA 3G8MA 2QMAA 4WYGA 4AZKA 2CFBA 1AKCA 2GQNA 3NYTA 3AELA 2ZY5A 1SF2A 3G0TA 1LK9A 3NRAA 3DYDA 3A9XA 2YCTA 4Q75A 3HBXA 5IWQA 1QJ5A 2JJGA 4GE7A 4AZJA 1O4SA 1CS1A 1IJIA 4ZASA 2D63A 1B5PA 2VLHA 3BB8A 1G4XA 3WCNA 5BJ3A 1BJNA 4E3RA 3VK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAT A;  4JEX A;  2VMR A;  2C7T A;  2JG2 A;  4RM1 A;  1GC3 A;  3WGC A;  2R5E A;  1I43 A;  1OHW A;  3W1H A;  2D7Y A;  3OP7 A;  3EZS A;  4E3Q A;  4TV7 A;  2VI8 A;  1Z3Z A;  3AEO A;  2VMT A;  4Q6R A;  1O69 A;  4XJP A;  4ZDL A;  4AO9 A;  2HOY A;  1CZC A;  2HUF A;  1WYV A;  1E5E A;  2D66 A;  1ECX A;  1WKG A;  2VMS A;  2Z67 A;  2AAT A;  1W23 A;  1C9C A;  2X8U A;  2DGK A;  4EU1 A;  1SZK A;  2VMO A;  2BI1 A;  4U1T A;  3QN6 A;  4R5Z A;  1CQ8 A;  3NU7 A;  2ZY4 A;  2CTZ A;  4XQ2 A;  2D7Z A;  4RKC A;  1BJO A;  4ZWV A;  3A2B A;  4Y0D A;  1BS0 A;  4ZWM A;  1KL2 A;  2VMY A;  3FSL A;  2C0R A;  3B1C A;  3JTX A;  4EB7 A;  5EIG B;  1YJS A;  3E2Z B;  4EFF A;  2EZ1 A;  2ZJG A;  1DTY A;  2E7J A;  2W7K A;  2EGY A;  2HOR A;  2VMW A;  4MY5 A;  3D6K A;  9AAT A;  1WST A;  1AY5 A;  3ELP A;  1AIB A;  2QB2 A;  3DXV A;  4OCA A;  3WGB A;  2W7E A;  1D2F A;  2AY6 A;  3LG0 A;  3MAD A;  3NUB A;  4UOY A;  5G2Q A;  4WP0 A;  1WKH A;  1X0M A;  2CAN A;  1GD9 A;  3IF2 A;  4MQR A;  4A0G A;  1AY4 A;  2BWP A;  4RAE A;  2YKY A;  5HXX A;  5G4J A;  2ORD A;  1ZC9 A;  2JJF A;  1D7S A;  1W7L A;  1UKJ A;  3FKD A;  2D65 A;  2YRR A;  2ZUK A;  1OXP A;  3MC6 C;  3NTJ A;  4JF1 A;  1ELU A;  2FYF A;  2YKV A;  4QGR A;  4A72 A;  2VMV A;  1RVU A;  3KGX A;  3PAA A;  3FZ8 A;  4OMA A;  5M4B A;  1ASL A;  1N2T A;  2HP1 A;  1GC2 A;  3DC1 A;  2CY8 A;  4Y0I A;  1O62 A;  2Z9V A;  2CJG A;  1AHY A;  1S09 A;  2CH1 A;  1J32 A;  5G09 A;  4A0H A;  1VJO A;  1CL1 A;  3DOD A;  2E54 A;  4JEV A;  4MGR A;  3AEJ A;  3RBF A;  3BWN A;  1LC8 A;  4NOG A;  1MAQ A;  2DKJ A;  1I29 A;  2VIB A;  4W91 A;  1AJR A;  4FFC A;  3N5M A;  4N0B A;  2C44 A;  3ZRQ A;  1V2F A;  2YHK A;  3CAI A;  3F6T A;  3WX9 A;  3FQ7 A;  4MKK A;  5M49 A;  4ZSW A;  3BWO A;  3RUY A;  1ART A;  1ASM A;  4IY7 A;  4JEY A;  5FT8 A;  2DR1 A;  3JW9 A;  3AOV A;  4ZSY A;  4ITG A;  2XH1 A;  1CQ7 A;  1IAY A;  4XEW A;  1BQA A;  1M0Q A;  5EIG A;  3WLX A;  1C7N A;  3E2Z A;  4RJY A;  2VIA A;  5E3K A;  3FVX A;  2W7G A;  4MSO A;  3QM2 A;  3FCR A;  4M2M A;  3RQ1 A;  4K2I A;  1KL1 A;  2QBT A;  5EFS A;  2VGW A;  2WKA A;  1XI9 A;  2HUI A;  3HLM A;  2AY7 A;  3PA9 A;  3B46 A;  1LS3 A;  1OHV A;  2ZY2 A;  4OC9 A;  4ADC A;  2X5F A;  4XK1 A;  3FQA A;  4OYT A;  3DR7 A;  3AEP A;  2W8J A;  4KYO A;  1AHG A;  1TOK A;  2EPJ A;  4MQQ A;  1W7M A;  4HVK A;  3TQX A;  4E1O A;  2HOZ A;  1ASN A;  2GMS A;  2W8T A;  2GSA A;  1V2E A;  1H1C A;  4AH3 A;  3I16 A;  1M4N A;  3LVJ A;  5K8B A;  1C0N A;  1YNU A;  1AMR A;  4F5K A;  1LC7 A;  3DZZ A;  5J8Q A;  1M0N A;  2C81 A;  3CQ4 A;  1GC4 A;  4WLJ A;  2Z20 A;  1DKA A;  4IYO B;  2AEV A;  3EI9 A;  3NDN A;  2PB0 A;  4I8A A;  4IXO A;  2FQ6 A;  1TPL A;  2BI3 A;  2BYL A;  3A9Y A;  3LV2 A;  1M0P A;  4WYE A;  5G0A A;  1B4X A;  1TAS A;  4UHM A;  1ASG A;  4WYD A;  1CJ0 A;  2HUU A;  1GEY A;  2OAT A;  2EO5 A;  5EAA A;  1DJE A;  3RBL A;  2YKU A;  3FVU A;  2AY8 A;  3ATH A;  3L8A A;  1V2D A;  2D64 A;  1M32 A;  4Q31 A;  5F9S A;  4R5F A;  1YIZ A;  2Z9X A;  1QJ3 A;  1C7G A;  2CIN A;  3H14 A;  3AOW A;  1LKC A;  5E5I A;  1W3U A;  1C7O A;  1KMJ A;  5EAV A;  2AY1 A;  3GJU A;  4O6Z A;  3MEB A;  4AOA A;  5D95 A;  2D5Y A;  1ASF A;  1AKA A;  4L0O A;  1IAX A;  2JJH A;  1I41 A;  1VEF A;  3L44 A;  2BYJ A;  3WCO A;  5TF5 A;  4E77 A;  4OBU A;  2JGT A;  2R5C B;  2VMZ A;  4LNL A;  4A6R A;  4PFF A;  4RKD A;  3RI6 A;  1E5F A;  1O61 A;  2HP2 A;  3EIB A;  3JWB A;  3ACZ A;  4XAU A;  2Z9W A;  3P6K A;  3MBB A;  1YAA A;  2W7L A;  4WBT A;  4WYC A;  1AMQ A;  1FC4 A;  1T3I A;  2WK9 A;  8AAT A;  5I92 A;  4LNJ A;  1QIT A;  1MAP A;  1AIA A;  3DRD A;  1UU2 A;  1QGN A;  3PIU A;  4R2N A;  1ORD A;  2PO3 A;  2WK7 A;  3B8X A;  4XJO A;  2GMU A;  3PGY A;  1DGE A;  4UQV A;  4Q76 A;  1I48 A;  1CL2 A;  1B8G A;  1EG5 A;  4W5K A;  5LHA A;  3AEN B;  1ARS A;  1TAR A;  1GEX A;  2NMP A;  3EIA A;  3WKR A;  1AIC A;  4A00 A;  1GC0 A;  2X5D A;  3FDD A;  1XEY A;  4U2H A;  4W1W A;  2DOU A;  3MAU A;  4ZM3 A;  3AEM A;  3II0 A;  2AY3 A;  1OAT A;  2JJE A;  3QI6 A;  4ZLV A;  3OKS A;  2X3L A;  3ASB A;  3BS8 A;  3EI7 A;  4JE5 A;  4IYO A;  3VAX A;  3NX3 A;  4R8D A;  2YCN A;  2W8U A;  3ECD A;  1ARI A;  1Y4I A;  4ZDP A;  1N8P A;  3TFT A;  4LNM A;  2BKW A;  2QA3 A;  3GZD C;  4TMR A;  2O7C A;  2Z9U A;  4F4E A;  3R9A A;  4WYF A;  4FL0 A;  1SZU A;  2XBN A;  1MLY A;  3WKS A;  4CVQ A;  1SZS A;  4KAM A;  4UHO A;  4WYA A;  1BJ4 A;  4XJL A;  3A9Z A;  1KKP A;  2DGL A;  4WB0 B;  5M46 A;  1PG8 A;  3QHX A;  4J8L A;  2BWO A;  4J5U A;  1IUG A;  3NNK A;  3GR9 A;  4RJ0 A;  1SFF A;  4K2B A;  3HL2 A;  1BJW A;  3HT4 A;  2BIG A;  3BV0 A;  3NYU A;  4ZM4 A;  3KKI A;  4F5H A;  2ZSL A;  4XJM A;  2BWN A;  5FT5 A;  3GWP A;  2R5C A;  2W7I A;  1M7Y A;  3FVS A;  2BIA A;  4A0F A;  1JF9 A;  4F5I A;  1CQ6 A;  4CBS A;  5C6U A;  1ZOB A;  1D7U A;  4BA5 A;  1QIS A;  2TPL A;  3H7F A;  4W8I A;  3K7Y A;  3VP6 A;  3VK4 A;  1JS3 A;  4MKJ A;  4GRX A;  5JAY A;  2BHX A;  4F5G A;  1GBN A;  4N0W A;  3UAK A;  1FG7 A;  3BCX A;  3N75 A;  1ASE A;  1X2A A;  1AAW A;  1SPA A;  5DX5 A;  4LC3 A;  2Z1Y A;  3BC8 A;  1CZE A;  3FFH A;  2DGM A;  1AMA A;  4CBR A;  2FNU A;  3DR4 A;  4ITX A;  3AEN A;  4A0R A;  1TOG A;  2VGU A;  3JU7 A;  3LY1 A;  2ZP7 A;  4PVF A;  2VMN A;  4H51 A;  4IW7 A;  5DJ9 A;  5EQC A;  1AHF A;  4DQ6 A;  1D7R A;  4HF8 A;  1TOJ A;  4ADD A;  1S07 A;  2FM1 A;  3LVK A;  4AO4 A;  1GDE A;  5EUE A;  4P7Y A;  4BA4 A;  5BJ4 A;  1QZ9 A;  4JE5 D;  2W7M A;  3DU4 A;  2DKB A;  4ISY A;  1IVR A;  3JWA A;  1JG8 A;  1MGV A;  3W1J A;  2FNI A;  1AJS B;  3COG A;  3UWC A;  4BHD A;  4F5L A;  3CBF A;  1IBJ A;  1RVY A;  4GDY A;  5F8V A;  4EMY A;  3ZRR A;  3ZZJ A;  3A8U X;  2BI2 A;  4ADB A;  2W7J A;  1OXO A;  3N0L A;  3NU8 A;  2D61 A;  4MQP A;  2FN6 A;  3HQT A;  3ISL A;  2HZP A;  2VYC A;  3MKJ A;  3P1T A;  4RIT A;  4WB0 A;  2W7F A;  1BW0 A;  1DGD A;  1AMS A;  1LC5 A;  2CJH A;  4KXK A;  4ATQ A;  1DJ9 A;  3MAF B;  5E4Z A;  5M4D A;  1S06 A;  2ZYJ A;  3BCB A;  3E77 A;  1S08 A;  1ASC A;  4RIZ A;  2AEU A;  1DJU A;  2VMU A;  2OKK A;  1LW4 A;  1ASD A;  1BKG A;  4DBC A;  2VGV A;  5EUD A;  4GSA A;  1YJY A;  3AV7 A;  2E7I A;  4IX8 A;  3GSB A;  5EUN A;  1AHE A;  3R4T A;  1B9I A;  4ZDO A;  1YIY A;  1GEW A;  1QIR A;  3EI6 A;  3RCH B;  3PD6 B;  3LVM A;  1PMO A;  3AAT A;  3B1D A;  4LW2 A;  5AX8 A;  1S0A A;  3ZRP A;  1V72 A;  2EZ2 A;  5HDM A;  4M2K A;  4LW4 A;  2CH2 A;  1P3W A;  2VGZ A;  1WYT B;  4IXS A;  3WZF A;  3FRK A;  3WY7 A;  4Y0H A;  3HDO A;  1B9H A;  4ADE A;  2ZC0 A;  1MDO A;  5FT4 A;  3NUI A;  4F5M A;  3PDB B;  1RV3 A;  3UE8 A;  2VMQ A;  2ZY3 A;  1SVV A;  1G7X A;  2VGS A;  3AEM C;  3I4J A;  2PB2 A;  3EI5 A;  3TCM A;  2YCP A;  1M6S A;  1WYU B;  1G4V A;  4RLG A;  2Z1Z A;  1IX6 A;  3PDX A;  4W1X A;  3JZL A;  4ZAH A;  3E6G A;  3GBX A;  2OQX A;  2OGE A;  2O1B A;  2YOB A;  3FTB A;  3ZZK A;  2R0T A;  1AJS A;  2VMP A;  1UU0 A;  2CJD A;  5DB5 A;  4B98 A;  4UHN A;  1ARH A;  5G4I A;  2VMX A;  3AEJ C;  4JEZ A;  2W7D A;  3BWN C;  3E2Y A;  3DXW A;  1N31 A;  2OGA A;  3VK2 A;  3FD0 A;  1LW5 A;  1Z7D A;  2RFV A;  4OBV A;  4TN4 A;  2E7U A;  4WLH A;  3LVL B;  2G6W A;  4BMK A;  3F9T A;  4OTL A;  4GE9 A;  3IHJ A;  1VP4 A;  4CXQ A;  2EH6 A;  2YRI A;  2Z61 A;  2BIE A;  3ASA A;  3KGW A;  3MAF A;  1TOI A;  3QGU A;  1EJI A;  3EUC A;  4DGT A;  1UU1 A;  3ELE A;  2Q7W A;  4B9B A;  1AAM A;  2R2N A;  1ZOD A;  2CST A;  4WXB A;  1AHX A;  3MC6 A;  2QLR A;  1G7W A;  2GB3 A;  3GET A;  1OHY A;  3QBO A;  1J04 A;  1BQD A;  2O0R A;  3EI8 A;  5G2P A;  4A6T A;  1ELQ A;  4F5F A;  1GCK A;  1MLZ A;  3Q8N A;  4BQ0 A;  4A6U A;  2V1P A;  5D5S A;  2F8J A;  2W8V A;  1ASA A;  1B5O A;  3VOM A;  4CXR A;  1IX8 A;  3G7Q A;  3GZC A;  3HMU A;  1EQB A;  1KKJ A;  3M5U A;  3RCH A;  1D7V A;  3FZ6 A;  3GZD A;  3FFR A;  3PD6 A;  3B1E A;  4JF0 A;  3CQ5 A;  5DJ1 A;  3TFU A;  3QPG A;  2VI9 A;  4PIW A;  1H0C A;  1MDZ A;  4JEW A;  1WYV B;  1BT4 A;  3F0H A;  1WYT A;  2HOX A;  3CQ6 A;  4P3M A;  2QB3 A;  1ARG A;  4WXF A;  3NYS A;  1AKB A;  1PMM A;  3E2F A;  3E9K A;  1U08 A;  3FZ7 A;  1ASB A;  1X28 A;  3I5T A;  1C4K A;  3LWS A;  3PDB A;  4WD2 A;  1JS6 A;  5HHY A;  3USF A;  2W7H A;  3FDB A;  4W1V A;  2BI9 A;  2JIS A;  3KE3 A;  1TOE A;  1WYU A;  3HVY A;  2VLF A;  4GE4 A;  5LH9 A;  2OKJ A;  1YOO A;  3K28 A;  1BJO B;  2AY9 A;  3FQ8 A;  3PJ0 A;  4M2J A;  4F5J A;  4OT8 A;  2ZSM A;  1AX4 A;  2WK8 A;  3T32 A;  4EB5 A;  7AAT A;  2W8W A;  1FG3 A;  1PFF A;  2AY5 A;  2CB1 A;  3BN1 A;  2YKX A;  1X29 A;  2AY4 A;  4IXZ A;  5FT6 A;  2VGT A;  2V0Y A;  4PFN A;  2AY2 A;  4WXG A;  1AY8 A;  1RV4 A;  1IX7 A;  1MDX A;  3PPL A;  4K2M A;  2BI5 A;  4ATP A;  1M0O A;  3TAT A;  3EZ1 A;  1YJZ A;  1DFO A;  1W7N A;  3W1I A;  3K40 A;  4GEB A;  3BCA A;  1KMK A;  3G8M A;  2QMA A;  4WYG A;  4AZK A;  2CFB A;  1AKC A;  2GQN A;  3NYT A;  3AEL A;  2ZY5 A;  1SF2 A;  3G0T A;  1LK9 A;  3NRA A;  3DYD A;  3A9X A;  2YCT A;  4Q75 A;  3HBX A;  5IWQ A;  1QJ5 A;  2JJG A;  4GE7 A;  4AZJ A;  1O4S A;  1CS1 A;  1IJI A;  4ZAS A;  2D63 A;  1B5P A;  2VLH A;  3BB8 A;  1G4X A;  3WCN A;  5BJ3 A;  1BJN A;  4E3R A;  3VK3 A; 
#chains in the Genus database with same CATH topology
 1TAT A;  4JEX A;  2VMR A;  2C7T A;  2JG2 A;  4RM1 A;  1GC3 A;  3WGC A;  2R5E A;  1I43 A;  1OHW A;  3W1H A;  2D7Y A;  2A1V A;  3OP7 A;  3EZS A;  4E3Q A;  4TV7 A;  2VI8 A;  1Z3Z A;  3AEO A;  2VMT A;  4Q6R A;  1O69 A;  4XJP A;  4ZDL A;  4AO9 A;  2HOY A;  1CZC A;  2HUF A;  1WYV A;  1E5E A;  2D66 A;  1ECX A;  1WKG A;  2VMS A;  2Z67 A;  2AAT A;  1W23 A;  1C9C A;  2X8U A;  2DGK A;  4EU1 A;  1SZK A;  2VMO A;  2BI1 A;  4U1T A;  3QN6 A;  4R5Z A;  1CQ8 A;  3NU7 A;  2ZY4 A;  2CTZ A;  4XQ2 A;  2D7Z A;  4RKC A;  1BJO A;  4ZWV A;  3A2B A;  4Y0D A;  1BS0 A;  4ZWM A;  1KL2 A;  2VMY A;  3FSL A;  2C0R A;  3B1C A;  3JTX A;  4EB7 A;  5EIG B;  1YJS A;  3E2Z B;  4EFF A;  2EZ1 A;  2ZJG A;  1DTY A;  2E7J A;  2W7K A;  2EGY A;  2HOR A;  2VMW A;  4MY5 A;  3D6K A;  9AAT A;  1WST A;  1AY5 A;  3ELP A;  1AIB A;  2QB2 A;  3DXV A;  4OCA A;  3WGB A;  2W7E A;  1D2F A;  2AY6 A;  3LG0 A;  3MAD A;  3NUB A;  4UOY A;  5G2Q A;  4WP0 A;  1WKH A;  1X0M A;  2CAN A;  1GD9 A;  3IF2 A;  4MQR A;  1KAF A;  4A0G A;  1AY4 A;  2BWP A;  4RAE A;  2YKY A;  5HXX A;  5G4J A;  2ORD A;  1ZC9 A;  2JJF A;  1D7S A;  1W7L A;  1UKJ A;  3FKD A;  2D65 A;  2YRR A;  2ZUK A;  1OXP A;  3MC6 C;  3NTJ A;  4JF1 A;  1ELU A;  2FYF A;  2YKV A;  4QGR A;  4A72 A;  2VMV A;  1RVU A;  3KGX A;  3PAA A;  3FZ8 A;  4OMA A;  5M4B A;  1ASL A;  1N2T A;  2HP1 A;  1GC2 A;  3DC1 A;  2CY8 A;  4Y0I A;  1O62 A;  2Z9V A;  2CJG A;  1AHY A;  1S09 A;  2CH1 A;  1J32 A;  5G09 A;  4A0H A;  1VJO A;  1CL1 A;  3DOD A;  2E54 A;  4JEV A;  4MGR A;  3AEJ A;  3RBF A;  3BWN A;  1LC8 A;  4NOG A;  1MAQ A;  2DKJ A;  1I29 A;  2VIB A;  4W91 A;  1AJR A;  4FFC A;  3N5M A;  4N0B A;  2C44 A;  3ZRQ A;  2WB6 A;  1V2F A;  2YHK A;  3CAI A;  3F6T A;  3WX9 A;  3FQ7 A;  4MKK A;  5M49 A;  4ZSW A;  3BWO A;  3RUY A;  1ART A;  1ASM A;  4IY7 A;  4JEY A;  5FT8 A;  2DR1 A;  3JW9 A;  3AOV A;  4ZSY A;  4ITG A;  2XH1 A;  1CQ7 A;  1IAY A;  4XEW A;  1BQA A;  1M0Q A;  5EIG A;  3WLX A;  1C7N A;  3E2Z A;  4RJY A;  2VIA A;  5E3K A;  3FVX A;  2W7G A;  4MSO A;  3QM2 A;  3FCR A;  4M2M A;  3RQ1 A;  4K2I A;  1KL1 A;  2QBT A;  5EFS A;  2VGW A;  2WKA A;  1XI9 A;  2HUI A;  3HLM A;  2AY7 A;  3PA9 A;  3B46 A;  1LS3 A;  1OHV A;  2ZY2 A;  4OC9 A;  4ADC A;  2X5F A;  4XK1 A;  3FQA A;  4OYT A;  3DR7 A;  3AEP A;  2W8J A;  4KYO A;  1AHG A;  1TOK A;  2EPJ A;  4MQQ A;  1W7M A;  4HVK A;  3TQX A;  4E1O A;  2HOZ A;  1ASN A;  2GMS A;  2W8T A;  2GSA A;  1V2E A;  3N4X A;  1H1C A;  4AH3 A;  3I16 A;  1M4N A;  3LVJ A;  5K8B A;  1C0N A;  1YNU A;  1AMR A;  4F5K A;  1LC7 A;  3DZZ A;  5J8Q A;  1M0N A;  2C81 A;  3CQ4 A;  1GC4 A;  4WLJ A;  2Z20 A;  1DKA A;  4IYO B;  2AEV A;  3EI9 A;  3NDN A;  2PB0 A;  4I8A A;  4IXO A;  2FQ6 A;  1TPL A;  2BI3 A;  2BYL A;  3A9Y A;  3LV2 A;  1M0P A;  4WYE A;  5G0A A;  1B4X A;  1TAS A;  4UHM A;  1ASG A;  4WYD A;  1CJ0 A;  2HUU A;  1GEY A;  2OAT A;  2EO5 A;  5EAA A;  1DJE A;  3RBL A;  2YKU A;  3FVU A;  2AY8 A;  3ATH A;  3L8A A;  1V2D A;  2D64 A;  1M32 A;  4Q31 A;  5F9S A;  4R5F A;  1YIZ A;  2Z9X A;  1QJ3 A;  1C7G A;  2CIN A;  3H14 A;  3AOW A;  1LKC A;  5E5I A;  1W3U A;  1C7O A;  1KMJ A;  5EAV A;  2AY1 A;  3GJU A;  4O6Z A;  3MEB A;  4AOA A;  5D95 A;  2D5Y A;  1ASF A;  1AKA A;  4L0O A;  1IAX A;  2JJH A;  1I41 A;  1VEF A;  3L44 A;  2BYJ A;  3WCO A;  5TF5 A;  4E77 A;  4OBU A;  2JGT A;  2R5C B;  2VMZ A;  4K05 A;  4LNL A;  4A6R A;  4PFF A;  4RKD A;  3RI6 A;  1E5F A;  1O61 A;  2HP2 A;  3EIB A;  3JWB A;  3ACZ A;  4XAU A;  2Z9W A;  3P6K A;  3MBB A;  1YAA A;  3N4R A;  2W7L A;  4WBT A;  4WYC A;  1AMQ A;  1FC4 A;  1T3I A;  2WK9 A;  8AAT A;  5I92 A;  4LNJ A;  1QIT A;  1MAP A;  1AIA A;  3DRD A;  1UU2 A;  1QGN A;  3PIU A;  4R2N A;  1ORD A;  2PO3 A;  2WK7 A;  3B8X A;  4XJO A;  2GMU A;  3PGY A;  1DGE A;  4UQV A;  4Q76 A;  1I48 A;  1CL2 A;  1B8G A;  1EG5 A;  4W5K A;  5LHA A;  3AEN B;  1ARS A;  1TAR A;  1GEX A;  2NMP A;  3EIA A;  3WKR A;  1AIC A;  4A00 A;  2QSR A;  1GC0 A;  2EYQ A;  2X5D A;  3FDD A;  1XEY A;  4U2H A;  4W1W A;  2DOU A;  3MAU A;  4ZM3 A;  3AEM A;  3II0 A;  2AY3 A;  1OAT A;  2JJE A;  3QI6 A;  4ZLV A;  3OKS A;  2X3L A;  3ASB A;  3BS8 A;  3EI7 A;  4JE5 A;  4IYO A;  3VAX A;  3NX3 A;  4R8D A;  2YCN A;  2W8U A;  3ECD A;  1ARI A;  1Y4I A;  4ZDP A;  1N8P A;  3TFT A;  4LNM A;  2BKW A;  2QA3 A;  3GZD C;  4TMR A;  2O7C A;  2Z9U A;  4F4E A;  3R9A A;  4WYF A;  4FL0 A;  1SZU A;  2XBN A;  5KTB A;  1MLY A;  3WKS A;  4CVQ A;  1SZS A;  4KAM A;  4UHO A;  4WYA A;  1BJ4 A;  4XJL A;  3A9Z A;  1KKP A;  2DGL A;  4WB0 B;  5M46 A;  1PG8 A;  3QHX A;  4J8L A;  2BWO A;  4J5U A;  1IUG A;  3NNK A;  3GR9 A;  4RJ0 A;  1SFF A;  4K2B A;  3HL2 A;  1BJW A;  3HT4 A;  2BIG A;  3BV0 A;  3NYU A;  4ZM4 A;  3KKI A;  4F5H A;  2ZSL A;  4XJM A;  2BWN A;  5FT5 A;  3GWP A;  2R5C A;  2W7I A;  1M7Y A;  3FVS A;  2BIA A;  4A0F A;  1JF9 A;  4F5I A;  1CQ6 A;  4CBS A;  5C6U A;  1ZOB A;  1D7U A;  4BA5 A;  1QIS A;  2TPL A;  3H7F A;  4W8I A;  3K7Y A;  3VP6 A;  3VK4 A;  1JS3 A;  4MKJ A;  4GRX A;  5JAY A;  2BHX A;  4F5G A;  1GBN A;  4N0W A;  3UAK A;  1FG7 A;  3BCX A;  3N75 A;  1ASE A;  1X2A A;  1AAW A;  1SPA A;  5DX5 A;  2FKI A;  4LC3 A;  2Z1Y A;  3BC8 A;  1CZE A;  3FFH A;  2DGM A;  1AMA A;  4CBR A;  2FNU A;  3DR4 A;  4ITX A;  3AEN A;  4A0R A;  1TOG A;  2VGU A;  3JU7 A;  3LY1 A;  2ZP7 A;  4PVF A;  2VMN A;  4H51 A;  4IW7 A;  5DJ9 A;  5EQC A;  1AHF A;  4DQ6 A;  1D7R A;  4HF8 A;  1TOJ A;  4ADD A;  1S07 A;  2FM1 A;  3LVK A;  4AO4 A;  1GDE A;  5EUE A;  4P7Y A;  4BA4 A;  5BJ4 A;  1QZ9 A;  4JE5 D;  2W7M A;  3DU4 A;  2DKB A;  4ISY A;  1IVR A;  3JWA A;  1JG8 A;  1MGV A;  3W1J A;  2FNI A;  1AJS B;  3COG A;  3UWC A;  4BHD A;  4F5L A;  3CBF A;  1IBJ A;  1RVY A;  4GDY A;  5F8V A;  4EMY A;  3ZRR A;  3ZZJ A;  3A8U X;  2BI2 A;  4ADB A;  2W7J A;  1OXO A;  3N0L A;  3NU8 A;  2D61 A;  4MQP A;  2FN6 A;  3HQT A;  3ISL A;  2HZP A;  2VYC A;  3MKJ A;  3P1T A;  4RIT A;  4WB0 A;  2W7F A;  1BW0 A;  1DGD A;  1AMS A;  1LC5 A;  2CJH A;  4KXK A;  4ATQ A;  1DJ9 A;  3MAF B;  5E4Z A;  5M4D A;  1S06 A;  2ZYJ A;  3BCB A;  3E77 A;  1S08 A;  1ASC A;  4RIZ A;  2AEU A;  1DJU A;  2VMU A;  2OKK A;  1LW4 A;  1ASD A;  3N4S A;  1BKG A;  4DBC A;  2VGV A;  5EUD A;  2KFP A;  4GSA A;  1YJY A;  3AV7 A;  2E7I A;  4IX8 A;  3GSB A;  5EUN A;  1AHE A;  3R4T A;  1B9I A;  4ZDO A;  1YIY A;  1GEW A;  1QIR A;  3EI6 A;  3RCH B;  3PD6 B;  3N7N A;  3LVM A;  1PMO A;  3AAT A;  3B1D A;  4LW2 A;  5AX8 A;  1S0A A;  3ZRP A;  1V72 A;  2EZ2 A;  5HDM A;  4M2K A;  4LW4 A;  2CH2 A;  1P3W A;  2VGZ A;  1WYT B;  4IXS A;  3WZF A;  3FRK A;  3WY7 A;  4Y0H A;  3HDO A;  1B9H A;  4ADE A;  2ZC0 A;  1MDO A;  5FT4 A;  3NUI A;  4F5M A;  3PDB B;  1RV3 A;  3UE8 A;  2VMQ A;  2ZY3 A;  1SVV A;  1G7X A;  2VGS A;  3AEM C;  3I4J A;  2PB2 A;  3EI5 A;  3TCM A;  2YCP A;  1M6S A;  1WYU B;  1G4V A;  4RLG A;  2Z1Z A;  1IX6 A;  3PDX A;  4W1X A;  3JZL A;  4ZAH A;  3E6G A;  3GBX A;  2OQX A;  2OGE A;  2O1B A;  2YOB A;  3FTB A;  3ZZK A;  2R0T A;  1AJS A;  2VMP A;  1UU0 A;  2CJD A;  5DB5 A;  4B98 A;  4UHN A;  1ARH A;  5G4I A;  2VMX A;  3AEJ C;  4JEZ A;  2W7D A;  3BWN C;  3E2Y A;  3DXW A;  1N31 A;  2OGA A;  3VK2 A;  3FD0 A;  1LW5 A;  1Z7D A;  2RFV A;  4OBV A;  4TN4 A;  2E7U A;  4WLH A;  3LVL B;  2G6W A;  4BMK A;  3F9T A;  4OTL A;  4GE9 A;  3IHJ A;  1VP4 A;  4CXQ A;  2EH6 A;  2YRI A;  2Z61 A;  2BIE A;  3ASA A;  3KGW A;  3MAF A;  1TOI A;  3QGU A;  1EJI A;  3EUC A;  4DGT A;  1UU1 A;  3ELE A;  2Q7W A;  4B9B A;  1AAM A;  2R2N A;  1ZOD A;  2CST A;  4WXB A;  1AHX A;  3MC6 A;  2QLR A;  1G7W A;  2GB3 A;  3H9X A;  3GET A;  1OHY A;  3QBO A;  1J04 A;  1BQD A;  2O0R A;  3EI8 A;  5G2P A;  4A6T A;  1ELQ A;  4F5F A;  1GCK A;  1MLZ A;  3Q8N A;  4BQ0 A;  4A6U A;  2V1P A;  5D5S A;  2F8J A;  2W8V A;  1ASA A;  1B5O A;  3VOM A;  4CXR A;  1IX8 A;  3G7Q A;  3GZC A;  3HMU A;  1EQB A;  1KKJ A;  3M5U A;  3RCH A;  1D7V A;  2G7J A;  3FZ6 A;  3GZD A;  3FFR A;  3PD6 A;  3B1E A;  4JF0 A;  3CQ5 A;  5DJ1 A;  3TFU A;  3QPG A;  2VI9 A;  4PIW A;  1H0C A;  1MDZ A;  4JEW A;  1WYV B;  1BT4 A;  3F0H A;  1WYT A;  2HOX A;  3CQ6 A;  4P3M A;  2QB3 A;  1ARG A;  4WXF A;  3NYS A;  1AKB A;  1PMM A;  3E2F A;  3E9K A;  1U08 A;  3FZ7 A;  1ASB A;  1X28 A;  3I5T A;  1C4K A;  3LWS A;  3PDB A;  4WD2 A;  1JS6 A;  5HHY A;  3USF A;  2W7H A;  3FDB A;  4W1V A;  2BI9 A;  2JIS A;  3KE3 A;  1TOE A;  1WYU A;  3HVY A;  2VLF A;  4GE4 A;  5LH9 A;  2OKJ A;  1YOO A;  4H63 Q;  3K28 A;  1BJO B;  2AY9 A;  3FQ8 A;  3PJ0 A;  4M2J A;  4F5J A;  4OT8 A;  2ZSM A;  1AX4 A;  2WK8 A;  3T32 A;  4EB5 A;  7AAT A;  2W8W A;  1FG3 A;  1PFF A;  2AY5 A;  2CB1 A;  3BN1 A;  2YKX A;  1X29 A;  2AY4 A;  4IXZ A;  5FT6 A;  2VGT A;  2V0Y A;  4PFN A;  2AY2 A;  4WXG A;  1AY8 A;  1RV4 A;  1IX7 A;  1MDX A;  3PPL A;  4K2M A;  2BI5 A;  4ATP A;  1M0O A;  3TAT A;  3EZ1 A;  1YJZ A;  1DFO A;  1W7N A;  3W1I A;  3K40 A;  4GEB A;  3BCA A;  1KMK A;  3G8M A;  2QMA A;  4WYG A;  4AZK A;  2CFB A;  1AKC A;  2GQN A;  3NYT A;  3AEL A;  2ZY5 A;  1SF2 A;  3G0T A;  1LK9 A;  3NRA A;  3DYD A;  3A9X A;  2YCT A;  4Q75 A;  3HBX A;  5IWQ A;  1QJ5 A;  2JJG A;  4GE7 A;  4AZJ A;  1O4S A;  1CS1 A;  1IJI A;  4ZAS A;  2D63 A;  1B5P A;  2VLH A;  3BB8 A;  1G4X A;  3WCN A;  5BJ3 A;  1BJN A;  4E3R A;  3VK3 A; 
#chains in the Genus database with same CATH homology
 1TAT A;  4JEX A;  2VMR A;  2C7T A;  2JG2 A;  4RM1 A;  1GC3 A;  3WGC A;  2R5E A;  1I43 A;  1OHW A;  3W1H A;  2D7Y A;  2A1V A;  3OP7 A;  3EZS A;  4E3Q A;  4TV7 A;  2VI8 A;  1Z3Z A;  3AEO A;  2VMT A;  4Q6R A;  1O69 A;  4XJP A;  4ZDL A;  4AO9 A;  2HOY A;  1CZC A;  2HUF A;  1WYV A;  1E5E A;  2D66 A;  1ECX A;  1WKG A;  2VMS A;  2Z67 A;  2AAT A;  1W23 A;  1C9C A;  2X8U A;  2DGK A;  4EU1 A;  1SZK A;  2VMO A;  2BI1 A;  4U1T A;  3QN6 A;  4R5Z A;  1CQ8 A;  3NU7 A;  2ZY4 A;  2CTZ A;  4XQ2 A;  2D7Z A;  4RKC A;  1BJO A;  4ZWV A;  3A2B A;  4Y0D A;  1BS0 A;  4ZWM A;  1KL2 A;  2VMY A;  3FSL A;  2C0R A;  3B1C A;  3JTX A;  4EB7 A;  5EIG B;  1YJS A;  3E2Z B;  4EFF A;  2EZ1 A;  2ZJG A;  1DTY A;  2E7J A;  2W7K A;  2EGY A;  2HOR A;  2VMW A;  4MY5 A;  3D6K A;  9AAT A;  1WST A;  1AY5 A;  3ELP A;  1AIB A;  2QB2 A;  3DXV A;  4OCA A;  3WGB A;  2W7E A;  1D2F A;  2AY6 A;  3LG0 A;  3MAD A;  3NUB A;  4UOY A;  5G2Q A;  4WP0 A;  1WKH A;  1X0M A;  2CAN A;  1GD9 A;  3IF2 A;  4MQR A;  4A0G A;  1AY4 A;  2BWP A;  4RAE A;  2YKY A;  5HXX A;  5G4J A;  2ORD A;  1ZC9 A;  2JJF A;  1D7S A;  1W7L A;  1UKJ A;  3FKD A;  2D65 A;  2YRR A;  2ZUK A;  1OXP A;  3MC6 C;  3NTJ A;  4JF1 A;  1ELU A;  2FYF A;  2YKV A;  4QGR A;  4A72 A;  2VMV A;  1RVU A;  3KGX A;  3PAA A;  3FZ8 A;  4OMA A;  5M4B A;  1ASL A;  1N2T A;  2HP1 A;  1GC2 A;  3DC1 A;  2CY8 A;  4Y0I A;  1O62 A;  2Z9V A;  2CJG A;  1AHY A;  1S09 A;  2CH1 A;  1J32 A;  5G09 A;  4A0H A;  1VJO A;  1CL1 A;  3DOD A;  2E54 A;  4JEV A;  4MGR A;  3AEJ A;  3RBF A;  3BWN A;  1LC8 A;  4NOG A;  1MAQ A;  2DKJ A;  1I29 A;  2VIB A;  4W91 A;  1AJR A;  4FFC A;  3N5M A;  4N0B A;  2C44 A;  3ZRQ A;  2WB6 A;  1V2F A;  2YHK A;  3CAI A;  3F6T A;  3WX9 A;  3FQ7 A;  4MKK A;  5M49 A;  4ZSW A;  3BWO A;  3RUY A;  1ART A;  1ASM A;  4IY7 A;  4JEY A;  5FT8 A;  2DR1 A;  3JW9 A;  3AOV A;  4ZSY A;  4ITG A;  2XH1 A;  1CQ7 A;  1IAY A;  4XEW A;  1BQA A;  1M0Q A;  5EIG A;  3WLX A;  1C7N A;  3E2Z A;  4RJY A;  2VIA A;  5E3K A;  3FVX A;  2W7G A;  4MSO A;  3QM2 A;  3FCR A;  4M2M A;  3RQ1 A;  4K2I A;  1KL1 A;  2QBT A;  5EFS A;  2VGW A;  2WKA A;  1XI9 A;  2HUI A;  3HLM A;  2AY7 A;  3PA9 A;  3B46 A;  1LS3 A;  1OHV A;  2ZY2 A;  4OC9 A;  4ADC A;  2X5F A;  4XK1 A;  3FQA A;  4OYT A;  3DR7 A;  3AEP A;  2W8J A;  4KYO A;  1AHG A;  1TOK A;  2EPJ A;  4MQQ A;  1W7M A;  4HVK A;  3TQX A;  4E1O A;  2HOZ A;  1ASN A;  2GMS A;  2W8T A;  2GSA A;  1V2E A;  3N4X A;  1H1C A;  4AH3 A;  3I16 A;  1M4N A;  3LVJ A;  5K8B A;  1C0N A;  1YNU A;  1AMR A;  4F5K A;  1LC7 A;  3DZZ A;  5J8Q A;  1M0N A;  2C81 A;  3CQ4 A;  1GC4 A;  4WLJ A;  2Z20 A;  1DKA A;  4IYO B;  2AEV A;  3EI9 A;  3NDN A;  2PB0 A;  4I8A A;  4IXO A;  2FQ6 A;  1TPL A;  2BI3 A;  2BYL A;  3A9Y A;  3LV2 A;  1M0P A;  4WYE A;  5G0A A;  1B4X A;  1TAS A;  4UHM A;  1ASG A;  4WYD A;  1CJ0 A;  2HUU A;  1GEY A;  2OAT A;  2EO5 A;  5EAA A;  1DJE A;  3RBL A;  2YKU A;  3FVU A;  2AY8 A;  3ATH A;  3L8A A;  1V2D A;  2D64 A;  1M32 A;  4Q31 A;  5F9S A;  4R5F A;  1YIZ A;  2Z9X A;  1QJ3 A;  1C7G A;  2CIN A;  3H14 A;  3AOW A;  1LKC A;  5E5I A;  1W3U A;  1C7O A;  1KMJ A;  5EAV A;  2AY1 A;  3GJU A;  4O6Z A;  3MEB A;  4AOA A;  5D95 A;  2D5Y A;  1ASF A;  1AKA A;  4L0O A;  1IAX A;  2JJH A;  1I41 A;  1VEF A;  3L44 A;  2BYJ A;  3WCO A;  5TF5 A;  4E77 A;  4OBU A;  2JGT A;  2R5C B;  2VMZ A;  4K05 A;  4LNL A;  4A6R A;  4PFF A;  4RKD A;  3RI6 A;  1E5F A;  1O61 A;  2HP2 A;  3EIB A;  3JWB A;  3ACZ A;  4XAU A;  2Z9W A;  3P6K A;  3MBB A;  1YAA A;  3N4R A;  2W7L A;  4WBT A;  4WYC A;  1AMQ A;  1FC4 A;  1T3I A;  2WK9 A;  8AAT A;  5I92 A;  4LNJ A;  1QIT A;  1MAP A;  1AIA A;  3DRD A;  1UU2 A;  1QGN A;  3PIU A;  4R2N A;  1ORD A;  2PO3 A;  2WK7 A;  3B8X A;  4XJO A;  2GMU A;  3PGY A;  1DGE A;  4UQV A;  4Q76 A;  1I48 A;  1CL2 A;  1B8G A;  1EG5 A;  4W5K A;  5LHA A;  3AEN B;  1ARS A;  1TAR A;  1GEX A;  2NMP A;  3EIA A;  3WKR A;  1AIC A;  4A00 A;  2QSR A;  1GC0 A;  2EYQ A;  2X5D A;  3FDD A;  1XEY A;  4U2H A;  4W1W A;  2DOU A;  3MAU A;  4ZM3 A;  3AEM A;  3II0 A;  2AY3 A;  1OAT A;  2JJE A;  3QI6 A;  4ZLV A;  3OKS A;  2X3L A;  3ASB A;  3BS8 A;  3EI7 A;  4JE5 A;  4IYO A;  3VAX A;  3NX3 A;  4R8D A;  2YCN A;  2W8U A;  3ECD A;  1ARI A;  1Y4I A;  4ZDP A;  1N8P A;  3TFT A;  4LNM A;  2BKW A;  2QA3 A;  3GZD C;  4TMR A;  2O7C A;  2Z9U A;  4F4E A;  3R9A A;  4WYF A;  4FL0 A;  1SZU A;  2XBN A;  5KTB A;  1MLY A;  3WKS A;  4CVQ A;  1SZS A;  4KAM A;  4UHO A;  4WYA A;  1BJ4 A;  4XJL A;  3A9Z A;  1KKP A;  2DGL A;  4WB0 B;  5M46 A;  1PG8 A;  3QHX A;  4J8L A;  2BWO A;  4J5U A;  1IUG A;  3NNK A;  3GR9 A;  4RJ0 A;  1SFF A;  4K2B A;  3HL2 A;  1BJW A;  3HT4 A;  2BIG A;  3BV0 A;  3NYU A;  4ZM4 A;  3KKI A;  4F5H A;  2ZSL A;  4XJM A;  2BWN A;  5FT5 A;  3GWP A;  2R5C A;  2W7I A;  1M7Y A;  3FVS A;  2BIA A;  4A0F A;  1JF9 A;  4F5I A;  1CQ6 A;  4CBS A;  5C6U A;  1ZOB A;  1D7U A;  4BA5 A;  1QIS A;  2TPL A;  3H7F A;  4W8I A;  3K7Y A;  3VP6 A;  3VK4 A;  1JS3 A;  4MKJ A;  4GRX A;  5JAY A;  2BHX A;  4F5G A;  1GBN A;  4N0W A;  3UAK A;  1FG7 A;  3BCX A;  3N75 A;  1ASE A;  1X2A A;  1AAW A;  1SPA A;  5DX5 A;  2FKI A;  4LC3 A;  2Z1Y A;  3BC8 A;  1CZE A;  3FFH A;  2DGM A;  1AMA A;  4CBR A;  2FNU A;  3DR4 A;  4ITX A;  3AEN A;  4A0R A;  1TOG A;  2VGU A;  3JU7 A;  3LY1 A;  2ZP7 A;  4PVF A;  2VMN A;  4H51 A;  4IW7 A;  5DJ9 A;  5EQC A;  1AHF A;  4DQ6 A;  1D7R A;  4HF8 A;  1TOJ A;  4ADD A;  1S07 A;  2FM1 A;  3LVK A;  4AO4 A;  1GDE A;  5EUE A;  4P7Y A;  4BA4 A;  5BJ4 A;  1QZ9 A;  4JE5 D;  2W7M A;  3DU4 A;  2DKB A;  4ISY A;  1IVR A;  3JWA A;  1JG8 A;  1MGV A;  3W1J A;  2FNI A;  1AJS B;  3COG A;  3UWC A;  4BHD A;  4F5L A;  3CBF A;  1IBJ A;  1RVY A;  4GDY A;  5F8V A;  4EMY A;  3ZRR A;  3ZZJ A;  3A8U X;  2BI2 A;  4ADB A;  2W7J A;  1OXO A;  3N0L A;  3NU8 A;  2D61 A;  4MQP A;  2FN6 A;  3HQT A;  3ISL A;  2HZP A;  2VYC A;  3MKJ A;  3P1T A;  4RIT A;  4WB0 A;  2W7F A;  1BW0 A;  1DGD A;  1AMS A;  1LC5 A;  2CJH A;  4KXK A;  4ATQ A;  1DJ9 A;  3MAF B;  5E4Z A;  5M4D A;  1S06 A;  2ZYJ A;  3BCB A;  3E77 A;  1S08 A;  1ASC A;  4RIZ A;  2AEU A;  1DJU A;  2VMU A;  2OKK A;  1LW4 A;  1ASD A;  3N4S A;  1BKG A;  4DBC A;  2VGV A;  5EUD A;  2KFP A;  4GSA A;  1YJY A;  3AV7 A;  2E7I A;  4IX8 A;  3GSB A;  5EUN A;  1AHE A;  3R4T A;  1B9I A;  4ZDO A;  1YIY A;  1GEW A;  1QIR A;  3EI6 A;  3RCH B;  3PD6 B;  3N7N A;  3LVM A;  1PMO A;  3AAT A;  3B1D A;  4LW2 A;  5AX8 A;  1S0A A;  3ZRP A;  1V72 A;  2EZ2 A;  5HDM A;  4M2K A;  4LW4 A;  2CH2 A;  1P3W A;  2VGZ A;  1WYT B;  4IXS A;  3WZF A;  3FRK A;  3WY7 A;  4Y0H A;  3HDO A;  1B9H A;  4ADE A;  2ZC0 A;  1MDO A;  5FT4 A;  3NUI A;  4F5M A;  3PDB B;  1RV3 A;  3UE8 A;  2VMQ A;  2ZY3 A;  1SVV A;  1G7X A;  2VGS A;  3AEM C;  3I4J A;  2PB2 A;  3EI5 A;  3TCM A;  2YCP A;  1M6S A;  1WYU B;  1G4V A;  4RLG A;  2Z1Z A;  1IX6 A;  3PDX A;  4W1X A;  3JZL A;  4ZAH A;  3E6G A;  3GBX A;  2OQX A;  2OGE A;  2O1B A;  2YOB A;  3FTB A;  3ZZK A;  2R0T A;  1AJS A;  2VMP A;  1UU0 A;  2CJD A;  5DB5 A;  4B98 A;  4UHN A;  1ARH A;  5G4I A;  2VMX A;  3AEJ C;  4JEZ A;  2W7D A;  3BWN C;  3E2Y A;  3DXW A;  1N31 A;  2OGA A;  3VK2 A;  3FD0 A;  1LW5 A;  1Z7D A;  2RFV A;  4OBV A;  4TN4 A;  2E7U A;  4WLH A;  3LVL B;  2G6W A;  4BMK A;  3F9T A;  4OTL A;  4GE9 A;  3IHJ A;  1VP4 A;  4CXQ A;  2EH6 A;  2YRI A;  2Z61 A;  2BIE A;  3ASA A;  3KGW A;  3MAF A;  1TOI A;  3QGU A;  1EJI A;  3EUC A;  4DGT A;  1UU1 A;  3ELE A;  2Q7W A;  4B9B A;  1AAM A;  2R2N A;  1ZOD A;  2CST A;  4WXB A;  1AHX A;  3MC6 A;  2QLR A;  1G7W A;  2GB3 A;  3H9X A;  3GET A;  1OHY A;  3QBO A;  1J04 A;  1BQD A;  2O0R A;  3EI8 A;  5G2P A;  4A6T A;  1ELQ A;  4F5F A;  1GCK A;  1MLZ A;  3Q8N A;  4BQ0 A;  4A6U A;  2V1P A;  5D5S A;  2F8J A;  2W8V A;  1ASA A;  1B5O A;  3VOM A;  4CXR A;  1IX8 A;  3G7Q A;  3GZC A;  3HMU A;  1EQB A;  1KKJ A;  3M5U A;  3RCH A;  1D7V A;  2G7J A;  3FZ6 A;  3GZD A;  3FFR A;  3PD6 A;  3B1E A;  4JF0 A;  3CQ5 A;  5DJ1 A;  3TFU A;  3QPG A;  2VI9 A;  4PIW A;  1H0C A;  1MDZ A;  4JEW A;  1WYV B;  1BT4 A;  3F0H A;  1WYT A;  2HOX A;  3CQ6 A;  4P3M A;  2QB3 A;  1ARG A;  4WXF A;  3NYS A;  1AKB A;  1PMM A;  3E2F A;  3E9K A;  1U08 A;  3FZ7 A;  1ASB A;  1X28 A;  3I5T A;  1C4K A;  3LWS A;  3PDB A;  4WD2 A;  1JS6 A;  5HHY A;  3USF A;  2W7H A;  3FDB A;  4W1V A;  2BI9 A;  2JIS A;  3KE3 A;  1TOE A;  1WYU A;  3HVY A;  2VLF A;  4GE4 A;  5LH9 A;  2OKJ A;  1YOO A;  4H63 Q;  3K28 A;  1BJO B;  2AY9 A;  3FQ8 A;  3PJ0 A;  4M2J A;  4F5J A;  4OT8 A;  2ZSM A;  1AX4 A;  2WK8 A;  3T32 A;  4EB5 A;  7AAT A;  2W8W A;  1FG3 A;  1PFF A;  2AY5 A;  2CB1 A;  3BN1 A;  2YKX A;  1X29 A;  2AY4 A;  4IXZ A;  5FT6 A;  2VGT A;  2V0Y A;  4PFN A;  2AY2 A;  4WXG A;  1AY8 A;  1RV4 A;  1IX7 A;  1MDX A;  3PPL A;  4K2M A;  2BI5 A;  4ATP A;  1M0O A;  3TAT A;  3EZ1 A;  1YJZ A;  1DFO A;  1W7N A;  3W1I A;  3K40 A;  4GEB A;  3BCA A;  1KMK A;  3G8M A;  2QMA A;  4WYG A;  4AZK A;  2CFB A;  1AKC A;  2GQN A;  3NYT A;  3AEL A;  2ZY5 A;  1SF2 A;  3G0T A;  1LK9 A;  3NRA A;  3DYD A;  3A9X A;  2YCT A;  4Q75 A;  3HBX A;  5IWQ A;  1QJ5 A;  2JJG A;  4GE7 A;  4AZJ A;  1O4S A;  1CS1 A;  1IJI A;  4ZAS A;  2D63 A;  1B5P A;  2VLH A;  3BB8 A;  1G4X A;  3WCN A;  5BJ3 A;  1BJN A;  4E3R A;  3VK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...