5FU0A

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
296
Chain Sequence
HHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric Competitive Inhibitors of the Glucose-1-Phosphate Thymidylyltransferase (Rmla) from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 101
structure length 296
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5fu0A00
2Z86A 1LVWA 4Y64A 1G23A 2VS5A 4EEAA 1JVDA 2AM3A 2E3DA 4KPZA 4C2SA 2X65A 2YC5A 3K8EA 5C36A 4M2AA 5C3DA 3BCVA 4AC3A 4D11A 2VFZA 2QH5A 3OGZA 1ZI5A 3OAMA 1H7QA 4FRPA 4IRQA 1H4CA 2OI5A 4B5BA 1H7EA 2FFUA 4FRBA 1PZTA 2XWMA 2I7BA 3PNNA 3R3IA 4CJCA 1FO9A 2Y4KA 1G3LA 2E8BA 1VZXA 2Y4JA 4YS8A 1ZI4A 4FRQA 3E26A 3ST8A 1V82A 2OEFA 4IRPA 3IOJA 1XHBA 1XZ6A 1Z90A 1ZCVA 4HG6A 1GWVA 1ZI1A 1WVCA 1H7GA 4FRDA 4P02A 4L41C 2PGVA 3F1CA 5EJ1A 1TW1A 1PZYB 1VPAA 4B2XA 4ARWA 1FGGA 3FWWA 3V0PA 2YQSA 3V8ZA 1LZIA 1O7QA 2VXLA 2RJ1A 1TW5A 4G3PA 1HV9A 2YCMA 5JQQA 1S4PA 4Y6NA 1K4VA 3I0EA 1R7YA 2AE7A 3K8DA 4EE5A 1ZCYA 1MC3A 3U0YA 4ECMA 4B4GA 1IIMA 4AAWA 1VH1A 3T7NA 4KC2A 1ZJ3A 4CJ8A 1G9RA 2RJ5A 3JTJA 4B4MA 4HO0A 3ZF8A 4FRMA 3SXDA 2APCA 3LW6A 1H5RA 3SXAA 4R7PA 4D48A 1ZJ0A 2D0JA 5AJPA 1ZCUA 1R7TA 2WGZA 4FRHA 1KWSA 3PKPA 4BMAA 4HO8A 1ZCTA 5AJNA 3JUJA 2OI7A 1WT1A 2AESA 2ZU9A 3SXEA 5C1LA 1G8OA 1QGSA 5EIYA 3DUVA 1HM9A 1G2VA 2JCLA 4G3SA 4B42A 1G93A 1WT3A 1H4EA 1VGWA 2DPWA 3JUKA 5C4CA 1ZIZA 1ZDFA 1ZDGA 2YESA 4KC4A 2P72A 5FYEA 2ZU8A 1GX4A 2RJ8A 3QVBA 1VZUA 2FYBA 2V0LA 2VSIA 1H3MA 4Y7UA 2YQCA 3U2UA 1VZTA 1WT0A 2OI6A 2YQHA 2UX8A 2W0VA 2FYAA 3I0FA 4CVHA 1TVYA 1QGQA 2ICXA 3Q80A 3SXGA 1VH3A 2PA4A 4KXOA 4EEMA 1I52A 4KQLA 4ASYA 4MYBA 4B3UA 3IOIA 3SX7A 5DDTA 4KT7A 3OH2A 1GWWA 1HM8A 2I5KA 3Q4SA 2BO4A 1WSZA 3I0GA 5CQPA 1W57A 3V0OA 4B2WA 5C1GA 3RSBA 5C4EA 3N9WA 1H5TB 4D0ZA 1LL0A 2W0WA 2V0JA 5J49A 4E1KA 1INJA 5EJZA 2VSHA 1O7OA 3CKQA 1G0RA 2GGOA 2WVKA 4HOCA 4G87A 2Y4LA 2QGIA 3OKRA 4UEGA 2FYCB 4HCQA 4FRLA 1H5SA 2O1HA 1VGUA 1FXJA 1ZJ2A 1JV3A 4D11C 3U0XA 2Y4MA 2BO7A 2AH9A 4HO4A 1FR9A 3CU0A 3NGWA 2XMHA 4XWIA 3USQA 5FV9A 5IFYA 5C3BA 5BXCA 2YQJA 4KPXA 1YP3A 1H7LA 3SX8A 1IINA 1FR8A 4LW6A 5CMIA 2Y7AA 1O23B 2D7IA 2RJ0A 3ZGGA 1ZJOA 1R7VA 4Y7FA 3T7MA 1FZWA 3F1YA 1S4OA 2V0KA 1EYRA 3U2WA 4G3QA 3V90A 4DECA 1VICA 1R82A 4KC1A 4ZDQA 3PKQA 3V0LA 3V0MA 5L6SA 2VD4A 5CQOA 2VS4A 1YP2A 2AECA 2XWLA 3V8YA 2BO8A 4EEOA 2VXMA 1VGZA 1H5SD 2A8UA 3OH3A 4EE3A 3ZLLA 5IDTA 5L6VA 2VS3A 2RIXA 5C4BA 4JISA 3I0LA 5C1HA 1NF5B 2RJ4A 5CMHA 3I0JA 2PGYA 4FCUA 1MP4A 2Y6PA 3E25A 2JCOA 3I0CA 2ICYA 1EZIA 2OEGA 3D8VA 2AM4A 1JYKA 4LW3A 4FCEA 4JD0A 2AM5A 4Y7GA 1GA8A 4Y7TA 2P73A 1INIA 1MP5A 1S4NA 2RIZA 4GBPA 2PX7A 3EE5A 1NMMB 3POLA 3FOQA 5C48A 1ZI3A 3SX3A 2WAWA 1FOAA 1H7FA 2XWNA 3DK5A 1FRWA 3I0IX 1YP4A 5C38A 3U2VA 3RMVA 4NALA 3CKJA 5FUHA 4M28A 3U2TA 2X5SA 3OH0A 1H5RB 1HM0A 4AYLA 2V0IA 1QG8A 1GX0A 3U2XA 4DDZA 4FRAA 4NANA 4M2BA 1MP3A 1V83A 1ZHJA 4HO9A 3OH4A 2FY7A 2NXVA 1LZ7A 1SS9A 4BQHA 1G95A 3OC9A 1G97A 4B4BA 1QWJA 3HL3A 1FXOA 1ZJPA 1E5KA 3I0DA 3TQDA 3RMWA 3ZGFA 1LZ0A 5I1FA 2YC3A 3V0QA 2X5ZA 1OQMB 1FG5N 1LL2A 2BO6A 2WE9A 4K6RA 5CMGX 3CKNA 2V0HA 2Z87A 3I0HA 1R7UA 3OH1A 5CQMX 1W77A 3R2WA 2I5EA 3O3PA 4ASJA 1GQ9A 5DDVA 2Q4JA 4Y9XA 2MZBA 1GQCA 1H4DA 4HO3A 1JV1A 5FTVA 3D5NA 2RJ7A 1VGTA 5IDSA 4FQWA 5FU0A 4Y7VA 4Y62A 3SPTA 4EEGA 4MNDA 5C49A 4P00A 2RITA 4NAIA 1NWGB 1FO8A 3D98A 3BRKX 4DE7A 2P6WA 1FGXA 5C47A 3TZTA 1H5SC 5FTSA 1JVGA 4Y63A 2FFVA 3CGXA 4HO2A 2CU2A 2GGQA 2X60A 1HJJA 4NAKA 2D7RA 3CKOA 1NKHB 2RJ6A 1LZJA 1ON8A 1LL3A 3V0NA 1HJLA 3CKVA 1H7HA 2XMEA 1H5SB 2AGDA 1G1LA 4J18A 3SX5A 5FU8A 1OMZA 2QKXA 4CJBA 2WVLA 5C8RA 3SXCA 5HS2A 2WEEA 3USRA 3Q7UA 5CQNX 1NQIB 1JYLA 4M4KA 1WT2A 2RIYA 1R7XA 1W55A 2JCJA 2O1FA 3T7OA 3IOHA 1ON6A 4EVWA 5C4DA 5AJOA 1H5TA 2O1GA 2WVMA 4Y6UA 1YROB 4KRVA 1TZFA 2JCKA 1NHEB 4EE4A 4FROA 4KNXA 3ZLKA 4D0TA 1FWYA 1R80A 2A8WA 3V91A 1V84A 4HO5A 1R81A 5CMFX 2RJ9A 1ZJ1A 3I0KA 3KIAA 5CMJA 1O0RA 1VM8A 2FYDB 4FREA 4AYJA 5CQLX 2ZU7A 3SXBA 3DJ4A 4HO6A 3GUEA 5C3AA 5C4FA 1H7TA 1OMXA 4KNRA
chains in the Genus database with same CATH superfamily
2Z86A 1LVWA 4Y64A 1G23A 2VS5A 4EEAA 1JVDA 2AM3A 2E3DA 4KPZA 4C2SA 2X65A 2YC5A 3K8EA 5C36A 4M2AA 5C3DA 3BCVA 4AC3A 4D11A 2VFZA 2QH5A 3OGZA 1ZI5A 3OAMA 1H7QA 4FRPA 4IRQA 1H4CA 2OI5A 4B5BA 1H7EA 2FFUA 4FRBA 1PZTA 2XWMA 2I7BA 3PNNA 3R3IA 4CJCA 1FO9A 2Y4KA 1G3LA 2E8BA 1VZXA 2Y4JA 4YS8A 1ZI4A 4FRQA 3E26A 3ST8A 1V82A 2OEFA 4IRPA 3IOJA 1XHBA 1XZ6A 1Z90A 1ZCVA 4HG6A 1GWVA 1ZI1A 1WVCA 1H7GA 4FRDA 4P02A 4L41C 2C0NA 2PGVA 3F1CA 5EJ1A 1TW1A 1PZYB 1VPAA 4B2XA 4ARWA 1FGGA 3FWWA 3V0PA 2YQSA 3V8ZA 1LZIA 1O7QA 2VXLA 2RJ1A 1TW5A 4G3PA 1HV9A 2YCMA 5JQQA 1S4PA 4Y6NA 1K4VA 3I0EA 1R7YA 2AE7A 3K8DA 4EE5A 1ZCYA 1MC3A 3U0YA 4ECMA 4B4GA 1IIMA 4AAWA 1VH1A 3T7NA 4KC2A 1ZJ3A 4CJ8A 1G9RA 2RJ5A 3JTJA 4B4MA 4HO0A 3ZF8A 4FRMA 3SXDA 2APCA 3LW6A 1H5RA 3SXAA 4R7PA 4D48A 1ZJ0A 2D0JA 5AJPA 1ZCUA 1R7TA 2WGZA 4FRHA 1KWSA 3PKPA 4BMAA 4HO8A 1ZCTA 5AJNA 3JUJA 2OI7A 1WT1A 5D91A 2AESA 2ZU9A 3SXEA 5C1LA 1G8OA 1QGSA 5EIYA 3DUVA 1HM9A 1G2VA 2JCLA 4G3SA 4B42A 1G93A 1WT3A 1H4EA 1VGWA 2DPWA 3JUKA 5C4CA 1ZIZA 1ZDFA 1ZDGA 2YESA 4KC4A 2P72A 5FYEA 2ZU8A 1GX4A 2RJ8A 3QVBA 1VZUA 2FYBA 2V0LA 2VSIA 1H3MA 4Y7UA 2YQCA 3U2UA 1VZTA 1WT0A 2OI6A 2YQHA 2UX8A 2W0VA 2FYAA 3I0FA 4CVHA 1TVYA 1QGQA 2ICXA 3Q80A 3SXGA 1VH3A 2PA4A 4KXOA 4EEMA 1I52A 4KQLA 4ASYA 4MYBA 4B3UA 3IOIA 3SX7A 5DDTA 4KT7A 3OH2A 1GWWA 1HM8A 2I5KA 3Q4SA 2BO4A 1WSZA 3I0GA 5CQPA 1W57A 3V0OA 4B2WA 5C1GA 3RSBA 5C4EA 3N9WA 1H5TB 4D0ZA 1LL0A 2W0WA 2V0JA 5J49A 5D92A 4E1KA 1INJA 5EJZA 2VSHA 1O7OA 3CKQA 1G0RA 2GGOA 2WVKA 4HOCA 4G87A 2Y4LA 2QGIA 3OKRA 4UEGA 2FYCB 4HCQA 4FRLA 1H5SA 4O6MA 2O1HA 1VGUA 1FXJA 1ZJ2A 4FIYA 1JV3A 4D11C 3U0XA 2Y4MA 2BO7A 2AH9A 4HO4A 1FR9A 3CU0A 3NGWA 2XMHA 4XWIA 3USQA 5FV9A 5IFYA 5C3BA 5BXCA 2YQJA 4KPXA 1YP3A 1H7LA 3SX8A 1IINA 1FR8A 4LW6A 5CMIA 2Y7AA 1O23B 2D7IA 2RJ0A 3ZGGA 1ZJOA 1R7VA 4Y7FA 3T7MA 1FZWA 3F1YA 1S4OA 2V0KA 1EYRA 3U2WA 4G3QA 3V90A 4DECA 1VICA 1R82A 4FIXA 4KC1A 4ZDQA 3PKQA 3V0LA 3V0MA 5L6SA 2VD4A 5CQOA 2VS4A 1YP2A 2AECA 2XWLA 3V8YA 2BO8A 4EEOA 2VXMA 1VGZA 1H5SD 2A8UA 3OH3A 4EE3A 3ZLLA 5IDTA 5L6VA 2VS3A 2RIXA 5C4BA 4JISA 3I0LA 5C1HA 1NF5B 2RJ4A 5CMHA 3I0JA 2PGYA 4FCUA 1MP4A 2Y6PA 3E25A 2JCOA 3I0CA 2ICYA 1EZIA 2OEGA 3D8VA 2AM4A 1JYKA 4LW3A 4FCEA 4JD0A 2AM5A 4Y7GA 1GA8A 4Y7TA 2P73A 1INIA 1MP5A 1S4NA 2RIZA 4GBPA 2PX7A 3EE5A 1NMMB 3POLA 3FOQA 5C48A 1ZI3A 3SX3A 2WAWA 1FOAA 1H7FA 2XWNA 3DK5A 1FRWA 3I0IX 1YP4A 5C38A 3U2VA 3RMVA 4NALA 3CKJA 5FUHA 4M28A 3U2TA 2X5SA 4MIXA 3OH0A 1H5RB 1HM0A 4AYLA 2V0IA 1QG8A 1GX0A 3U2XA 4DDZA 4FRAA 4NANA 4M2BA 1MP3A 1V83A 1ZHJA 4HO9A 3OH4A 2FY7A 2NXVA 1LZ7A 1SS9A 4BQHA 1G95A 3OC9A 1G97A 4B4BA 1QWJA 3HL3A 1FXOA 1ZJPA 1E5KA 3I0DA 3TQDA 3RMWA 3ZGFA 1LZ0A 5I1FA 2YC3A 3V0QA 2X5ZA 1OQMB 1FG5N 1LL2A 2BO6A 2WE9A 4K6RA 5CMGX 3CKNA 2V0HA 2Z87A 3I0HA 1R7UA 3OH1A 5CQMX 1W77A 4Q7CA 3R2WA 2I5EA 3O3PA 4ASJA 2J0AA 1GQ9A 5DDVA 2Q4JA 4Y9XA 2MZBA 1GQCA 1H4DA 4HO3A 1JV1A 5FTVA 3D5NA 2RJ7A 1VGTA 5IDSA 4FQWA 5FU0A 4Y7VA 4Y62A 3SPTA 4EEGA 4MNDA 5C49A 4P00A 2RITA 4NAIA 1NWGB 1FO8A 3BRKX 3D98A 4DE7A 2P6WA 1FGXA 5C47A 3TZTA 1H5SC 5FTSA 1JVGA 4Y63A 2FFVA 3CGXA 4HO2A 2CU2A 2GGQA 2X60A 1HJJA 4NAKA 2D7RA 3CKOA 1NKHB 2RJ6A 1LZJA 1ON8A 1LL3A 3V0NA 1HJLA 3CKVA 1H7HA 2XMEA 1H5SB 2AGDA 1G1LA 4J18A 3SX5A 5FU8A 1OMZA 2QKXA 4CJBA 2WVLA 5C8RA 3SXCA 5HS2A 2WEEA 3USRA 3Q7UA 5CQNX 1NQIB 1JYLA 2VK9A 4M4KA 1WT2A 2RIYA 1R7XA 1W55A 2JCJA 2O1FA 3T7OA 3IOHA 1ON6A 4EVWA 5C4DA 5AJOA 1H5TA 2O1GA 2WVMA 4Y6UA 1YROB 4KRVA 1TZFA 2JCKA 4O6NA 1NHEB 4EE4A 4FROA 4KNXA 3ZLKA 4D0TA 1FWYA 1R80A 2A8WA 2J0BA 3V91A 1V84A 4HO5A 1R81A 5CMFX 2RJ9A 1ZJ1A 3I0KA 3KIAA 5CMJA 1O0RA 1VM8A 2FYDB 4FREA 4AYJA 5CQLX 2ZU7A 3SXBA 3DJ4A 4HO6A 3GUEA 5C3AA 5C4FA 1H7TA 1OMXA 4KNRA
chains in the Genus database with same CATH topology
2Z86A 1LVWA 4Y64A 1G23A 2VS5A 4EEAA 1JVDA 2AM3A 2E3DA 4KPZA 4C2SA 2X65A 2YC5A 3K8EA 5C36A 4M2AA 5C3DA 3BCVA 4AC3A 4D11A 2VFZA 2QH5A 3OGZA 1ZI5A 3OAMA 1H7QA 4FRPA 4IRQA 1H4CA 2OI5A 4B5BA 1H7EA 2FFUA 4FRBA 1PZTA 2XWMA 2I7BA 3PNNA 3R3IA 4CJCA 1FO9A 2Y4KA 1G3LA 2E8BA 1VZXA 2Y4JA 4YS8A 1ZI4A 4FRQA 3E26A 3ST8A 1V82A 2OEFA 4IRPA 3IOJA 1XHBA 1XZ6A 1Z90A 1ZCVA 4HG6A 1GWVA 1ZI1A 1WVCA 1H7GA 4FRDA 4P02A 4L41C 2C0NA 2PGVA 3F1CA 5EJ1A 1TW1A 1PZYB 1VPAA 4B2XA 4ARWA 1FGGA 3FWWA 3V0PA 2YQSA 3V8ZA 1LZIA 1O7QA 2VXLA 2RJ1A 1TW5A 4G3PA 1HV9A 2YCMA 5JQQA 1S4PA 4Y6NA 1K4VA 3I0EA 1R7YA 2AE7A 3K8DA 4EE5A 1ZCYA 1MC3A 3U0YA 4ECMA 4B4GA 1IIMA 4AAWA 1VH1A 3T7NA 4KC2A 1ZJ3A 4CJ8A 1G9RA 2RJ5A 3JTJA 4B4MA 4HO0A 3ZF8A 4FRMA 3SXDA 2APCA 3LW6A 1H5RA 3SXAA 4R7PA 4D48A 1ZJ0A 2D0JA 5AJPA 1ZCUA 1R7TA 2WGZA 4FRHA 1KWSA 3PKPA 4BMAA 4HO8A 1ZCTA 5AJNA 3JUJA 2OI7A 1WT1A 5D91A 2AESA 2ZU9A 3SXEA 5C1LA 1G8OA 1QGSA 5EIYA 3DUVA 1HM9A 1G2VA 2JCLA 4G3SA 4B42A 1G93A 1WT3A 1H4EA 1VGWA 2DPWA 3JUKA 5C4CA 1ZIZA 1ZDFA 1ZDGA 2YESA 4KC4A 2P72A 5FYEA 2ZU8A 1GX4A 2RJ8A 3QVBA 1VZUA 2FYBA 2V0LA 2VSIA 1H3MA 4Y7UA 2YQCA 3U2UA 1VZTA 1WT0A 2OI6A 2YQHA 2UX8A 2W0VA 2FYAA 3I0FA 4CVHA 1TVYA 1QGQA 2ICXA 3Q80A 3SXGA 1VH3A 2PA4A 4KXOA 4EEMA 1I52A 4KQLA 4ASYA 4MYBA 4B3UA 3IOIA 3SX7A 5DDTA 4KT7A 3OH2A 1GWWA 1HM8A 2I5KA 3Q4SA 2BO4A 1WSZA 3I0GA 5CQPA 1W57A 3V0OA 4B2WA 5C1GA 3RSBA 5C4EA 3N9WA 1H5TB 4D0ZA 1LL0A 2W0WA 2V0JA 5J49A 5D92A 4E1KA 1INJA 5EJZA 2VSHA 1O7OA 3CKQA 1G0RA 2GGOA 2WVKA 4HOCA 4G87A 2Y4LA 2QGIA 3OKRA 4UEGA 2FYCB 4HCQA 4FRLA 1H5SA 4O6MA 2O1HA 1VGUA 1FXJA 1ZJ2A 4FIYA 1JV3A 4D11C 3U0XA 2Y4MA 2BO7A 2AH9A 4HO4A 1FR9A 3CU0A 3NGWA 2XMHA 4XWIA 3USQA 5FV9A 5IFYA 5C3BA 5BXCA 2YQJA 4KPXA 1YP3A 1H7LA 3SX8A 1IINA 1FR8A 4LW6A 5CMIA 2Y7AA 1O23B 2D7IA 2RJ0A 3ZGGA 1ZJOA 1R7VA 4Y7FA 3T7MA 1FZWA 3F1YA 1S4OA 2V0KA 1EYRA 3U2WA 4G3QA 3V90A 4DECA 1VICA 1R82A 4FIXA 4KC1A 4ZDQA 3PKQA 3V0LA 3V0MA 5L6SA 2VD4A 5CQOA 2VS4A 1YP2A 2AECA 2XWLA 3V8YA 2BO8A 4EEOA 2VXMA 1VGZA 1H5SD 2A8UA 3OH3A 4EE3A 3ZLLA 5IDTA 5L6VA 2VS3A 2RIXA 5C4BA 4JISA 3I0LA 5C1HA 1NF5B 2RJ4A 5CMHA 3I0JA 2PGYA 4FCUA 1MP4A 2Y6PA 3E25A 2JCOA 3I0CA 2ICYA 1EZIA 2OEGA 3D8VA 2AM4A 1JYKA 4LW3A 4FCEA 4JD0A 2AM5A 4Y7GA 1GA8A 4Y7TA 2P73A 1INIA 1MP5A 1S4NA 2RIZA 4GBPA 2PX7A 3EE5A 1NMMB 3POLA 3FOQA 5C48A 1ZI3A 3SX3A 2WAWA 1FOAA 1H7FA 2XWNA 3DK5A 1FRWA 3I0IX 1YP4A 5C38A 3U2VA 3RMVA 4NALA 3CKJA 5FUHA 4M28A 3U2TA 2X5SA 4MIXA 3OH0A 1H5RB 1HM0A 4AYLA 2V0IA 1QG8A 1GX0A 3U2XA 4DDZA 4FRAA 4NANA 4M2BA 1MP3A 1V83A 1ZHJA 4HO9A 3OH4A 2FY7A 2NXVA 1LZ7A 1SS9A 4BQHA 1G95A 3OC9A 1G97A 4B4BA 1QWJA 3HL3A 1FXOA 1ZJPA 1E5KA 3I0DA 3TQDA 3RMWA 3ZGFA 1LZ0A 5I1FA 2YC3A 3V0QA 2X5ZA 1OQMB 1FG5N 1LL2A 2BO6A 2WE9A 4K6RA 5CMGX 3CKNA 2V0HA 2Z87A 3I0HA 1R7UA 3OH1A 5CQMX 1W77A 4Q7CA 3R2WA 2I5EA 3O3PA 4ASJA 2J0AA 1GQ9A 5DDVA 2Q4JA 4Y9XA 2MZBA 1GQCA 1H4DA 4HO3A 1JV1A 5FTVA 3D5NA 2RJ7A 1VGTA 5IDSA 4FQWA 5FU0A 4Y7VA 4Y62A 3SPTA 4EEGA 4MNDA 5C49A 4P00A 2RITA 4NAIA 1NWGB 1FO8A 3BRKX 3D98A 4DE7A 2P6WA 1FGXA 5C47A 3TZTA 1H5SC 5FTSA 1JVGA 4Y63A 2FFVA 3CGXA 4HO2A 2CU2A 2GGQA 2X60A 1HJJA 4NAKA 2D7RA 3CKOA 1NKHB 2RJ6A 1LZJA 1ON8A 1LL3A 3V0NA 1HJLA 3CKVA 1H7HA 2XMEA 1H5SB 2AGDA 1G1LA 4J18A 3SX5A 5FU8A 1OMZA 2QKXA 4CJBA 2WVLA 5C8RA 3SXCA 5HS2A 2WEEA 3USRA 3Q7UA 5CQNX 1NQIB 1JYLA 2VK9A 4M4KA 1WT2A 2RIYA 1R7XA 1W55A 2JCJA 2O1FA 3T7OA 3IOHA 1ON6A 4EVWA 5C4DA 5AJOA 1H5TA 2O1GA 2WVMA 4Y6UA 1YROB 4KRVA 1TZFA 2JCKA 4O6NA 1NHEB 4EE4A 4FROA 4KNXA 3ZLKA 4D0TA 1FWYA 1R80A 2A8WA 2J0BA 3V91A 1V84A 4HO5A 1R81A 5CMFX 2RJ9A 1ZJ1A 3I0KA 3KIAA 5CMJA 1O0RA 1VM8A 2FYDB 4FREA 4AYJA 5CQLX 2ZU7A 3SXBA 3DJ4A 4HO6A 3GUEA 5C3AA 5C4FA 1H7TA 1OMXA 4KNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z86 A;  1LVW A;  4Y64 A;  1G23 A;  2VS5 A;  4EEA A;  1JVD A;  2AM3 A;  2E3D A;  4KPZ A;  4C2S A;  2X65 A;  2YC5 A;  3K8E A;  5C36 A;  4M2A A;  5C3D A;  3BCV A;  4AC3 A;  4D11 A;  2VFZ A;  2QH5 A;  3OGZ A;  1ZI5 A;  3OAM A;  1H7Q A;  4FRP A;  4IRQ A;  1H4C A;  2OI5 A;  4B5B A;  1H7E A;  2FFU A;  4FRB A;  1PZT A;  2XWM A;  2I7B A;  3PNN A;  3R3I A;  4CJC A;  1FO9 A;  2Y4K A;  1G3L A;  2E8B A;  1VZX A;  2Y4J A;  4YS8 A;  1ZI4 A;  4FRQ A;  3E26 A;  3ST8 A;  1V82 A;  2OEF A;  4IRP A;  3IOJ A;  1XHB A;  1XZ6 A;  1Z90 A;  1ZCV A;  4HG6 A;  1GWV A;  1ZI1 A;  1WVC A;  1H7G A;  4FRD A;  4P02 A;  4L41 C;  2PGV A;  3F1C A;  5EJ1 A;  1TW1 A;  1PZY B;  1VPA A;  4B2X A;  4ARW A;  1FGG A;  3FWW A;  3V0P A;  2YQS A;  3V8Z A;  1LZI A;  1O7Q A;  2VXL A;  2RJ1 A;  1TW5 A;  4G3P A;  1HV9 A;  2YCM A;  5JQQ A;  1S4P A;  4Y6N A;  1K4V A;  3I0E A;  1R7Y A;  2AE7 A;  3K8D A;  4EE5 A;  1ZCY A;  1MC3 A;  3U0Y A;  4ECM A;  4B4G A;  1IIM A;  4AAW A;  1VH1 A;  3T7N A;  4KC2 A;  1ZJ3 A;  4CJ8 A;  1G9R A;  2RJ5 A;  3JTJ A;  4B4M A;  4HO0 A;  3ZF8 A;  4FRM A;  3SXD A;  2APC A;  3LW6 A;  1H5R A;  3SXA A;  4R7P A;  4D48 A;  1ZJ0 A;  2D0J A;  5AJP A;  1ZCU A;  1R7T A;  2WGZ A;  4FRH A;  1KWS A;  3PKP A;  4BMA A;  4HO8 A;  1ZCT A;  5AJN A;  3JUJ A;  2OI7 A;  1WT1 A;  2AES A;  2ZU9 A;  3SXE A;  5C1L A;  1G8O A;  1QGS A;  5EIY A;  3DUV A;  1HM9 A;  1G2V A;  2JCL A;  4G3S A;  4B42 A;  1G93 A;  1WT3 A;  1H4E A;  1VGW A;  2DPW A;  3JUK A;  5C4C A;  1ZIZ A;  1ZDF A;  1ZDG A;  2YES A;  4KC4 A;  2P72 A;  5FYE A;  2ZU8 A;  1GX4 A;  2RJ8 A;  3QVB A;  1VZU A;  2FYB A;  2V0L A;  2VSI A;  1H3M A;  4Y7U A;  2YQC A;  3U2U A;  1VZT A;  1WT0 A;  2OI6 A;  2YQH A;  2UX8 A;  2W0V A;  2FYA A;  3I0F A;  4CVH A;  1TVY A;  1QGQ A;  2ICX A;  3Q80 A;  3SXG A;  1VH3 A;  2PA4 A;  4KXO A;  4EEM A;  1I52 A;  4KQL A;  4ASY A;  4MYB A;  4B3U A;  3IOI A;  3SX7 A;  5DDT A;  4KT7 A;  3OH2 A;  1GWW A;  1HM8 A;  2I5K A;  3Q4S A;  2BO4 A;  1WSZ A;  3I0G A;  5CQP A;  1W57 A;  3V0O A;  4B2W A;  5C1G A;  3RSB A;  5C4E A;  3N9W A;  1H5T B;  4D0Z A;  1LL0 A;  2W0W A;  2V0J A;  5J49 A;  4E1K A;  1INJ A;  5EJZ A;  2VSH A;  1O7O A;  3CKQ A;  1G0R A;  2GGO A;  2WVK A;  4HOC A;  4G87 A;  2Y4L A;  2QGI A;  3OKR A;  4UEG A;  2FYC B;  4HCQ A;  4FRL A;  1H5S A;  2O1H A;  1VGU A;  1FXJ A;  1ZJ2 A;  1JV3 A;  4D11 C;  3U0X A;  2Y4M A;  2BO7 A;  2AH9 A;  4HO4 A;  1FR9 A;  3CU0 A;  3NGW A;  2XMH A;  4XWI A;  3USQ A;  5FV9 A;  5IFY A;  5C3B A;  5BXC A;  2YQJ A;  4KPX A;  1YP3 A;  1H7L A;  3SX8 A;  1IIN A;  1FR8 A;  4LW6 A;  5CMI A;  2Y7A A;  1O23 B;  2D7I A;  2RJ0 A;  3ZGG A;  1ZJO A;  1R7V A;  4Y7F A;  3T7M A;  1FZW A;  3F1Y A;  1S4O A;  2V0K A;  1EYR A;  3U2W A;  4G3Q A;  3V90 A;  4DEC A;  1VIC A;  1R82 A;  4KC1 A;  4ZDQ A;  3PKQ A;  3V0L A;  3V0M A;  5L6S A;  2VD4 A;  5CQO A;  2VS4 A;  1YP2 A;  2AEC A;  2XWL A;  3V8Y A;  2BO8 A;  4EEO A;  2VXM A;  1VGZ A;  1H5S D;  2A8U A;  3OH3 A;  4EE3 A;  3ZLL A;  5IDT A;  5L6V A;  2VS3 A;  2RIX A;  5C4B A;  4JIS A;  3I0L A;  5C1H A;  1NF5 B;  2RJ4 A;  5CMH A;  3I0J A;  2PGY A;  4FCU A;  1MP4 A;  2Y6P A;  3E25 A;  2JCO A;  3I0C A;  2ICY A;  1EZI A;  2OEG A;  3D8V A;  2AM4 A;  1JYK A;  4LW3 A;  4FCE A;  4JD0 A;  2AM5 A;  4Y7G A;  1GA8 A;  4Y7T A;  2P73 A;  1INI A;  1MP5 A;  1S4N A;  2RIZ A;  4GBP A;  2PX7 A;  3EE5 A;  1NMM B;  3POL A;  3FOQ A;  5C48 A;  1ZI3 A;  3SX3 A;  2WAW A;  1FOA A;  1H7F A;  2XWN A;  3DK5 A;  1FRW A;  3I0I X;  1YP4 A;  5C38 A;  3U2V A;  3RMV A;  4NAL A;  3CKJ A;  5FUH A;  4M28 A;  3U2T A;  2X5S A;  3OH0 A;  1H5R B;  1HM0 A;  4AYL A;  2V0I A;  1QG8 A;  1GX0 A;  3U2X A;  4DDZ A;  4FRA A;  4NAN A;  4M2B A;  1MP3 A;  1V83 A;  1ZHJ A;  4HO9 A;  3OH4 A;  2FY7 A;  2NXV A;  1LZ7 A;  1SS9 A;  4BQH A;  1G95 A;  3OC9 A;  1G97 A;  4B4B A;  1QWJ A;  3HL3 A;  1FXO A;  1ZJP A;  1E5K A;  3I0D A;  3TQD A;  3RMW A;  3ZGF A;  1LZ0 A;  5I1F A;  2YC3 A;  3V0Q A;  2X5Z A;  1OQM B;  1FG5 N;  1LL2 A;  2BO6 A;  2WE9 A;  4K6R A;  5CMG X;  3CKN A;  2V0H A;  2Z87 A;  3I0H A;  1R7U A;  3OH1 A;  5CQM X;  1W77 A;  3R2W A;  2I5E A;  3O3P A;  4ASJ A;  1GQ9 A;  5DDV A;  2Q4J A;  4Y9X A;  2MZB A;  1GQC A;  1H4D A;  4HO3 A;  1JV1 A;  5FTV A;  3D5N A;  2RJ7 A;  1VGT A;  5IDS A;  4FQW A;  5FU0 A;  4Y7V A;  4Y62 A;  3SPT A;  4EEG A;  4MND A;  5C49 A;  4P00 A;  2RIT A;  4NAI A;  1NWG B;  1FO8 A;  3D98 A;  3BRK X;  4DE7 A;  2P6W A;  1FGX A;  5C47 A;  3TZT A;  1H5S C;  5FTS A;  1JVG A;  4Y63 A;  2FFV A;  3CGX A;  4HO2 A;  2CU2 A;  2GGQ A;  2X60 A;  1HJJ A;  4NAK A;  2D7R A;  3CKO A;  1NKH B;  2RJ6 A;  1LZJ A;  1ON8 A;  1LL3 A;  3V0N A;  1HJL A;  3CKV A;  1H7H A;  2XME A;  1H5S B;  2AGD A;  1G1L A;  4J18 A;  3SX5 A;  5FU8 A;  1OMZ A;  2QKX A;  4CJB A;  2WVL A;  5C8R A;  3SXC A;  5HS2 A;  2WEE A;  3USR A;  3Q7U A;  5CQN X;  1NQI B;  1JYL A;  4M4K A;  1WT2 A;  2RIY A;  1R7X A;  1W55 A;  2JCJ A;  2O1F A;  3T7O A;  3IOH A;  1ON6 A;  4EVW A;  5C4D A;  5AJO A;  1H5T A;  2O1G A;  2WVM A;  4Y6U A;  1YRO B;  4KRV A;  1TZF A;  2JCK A;  1NHE B;  4EE4 A;  4FRO A;  4KNX A;  3ZLK A;  4D0T A;  1FWY A;  1R80 A;  2A8W A;  3V91 A;  1V84 A;  4HO5 A;  1R81 A;  5CMF X;  2RJ9 A;  1ZJ1 A;  3I0K A;  3KIA A;  5CMJ A;  1O0R A;  1VM8 A;  2FYD B;  4FRE A;  4AYJ A;  5CQL X;  2ZU7 A;  3SXB A;  3DJ4 A;  4HO6 A;  3GUE A;  5C3A A;  5C4F A;  1H7T A;  1OMX A;  4KNR A; 
#chains in the Genus database with same CATH topology
 2Z86 A;  1LVW A;  4Y64 A;  1G23 A;  2VS5 A;  4EEA A;  1JVD A;  2AM3 A;  2E3D A;  4KPZ A;  4C2S A;  2X65 A;  2YC5 A;  3K8E A;  5C36 A;  4M2A A;  5C3D A;  3BCV A;  4AC3 A;  4D11 A;  2VFZ A;  2QH5 A;  3OGZ A;  1ZI5 A;  3OAM A;  1H7Q A;  4FRP A;  4IRQ A;  1H4C A;  2OI5 A;  4B5B A;  1H7E A;  2FFU A;  4FRB A;  1PZT A;  2XWM A;  2I7B A;  3PNN A;  3R3I A;  4CJC A;  1FO9 A;  2Y4K A;  1G3L A;  2E8B A;  1VZX A;  2Y4J A;  4YS8 A;  1ZI4 A;  4FRQ A;  3E26 A;  3ST8 A;  1V82 A;  2OEF A;  4IRP A;  3IOJ A;  1XHB A;  1XZ6 A;  1Z90 A;  1ZCV A;  4HG6 A;  1GWV A;  1ZI1 A;  1WVC A;  1H7G A;  4FRD A;  4P02 A;  4L41 C;  2C0N A;  2PGV A;  3F1C A;  5EJ1 A;  1TW1 A;  1PZY B;  1VPA A;  4B2X A;  4ARW A;  1FGG A;  3FWW A;  3V0P A;  2YQS A;  3V8Z A;  1LZI A;  1O7Q A;  2VXL A;  2RJ1 A;  1TW5 A;  4G3P A;  1HV9 A;  2YCM A;  5JQQ A;  1S4P A;  4Y6N A;  1K4V A;  3I0E A;  1R7Y A;  2AE7 A;  3K8D A;  4EE5 A;  1ZCY A;  1MC3 A;  3U0Y A;  4ECM A;  4B4G A;  1IIM A;  4AAW A;  1VH1 A;  3T7N A;  4KC2 A;  1ZJ3 A;  4CJ8 A;  1G9R A;  2RJ5 A;  3JTJ A;  4B4M A;  4HO0 A;  3ZF8 A;  4FRM A;  3SXD A;  2APC A;  3LW6 A;  1H5R A;  3SXA A;  4R7P A;  4D48 A;  1ZJ0 A;  2D0J A;  5AJP A;  1ZCU A;  1R7T A;  2WGZ A;  4FRH A;  1KWS A;  3PKP A;  4BMA A;  4HO8 A;  1ZCT A;  5AJN A;  3JUJ A;  2OI7 A;  1WT1 A;  5D91 A;  2AES A;  2ZU9 A;  3SXE A;  5C1L A;  1G8O A;  1QGS A;  5EIY A;  3DUV A;  1HM9 A;  1G2V A;  2JCL A;  4G3S A;  4B42 A;  1G93 A;  1WT3 A;  1H4E A;  1VGW A;  2DPW A;  3JUK A;  5C4C A;  1ZIZ A;  1ZDF A;  1ZDG A;  2YES A;  4KC4 A;  2P72 A;  5FYE A;  2ZU8 A;  1GX4 A;  2RJ8 A;  3QVB A;  1VZU A;  2FYB A;  2V0L A;  2VSI A;  1H3M A;  4Y7U A;  2YQC A;  3U2U A;  1VZT A;  1WT0 A;  2OI6 A;  2YQH A;  2UX8 A;  2W0V A;  2FYA A;  3I0F A;  4CVH A;  1TVY A;  1QGQ A;  2ICX A;  3Q80 A;  3SXG A;  1VH3 A;  2PA4 A;  4KXO A;  4EEM A;  1I52 A;  4KQL A;  4ASY A;  4MYB A;  4B3U A;  3IOI A;  3SX7 A;  5DDT A;  4KT7 A;  3OH2 A;  1GWW A;  1HM8 A;  2I5K A;  3Q4S A;  2BO4 A;  1WSZ A;  3I0G A;  5CQP A;  1W57 A;  3V0O A;  4B2W A;  5C1G A;  3RSB A;  5C4E A;  3N9W A;  1H5T B;  4D0Z A;  1LL0 A;  2W0W A;  2V0J A;  5J49 A;  5D92 A;  4E1K A;  1INJ A;  5EJZ A;  2VSH A;  1O7O A;  3CKQ A;  1G0R A;  2GGO A;  2WVK A;  4HOC A;  4G87 A;  2Y4L A;  2QGI A;  3OKR A;  4UEG A;  2FYC B;  4HCQ A;  4FRL A;  1H5S A;  4O6M A;  2O1H A;  1VGU A;  1FXJ A;  1ZJ2 A;  4FIY A;  1JV3 A;  4D11 C;  3U0X A;  2Y4M A;  2BO7 A;  2AH9 A;  4HO4 A;  1FR9 A;  3CU0 A;  3NGW A;  2XMH A;  4XWI A;  3USQ A;  5FV9 A;  5IFY A;  5C3B A;  5BXC A;  2YQJ A;  4KPX A;  1YP3 A;  1H7L A;  3SX8 A;  1IIN A;  1FR8 A;  4LW6 A;  5CMI A;  2Y7A A;  1O23 B;  2D7I A;  2RJ0 A;  3ZGG A;  1ZJO A;  1R7V A;  4Y7F A;  3T7M A;  1FZW A;  3F1Y A;  1S4O A;  2V0K A;  1EYR A;  3U2W A;  4G3Q A;  3V90 A;  4DEC A;  1VIC A;  1R82 A;  4FIX A;  4KC1 A;  4ZDQ A;  3PKQ A;  3V0L A;  3V0M A;  5L6S A;  2VD4 A;  5CQO A;  2VS4 A;  1YP2 A;  2AEC A;  2XWL A;  3V8Y A;  2BO8 A;  4EEO A;  2VXM A;  1VGZ A;  1H5S D;  2A8U A;  3OH3 A;  4EE3 A;  3ZLL A;  5IDT A;  5L6V A;  2VS3 A;  2RIX A;  5C4B A;  4JIS A;  3I0L A;  5C1H A;  1NF5 B;  2RJ4 A;  5CMH A;  3I0J A;  2PGY A;  4FCU A;  1MP4 A;  2Y6P A;  3E25 A;  2JCO A;  3I0C A;  2ICY A;  1EZI A;  2OEG A;  3D8V A;  2AM4 A;  1JYK A;  4LW3 A;  4FCE A;  4JD0 A;  2AM5 A;  4Y7G A;  1GA8 A;  4Y7T A;  2P73 A;  1INI A;  1MP5 A;  1S4N A;  2RIZ A;  4GBP A;  2PX7 A;  3EE5 A;  1NMM B;  3POL A;  3FOQ A;  5C48 A;  1ZI3 A;  3SX3 A;  2WAW A;  1FOA A;  1H7F A;  2XWN A;  3DK5 A;  1FRW A;  3I0I X;  1YP4 A;  5C38 A;  3U2V A;  3RMV A;  4NAL A;  3CKJ A;  5FUH A;  4M28 A;  3U2T A;  2X5S A;  4MIX A;  3OH0 A;  1H5R B;  1HM0 A;  4AYL A;  2V0I A;  1QG8 A;  1GX0 A;  3U2X A;  4DDZ A;  4FRA A;  4NAN A;  4M2B A;  1MP3 A;  1V83 A;  1ZHJ A;  4HO9 A;  3OH4 A;  2FY7 A;  2NXV A;  1LZ7 A;  1SS9 A;  4BQH A;  1G95 A;  3OC9 A;  1G97 A;  4B4B A;  1QWJ A;  3HL3 A;  1FXO A;  1ZJP A;  1E5K A;  3I0D A;  3TQD A;  3RMW A;  3ZGF A;  1LZ0 A;  5I1F A;  2YC3 A;  3V0Q A;  2X5Z A;  1OQM B;  1FG5 N;  1LL2 A;  2BO6 A;  2WE9 A;  4K6R A;  5CMG X;  3CKN A;  2V0H A;  2Z87 A;  3I0H A;  1R7U A;  3OH1 A;  5CQM X;  1W77 A;  4Q7C A;  3R2W A;  2I5E A;  3O3P A;  4ASJ A;  2J0A A;  1GQ9 A;  5DDV A;  2Q4J A;  4Y9X A;  2MZB A;  1GQC A;  1H4D A;  4HO3 A;  1JV1 A;  5FTV A;  3D5N A;  2RJ7 A;  1VGT A;  5IDS A;  4FQW A;  5FU0 A;  4Y7V A;  4Y62 A;  3SPT A;  4EEG A;  4MND A;  5C49 A;  4P00 A;  2RIT A;  4NAI A;  1NWG B;  1FO8 A;  3BRK X;  3D98 A;  4DE7 A;  2P6W A;  1FGX A;  5C47 A;  3TZT A;  1H5S C;  5FTS A;  1JVG A;  4Y63 A;  2FFV A;  3CGX A;  4HO2 A;  2CU2 A;  2GGQ A;  2X60 A;  1HJJ A;  4NAK A;  2D7R A;  3CKO A;  1NKH B;  2RJ6 A;  1LZJ A;  1ON8 A;  1LL3 A;  3V0N A;  1HJL A;  3CKV A;  1H7H A;  2XME A;  1H5S B;  2AGD A;  1G1L A;  4J18 A;  3SX5 A;  5FU8 A;  1OMZ A;  2QKX A;  4CJB A;  2WVL A;  5C8R A;  3SXC A;  5HS2 A;  2WEE A;  3USR A;  3Q7U A;  5CQN X;  1NQI B;  1JYL A;  2VK9 A;  4M4K A;  1WT2 A;  2RIY A;  1R7X A;  1W55 A;  2JCJ A;  2O1F A;  3T7O A;  3IOH A;  1ON6 A;  4EVW A;  5C4D A;  5AJO A;  1H5T A;  2O1G A;  2WVM A;  4Y6U A;  1YRO B;  4KRV A;  1TZF A;  2JCK A;  4O6N A;  1NHE B;  4EE4 A;  4FRO A;  4KNX A;  3ZLK A;  4D0T A;  1FWY A;  1R80 A;  2A8W A;  2J0B A;  3V91 A;  1V84 A;  4HO5 A;  1R81 A;  5CMF X;  2RJ9 A;  1ZJ1 A;  3I0K A;  3KIA A;  5CMJ A;  1O0R A;  1VM8 A;  2FYD B;  4FRE A;  4AYJ A;  5CQL X;  2ZU7 A;  3SXB A;  3DJ4 A;  4HO6 A;  3GUE A;  5C3A A;  5C4F A;  1H7T A;  1OMX A;  4KNR A; 
#chains in the Genus database with same CATH homology
 2Z86 A;  1LVW A;  4Y64 A;  1G23 A;  2VS5 A;  4EEA A;  1JVD A;  2AM3 A;  2E3D A;  4KPZ A;  4C2S A;  2X65 A;  2YC5 A;  3K8E A;  5C36 A;  4M2A A;  5C3D A;  3BCV A;  4AC3 A;  4D11 A;  2VFZ A;  2QH5 A;  3OGZ A;  1ZI5 A;  3OAM A;  1H7Q A;  4FRP A;  4IRQ A;  1H4C A;  2OI5 A;  4B5B A;  1H7E A;  2FFU A;  4FRB A;  1PZT A;  2XWM A;  2I7B A;  3PNN A;  3R3I A;  4CJC A;  1FO9 A;  2Y4K A;  1G3L A;  2E8B A;  1VZX A;  2Y4J A;  4YS8 A;  1ZI4 A;  4FRQ A;  3E26 A;  3ST8 A;  1V82 A;  2OEF A;  4IRP A;  3IOJ A;  1XHB A;  1XZ6 A;  1Z90 A;  1ZCV A;  4HG6 A;  1GWV A;  1ZI1 A;  1WVC A;  1H7G A;  4FRD A;  4P02 A;  4L41 C;  2C0N A;  2PGV A;  3F1C A;  5EJ1 A;  1TW1 A;  1PZY B;  1VPA A;  4B2X A;  4ARW A;  1FGG A;  3FWW A;  3V0P A;  2YQS A;  3V8Z A;  1LZI A;  1O7Q A;  2VXL A;  2RJ1 A;  1TW5 A;  4G3P A;  1HV9 A;  2YCM A;  5JQQ A;  1S4P A;  4Y6N A;  1K4V A;  3I0E A;  1R7Y A;  2AE7 A;  3K8D A;  4EE5 A;  1ZCY A;  1MC3 A;  3U0Y A;  4ECM A;  4B4G A;  1IIM A;  4AAW A;  1VH1 A;  3T7N A;  4KC2 A;  1ZJ3 A;  4CJ8 A;  1G9R A;  2RJ5 A;  3JTJ A;  4B4M A;  4HO0 A;  3ZF8 A;  4FRM A;  3SXD A;  2APC A;  3LW6 A;  1H5R A;  3SXA A;  4R7P A;  4D48 A;  1ZJ0 A;  2D0J A;  5AJP A;  1ZCU A;  1R7T A;  2WGZ A;  4FRH A;  1KWS A;  3PKP A;  4BMA A;  4HO8 A;  1ZCT A;  5AJN A;  3JUJ A;  2OI7 A;  1WT1 A;  5D91 A;  2AES A;  2ZU9 A;  3SXE A;  5C1L A;  1G8O A;  1QGS A;  5EIY A;  3DUV A;  1HM9 A;  1G2V A;  2JCL A;  4G3S A;  4B42 A;  1G93 A;  1WT3 A;  1H4E A;  1VGW A;  2DPW A;  3JUK A;  5C4C A;  1ZIZ A;  1ZDF A;  1ZDG A;  2YES A;  4KC4 A;  2P72 A;  5FYE A;  2ZU8 A;  1GX4 A;  2RJ8 A;  3QVB A;  1VZU A;  2FYB A;  2V0L A;  2VSI A;  1H3M A;  4Y7U A;  2YQC A;  3U2U A;  1VZT A;  1WT0 A;  2OI6 A;  2YQH A;  2UX8 A;  2W0V A;  2FYA A;  3I0F A;  4CVH A;  1TVY A;  1QGQ A;  2ICX A;  3Q80 A;  3SXG A;  1VH3 A;  2PA4 A;  4KXO A;  4EEM A;  1I52 A;  4KQL A;  4ASY A;  4MYB A;  4B3U A;  3IOI A;  3SX7 A;  5DDT A;  4KT7 A;  3OH2 A;  1GWW A;  1HM8 A;  2I5K A;  3Q4S A;  2BO4 A;  1WSZ A;  3I0G A;  5CQP A;  1W57 A;  3V0O A;  4B2W A;  5C1G A;  3RSB A;  5C4E A;  3N9W A;  1H5T B;  4D0Z A;  1LL0 A;  2W0W A;  2V0J A;  5J49 A;  5D92 A;  4E1K A;  1INJ A;  5EJZ A;  2VSH A;  1O7O A;  3CKQ A;  1G0R A;  2GGO A;  2WVK A;  4HOC A;  4G87 A;  2Y4L A;  2QGI A;  3OKR A;  4UEG A;  2FYC B;  4HCQ A;  4FRL A;  1H5S A;  4O6M A;  2O1H A;  1VGU A;  1FXJ A;  1ZJ2 A;  4FIY A;  1JV3 A;  4D11 C;  3U0X A;  2Y4M A;  2BO7 A;  2AH9 A;  4HO4 A;  1FR9 A;  3CU0 A;  3NGW A;  2XMH A;  4XWI A;  3USQ A;  5FV9 A;  5IFY A;  5C3B A;  5BXC A;  2YQJ A;  4KPX A;  1YP3 A;  1H7L A;  3SX8 A;  1IIN A;  1FR8 A;  4LW6 A;  5CMI A;  2Y7A A;  1O23 B;  2D7I A;  2RJ0 A;  3ZGG A;  1ZJO A;  1R7V A;  4Y7F A;  3T7M A;  1FZW A;  3F1Y A;  1S4O A;  2V0K A;  1EYR A;  3U2W A;  4G3Q A;  3V90 A;  4DEC A;  1VIC A;  1R82 A;  4FIX A;  4KC1 A;  4ZDQ A;  3PKQ A;  3V0L A;  3V0M A;  5L6S A;  2VD4 A;  5CQO A;  2VS4 A;  1YP2 A;  2AEC A;  2XWL A;  3V8Y A;  2BO8 A;  4EEO A;  2VXM A;  1VGZ A;  1H5S D;  2A8U A;  3OH3 A;  4EE3 A;  3ZLL A;  5IDT A;  5L6V A;  2VS3 A;  2RIX A;  5C4B A;  4JIS A;  3I0L A;  5C1H A;  1NF5 B;  2RJ4 A;  5CMH A;  3I0J A;  2PGY A;  4FCU A;  1MP4 A;  2Y6P A;  3E25 A;  2JCO A;  3I0C A;  2ICY A;  1EZI A;  2OEG A;  3D8V A;  2AM4 A;  1JYK A;  4LW3 A;  4FCE A;  4JD0 A;  2AM5 A;  4Y7G A;  1GA8 A;  4Y7T A;  2P73 A;  1INI A;  1MP5 A;  1S4N A;  2RIZ A;  4GBP A;  2PX7 A;  3EE5 A;  1NMM B;  3POL A;  3FOQ A;  5C48 A;  1ZI3 A;  3SX3 A;  2WAW A;  1FOA A;  1H7F A;  2XWN A;  3DK5 A;  1FRW A;  3I0I X;  1YP4 A;  5C38 A;  3U2V A;  3RMV A;  4NAL A;  3CKJ A;  5FUH A;  4M28 A;  3U2T A;  2X5S A;  4MIX A;  3OH0 A;  1H5R B;  1HM0 A;  4AYL A;  2V0I A;  1QG8 A;  1GX0 A;  3U2X A;  4DDZ A;  4FRA A;  4NAN A;  4M2B A;  1MP3 A;  1V83 A;  1ZHJ A;  4HO9 A;  3OH4 A;  2FY7 A;  2NXV A;  1LZ7 A;  1SS9 A;  4BQH A;  1G95 A;  3OC9 A;  1G97 A;  4B4B A;  1QWJ A;  3HL3 A;  1FXO A;  1ZJP A;  1E5K A;  3I0D A;  3TQD A;  3RMW A;  3ZGF A;  1LZ0 A;  5I1F A;  2YC3 A;  3V0Q A;  2X5Z A;  1OQM B;  1FG5 N;  1LL2 A;  2BO6 A;  2WE9 A;  4K6R A;  5CMG X;  3CKN A;  2V0H A;  2Z87 A;  3I0H A;  1R7U A;  3OH1 A;  5CQM X;  1W77 A;  4Q7C A;  3R2W A;  2I5E A;  3O3P A;  4ASJ A;  2J0A A;  1GQ9 A;  5DDV A;  2Q4J A;  4Y9X A;  2MZB A;  1GQC A;  1H4D A;  4HO3 A;  1JV1 A;  5FTV A;  3D5N A;  2RJ7 A;  1VGT A;  5IDS A;  4FQW A;  5FU0 A;  4Y7V A;  4Y62 A;  3SPT A;  4EEG A;  4MND A;  5C49 A;  4P00 A;  2RIT A;  4NAI A;  1NWG B;  1FO8 A;  3BRK X;  3D98 A;  4DE7 A;  2P6W A;  1FGX A;  5C47 A;  3TZT A;  1H5S C;  5FTS A;  1JVG A;  4Y63 A;  2FFV A;  3CGX A;  4HO2 A;  2CU2 A;  2GGQ A;  2X60 A;  1HJJ A;  4NAK A;  2D7R A;  3CKO A;  1NKH B;  2RJ6 A;  1LZJ A;  1ON8 A;  1LL3 A;  3V0N A;  1HJL A;  3CKV A;  1H7H A;  2XME A;  1H5S B;  2AGD A;  1G1L A;  4J18 A;  3SX5 A;  5FU8 A;  1OMZ A;  2QKX A;  4CJB A;  2WVL A;  5C8R A;  3SXC A;  5HS2 A;  2WEE A;  3USR A;  3Q7U A;  5CQN X;  1NQI B;  1JYL A;  2VK9 A;  4M4K A;  1WT2 A;  2RIY A;  1R7X A;  1W55 A;  2JCJ A;  2O1F A;  3T7O A;  3IOH A;  1ON6 A;  4EVW A;  5C4D A;  5AJO A;  1H5T A;  2O1G A;  2WVM A;  4Y6U A;  1YRO B;  4KRV A;  1TZF A;  2JCK A;  4O6N A;  1NHE B;  4EE4 A;  4FRO A;  4KNX A;  3ZLK A;  4D0T A;  1FWY A;  1R80 A;  2A8W A;  2J0B A;  3V91 A;  1V84 A;  4HO5 A;  1R81 A;  5CMF X;  2RJ9 A;  1ZJ1 A;  3I0K A;  3KIA A;  5CMJ A;  1O0R A;  1VM8 A;  2FYD B;  4FRE A;  4AYJ A;  5CQL X;  2ZU7 A;  3SXB A;  3DJ4 A;  4HO6 A;  3GUE A;  5C3A A;  5C4F A;  1H7T A;  1OMX A;  4KNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...