5FU6B

Not module of the human ccr4-not complex (crystallization mutant)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
192
structure length
192
Chain Sequence
b'EMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 31
structure length 192
sequence length 192
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu6B00
4BY6C 4C0DC 5FU7B 5FU7C 4BY6B 4C0DB 4C0GA 4C0FA 5FU6B 5FU6C
chains in the Genus database with same CATH superfamily
4C92E 3L2QA 2JT4A 1K0XA 2F2WA 2OAUA 2EYWA 1B3QA 3C4SA 3FJ5A 1WX6A 1V76A 4C8QF 1NEGA 4C0GA 2DBKA 2GQIA 3GIBA 1YJWA 1VQNT 1FX7A 3M58A 2ZAEA 1B7TA 3OS5A 3EFRA 4IUUA 5L23A 4AG2C 2DTIA 3CCLT 1G3SA 3NFCA 5GAN4 1QVGS 2H3JA 2R58A 4F16A 1QQJA 3CCRT 3G71T 1S1NA 1KD1U 1WXTA 2DIQA 2HL5C 1PM3A 5FU7C 2KROA 2A3LA 5LJ5j 4BE1A 2GTOA 4ZGEB 8AT1B 2EYQA 1TXQA 3QJYA 5AYFA 1ZBJA 1BU1A 3CCEQ 1HYOA 5GMKm 4EMKC 2JW4A 2LC4A 3MEAA 2LNVA 2G3RA 5CKDA 4LN2A 2RA2A 2YXYA 1M3AA 4JLGA 2ZCFB 3JCMb 2RI2A 3QIIA 2E4HA 2RN8A 4RTWA 3OS2A 1D0ZA 1RUWA 3CCSA 1FMVA 4LDYA 4C92C 2K79A 1FWZA 2LT4A 4PK4A 2X35A 3MP1A 4LDXA 1NYGA 3PFSA 2LQKA 2DVJA 4C8QA 5LJ3e 4PLIA 4PFOA 4J7FA 2NUPB 1W1FA 1VQMQ 1XJWB 1HXDA 2DPPB 2K2VA 1IGQA 1EX4A 4OB1B 2KRMA 2HDAA 1JXMA 3O8VA 4Z8AA 3SB2A 4IUPA 4E7LA 1VQ9Q 3MHXA 1WQ7A 1VQ6Q 2CKKA 1QVGA 1LJOA 2FHDA 1E7OA 3DKMA 1VQ5A 3V7RA 1SEMA 1RL2A 2J6KA 4HXJA 4IKFA 2PNIA 1RAIB 2QDYB 1SSFA 2COZA 2L5QA 2X4XA 1IXDA 3CC2Q 2DXBA 2VKNA 1VQKQ 1CKBA 1RACB 3RBBB 3VYGA 2M0OA 3EGDB 1YP5A 4XTVA 2DTOA 2EAYA 3V7CA 1K8AU 2K7AA 1MV3A 3I5SA 4BI3A 2KMTA 1RI9A 3HKSA 4ESRA 1N27A 5GANf 4L59A 1NJIR 1WXUA 3MKDA 1VQ8Q 5LJ5e 4O6JA 2KRSA 2DE0X 3SWNA 2YUOA 2M1HA 2PVDB 3X24B 3JRZA 2XI9A 1Q86C 1H3ZA 2EYXA 3QKJA 4J6WA 2QQRA 4QQ6A 4JZ4A 2CP5A 1VUBA 1QVPA 2LJ1A 2JTFA 4JRPA 5HK3A 1E6HA 1G2BA 5KYXB 1Y96A 1O75A 4L6V5 4OGEA 3RUXA 2YDLA 3DLMA 1EFNA 3I55A 1N9RA 2X3XD 2K3YA 2QAZA 1JXOA 1JJ2S 2RI3A 3BDUA 4JS5A 4IIMA 3I56T 1XQHA 1YITA 4GLMA 2A7YA 4AFSC 2X3WD 2CUDA 4CC3A 2WACA 1O9SA 2FZKB 4Y91A 1UE9A 3QWXX 1YHQT 2XDPA 4FSSA 2QQSA 2O01E 1H92A 2DLPA 5FW9A 2QGGA 5FROA 4C92D 5GAMj 4M7AE 1TG0A 3JV3A 1K4US 5CR2A 2RJEA 2DEUA 1X6BA 4WTOB 3KXTA 1BI1A 2CZ6B 2QQ9A 4TVRA 5CKFA 2CZ1B 4PJNA 2JXBA 3R6OA 2JOYA 2LX7A 4WCIA 4C5EA 2LP5A 3H8ZA 1PC0A 4X34A 1M27C 4RKUE 3GPLA 4NL3A 5GAN7 2EQJA 2BZ8A 5LJ3h 1AEYA 1VQLT 1WI7A 4KGVB 4XTWA 3EGUA 3C95A 3AHUA 2HD0A 3KUFA 5J26A 2ED1A 3NTHA 4X9CA 1U3OA 2XICA 3QWYA 1Y0MA 2CZ7B 3UPUA 3JB9D 4QT7A 3KBGA 2E3HA 2KI7A 4OF1A 3HL8A 3EG9B 1IRXA 3E9FA 4C8QB 5GAOm 2DJQA 9ATCB 2MIOA 3JCMc 5GANe 2HNIA 1JJ2A 2FZGB 3CCEA 3VS6A 3MP6A 1YN8A 1RAAB 3EG0A 4LDWA 2A37A 4XU1A 4GY5A 4PLLA 2QA4Q 3QZ5B 1H3HA 2KY9A 1PKSA 3PNWC 1ZSZA 2J05A 4C8QG 3L2WA 1FXXA 1UGQB 2DL4A 3CMET 4MMKA 3G4SQ 4OB2B 1KQ1A 2EPDA 4ZGDB 3CD6T 1ZUKA 2D0QB 4KGXB 2K5LA 2KDSA 1D1CA 1PG5B 1JQQA 2RHYA 1YBYA 1RAHB 2DAQA 2DILA 1MMGA 4A4GA 1VQMA 1ABQA 2XK0A 2CH4A 2LRQA 1YCYA 2BZYA 4E7HA 2K5FA 5LJ3g 4XU0A 5GAMe 1U8RA 1VQ9A 4M75F 1QP3A 3OMGA 3NPFA 2CGHA 2EGAA 1VQ6A 5KYNA 5KYWB 2B8AA 3LWHA 1UJYA 4KRTA 4D6WA 1NZ9A 3QBYA 4Z02A 3SWNB 3QDRB 2LCSA 2ZGWA 2KK4A 2EIFA 2ZPFB 4M4ZA 2A28A 1GBQA 1ZA1B 2EYYA 4ELYC 1Z9QA 2FEIA 3I5RA 2GTJA 1I4K1 2LZ6B 4DBQA 2RO0A 4J9GA 2RQVA 3RMQA 4A4FA 3CC2A 2EYZA 2GBQA 1VQKA 2X4JA 2OTJT 1AWXA 1KQSS 3DB4A 1Y96B 2D0NA 4RUGA 4VUBA 1K73U 1MNEA 1NPPA 1Q7YC 3IQLA 4OMPA 4J9IA 1V29B 4PJOF 5C6SA 1VQ8A 1QKWA 1QKXA 2L3SA 4A63B 4N0AC 2JN0A 2NUZA 3HHTB 2X51A 3RNJA 1Y7XA 3CCVT 4XK8E 4EDUA 5A0LA 1AWOA 5LJ5g 3MCAB 3HPWA 3OYGA 1Y07A 1NJIU 3FJPA 3L2ZA 2GQVA 2M0YA 5GJVB 2KRNA 2MCNA 5KCOA 1YFNA 4N4GA 2VC8A 3OA6A 4RG8A 2DD5A 1TWBA 4JLIA 1ABOA 4HVWA 1TOVA 1UHFA 1MV0B 2LCCA 3OYIA 2KR3A 4JDSA 2PQWA 2DL3A 1PRLC 1C0MA 2QTXA 1IGUA 1YJNT 1KJWA 1I1JA 3TVTA 2F5TX 2HQHA 5IH2A 1VQ7T 3BY7A 2EKOA 3REBB 1KHIA 1TH7A 5GANh 5I11A 2VXEA 2K4YA 5D7UA 3CCJQ 1QVFS 1GRIA 4LDVA 2DBMA 1S72T 4M7AD 1VQ5Q 1E6GA 5KYYA 2VGNA 2GFAA 1KQSA 1OQKA 1K8AR 1S72Q 2OTLT 3JB9I 2D6FA 4F17A 4PJOA 5CKBA 1G5VA 1W4SA 1K76A 5KE3A 1W2BS 4F7UF 1G3WA 1UGRB 2RPNA 4AT1B 2GGRA 2E5KA 1KIKA 3H6ZA 4FM4B 3I35A 5KCHA 1AZEA 5D6YA 2HMAA 4F04B 1M2OA 2LJ3A 3QUIA 3V8LA 2I0NA 3GP8A 2E5QA 2YT6A 2V26A 4M7DF 1M30A 1KHCA 5J39A 3SEMA 4R0KA 5GAOn 1MMDA 3BW1A 4E6RA 4RMOA 4C8QC 1NEBA 2HKNA 2K57A 3VU3C 3L42A 2EGCA 3L2RA 4OMOA 2XD0A 5GANg 4JJDA 3TQ7P 2DVEA 8ATCB 2QA4A 5LJ3f 1YI2Q 2CZ0B 3PT9A 2LVMA 4FW2A 2RK1A 1QVFA 2YRDA 3GBQA 2D8HA 1UTIA 4KULA 1AT1B 2PTKA 4MDXA 1H641 4LDUA 3G4SA 1PCXA 3OYDA 2RMOA 2DZCA 4BE0A 3VKIA 1X2KA 1OX9A 3M0RA 3JB9H 3VS2A 2RQRA 2CP6A 4LE9A 2AKLA 1GFCA 1ZBXA 4M78D 4F7UA 2V8KA 1W2BA 2BZXA 1VQ4T 3X28B 5GAN6 3RERA 4AFZC 5CAIA 3CBOA 5KYXA 3NMZC 2F2VA 5ECAA 1T3LA 1M1KC 2ESWA 2FO0A 2V1RA 1NYFA 2DRMA 1VA7A 2YLCA 1VQOT 3SWNC 2DL5A 4PNOA 4R56A 3MEUA 1LPLA 4DBRA 4NL2A 1K9MR 2KBTA 1YCSB 1QWFA 4E7IA 1VQOQ 1UG1A 1OZ3A 2KVQG 5FU6C 1VQNQ 4LD9K 3M9QA 1SKUB 5IXFA 2RK2A 5LJ5f 3OBWA 2QXFA 2E70A 1J3TA 3CCLQ 2DL8A 1CKAA 3CBPA 2ZZDA 4M75B 1KC8U 1M90R 4M77B 3A98A 2OTJA 3CCQT 3OYJA 3CCRQ 1BYMA 3G71Q 2YRVA 2OAWA 1GL5A 2HQXA 3CCMT 4MZPA 3NHNA 1VQPT 2CH4W 1SHFA 2LMJA 4FIBA 3G6ET 2GFUA 3MJXA 3EG3A 3GLXA 4L5GA 5CK9A 4M75G 2D1XA 1BI2A 3WVEB 2VASA 5C0MA 3UT1A 4DOVA 4M77G 1IHVA 4OB0B 4FU6A 5KYYB 2AZVA 1WJSA 5D6WA 2NLUA 4QVDA 5HKCA 1R0BG 2HEQA 4PJOB 1OOTA 4BACA 1MGQA 2YLBA 3EG9A 4Y92A 4PJLA 1VIEA 1MMNA 4XTUA 3DB3A 3LLRA 2KSSA 4Y28E 1ZSGA 1XTDA 1JEGA 2DYIA 2FPDA 2KYMA 1Q95G 4JPBW 4KGZB 3MEVA 3RDVA 2KAFA 3HRTA 2F1LA 4HVUA 3CCJA 1MNDA 4PJOG 1Q82R 2LQ8A 4GBQA 3PTAA 1OX8A 1IO6A 3A8OB 2IG0A 3OS0A 3E19A 3EFOA 1K73R 4RTXA 1S72A 2XU8A 2R57A 1XOVA 5GMKh 3JCMe 1TUDA 2FG0A 3OYHA 3A8GB 4C0FA 2HBPA 3EH1A 2E3IA 2OJ2A 4BI4A 2EW3A 1PWTA 1WDXA 2P84A 3OYYA 3VS1A 4RTYA 3TSZA 1UECA 1BBZA 5DM7R 2K2MA 4RG2A 1WXBA 4RTUA 3P8DA 2QGFB 1WZOA 2L0AA 2RQTA 1ZSZC 5KYWA 2DA9A 2PUOB 4OVAA 3UA7A 1OYXA 3A1PA 1LNXA 1ZUYA 3V8KA 2YUQA 4C92F 6AT1B 2CT3A 3GOXA 3OB9A 3EAEA 4JUVA 3H0FA 4F7UB 5KYUB 2ED0A 4V2SA 2DO3A 1ZLMA 1EZZB 2I2LA 3OSVA 1SF9A 4A4KA 2DNUA 3FDRA 2LDMA 2DM1A 3CXCP 3A8LB 3REAB 2IIMA 1VYUA 1YI2A 1TTHB 4M7DB 3HP9A 2MAMA 5IHKA 1V1CA 2KGTA 3EH2A 3S3NA 3EGXB 3H41A 4J9BA 4F7UG 1ZX6A 1T3SA 2M9UA 3SHWA 4CRIA 2PVGB 4XAXB 1N9SA 2AHJB 2MWPA 3P8BB 5GAMf 3FB9A 3FEOA 2FVUA 1GCPA 4II1A 1QLYA 2AT1B 3I56Q 3J7AF 4JRKA 1CSKA 2GNCA 1YHQQ 4M78G 2KE9A 1KD1C 3H0IA 3G7ZA 2G6FX 1UGSB 4DA4A 4M7DG 4EIKA 1HSQA 5GAN8 3PIOA 3M4GA 3U23A 3CMAT 3OW2P 2KXCA 2QASA 2ROTA 5LJ3d 4F14A 2QEXT 3M0TA 1M5Q1 1U06A 5D6XA 2RI5A 3M4YA 4HCBA 2MWOA 1GCQA 4XQ3A 2VUBA 2XDDA 1VQOA 5CVIA 2BTTA 1W2BP 4HCZA 1VQNA 3OY9A 3CQTA 2L3PA 3LH5A 2A08A 2DKGA 1VQLQ 1BI0A 3CPWA 2ATCB 2E1HA 3CCLA 2EJ9A 1K9MU 1N8RU 2RH2A 4O5VA 1SRLA 2J7IA 3CCRA 1I8FA 4HKEA 3SDZA 3G71A 1UGPB 1Q81C 2RHXA 1LOJA 1TS9A 7AT1B 3CC7T 1M4ZA 4FYYB 1HJDA 2DFUA 2ZPBB 2EJGA 4HA8A 3E2UA 2V8JA 1M90U 2L8DA 1BB9A 3G6EA 3TCJA 2K5IA 2D9TA 2RHZA 3CCUT 5LJ5d 3EFSA 2RM4A 2QQAA 1YIJT 1M9SA 4ELZC 3EFOB 2LTOA 1WFWA 4OGCA 1KFZA 3CMEQ 4PJOC 2R5MA 4PL6A 3CD6Q 3C0CA 2X9HA 5LJ5h 1D1AA 5A2QE 2RJCA 2JS2A 2F5KA 4MZMA 4OMFB 3CC4T 2JNGA 2LX9A 1WHJA 3GNGA 3JCMQ 4FYVB 1OPKA 1WJRA 4JJBA 4JRIA 1K8AC 2QG9B 3PMIA 3R6NA 2BE9B 4M77F 5LL6S 3V7SA 2COWA 3C94A 4FYXB 3NTKA 4ZGJB 1JO8A 4CI0C 3LW5E 3ULRB 1GXIE 1KC8R 4KH1B 2QI2A 4AG1C 1Y71A 4J8OA 5I22A 3OYKA 1NE8A 3M0UA 2W0ZA 1HD3A 3OYFA 4QQGA 3E1SA 1YJWT 1Q82U 2O31A 3PGGA 4JJCA 1PD0A 4B6MA 3JCMg 4J9DA 2O9VA 1JU5C 2OTJQ 1BI3A 2K3XA 2P4RA 3F70A 2H8HA 1QVGP 2RHIA 4BI8B 4N4HA 2RD1A 4IUQA 4M7AF 5FU7B 3E9GA 1RAEB 4LXCA 3QO3A 3CCVQ 2E41A 5A0DA 3EHQA 3PMTA 4X9DA 3BFMA 2YUPA 1BK2A 2FB7A 1PNJA 4KT0E 4M75A 1B07A 2LJ0A 4M77A 4RTZA 2LCLA 3CCST 4ATOA 5GANd 3OS1A 4C8QE 2FYKA 4J9CA 4C92B 2MOXA 1X69A 3UWNA 4AMCA 3ME9A 4PKCC 1WGSA 1HK9A 4EPCA 2MF2A 3QYGB 3S3OA 2JS0A 1YJNQ 3I56A 2PUKB 4AFQC 1VQ7Q 4CC4B 2HAXA 4IUTA 2VGMA 2RHUA 1YHQA 3RESA 3TEEA 1M2VB 1BIBA 1GFDA 2HQEA 2JJ9A 1NLPC 2RQWA 3PVQA 4BD3A 4C92G 2ZPEB 2CT4A 2CP0A 3VRZA 4A4HA 4J9HA 2OTLQ 2ROLA 2QTVA 5IN1A 1YJ9T 1D3BA 4M7AA 4K11A 3J81E 1OI1A 3CEYA 1WLPB 2K6DA 3ZBDA 5GAMd 4OMMA 4DEXA 3JCMJ 1YJ9Q 1SG5A 3WXMB 4ANJA 2DERA 1NG2A 4OMQA 2BKDN 4M78F 3EG1A 1OV3A 1VQLA 1U5SA 3M0QA 3FC3A 5A0GA 5GAMh 1DJ7B 2VYTA 3VRYA 4FT4A 2RJDA 3JB9G 3QJ6A 3FLGA 2VVKA 1TU0B 5EC7A 5FWBA 2OX7A 2EKHA 2YHTA 4BY6B 4J6YA 2NUTB 3HFNA 2ABLA 2EFIA 5I2SA 1RLPC 1KQ2A 3LYIA 2P4TA 3L1AA 3OSSC 2YRCA 1WA7A 3OYAA 2SRCA 2K3BA 1YWPA 5J3BA 2EQUA 3CPFA 4Q5WA 2JM8A 5DLOA 4J9FA 3A8MB 2O88A 3VS5A 4E7ZA 3I55T 3ER0A 2YUNA 2AK5A 3DLLA 3CMEA 1M3BA 4JJNK 1SRMA 3CD6A 5KYUA 1NM7A 1JJ2P 4IIOA 5FLXE 1YITT 1RADB 2X4YA 2GCXA 2IPOB 1AWWA 2DETA 3QYHB 1H8KA 1M1GA 5CKEA 4Z89A 3VUZA 1K73C 1VQ4Q 2JTEA 2WSFE 2KEAA 4RCBA 5LJ3j 3VS0A 3X25B 3JCMf 2JTMA 3MPUB 5M9OA 4FSXA 4M78A 3LH0A 1Q86U 2FL7A 4A4EA 1QMCA 4C5GA 1M8VA 2DF6A 2DL7A 3N5BB 4M7DA 3V8JA 5GAMg 4AFUC 2HL3A 3EGXA 4QW2A 1N8RR 2L2PA 5FRNA 2LQWA 1SSHA 4QVCA 1UFFA 2ZPIB 3UF4A 3C12A 1NLOC 3M59A 1VOMA 3OQ5A 4HCKA 2RF0A 1NJIC 1SPKA 3LGFA 4B9XA 5IAYA 2DEQA 1Y57A 2EVRA 3SFMA 1F1BB 4RTVA 2DX1A 3EG2A 2XIDA 5CKHA 1KK7A 2LQNA 1WYXA 3GF5A 1MMAA 1JB0E 3RR6A 1X01A 2H3EB 2CP3A 3CCQQ 2E6NA 2QDLA 3LWIA 4YTLA 2VXFA 2JMCA 3CCMQ 4J9EA 1VQPQ 4HT9A 2KXDA 1WQWA 1WJQA 3RKYA 5GAOr 3G6EQ 3CCET 1FYNA 4NS5A 4E7SA 1D0YA 3M5AA 3CCVA 4E7KA 1QWEA 3JCMX 5GAOp 3PIPA 1RI0A 1KSWA 3GNFB 1VYVA 1WHKA 4D8DA 3FRNA 2ENMA 2CYZB 4B9WA 4C8QD 5KH6A 1D3BB 4M7AB 3TU4K 4FYWB 3OYMA 2IVWA 5EG2A 1ZHIA 2PZ1A 1IREB 3M54A 1WPYA 4ZN3A 1GCQC 1YJNA 2XKOC 5HY6A 1VQMT 4C0DB 1OEBA 1VQ7A 1X2QA 1Q81U 3VS4A 2A36A 4ME7A 1VQ9T 1QCOA 4ZNXA 2JMAA 1VQ6T 4M7AG 2P0QA 4CC2A 2ZPGB 4MDWA 3BDLA 1JBMA 1P92A 1K0SA 3ZEHA 5CQXA 1IZ6A 3T9NA 1X43A 2O9SA 2OTLA 1Z9ZA 3EHRA 2RQUA 2EWNA 2CUBA 4QKUA 5HCKA 3OYNA 1R8OB 4FCYA 5IHNA 1YJ9A 1U1TA 2COYA 4PFZA 3CC2T 2FRWA 5AT1B 2DXUA 3QSUA 2KNBB 1VQKT 1G3YA 2O4XA 2FRYA 1PKTA 3FIFA 1M1KR 3TSWA 1OU8A 4BB7A 5GMKl 1KQSP 2DJZA 2XMFA 2M02A 3LX7A 2AIRB 3HSBA 2RNAA 1BCMA 3QZ9B 1C6VX 1UJ0A 3OYLA 4C5HA 5IT9E 2DMOA 4D8KA 3QPHA 1VQ8T 2HSPA 3RKWA 3JSCA 3M55A 4FL6A 1OULA 4FW1A 5DY9A 1SHGA 2QQBA 3CPWS 4BY6C 2FPFA 4ZTJA 5GAN2 3M0SA 2HBWA 2NYSA 4XU2A 4M75E 4M78B 5GANj 4M77E 2Y90A 3WVDB 3UATA 2CREA 3QHSA 5CO7A 1G3TA 4QVZA 2Y4XA 4FT2A 1M3CA 4HCCA 1UDLA 3M56A 1MHNA 3BE3A 2VB6A 2E6ZA 2DIGA 3JB9J 1UUEA 3JB9F 1WNLA 1I5LA 2PU9B 1T0JA 3URGA 4QQDA 2O2OA 1Q7YU 3SD4A 3KFVA 4LD6A 4HVVA 1K1ZA 4ZTFA 1KC8C 1OU9A 4EMKA 2EQMA 1VQ4A 1LVKA 1QP2A 1RAGB 4KBMB 3H9NA 2HKQB 1B34A 3M57A 3QXEB 4ORZA 1QVFP 2J06A 4PJOE 3RMSA 2F2XA 3CMAQ 1AVZC 3HRUA 3VUBA 1X6OA 2DXCA 5KE2A 2QEXQ 4C92A 4OMNA 4Z88A 3MEWA 4MZTA 2ECZA 4OP0A 2W10A 1AHJB 4J7IA 3OYCA 4LUDA 2VV5A 3RKXA 2V1QA 1VIFA 4DEYA 5FRMA 5DLQE 3CBMA 3HFOA 3JCMP 2E10A 2KYBA 3VS7A 4OB3B 1M2VA 4M75C 1YNZA 4M77C 3JCMd 4XU3A 1I81A 2MYSA 2E65A 4DOWA 3L2UA 3CCQA 2X4WA 2M16A 2XG8D 1TUCA 1AD5A 2MMPA 3JCMW 3CCMA 4XTXA 2CSQA 1VQPA 2HZYA 1OZ2A 3JCMh 2E12A 1R0CB 3CC7Q 2FZCB 2C0OA 3MO8A 1ARKA 3LGLA 2RJFA 4C0ZA 4EMHA 2C0TA 3AT1B 5IXBA 3CCUQ 2QA4T 1YIJQ 4E47A 1ZUUA 2JUFA 1Q86R 2A0FB 3UA6A 1UEBA 3JCMV 3G4ST 4F7UE 4PJMA 3Q1JA 2RB6A 4M7AC 2Y4YA 2NUTA 1UHCA 4KUIA 2KT1A 2KQWA 1WHMA 5I21A 3CC4Q 2CSIA 1WHHA 2O4XB 2C0IA 2BE7D 2P0KA 3UDCA 3M0PA 4C0DC 2Z0WA 3MP8A 3PE0A 2MPXC 1A0NB 1N6AA 4M78E 3JAME 3L2VA 1C1AA 4M7DE 4BUGA 2EQIA 1LCKA 1YWOA 5CCAA 3J80E 2ZPHB 2BUDA 1W70A 3VJPA 3P8HA 1BCOA 1X75C 3META 1XNIA 2L3RA 4EMGA 1KD1R 5FWCA 1YJWQ 5GAOl 1RABB 5CQYA 4J83A 4KUDK 1M8MA 2WSEE 5FU6B 3THKA 1WHGA 2PVOB 2YSQA 4C5IA 2P0PA 3OYEA 2HCKA 1D0XA 2KT8A 4X1VA 1AZGB 4DQ2A 4ZN1A 1QW1A 3D7SB 1M1KU 4N4IA 1TSFA 4JRQA 4EMKB 1BKBA 1PRMC 5L8RE 4J5YA 3X26B 5HK0A 2DTHA 4R55A 1FMKA 3G1JA 1OPLA 4M75D 2F69A 2DD4A 1B34B 4RCCA 3RIRA 3ZFJA 4M77D 1EIFA 3INZA 3S6WA 1T0HA 4M78C 3OBYA 3CXCS 2AZSA 1Q81R 4HT8A 4M7DC 2R5AA 4LUEA 3CCSQ 2DXTA 5GJWB 1PSFA 2CDTA 1BIAA 2C06A 3O5ZA 3A5ZB 2JM9A 5GMKj 2CP2A 2GF7A 1JRIA 2V8IA 1IB8A 3I9QA 1QCNA 3OYBA 3M53A 1I07A 5IHIA 4KH0B 1PD1A 1RAFB 1FMWA 2DRKA 2AKKA 4E7JA 1N8RC 1K9MC 2WSCE 2MI6A 4OMLA 3HRSA 4UC4A 3CCJT 1WIEA 4PJOD 2YWWA 1G83A 2DK3A 1VQ5T 4J6XA 3OW2S 2NWMA 1X6GA 4E2FB 1AWJA 2BIVA 3CMAA 1MUZA 3VV0A 4BE2A 3QDFA 2VWFA 4CC7A 2JVVA 5I2MA 2J6FA 5GAOq 2QEXA 3ZL7C 1M90C 2E64A 4PFPA 4IUVA 2OI3A 2EGEA 1G8XA 4WF2A 1PHTA 1PSEA 3VS3A 5CIUA 3VYHB 4JZ3A 1AOJA 3X20B 4MMLA 2LNHB 3A8HB 3ASKA 1WHLA 1UGVA 1NPRA 2NUPA 4A53A 2EJFA 2EQKA 2QK0A 2CS7A 2CP7A 1M1FA 5GMKi 2B86A 1I0CA 3NGPA 5GAN5 2XDBA 3HTRA 3PVLA 3CXCA 1ZSZB 4A54A 1NBEB 4RTTA 4DBFA 2JZ2A 5GAN3 1IHWA 2D8JA 4BDZA 4PJJA 3CC7A 1KG1A 4P5NA 2L3QA 1Q7YR 1ACMB 3CPWP 2MK5A 1ZQ1A 4NOYA 2HSEB 1R77A 1UB4A 3NTIA 4IURA 1X27A 1I5OB 2LT1A 3CCUA 3OMCA 1YI2T 3EGDA 3TREA 1YIJA 4GLKA 1N5ZA 3I55Q 1VYTA 1TUGB 4JS4A 4XTZA 1QCFA 5GMKe 3OW2A 2DYBA 1K9AA 1Q82C 2XHCA 1RLQC 4N0AA 2J6OA 1ZA2B 4LNPA 1YITQ 1W6XA 1D1BA 1D09B 3CC4A 1GBRA 2FPEA 2DZ9A 2SEMA 3QG1A 2EBPA 3H0HA 4XTYA 4M7DD 2M51A 2L89A 2K9GA 2QYZA 4BDYA 4DBHA 3S3MA 1U1SA
chains in the Genus database with same CATH topology
2V8JA 2LCCA 3OYIA 2L8DA 4JDSA 1M90U 4C92E 3L2QA 2PQWA 4BB7A 5GMKl 2DJZA 2OAUA 3G6EA 2QTXA 3LX7A 3TCJA 2K5IA 3C4SA 1YJNT 3HSBA 2F5TX 3QZ9B 1VQ7T 3OYLA 2D9TA 2RHZA 3BY7A 4C8QF 5LJ5d 3CCUT 2EKOA 3EFSA 4C5HA 1KHIA 1TH7A 5IT9E 2RM4A 3QPHA 2QQAA 4C0GA 1M9SA 1YIJT 4ELZC 5GANh 1VQ8T 2VXEA 3RKWA 2K4YA 3JSCA 3GIBA 3M55A 2LTOA 4FL6A 4OGCA 1YJWA 1VQNT 5DY9A 1QVFS 2QQBA 4LDVA 1FX7A 3M58A 3CPWS 1S72T 4BY6C 4M7AD 4ZTJA 3OS5A 4PJOC 5GAN2 2R5MA 3EFRA 2VGNA 4IUUA 4PL6A 2GFAA 1KQSA 2DTIA 3CCLT 5LJ5h 1G3SA 3NFCA 5GAN4 5A2QE 2RJCA 1QVGS 2H3JA 2R58A 2OTLT 3JB9I 2F5KA 4XU2A 4MZMA 4M75E 4M78B 4OMFB 3CC4T 5GANj 2D6FA 2JNGA 4PJOA 3CCRT 5CKBA 2LX9A 4M77E 1G5VA 1W4SA 3G71T 1KD1U 3GNGA 5KE3A 3JCMQ 1W2BS 1WJRA 1K8AC 2Y90A 4JRIA 3WVDB 4F7UF 3QHSA 5CO7A 1G3TA 2DIQA 1G3WA 2Y4XA 1UGRB 3PMIA 4FT2A 4QVZA 4HCCA 5FU7C 3M56A 1MHNA 4M77F 2A3LA 5LJ5j 4BE1A 5LL6S 4ZGEB 3V7SA 2E6ZA 2DIGA 2EYQA 3C94A 3H6ZA 4FM4B 3JB9J 3JB9F 3QJYA 5KCHA 3NTKA 4ZGJB 1WNLA 5AYFA 1I5LA 2PU9B 5D6YA 5GMKm 4CI0C 3LW5E 4QQDA 3URGA 1GXIE 3QUIA 4EMKC 1Q7YU 2QI2A 3SD4A 3V8LA 2LC4A 3MEAA 2LNVA 2G3RA 5CKDA 3GP8A 1Y71A 2RA2A 4J8OA 4LD6A 2E5QA 3OYKA 4JLGA 1NE8A 2ZCFB 3JCMb 4M7DF 2RI2A 1KHCA 3QIIA 5J39A 4ZTFA 1KC8C 4EMKA 2EQMA 3OYFA 1VQ4A 3OS2A 1QP2A 4QQGA 3E1SA 1YJWT 5GAOn 4KBMB 3BW1A 1Q82U 3CCSA 4LDYA 4RMOA 1B34A 3M57A 3PGGA 3QXEB 4C92C 4C8QC 3JCMg 1FWZA 4PJOE 3RMSA 2LT4A 2K57A 1BI3A 2K3XA 2X35A 3HRUA 3MP1A 3VUBA 1X6OA 2DXCA 5KE2A 3F70A 4LDXA 3PFSA 2LQKA 4C92A 3VU3C 3MEWA 4C8QA 3L42A 4MZTA 4PLIA 5LJ3e 3L2RA 4J7FA 2RHIA 2XD0A 4OP0A 5GANg 4BI8B 1HXDA 1AHJB 2DPPB 2K2VA 4J7IA 2DVEA 3OYCA 4N4HA 2QA4A 2RD1A 4IUQA 5LJ3f 4M7AF 2VV5A 2CZ0B 4OB1B 3RKXA 3PT9A 2LVMA 2RK1A 3O8VA 1VIFA 3SB2A 4IUPA 5FU7B 4E7LA 1QVFA 3E9GA 5FRMA 4KULA 3CBMA 3HFOA 5DLQE 3JCMP 3MHXA 2E10A 4MDXA 1H641 4LDUA 1WQ7A 3G4SA 3OYDA 4OB3B 4M75C 3QO3A 2CKKA 2DZCA 4BE0A 2E41A 3VKIA 5A0DA 1LJOA 4M77C 1QVGA 3PMTA 4XU3A 2FHDA 4X9DA 3JCMd 3JB9H 1I81A 3BFMA 3DKMA 1VQ5A 1ZBXA 2E65A 4M78D 4DOWA 2FB7A 3V7RA 4F7UA 3L2UA 2V8KA 1W2BA 1RL2A 4KT0E 4M75A 3CCQA 4IKFA 1VQ4T 2X4WA 2M16A 2XG8D 4M77A 3X28B 5GAN6 2MMPA 3JCMW 3RERA 3CCMA 2LCLA 2QDYB 1SSFA 4XTXA 3CCST 4ATOA 5CAIA 5GANd 3OS1A 1VQPA 1OZ2A 3CBOA 2L5QA 2X4XA 3JCMh 4C8QE 2E12A 2DXBA 2FYKA 4C92B 3VYGA 3MO8A 2M0OA 3UWNA 3ME9A 4PKCC 1WGSA 2RJFA 3LGLA 1M1KC 4XTVA 2DTOA 1HK9A 2EAYA 4C0ZA 3V7CA 4EPCA 2MF2A 1K8AU 3QYGB 3S3OA 4BI3A 2YLCA 1VQOT 4EMHA 3I56A 3SWNC 2PUKB 4PNOA 2KMTA 3MEUA 4R56A 2HAXA 4NL2A 4IUTA 2QA4T 2VGMA 2RHUA 3HKSA 5GANf 1N27A 4L59A 4E7IA 4E47A 5LJ5e 1YHQA 4O6JA 2JUFA 3RESA 3SWNA 3TEEA 1OZ3A 2KVQG 1BIBA 5FU6C 2HQEA 4LD9K 1UEBA 3JCMV 3M9QA 3G4ST 2M1HA 2PVDB 3X24B 2RK2A 4BD3A 4F7UE 5LJ5f 4C92G 3Q1JA 2RB6A 3OBWA 4M7AC 2QXFA 3JRZA 2ZPEB 2E70A 2XI9A 2Y4YA 1Q86C 1H3ZA 4M75B 3CBPA 2ZZDA 3QKJA 4A4HA 4J6WA 4KUIA 1KC8U 2QQRA 4M77B 4QQ6A 2KQWA 2OTJA 5I21A 3CCQT 2O4XB 5IN1A 3OYJA 1YJ9T 1D3BA 4M7AA 1VUBA 1QVPA 1BYMA 2P0KA 2YRVA 2JTFA 3UDCA 4JRPA 5HK3A 3J81E 1OI1A 2HQXA 3CEYA 4C0DC 3MP8A 4MZPA 3ZBDA 3CCMT 1VQPT 1N6AA 5GAMd 3JCMJ 4M78E 3WXMB 1Y96A 4FIBA 1O75A 4L6V5 4OGEA 3RUXA 3JAME 3DLMA 3I55A 3L2VA 3G6ET 4M7DE 1N9RA 2GFUA 2BKDN 4BUGA 2K3YA 4M78F 5CCAA 1VQLA 1JJ2S 3J80E 2RI3A 3BDUA 3GLXA 2ZPHB 4L5GA 5CK9A 2BUDA 4JS5A 3VJPA 4M75G 3I56T 1BI2A 1XQHA 3WVEB 5A0GA 5C0MA 3UT1A 4DOVA 5GAMh 3FC3A 4M77G 1YITA 3P8HA 4OB0B 1DJ7B 2VYTA 2A7YA 4FU6A 2RJDA 1X75C 4FT4A 1WJSA 3JB9G 2WACA 1O9SA 3FLGA 1XNIA 3META 3QJ6A 4Y91A 1YHQT 2XDPA 2L3RA 2QQSA 4EMGA 2O01E 5D6WA 2NLUA 4QVDA 5HKCA 2YHTA 4BY6B 5GAOl 4PJOB 4J6YA 4BACA 5CQYA 4J83A 1MGQA 4KUDK 3HFNA 5FROA 2WSEE 2YLBA 5FU6B 2EFIA 4C92D 5I2SA 2PVOB 1VIEA 5GAMj 1KQ2A 4M7AE 3LYIA 2P4TA 3L1AA 4XTUA 3OSSC 2RJEA 5CR2A 3DB3A 3LLRA 4C5IA 3OYAA 3KXTA 2KSSA 4Y28E 1BI1A 2CZ6B 2QQ9A 4TVRA 5CKFA 1XTDA 2CZ1B 2P0PA 3PIPA 5J3BA 2EQUA 3CPFA 2JOYA 3R6OA 3OYEA 4Q5WA 4C5EA 3MEVA 5DLOA 3A8MB 3H8ZA 2KAFA 4DQ2A 4X34A 3HRTA 4RKUE 4ZN1A 3ER0A 3I55T 3GPLA 1QW1A 3CCJA 1M1KU 4NL3A 5GAN7 4N4IA 4PJOG 2EQJA 3DLLA 5LJ3h 3CMEA 2LQ8A 4JRQA 1VQLT 3PTAA 4JJNK 4EMKB 4XTWA 3A8OB 1BKBA 2IG0A 5L8RE 3OS0A 3CD6A 3C95A 4J5YA 3E19A 2HD0A 3X26B 5HK0A 3KUFA 2DTHA 5FLXE 4R55A 3AHUA 4M75D 1YITT 2F69A 5J26A 3NTHA 1S72A 2DD4A 1B34B 2R57A 2XU8A 4RCCA 3RIRA 4M77D 2X4YA 2GCXA 1XOVA 4X9CA 3ZFJA 5GMKh 1EIFA 3INZA 3S6WA 3JCMe 3QYHB 1M1GA 2XICA 4M78C 2CZ7B 3OBYA 5CKEA 3CXCS 3UPUA 3JB9D 3VUZA 3KBGA 4HT8A 4OF1A 1K73C 3OYHA 3HL8A 4M7DC 2R5AA 2WSFE 4RCBA 5LJ3j 3E9FA 3X25B 4C8QB 3JCMf 5GAOm 2JTMA 3A8GB 2DXTA 2HBPA 4C0FA 1PSFA 5M9OA 4FSXA 1BIAA 4BI4A 4M78A 3LH0A 1Q86U 2FL7A 4A4EA 2C06A 4C5GA 1M8VA 3OYYA 3JCMc 5GANe 3A5ZB 4M7DA 3N5BB 2HNIA 1JJ2A 5GMKj 3CCEA 3V8JA 5DM7R 4RG2A 5GAMg 2GF7A 3MP6A 1JRIA 4QW2A 2V8IA 5FRNA 3P8DA 3OYBA 4LDWA 4QVCA 3M53A 2ZPIB 2PUOB 4OVAA 1OYXA 4XU1A 4GY5A 3C12A 4PLLA 3QZ5B 4E7JA 3M59A 1N8RC 1K9MC 2WSCE 1LNXA 2MI6A 3V8KA 3HRSA 3OQ5A 1NJIC 4C92F 3LGFA 2KY9A 4UC4A 4B9XA 5IAYA 3PNWC 3CCJT 3GOXA 3OB9A 2DEQA 3EAEA 4JUVA 4C8QG 3L2WA 1FXXA 1UGQB 4F7UB 3SFMA 4PJOD 3CMET 4MMKA 2DK3A 1VQ5T 4J6XA 1KQ1A 4OB2B 4ZGDB 3OW2S 2XIDA 3CD6T 4V2SA 5CKHA 2DO3A 2BIVA 3CMAA 2D0QB 3VV0A 2K5LA 4BE2A 2KDSA 2I2LA 3OSVA 3GF5A 2JVVA 1JB0E 5I2MA 5GAOq 2QEXA 1X01A 2RHYA 1YBYA 1M90C 4A4KA 2DAQA 2E64A 3FDRA 4IUVA 2LDMA 2E6NA 4A4GA 4WF2A 1VQMA 1PSEA 2XK0A 3LWIA 4YTLA 2LRQA 2VXFA 5CIUA 3VYHB 1YCYA 3A8LB 3X20B 1YI2A 4MMLA 4E7HA 4HT9A 3A8HB 1WQWA 4M7DB 3HP9A 1WJQA 2K5FA 3RKYA 3ASKA 2MAMA 5LJ3g 3S3NA 5GAOr 4XU0A 5GAMe 1U8RA 1VQ9A 4M75F 1NPRA 1QP3A 4F7UG 3OMGA 4A53A 2EJFA 3CCET 2CGHA 2M9UA 4NS5A 4CRIA 1VQ6A 2PVGB 4XAXB 2EQKA 1N9SA 2B8AA 2AHJB 2MWPA 3P8BB 3M5AA 3LWHA 3CCVA 4D6WA 4E7KA 5GAMf 1NZ9A 3QBYA 4Z02A 3SWNB 3JCMX 3QDRB 2CS7A 3FB9A 5GMKi 1M1FA 2ZGWA 2FVUA 3FEOA 4II1A 5GAOp 1RI0A 2EIFA 2KK4A 2ZPFB 3GNFB 5GAN5 4JRKA 2XDBA 3J7AF 3CXCA 4A54A 4ELYC 3FRNA 4M78G 2JZ2A 2CYZB 1KD1C 4B9WA 1I4K1 3G7ZA 5GAN3 4C8QD 1UGSB 2RO0A 4DA4A 5KH6A 4M7DG 3RMQA 4A4FA 1D3BB 4M7AB 3CC2A 5GAN8 3PIOA 4BDZA 3M4GA 3TU4K 3CC7A 3OYMA 1KG1A 4P5NA 2X4JA 1VQKA 3CMAT 2OTJT 2IVWA 5LJ3d 1KQSS 3DB4A 2QEXT 5EG2A 1ZHIA 1IREB 3M54A 1WPYA 1Y96B 4VUBA 1ZQ1A 4ZN3A 4NOYA 1K73U 1NPPA 1YJNA 1UB4A 1M5Q1 2XKOC 3NTIA 4IURA 5HY6A 4C0DB 5D6XA 1VQMT 2RI5A 1VQ7A 1Q7YC 2LT1A 3CCUA 4PJOF 1V29B 3M4YA 3OMCA 5C6SA 1YI2T 4HCBA 1Q81U 2MWOA 3TREA 1YIJA 4ME7A 4XQ3A 2VUBA 2XDDA 1VQOA 1VQ8A 4GLKA 5CVIA 1VQ9T 4HCZA 4N0AC 2JN0A 4JS4A 1VQNA 3HHTB 4XTZA 5GMKe 3OY9A 3OW2A 1VQ6T 4M7AG 2P0QA 2DKGA 1Y7XA 1Q82C 1BI0A 3CCVT 4XK8E 3CPWA 4EDUA 5A0LA 2ZPGB 2E1HA 2XHCA 4MDWA 3CCLA 3BDLA 1JBMA 1P92A 4N0AA 5LJ5g 2EJ9A 3ZEHA 3MCAB 5CQXA 1N8RU 1K9MU 1IZ6A 2RH2A 3HPWA 3T9NA 2OTLA 3OYGA 1Y07A 4O5VA 1NJIU 3CC4A 3FJPA 3L2ZA 2DZ9A 1I8FA 2GQVA 4HKEA 3CCRA 3SDZA 3QG1A 3G71A 2EWNA 5KCOA 1UGPB 1Q81C 4N4GA 3OYNA 1R8OB 2VC8A 3OA6A 2RHXA 4RG8A 1LOJA 1YJ9A 1U1TA 2DD5A 4XTYA 4M7DD 3CC2T 2L89A 4BDYA 3CC7T 1M4ZA 2DXUA 4JLIA 3QSUA 1VQKT 1G3YA 3S3MA 2O4XA 2ZPBB 2EJGA 1U1SA 4HA8A 3FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY6 C;  4C0D C;  5FU7 B;  5FU7 C;  4BY6 B;  4C0D B;  4C0G A;  4C0F A;  5FU6 B;  5FU6 C; 
#chains in the Genus database with same CATH topology
 4C92 E;  3L2Q A;  2JT4 A;  1K0X A;  2F2W A;  2OAU A;  2EYW A;  1B3Q A;  3C4S A;  3FJ5 A;  1WX6 A;  1V76 A;  4C8Q F;  1NEG A;  4C0G A;  2DBK A;  2GQI A;  3GIB A;  1YJW A;  1VQN T;  1FX7 A;  3M58 A;  2ZAE A;  1B7T A;  3OS5 A;  3EFR A;  4IUU A;  5L23 A;  4AG2 C;  2DTI A;  3CCL T;  1G3S A;  3NFC A;  5GAN 4;  1QVG S;  2H3J A;  2R58 A;  4F16 A;  1QQJ A;  3CCR T;  3G71 T;  1S1N A;  1KD1 U;  1WXT A;  2DIQ A;  2HL5 C;  1PM3 A;  5FU7 C;  2KRO A;  2A3L A;  5LJ5 j;  4BE1 A;  2GTO A;  4ZGE B;  8AT1 B;  2EYQ A;  1TXQ A;  3QJY A;  5AYF A;  1ZBJ A;  1BU1 A;  3CCE Q;  1HYO A;  5GMK m;  4EMK C;  2JW4 A;  2LC4 A;  3MEA A;  2LNV A;  2G3R A;  5CKD A;  4LN2 A;  2RA2 A;  2YXY A;  1M3A A;  4JLG A;  2ZCF B;  3JCM b;  2RI2 A;  3QII A;  2E4H A;  2RN8 A;  4RTW A;  3OS2 A;  1D0Z A;  1RUW A;  3CCS A;  1FMV A;  4LDY A;  4C92 C;  2K79 A;  1FWZ A;  2LT4 A;  4PK4 A;  2X35 A;  3MP1 A;  4LDX A;  1NYG A;  3PFS A;  2LQK A;  2DVJ A;  4C8Q A;  5LJ3 e;  4PLI A;  4PFO A;  4J7F A;  2NUP B;  1W1F A;  1VQM Q;  1XJW B;  1HXD A;  2DPP B;  2K2V A;  1IGQ A;  1EX4 A;  4OB1 B;  2KRM A;  2HDA A;  1JXM A;  3O8V A;  4Z8A A;  3SB2 A;  4IUP A;  4E7L A;  1VQ9 Q;  3MHX A;  1WQ7 A;  1VQ6 Q;  2CKK A;  1QVG A;  1LJO A;  2FHD A;  1E7O A;  3DKM A;  1VQ5 A;  3V7R A;  1SEM A;  1RL2 A;  2J6K A;  4HXJ A;  4IKF A;  2PNI A;  1RAI B;  2QDY B;  1SSF A;  2COZ A;  2L5Q A;  2X4X A;  1IXD A;  3CC2 Q;  2DXB A;  2VKN A;  1VQK Q;  1CKB A;  1RAC B;  3RBB B;  3VYG A;  2M0O A;  3EGD B;  1YP5 A;  4XTV A;  2DTO A;  2EAY A;  3V7C A;  1K8A U;  2K7A A;  1MV3 A;  3I5S A;  4BI3 A;  2KMT A;  1RI9 A;  3HKS A;  4ESR A;  1N27 A;  5GAN f;  4L59 A;  1NJI R;  1WXU A;  3MKD A;  1VQ8 Q;  5LJ5 e;  4O6J A;  2KRS A;  2DE0 X;  3SWN A;  2YUO A;  2M1H A;  2PVD B;  3X24 B;  3JRZ A;  2XI9 A;  1Q86 C;  1H3Z A;  2EYX A;  3QKJ A;  4J6W A;  2QQR A;  4QQ6 A;  4JZ4 A;  2CP5 A;  1VUB A;  1QVP A;  2LJ1 A;  2JTF A;  4JRP A;  5HK3 A;  1E6H A;  1G2B A;  5KYX B;  1Y96 A;  1O75 A;  4L6V 5;  4OGE A;  3RUX A;  2YDL A;  3DLM A;  1EFN A;  3I55 A;  1N9R A;  2X3X D;  2K3Y A;  2QAZ A;  1JXO A;  1JJ2 S;  2RI3 A;  3BDU A;  4JS5 A;  4IIM A;  3I56 T;  1XQH A;  1YIT A;  4GLM A;  2A7Y A;  4AFS C;  2X3W D;  2CUD A;  4CC3 A;  2WAC A;  1O9S A;  2FZK B;  4Y91 A;  1UE9 A;  3QWX X;  1YHQ T;  2XDP A;  4FSS A;  2QQS A;  2O01 E;  1H92 A;  2DLP A;  5FW9 A;  2QGG A;  5FRO A;  4C92 D;  5GAM j;  4M7A E;  1TG0 A;  3JV3 A;  1K4U S;  5CR2 A;  2RJE A;  2DEU A;  1X6B A;  4WTO B;  3KXT A;  1BI1 A;  2CZ6 B;  2QQ9 A;  4TVR A;  5CKF A;  2CZ1 B;  4PJN A;  2JXB A;  3R6O A;  2JOY A;  2LX7 A;  4WCI A;  4C5E A;  2LP5 A;  3H8Z A;  1PC0 A;  4X34 A;  1M27 C;  4RKU E;  3GPL A;  4NL3 A;  5GAN 7;  2EQJ A;  2BZ8 A;  5LJ3 h;  1AEY A;  1VQL T;  1WI7 A;  4KGV B;  4XTW A;  3EGU A;  3C95 A;  3AHU A;  2HD0 A;  3KUF A;  5J26 A;  2ED1 A;  3NTH A;  4X9C A;  1U3O A;  2XIC A;  3QWY A;  1Y0M A;  2CZ7 B;  3UPU A;  3JB9 D;  4QT7 A;  3KBG A;  2E3H A;  2KI7 A;  4OF1 A;  3HL8 A;  3EG9 B;  1IRX A;  3E9F A;  4C8Q B;  5GAO m;  2DJQ A;  9ATC B;  2MIO A;  3JCM c;  5GAN e;  2HNI A;  1JJ2 A;  2FZG B;  3CCE A;  3VS6 A;  3MP6 A;  1YN8 A;  1RAA B;  3EG0 A;  4LDW A;  2A37 A;  4XU1 A;  4GY5 A;  4PLL A;  2QA4 Q;  3QZ5 B;  1H3H A;  2KY9 A;  1PKS A;  3PNW C;  1ZSZ A;  2J05 A;  4C8Q G;  3L2W A;  1FXX A;  1UGQ B;  2DL4 A;  3CME T;  4MMK A;  3G4S Q;  4OB2 B;  1KQ1 A;  2EPD A;  4ZGD B;  3CD6 T;  1ZUK A;  2D0Q B;  4KGX B;  2K5L A;  2KDS A;  1D1C A;  1PG5 B;  1JQQ A;  2RHY A;  1YBY A;  1RAH B;  2DAQ A;  2DIL A;  1MMG A;  4A4G A;  1VQM A;  1ABQ A;  2XK0 A;  2CH4 A;  2LRQ A;  1YCY A;  2BZY A;  4E7H A;  2K5F A;  5LJ3 g;  4XU0 A;  5GAM e;  1U8R A;  1VQ9 A;  4M75 F;  1QP3 A;  3OMG A;  3NPF A;  2CGH A;  2EGA A;  1VQ6 A;  5KYN A;  5KYW B;  2B8A A;  3LWH A;  1UJY A;  4KRT A;  4D6W A;  1NZ9 A;  3QBY A;  4Z02 A;  3SWN B;  3QDR B;  2LCS A;  2ZGW A;  2KK4 A;  2EIF A;  2ZPF B;  4M4Z A;  2A28 A;  1GBQ A;  1ZA1 B;  2EYY A;  4ELY C;  1Z9Q A;  2FEI A;  3I5R A;  2GTJ A;  1I4K 1;  2LZ6 B;  4DBQ A;  2RO0 A;  4J9G A;  2RQV A;  3RMQ A;  4A4F A;  3CC2 A;  2EYZ A;  2GBQ A;  1VQK A;  2X4J A;  2OTJ T;  1AWX A;  1KQS S;  3DB4 A;  1Y96 B;  2D0N A;  4RUG A;  4VUB A;  1K73 U;  1MNE A;  1NPP A;  1Q7Y C;  3IQL A;  4OMP A;  4J9I A;  1V29 B;  4PJO F;  5C6S A;  1VQ8 A;  1QKW A;  1QKX A;  2L3S A;  4A63 B;  4N0A C;  2JN0 A;  2NUZ A;  3HHT B;  2X51 A;  3RNJ A;  1Y7X A;  3CCV T;  4XK8 E;  4EDU A;  5A0L A;  1AWO A;  5LJ5 g;  3MCA B;  3HPW A;  3OYG A;  1Y07 A;  1NJI U;  3FJP A;  3L2Z A;  2GQV A;  2M0Y A;  5GJV B;  2KRN A;  2MCN A;  5KCO A;  1YFN A;  4N4G A;  2VC8 A;  3OA6 A;  4RG8 A;  2DD5 A;  1TWB A;  4JLI A;  1ABO A;  4HVW A;  1TOV A;  1UHF A;  1MV0 B;  2LCC A;  3OYI A;  2KR3 A;  4JDS A;  2PQW A;  2DL3 A;  1PRL C;  1C0M A;  2QTX A;  1IGU A;  1YJN T;  1KJW A;  1I1J A;  3TVT A;  2F5T X;  2HQH A;  5IH2 A;  1VQ7 T;  3BY7 A;  2EKO A;  3REB B;  1KHI A;  1TH7 A;  5GAN h;  5I11 A;  2VXE A;  2K4Y A;  5D7U A;  3CCJ Q;  1QVF S;  1GRI A;  4LDV A;  2DBM A;  1S72 T;  4M7A D;  1VQ5 Q;  1E6G A;  5KYY A;  2VGN A;  2GFA A;  1KQS A;  1OQK A;  1K8A R;  1S72 Q;  2OTL T;  3JB9 I;  2D6F A;  4F17 A;  4PJO A;  5CKB A;  1G5V A;  1W4S A;  1K76 A;  5KE3 A;  1W2B S;  4F7U F;  1G3W A;  1UGR B;  2RPN A;  4AT1 B;  2GGR A;  2E5K A;  1KIK A;  3H6Z A;  4FM4 B;  3I35 A;  5KCH A;  1AZE A;  5D6Y A;  2HMA A;  4F04 B;  1M2O A;  2LJ3 A;  3QUI A;  3V8L A;  2I0N A;  3GP8 A;  2E5Q A;  2YT6 A;  2V26 A;  4M7D F;  1M30 A;  1KHC A;  5J39 A;  3SEM A;  4R0K A;  5GAO n;  1MMD A;  3BW1 A;  4E6R A;  4RMO A;  4C8Q C;  1NEB A;  2HKN A;  2K57 A;  3VU3 C;  3L42 A;  2EGC A;  3L2R A;  4OMO A;  2XD0 A;  5GAN g;  4JJD A;  3TQ7 P;  2DVE A;  8ATC B;  2QA4 A;  5LJ3 f;  1YI2 Q;  2CZ0 B;  3PT9 A;  2LVM A;  4FW2 A;  2RK1 A;  1QVF A;  2YRD A;  3GBQ A;  2D8H A;  1UTI A;  4KUL A;  1AT1 B;  2PTK A;  4MDX A;  1H64 1;  4LDU A;  3G4S A;  1PCX A;  3OYD A;  2RMO A;  2DZC A;  4BE0 A;  3VKI A;  1X2K A;  1OX9 A;  3M0R A;  3JB9 H;  3VS2 A;  2RQR A;  2CP6 A;  4LE9 A;  2AKL A;  1GFC A;  1ZBX A;  4M78 D;  4F7U A;  2V8K A;  1W2B A;  2BZX A;  1VQ4 T;  3X28 B;  5GAN 6;  3RER A;  4AFZ C;  5CAI A;  3CBO A;  5KYX A;  3NMZ C;  2F2V A;  5ECA A;  1T3L A;  1M1K C;  2ESW A;  2FO0 A;  2V1R A;  1NYF A;  2DRM A;  1VA7 A;  2YLC A;  1VQO T;  3SWN C;  2DL5 A;  4PNO A;  4R56 A;  3MEU A;  1LPL A;  4DBR A;  4NL2 A;  1K9M R;  2KBT A;  1YCS B;  1QWF A;  4E7I A;  1VQO Q;  1UG1 A;  1OZ3 A;  2KVQ G;  5FU6 C;  1VQN Q;  4LD9 K;  3M9Q A;  1SKU B;  5IXF A;  2RK2 A;  5LJ5 f;  3OBW A;  2QXF A;  2E70 A;  1J3T A;  3CCL Q;  2DL8 A;  1CKA A;  3CBP A;  2ZZD A;  4M75 B;  1KC8 U;  1M90 R;  4M77 B;  3A98 A;  2OTJ A;  3CCQ T;  3OYJ A;  3CCR Q;  1BYM A;  3G71 Q;  2YRV A;  2OAW A;  1GL5 A;  2HQX A;  3CCM T;  4MZP A;  3NHN A;  1VQP T;  2CH4 W;  1SHF A;  2LMJ A;  4FIB A;  3G6E T;  2GFU A;  3MJX A;  3EG3 A;  3GLX A;  4L5G A;  5CK9 A;  4M75 G;  2D1X A;  1BI2 A;  3WVE B;  2VAS A;  5C0M A;  3UT1 A;  4DOV A;  4M77 G;  1IHV A;  4OB0 B;  4FU6 A;  5KYY B;  2AZV A;  1WJS A;  5D6W A;  2NLU A;  4QVD A;  5HKC A;  1R0B G;  2HEQ A;  4PJO B;  1OOT A;  4BAC A;  1MGQ A;  2YLB A;  3EG9 A;  4Y92 A;  4PJL A;  1VIE A;  1MMN A;  4XTU A;  3DB3 A;  3LLR A;  2KSS A;  4Y28 E;  1ZSG A;  1XTD A;  1JEG A;  2DYI A;  2FPD A;  2KYM A;  1Q95 G;  4JPB W;  4KGZ B;  3MEV A;  3RDV A;  2KAF A;  3HRT A;  2F1L A;  4HVU A;  3CCJ A;  1MND A;  4PJO G;  1Q82 R;  2LQ8 A;  4GBQ A;  3PTA A;  1OX8 A;  1IO6 A;  3A8O B;  2IG0 A;  3OS0 A;  3E19 A;  3EFO A;  1K73 R;  4RTX A;  1S72 A;  2XU8 A;  2R57 A;  1XOV A;  5GMK h;  3JCM e;  1TUD A;  2FG0 A;  3OYH A;  3A8G B;  4C0F A;  2HBP A;  3EH1 A;  2E3I A;  2OJ2 A;  4BI4 A;  2EW3 A;  1PWT A;  1WDX A;  2P84 A;  3OYY A;  3VS1 A;  4RTY A;  3TSZ A;  1UEC A;  1BBZ A;  5DM7 R;  2K2M A;  4RG2 A;  1WXB A;  4RTU A;  3P8D A;  2QGF B;  1WZO A;  2L0A A;  2RQT A;  1ZSZ C;  5KYW A;  2DA9 A;  2PUO B;  4OVA A;  3UA7 A;  1OYX A;  3A1P A;  1LNX A;  1ZUY A;  3V8K A;  2YUQ A;  4C92 F;  6AT1 B;  2CT3 A;  3GOX A;  3OB9 A;  3EAE A;  4JUV A;  3H0F A;  4F7U B;  5KYU B;  2ED0 A;  4V2S A;  2DO3 A;  1ZLM A;  1EZZ B;  2I2L A;  3OSV A;  1SF9 A;  4A4K A;  2DNU A;  3FDR A;  2LDM A;  2DM1 A;  3CXC P;  3A8L B;  3REA B;  2IIM A;  1VYU A;  1YI2 A;  1TTH B;  4M7D B;  3HP9 A;  2MAM A;  5IHK A;  1V1C A;  2KGT A;  3EH2 A;  3S3N A;  3EGX B;  3H41 A;  4J9B A;  4F7U G;  1ZX6 A;  1T3S A;  2M9U A;  3SHW A;  4CRI A;  2PVG B;  4XAX B;  1N9S A;  2AHJ B;  2MWP A;  3P8B B;  5GAM f;  3FB9 A;  3FEO A;  2FVU A;  1GCP A;  4II1 A;  1QLY A;  2AT1 B;  3I56 Q;  3J7A F;  4JRK A;  1CSK A;  2GNC A;  1YHQ Q;  4M78 G;  2KE9 A;  1KD1 C;  3H0I A;  3G7Z A;  2G6F X;  1UGS B;  4DA4 A;  4M7D G;  4EIK A;  1HSQ A;  5GAN 8;  3PIO A;  3M4G A;  3U23 A;  3CMA T;  3OW2 P;  2KXC A;  2QAS A;  2ROT A;  5LJ3 d;  4F14 A;  2QEX T;  3M0T A;  1M5Q 1;  1U06 A;  5D6X A;  2RI5 A;  3M4Y A;  4HCB A;  2MWO A;  1GCQ A;  4XQ3 A;  2VUB A;  2XDD A;  1VQO A;  5CVI A;  2BTT A;  1W2B P;  4HCZ A;  1VQN A;  3OY9 A;  3CQT A;  2L3P A;  3LH5 A;  2A08 A;  2DKG A;  1VQL Q;  1BI0 A;  3CPW A;  2ATC B;  2E1H A;  3CCL A;  2EJ9 A;  1K9M U;  1N8R U;  2RH2 A;  4O5V A;  1SRL A;  2J7I A;  3CCR A;  1I8F A;  4HKE A;  3SDZ A;  3G71 A;  1UGP B;  1Q81 C;  2RHX A;  1LOJ A;  1TS9 A;  7AT1 B;  3CC7 T;  1M4Z A;  4FYY B;  1HJD A;  2DFU A;  2ZPB B;  2EJG A;  4HA8 A;  3E2U A;  2V8J A;  1M90 U;  2L8D A;  1BB9 A;  3G6E A;  3TCJ A;  2K5I A;  2D9T A;  2RHZ A;  3CCU T;  5LJ5 d;  3EFS A;  2RM4 A;  2QQA A;  1YIJ T;  1M9S A;  4ELZ C;  3EFO B;  2LTO A;  1WFW A;  4OGC A;  1KFZ A;  3CME Q;  4PJO C;  2R5M A;  4PL6 A;  3CD6 Q;  3C0C A;  2X9H A;  5LJ5 h;  1D1A A;  5A2Q E;  2RJC A;  2JS2 A;  2F5K A;  4MZM A;  4OMF B;  3CC4 T;  2JNG A;  2LX9 A;  1WHJ A;  3GNG A;  3JCM Q;  4FYV B;  1OPK A;  1WJR A;  4JJB A;  4JRI A;  1K8A C;  2QG9 B;  3PMI A;  3R6N A;  2BE9 B;  4M77 F;  5LL6 S;  3V7S A;  2COW A;  3C94 A;  4FYX B;  3NTK A;  4ZGJ B;  1JO8 A;  4CI0 C;  3LW5 E;  3ULR B;  1GXI E;  1KC8 R;  4KH1 B;  2QI2 A;  4AG1 C;  1Y71 A;  4J8O A;  5I22 A;  3OYK A;  1NE8 A;  3M0U A;  2W0Z A;  1HD3 A;  3OYF A;  4QQG A;  3E1S A;  1YJW T;  1Q82 U;  2O31 A;  3PGG A;  4JJC A;  1PD0 A;  4B6M A;  3JCM g;  4J9D A;  2O9V A;  1JU5 C;  2OTJ Q;  1BI3 A;  2K3X A;  2P4R A;  3F70 A;  2H8H A;  1QVG P;  2RHI A;  4BI8 B;  4N4H A;  2RD1 A;  4IUQ A;  4M7A F;  5FU7 B;  3E9G A;  1RAE B;  4LXC A;  3QO3 A;  3CCV Q;  2E41 A;  5A0D A;  3EHQ A;  3PMT A;  4X9D A;  3BFM A;  2YUP A;  1BK2 A;  2FB7 A;  1PNJ A;  4KT0 E;  4M75 A;  1B07 A;  2LJ0 A;  4M77 A;  4RTZ A;  2LCL A;  3CCS T;  4ATO A;  5GAN d;  3OS1 A;  4C8Q E;  2FYK A;  4J9C A;  4C92 B;  2MOX A;  1X69 A;  3UWN A;  4AMC A;  3ME9 A;  4PKC C;  1WGS A;  1HK9 A;  4EPC A;  2MF2 A;  3QYG B;  3S3O A;  2JS0 A;  1YJN Q;  3I56 A;  2PUK B;  4AFQ C;  1VQ7 Q;  4CC4 B;  2HAX A;  4IUT A;  2VGM A;  2RHU A;  1YHQ A;  3RES A;  3TEE A;  1M2V B;  1BIB A;  1GFD A;  2HQE A;  2JJ9 A;  1NLP C;  2RQW A;  3PVQ A;  4BD3 A;  4C92 G;  2ZPE B;  2CT4 A;  2CP0 A;  3VRZ A;  4A4H A;  4J9H A;  2OTL Q;  2ROL A;  2QTV A;  5IN1 A;  1YJ9 T;  1D3B A;  4M7A A;  4K11 A;  3J81 E;  1OI1 A;  3CEY A;  1WLP B;  2K6D A;  3ZBD A;  5GAM d;  4OMM A;  4DEX A;  3JCM J;  1YJ9 Q;  1SG5 A;  3WXM B;  4ANJ A;  2DER A;  1NG2 A;  4OMQ A;  2BKD N;  4M78 F;  3EG1 A;  1OV3 A;  1VQL A;  1U5S A;  3M0Q A;  3FC3 A;  5A0G A;  5GAM h;  1DJ7 B;  2VYT A;  3VRY A;  4FT4 A;  2RJD A;  3JB9 G;  3QJ6 A;  3FLG A;  2VVK A;  1TU0 B;  5EC7 A;  5FWB A;  2OX7 A;  2EKH A;  2YHT A;  4BY6 B;  4J6Y A;  2NUT B;  3HFN A;  2ABL A;  2EFI A;  5I2S A;  1RLP C;  1KQ2 A;  3LYI A;  2P4T A;  3L1A A;  3OSS C;  2YRC A;  1WA7 A;  3OYA A;  2SRC A;  2K3B A;  1YWP A;  5J3B A;  2EQU A;  3CPF A;  4Q5W A;  2JM8 A;  5DLO A;  4J9F A;  3A8M B;  2O88 A;  3VS5 A;  4E7Z A;  3I55 T;  3ER0 A;  2YUN A;  2AK5 A;  3DLL A;  3CME A;  1M3B A;  4JJN K;  1SRM A;  3CD6 A;  5KYU A;  1NM7 A;  1JJ2 P;  4IIO A;  5FLX E;  1YIT T;  1RAD B;  2X4Y A;  2GCX A;  2IPO B;  1AWW A;  2DET A;  3QYH B;  1H8K A;  1M1G A;  5CKE A;  4Z89 A;  3VUZ A;  1K73 C;  1VQ4 Q;  2JTE A;  2WSF E;  2KEA A;  4RCB A;  5LJ3 j;  3VS0 A;  3X25 B;  3JCM f;  2JTM A;  3MPU B;  5M9O A;  4FSX A;  4M78 A;  3LH0 A;  1Q86 U;  2FL7 A;  4A4E A;  1QMC A;  4C5G A;  1M8V A;  2DF6 A;  2DL7 A;  3N5B B;  4M7D A;  3V8J A;  5GAM g;  4AFU C;  2HL3 A;  3EGX A;  4QW2 A;  1N8R R;  2L2P A;  5FRN A;  2LQW A;  1SSH A;  4QVC A;  1UFF A;  2ZPI B;  3UF4 A;  3C12 A;  1NLO C;  3M59 A;  1VOM A;  3OQ5 A;  4HCK A;  2RF0 A;  1NJI C;  1SPK A;  3LGF A;  4B9X A;  5IAY A;  2DEQ A;  1Y57 A;  2EVR A;  3SFM A;  1F1B B;  4RTV A;  2DX1 A;  3EG2 A;  2XID A;  5CKH A;  1KK7 A;  2LQN A;  1WYX A;  3GF5 A;  1MMA A;  1JB0 E;  3RR6 A;  1X01 A;  2H3E B;  2CP3 A;  3CCQ Q;  2E6N A;  2QDL A;  3LWI A;  4YTL A;  2VXF A;  2JMC A;  3CCM Q;  4J9E A;  1VQP Q;  4HT9 A;  2KXD A;  1WQW A;  1WJQ A;  3RKY A;  5GAO r;  3G6E Q;  3CCE T;  1FYN A;  4NS5 A;  4E7S A;  1D0Y A;  3M5A A;  3CCV A;  4E7K A;  1QWE A;  3JCM X;  5GAO p;  3PIP A;  1RI0 A;  1KSW A;  3GNF B;  1VYV A;  1WHK A;  4D8D A;  3FRN A;  2ENM A;  2CYZ B;  4B9W A;  4C8Q D;  5KH6 A;  1D3B B;  4M7A B;  3TU4 K;  4FYW B;  3OYM A;  2IVW A;  5EG2 A;  1ZHI A;  2PZ1 A;  1IRE B;  3M54 A;  1WPY A;  4ZN3 A;  1GCQ C;  1YJN A;  2XKO C;  5HY6 A;  1VQM T;  4C0D B;  1OEB A;  1VQ7 A;  1X2Q A;  1Q81 U;  3VS4 A;  2A36 A;  4ME7 A;  1VQ9 T;  1QCO A;  4ZNX A;  2JMA A;  1VQ6 T;  4M7A G;  2P0Q A;  4CC2 A;  2ZPG B;  4MDW A;  3BDL A;  1JBM A;  1P92 A;  1K0S A;  3ZEH A;  5CQX A;  1IZ6 A;  3T9N A;  1X43 A;  2O9S A;  2OTL A;  1Z9Z A;  3EHR A;  2RQU A;  2EWN A;  2CUB A;  4QKU A;  5HCK A;  3OYN A;  1R8O B;  4FCY A;  5IHN A;  1YJ9 A;  1U1T A;  2COY A;  4PFZ A;  3CC2 T;  2FRW A;  5AT1 B;  2DXU A;  3QSU A;  2KNB B;  1VQK T;  1G3Y A;  2O4X A;  2FRY A;  1PKT A;  3FIF A;  1M1K R;  3TSW A;  1OU8 A;  4BB7 A;  5GMK l;  1KQS P;  2DJZ A;  2XMF A;  2M02 A;  3LX7 A;  2AIR B;  3HSB A;  2RNA A;  1BCM A;  3QZ9 B;  1C6V X;  1UJ0 A;  3OYL A;  4C5H A;  5IT9 E;  2DMO A;  4D8K A;  3QPH A;  1VQ8 T;  2HSP A;  3RKW A;  3JSC A;  3M55 A;  4FL6 A;  1OUL A;  4FW1 A;  5DY9 A;  1SHG A;  2QQB A;  3CPW S;  4BY6 C;  2FPF A;  4ZTJ A;  5GAN 2;  3M0S A;  2HBW A;  2NYS A;  4XU2 A;  4M75 E;  4M78 B;  5GAN j;  4M77 E;  2Y90 A;  3WVD B;  3UAT A;  2CRE A;  3QHS A;  5CO7 A;  1G3T A;  4QVZ A;  2Y4X A;  4FT2 A;  1M3C A;  4HCC A;  1UDL A;  3M56 A;  1MHN A;  3BE3 A;  2VB6 A;  2E6Z A;  2DIG A;  3JB9 J;  1UUE A;  3JB9 F;  1WNL A;  1I5L A;  2PU9 B;  1T0J A;  3URG A;  4QQD A;  2O2O A;  1Q7Y U;  3SD4 A;  3KFV A;  4LD6 A;  4HVV A;  1K1Z A;  4ZTF A;  1KC8 C;  1OU9 A;  4EMK A;  2EQM A;  1VQ4 A;  1LVK A;  1QP2 A;  1RAG B;  4KBM B;  3H9N A;  2HKQ B;  1B34 A;  3M57 A;  3QXE B;  4ORZ A;  1QVF P;  2J06 A;  4PJO E;  3RMS A;  2F2X A;  3CMA Q;  1AVZ C;  3HRU A;  3VUB A;  1X6O A;  2DXC A;  5KE2 A;  2QEX Q;  4C92 A;  4OMN A;  4Z88 A;  3MEW A;  4MZT A;  2ECZ A;  4OP0 A;  2W10 A;  1AHJ B;  4J7I A;  3OYC A;  4LUD A;  2VV5 A;  3RKX A;  2V1Q A;  1VIF A;  4DEY A;  5FRM A;  5DLQ E;  3CBM A;  3HFO A;  3JCM P;  2E10 A;  2KYB A;  3VS7 A;  4OB3 B;  1M2V A;  4M75 C;  1YNZ A;  4M77 C;  3JCM d;  4XU3 A;  1I81 A;  2MYS A;  2E65 A;  4DOW A;  3L2U A;  3CCQ A;  2X4W A;  2M16 A;  2XG8 D;  1TUC A;  1AD5 A;  2MMP A;  3JCM W;  3CCM A;  4XTX A;  2CSQ A;  1VQP A;  2HZY A;  1OZ2 A;  3JCM h;  2E12 A;  1R0C B;  3CC7 Q;  2FZC B;  2C0O A;  3MO8 A;  1ARK A;  3LGL A;  2RJF A;  4C0Z A;  4EMH A;  2C0T A;  3AT1 B;  5IXB A;  3CCU Q;  2QA4 T;  1YIJ Q;  4E47 A;  1ZUU A;  2JUF A;  1Q86 R;  2A0F B;  3UA6 A;  1UEB A;  3JCM V;  3G4S T;  4F7U E;  4PJM A;  3Q1J A;  2RB6 A;  4M7A C;  2Y4Y A;  2NUT A;  1UHC A;  4KUI A;  2KT1 A;  2KQW A;  1WHM A;  5I21 A;  3CC4 Q;  2CSI A;  1WHH A;  2O4X B;  2C0I A;  2BE7 D;  2P0K A;  3UDC A;  3M0P A;  4C0D C;  2Z0W A;  3MP8 A;  3PE0 A;  2MPX C;  1A0N B;  1N6A A;  4M78 E;  3JAM E;  3L2V A;  1C1A A;  4M7D E;  4BUG A;  2EQI A;  1LCK A;  1YWO A;  5CCA A;  3J80 E;  2ZPH B;  2BUD A;  1W70 A;  3VJP A;  3P8H A;  1BCO A;  1X75 C;  3MET A;  1XNI A;  2L3R A;  4EMG A;  1KD1 R;  5FWC A;  1YJW Q;  5GAO l;  1RAB B;  5CQY A;  4J83 A;  4KUD K;  1M8M A;  2WSE E;  5FU6 B;  3THK A;  1WHG A;  2PVO B;  2YSQ A;  4C5I A;  2P0P A;  3OYE A;  2HCK A;  1D0X A;  2KT8 A;  4X1V A;  1AZG B;  4DQ2 A;  4ZN1 A;  1QW1 A;  3D7S B;  1M1K U;  4N4I A;  1TSF A;  4JRQ A;  4EMK B;  1BKB A;  1PRM C;  5L8R E;  4J5Y A;  3X26 B;  5HK0 A;  2DTH A;  4R55 A;  1FMK A;  3G1J A;  1OPL A;  4M75 D;  2F69 A;  2DD4 A;  1B34 B;  4RCC A;  3RIR A;  3ZFJ A;  4M77 D;  1EIF A;  3INZ A;  3S6W A;  1T0H A;  4M78 C;  3OBY A;  3CXC S;  2AZS A;  1Q81 R;  4HT8 A;  4M7D C;  2R5A A;  4LUE A;  3CCS Q;  2DXT A;  5GJW B;  1PSF A;  2CDT A;  1BIA A;  2C06 A;  3O5Z A;  3A5Z B;  2JM9 A;  5GMK j;  2CP2 A;  2GF7 A;  1JRI A;  2V8I A;  1IB8 A;  3I9Q A;  1QCN A;  3OYB A;  3M53 A;  1I07 A;  5IHI A;  4KH0 B;  1PD1 A;  1RAF B;  1FMW A;  2DRK A;  2AKK A;  4E7J A;  1N8R C;  1K9M C;  2WSC E;  2MI6 A;  4OML A;  3HRS A;  4UC4 A;  3CCJ T;  1WIE A;  4PJO D;  2YWW A;  1G83 A;  2DK3 A;  1VQ5 T;  4J6X A;  3OW2 S;  2NWM A;  1X6G A;  4E2F B;  1AWJ A;  2BIV A;  3CMA A;  1MUZ A;  3VV0 A;  4BE2 A;  3QDF A;  2VWF A;  4CC7 A;  2JVV A;  5I2M A;  2J6F A;  5GAO q;  2QEX A;  3ZL7 C;  1M90 C;  2E64 A;  4PFP A;  4IUV A;  2OI3 A;  2EGE A;  1G8X A;  4WF2 A;  1PHT A;  1PSE A;  3VS3 A;  5CIU A;  3VYH B;  4JZ3 A;  1AOJ A;  3X20 B;  4MML A;  2LNH B;  3A8H B;  3ASK A;  1WHL A;  1UGV A;  1NPR A;  2NUP A;  4A53 A;  2EJF A;  2EQK A;  2QK0 A;  2CS7 A;  2CP7 A;  1M1F A;  5GMK i;  2B86 A;  1I0C A;  3NGP A;  5GAN 5;  2XDB A;  3HTR A;  3PVL A;  3CXC A;  1ZSZ B;  4A54 A;  1NBE B;  4RTT A;  4DBF A;  2JZ2 A;  5GAN 3;  1IHW A;  2D8J A;  4BDZ A;  4PJJ A;  3CC7 A;  1KG1 A;  4P5N A;  2L3Q A;  1Q7Y R;  1ACM B;  3CPW P;  2MK5 A;  1ZQ1 A;  4NOY A;  2HSE B;  1R77 A;  1UB4 A;  3NTI A;  4IUR A;  1X27 A;  1I5O B;  2LT1 A;  3CCU A;  3OMC A;  1YI2 T;  3EGD A;  3TRE A;  1YIJ A;  4GLK A;  1N5Z A;  3I55 Q;  1VYT A;  1TUG B;  4JS4 A;  4XTZ A;  1QCF A;  5GMK e;  3OW2 A;  2DYB A;  1K9A A;  1Q82 C;  2XHC A;  1RLQ C;  4N0A A;  2J6O A;  1ZA2 B;  4LNP A;  1YIT Q;  1W6X A;  1D1B A;  1D09 B;  3CC4 A;  1GBR A;  2FPE A;  2DZ9 A;  2SEM A;  3QG1 A;  2EBP A;  3H0H A;  4XTY A;  4M7D D;  2M51 A;  2L89 A;  2K9G A;  2QYZ A;  4BDY A;  4DBH A;  3S3M A;  1U1S A; 
#chains in the Genus database with same CATH homology
 2V8J A;  2LCC A;  3OYI A;  2L8D A;  4JDS A;  1M90 U;  4C92 E;  3L2Q A;  2PQW A;  4BB7 A;  5GMK l;  2DJZ A;  2OAU A;  3G6E A;  2QTX A;  3LX7 A;  3TCJ A;  2K5I A;  3C4S A;  1YJN T;  3HSB A;  2F5T X;  3QZ9 B;  1VQ7 T;  3OYL A;  2D9T A;  2RHZ A;  3BY7 A;  4C8Q F;  5LJ5 d;  3CCU T;  2EKO A;  3EFS A;  4C5H A;  1KHI A;  1TH7 A;  5IT9 E;  2RM4 A;  3QPH A;  2QQA A;  4C0G A;  1M9S A;  1YIJ T;  4ELZ C;  5GAN h;  1VQ8 T;  2VXE A;  3RKW A;  2K4Y A;  3JSC A;  3GIB A;  3M55 A;  2LTO A;  4FL6 A;  4OGC A;  1YJW A;  1VQN T;  5DY9 A;  1QVF S;  2QQB A;  4LDV A;  1FX7 A;  3M58 A;  3CPW S;  1S72 T;  4BY6 C;  4M7A D;  4ZTJ A;  3OS5 A;  4PJO C;  5GAN 2;  2R5M A;  3EFR A;  2VGN A;  4IUU A;  4PL6 A;  2GFA A;  1KQS A;  2DTI A;  3CCL T;  5LJ5 h;  1G3S A;  3NFC A;  5GAN 4;  5A2Q E;  2RJC A;  1QVG S;  2H3J A;  2R58 A;  2OTL T;  3JB9 I;  2F5K A;  4XU2 A;  4MZM A;  4M75 E;  4M78 B;  4OMF B;  3CC4 T;  5GAN j;  2D6F A;  2JNG A;  4PJO A;  3CCR T;  5CKB A;  2LX9 A;  4M77 E;  1G5V A;  1W4S A;  3G71 T;  1KD1 U;  3GNG A;  5KE3 A;  3JCM Q;  1W2B S;  1WJR A;  1K8A C;  2Y90 A;  4JRI A;  3WVD B;  4F7U F;  3QHS A;  5CO7 A;  1G3T A;  2DIQ A;  1G3W A;  2Y4X A;  1UGR B;  3PMI A;  4FT2 A;  4QVZ A;  4HCC A;  5FU7 C;  3M56 A;  1MHN A;  4M77 F;  2A3L A;  5LJ5 j;  4BE1 A;  5LL6 S;  4ZGE B;  3V7S A;  2E6Z A;  2DIG A;  2EYQ A;  3C94 A;  3H6Z A;  4FM4 B;  3JB9 J;  3JB9 F;  3QJY A;  5KCH A;  3NTK A;  4ZGJ B;  1WNL A;  5AYF A;  1I5L A;  2PU9 B;  5D6Y A;  5GMK m;  4CI0 C;  3LW5 E;  4QQD A;  3URG A;  1GXI E;  3QUI A;  4EMK C;  1Q7Y U;  2QI2 A;  3SD4 A;  3V8L A;  2LC4 A;  3MEA A;  2LNV A;  2G3R A;  5CKD A;  3GP8 A;  1Y71 A;  2RA2 A;  4J8O A;  4LD6 A;  2E5Q A;  3OYK A;  4JLG A;  1NE8 A;  2ZCF B;  3JCM b;  4M7D F;  2RI2 A;  1KHC A;  3QII A;  5J39 A;  4ZTF A;  1KC8 C;  4EMK A;  2EQM A;  3OYF A;  1VQ4 A;  3OS2 A;  1QP2 A;  4QQG A;  3E1S A;  1YJW T;  5GAO n;  4KBM B;  3BW1 A;  1Q82 U;  3CCS A;  4LDY A;  4RMO A;  1B34 A;  3M57 A;  3PGG A;  3QXE B;  4C92 C;  4C8Q C;  3JCM g;  1FWZ A;  4PJO E;  3RMS A;  2LT4 A;  2K57 A;  1BI3 A;  2K3X A;  2X35 A;  3HRU A;  3MP1 A;  3VUB A;  1X6O A;  2DXC A;  5KE2 A;  3F70 A;  4LDX A;  3PFS A;  2LQK A;  4C92 A;  3VU3 C;  3MEW A;  4C8Q A;  3L42 A;  4MZT A;  4PLI A;  5LJ3 e;  3L2R A;  4J7F A;  2RHI A;  2XD0 A;  4OP0 A;  5GAN g;  4BI8 B;  1HXD A;  1AHJ B;  2DPP B;  2K2V A;  4J7I A;  2DVE A;  3OYC A;  4N4H A;  2QA4 A;  2RD1 A;  4IUQ A;  5LJ3 f;  4M7A F;  2VV5 A;  2CZ0 B;  4OB1 B;  3RKX A;  3PT9 A;  2LVM A;  2RK1 A;  3O8V A;  1VIF A;  3SB2 A;  4IUP A;  5FU7 B;  4E7L A;  1QVF A;  3E9G A;  5FRM A;  4KUL A;  3CBM A;  3HFO A;  5DLQ E;  3JCM P;  3MHX A;  2E10 A;  4MDX A;  1H64 1;  4LDU A;  1WQ7 A;  3G4S A;  3OYD A;  4OB3 B;  4M75 C;  3QO3 A;  2CKK A;  2DZC A;  4BE0 A;  2E41 A;  3VKI A;  5A0D A;  1LJO A;  4M77 C;  1QVG A;  3PMT A;  4XU3 A;  2FHD A;  4X9D A;  3JCM d;  3JB9 H;  1I81 A;  3BFM A;  3DKM A;  1VQ5 A;  1ZBX A;  2E65 A;  4M78 D;  4DOW A;  2FB7 A;  3V7R A;  4F7U A;  3L2U A;  2V8K A;  1W2B A;  1RL2 A;  4KT0 E;  4M75 A;  3CCQ A;  4IKF A;  1VQ4 T;  2X4W A;  2M16 A;  2XG8 D;  4M77 A;  3X28 B;  5GAN 6;  2MMP A;  3JCM W;  3RER A;  3CCM A;  2LCL A;  2QDY B;  1SSF A;  4XTX A;  3CCS T;  4ATO A;  5CAI A;  5GAN d;  3OS1 A;  1VQP A;  1OZ2 A;  3CBO A;  2L5Q A;  2X4X A;  3JCM h;  4C8Q E;  2E12 A;  2DXB A;  2FYK A;  4C92 B;  3VYG A;  3MO8 A;  2M0O A;  3UWN A;  3ME9 A;  4PKC C;  1WGS A;  2RJF A;  3LGL A;  1M1K C;  4XTV A;  2DTO A;  1HK9 A;  2EAY A;  4C0Z A;  3V7C A;  4EPC A;  2MF2 A;  1K8A U;  3QYG B;  3S3O A;  4BI3 A;  2YLC A;  1VQO T;  4EMH A;  3I56 A;  3SWN C;  2PUK B;  4PNO A;  2KMT A;  3MEU A;  4R56 A;  2HAX A;  4NL2 A;  4IUT A;  2QA4 T;  2VGM A;  2RHU A;  3HKS A;  5GAN f;  1N27 A;  4L59 A;  4E7I A;  4E47 A;  5LJ5 e;  1YHQ A;  4O6J A;  2JUF A;  3RES A;  3SWN A;  3TEE A;  1OZ3 A;  2KVQ G;  1BIB A;  5FU6 C;  2HQE A;  4LD9 K;  1UEB A;  3JCM V;  3M9Q A;  3G4S T;  2M1H A;  2PVD B;  3X24 B;  2RK2 A;  4BD3 A;  4F7U E;  5LJ5 f;  4C92 G;  3Q1J A;  2RB6 A;  3OBW A;  4M7A C;  2QXF A;  3JRZ A;  2ZPE B;  2E70 A;  2XI9 A;  2Y4Y A;  1Q86 C;  1H3Z A;  4M75 B;  3CBP A;  2ZZD A;  3QKJ A;  4A4H A;  4J6W A;  4KUI A;  1KC8 U;  2QQR A;  4M77 B;  4QQ6 A;  2KQW A;  2OTJ A;  5I21 A;  3CCQ T;  2O4X B;  5IN1 A;  3OYJ A;  1YJ9 T;  1D3B A;  4M7A A;  1VUB A;  1QVP A;  1BYM A;  2P0K A;  2YRV A;  2JTF A;  3UDC A;  4JRP A;  5HK3 A;  3J81 E;  1OI1 A;  2HQX A;  3CEY A;  4C0D C;  3MP8 A;  4MZP A;  3ZBD A;  3CCM T;  1VQP T;  1N6A A;  5GAM d;  3JCM J;  4M78 E;  3WXM B;  1Y96 A;  4FIB A;  1O75 A;  4L6V 5;  4OGE A;  3RUX A;  3JAM E;  3DLM A;  3I55 A;  3L2V A;  3G6E T;  4M7D E;  1N9R A;  2GFU A;  2BKD N;  4BUG A;  2K3Y A;  4M78 F;  5CCA A;  1VQL A;  1JJ2 S;  3J80 E;  2RI3 A;  3BDU A;  3GLX A;  2ZPH B;  4L5G A;  5CK9 A;  2BUD A;  4JS5 A;  3VJP A;  4M75 G;  3I56 T;  1BI2 A;  1XQH A;  3WVE B;  5A0G A;  5C0M A;  3UT1 A;  4DOV A;  5GAM h;  3FC3 A;  4M77 G;  1YIT A;  3P8H A;  4OB0 B;  1DJ7 B;  2VYT A;  2A7Y A;  4FU6 A;  2RJD A;  1X75 C;  4FT4 A;  1WJS A;  3JB9 G;  2WAC A;  1O9S A;  3FLG A;  1XNI A;  3MET A;  3QJ6 A;  4Y91 A;  1YHQ T;  2XDP A;  2L3R A;  2QQS A;  4EMG A;  2O01 E;  5D6W A;  2NLU A;  4QVD A;  5HKC A;  2YHT A;  4BY6 B;  5GAO l;  4PJO B;  4J6Y A;  4BAC A;  5CQY A;  4J83 A;  1MGQ A;  4KUD K;  3HFN A;  5FRO A;  2WSE E;  2YLB A;  5FU6 B;  2EFI A;  4C92 D;  5I2S A;  2PVO B;  1VIE A;  5GAM j;  1KQ2 A;  4M7A E;  3LYI A;  2P4T A;  3L1A A;  4XTU A;  3OSS C;  2RJE A;  5CR2 A;  3DB3 A;  3LLR A;  4C5I A;  3OYA A;  3KXT A;  2KSS A;  4Y28 E;  1BI1 A;  2CZ6 B;  2QQ9 A;  4TVR A;  5CKF A;  1XTD A;  2CZ1 B;  2P0P A;  3PIP A;  5J3B A;  2EQU A;  3CPF A;  2JOY A;  3R6O A;  3OYE A;  4Q5W A;  4C5E A;  3MEV A;  5DLO A;  3A8M B;  3H8Z A;  2KAF A;  4DQ2 A;  4X34 A;  3HRT A;  4RKU E;  4ZN1 A;  3ER0 A;  3I55 T;  3GPL A;  1QW1 A;  3CCJ A;  1M1K U;  4NL3 A;  5GAN 7;  4N4I A;  4PJO G;  2EQJ A;  3DLL A;  5LJ3 h;  3CME A;  2LQ8 A;  4JRQ A;  1VQL T;  3PTA A;  4JJN K;  4EMK B;  4XTW A;  3A8O B;  1BKB A;  2IG0 A;  5L8R E;  3OS0 A;  3CD6 A;  3C95 A;  4J5Y A;  3E19 A;  2HD0 A;  3X26 B;  5HK0 A;  3KUF A;  2DTH A;  5FLX E;  4R55 A;  3AHU A;  4M75 D;  1YIT T;  2F69 A;  5J26 A;  3NTH A;  1S72 A;  2DD4 A;  1B34 B;  2R57 A;  2XU8 A;  4RCC A;  3RIR A;  4M77 D;  2X4Y A;  2GCX A;  1XOV A;  4X9C A;  3ZFJ A;  5GMK h;  1EIF A;  3INZ A;  3S6W A;  3JCM e;  3QYH B;  1M1G A;  2XIC A;  4M78 C;  2CZ7 B;  3OBY A;  5CKE A;  3CXC S;  3UPU A;  3JB9 D;  3VUZ A;  3KBG A;  4HT8 A;  4OF1 A;  1K73 C;  3OYH A;  3HL8 A;  4M7D C;  2R5A A;  2WSF E;  4RCB A;  5LJ3 j;  3E9F A;  3X25 B;  4C8Q B;  3JCM f;  5GAO m;  2JTM A;  3A8G B;  2DXT A;  2HBP A;  4C0F A;  1PSF A;  5M9O A;  4FSX A;  1BIA A;  4BI4 A;  4M78 A;  3LH0 A;  1Q86 U;  2FL7 A;  4A4E A;  2C06 A;  4C5G A;  1M8V A;  3OYY A;  3JCM c;  5GAN e;  3A5Z B;  4M7D A;  3N5B B;  2HNI A;  1JJ2 A;  5GMK j;  3CCE A;  3V8J A;  5DM7 R;  4RG2 A;  5GAM g;  2GF7 A;  3MP6 A;  1JRI A;  4QW2 A;  2V8I A;  5FRN A;  3P8D A;  3OYB A;  4LDW A;  4QVC A;  3M53 A;  2ZPI B;  2PUO B;  4OVA A;  1OYX A;  4XU1 A;  4GY5 A;  3C12 A;  4PLL A;  3QZ5 B;  4E7J A;  3M59 A;  1N8R C;  1K9M C;  2WSC E;  1LNX A;  2MI6 A;  3V8K A;  3HRS A;  3OQ5 A;  1NJI C;  4C92 F;  3LGF A;  2KY9 A;  4UC4 A;  4B9X A;  5IAY A;  3PNW C;  3CCJ T;  3GOX A;  3OB9 A;  2DEQ A;  3EAE A;  4JUV A;  4C8Q G;  3L2W A;  1FXX A;  1UGQ B;  4F7U B;  3SFM A;  4PJO D;  3CME T;  4MMK A;  2DK3 A;  1VQ5 T;  4J6X A;  1KQ1 A;  4OB2 B;  4ZGD B;  3OW2 S;  2XID A;  3CD6 T;  4V2S A;  5CKH A;  2DO3 A;  2BIV A;  3CMA A;  2D0Q B;  3VV0 A;  2K5L A;  4BE2 A;  2KDS A;  2I2L A;  3OSV A;  3GF5 A;  2JVV A;  1JB0 E;  5I2M A;  5GAO q;  2QEX A;  1X01 A;  2RHY A;  1YBY A;  1M90 C;  4A4K A;  2DAQ A;  2E64 A;  3FDR A;  4IUV A;  2LDM A;  2E6N A;  4A4G A;  4WF2 A;  1VQM A;  1PSE A;  2XK0 A;  3LWI A;  4YTL A;  2LRQ A;  2VXF A;  5CIU A;  3VYH B;  1YCY A;  3A8L B;  3X20 B;  1YI2 A;  4MML A;  4E7H A;  4HT9 A;  3A8H B;  1WQW A;  4M7D B;  3HP9 A;  1WJQ A;  2K5F A;  3RKY A;  3ASK A;  2MAM A;  5LJ3 g;  3S3N A;  5GAO r;  4XU0 A;  5GAM e;  1U8R A;  1VQ9 A;  4M75 F;  1NPR A;  1QP3 A;  4F7U G;  3OMG A;  4A53 A;  2EJF A;  3CCE T;  2CGH A;  2M9U A;  4NS5 A;  4CRI A;  1VQ6 A;  2PVG B;  4XAX B;  2EQK A;  1N9S A;  2B8A A;  2AHJ B;  2MWP A;  3P8B B;  3M5A A;  3LWH A;  3CCV A;  4D6W A;  4E7K A;  5GAM f;  1NZ9 A;  3QBY A;  4Z02 A;  3SWN B;  3JCM X;  3QDR B;  2CS7 A;  3FB9 A;  5GMK i;  1M1F A;  2ZGW A;  2FVU A;  3FEO A;  4II1 A;  5GAO p;  1RI0 A;  2EIF A;  2KK4 A;  2ZPF B;  3GNF B;  5GAN 5;  4JRK A;  2XDB A;  3J7A F;  3CXC A;  4A54 A;  4ELY C;  3FRN A;  4M78 G;  2JZ2 A;  2CYZ B;  1KD1 C;  4B9W A;  1I4K 1;  3G7Z A;  5GAN 3;  4C8Q D;  1UGS B;  2RO0 A;  4DA4 A;  5KH6 A;  4M7D G;  3RMQ A;  4A4F A;  1D3B B;  4M7A B;  3CC2 A;  5GAN 8;  3PIO A;  4BDZ A;  3M4G A;  3TU4 K;  3CC7 A;  3OYM A;  1KG1 A;  4P5N A;  2X4J A;  1VQK A;  3CMA T;  2OTJ T;  2IVW A;  5LJ3 d;  1KQS S;  3DB4 A;  2QEX T;  5EG2 A;  1ZHI A;  1IRE B;  3M54 A;  1WPY A;  1Y96 B;  4VUB A;  1ZQ1 A;  4ZN3 A;  4NOY A;  1K73 U;  1NPP A;  1YJN A;  1UB4 A;  1M5Q 1;  2XKO C;  3NTI A;  4IUR A;  5HY6 A;  4C0D B;  5D6X A;  1VQM T;  2RI5 A;  1VQ7 A;  1Q7Y C;  2LT1 A;  3CCU A;  4PJO F;  1V29 B;  3M4Y A;  3OMC A;  5C6S A;  1YI2 T;  4HCB A;  1Q81 U;  2MWO A;  3TRE A;  1YIJ A;  4ME7 A;  4XQ3 A;  2VUB A;  2XDD A;  1VQO A;  1VQ8 A;  4GLK A;  5CVI A;  1VQ9 T;  4HCZ A;  4N0A C;  2JN0 A;  4JS4 A;  1VQN A;  3HHT B;  4XTZ A;  5GMK e;  3OY9 A;  3OW2 A;  1VQ6 T;  4M7A G;  2P0Q A;  2DKG A;  1Y7X A;  1Q82 C;  1BI0 A;  3CCV T;  4XK8 E;  3CPW A;  4EDU A;  5A0L A;  2ZPG B;  2E1H A;  2XHC A;  4MDW A;  3CCL A;  3BDL A;  1JBM A;  1P92 A;  4N0A A;  5LJ5 g;  2EJ9 A;  3ZEH A;  3MCA B;  5CQX A;  1N8R U;  1K9M U;  1IZ6 A;  2RH2 A;  3HPW A;  3T9N A;  2OTL A;  3OYG A;  1Y07 A;  4O5V A;  1NJI U;  3CC4 A;  3FJP A;  3L2Z A;  2DZ9 A;  1I8F A;  2GQV A;  4HKE A;  3CCR A;  3SDZ A;  3QG1 A;  3G71 A;  2EWN A;  5KCO A;  1UGP B;  1Q81 C;  4N4G A;  3OYN A;  1R8O B;  2VC8 A;  3OA6 A;  2RHX A;  4RG8 A;  1LOJ A;  1YJ9 A;  1U1T A;  2DD5 A;  4XTY A;  4M7D D;  3CC2 T;  2L89 A;  4BDY A;  3CC7 T;  1M4Z A;  2DXU A;  4JLI A;  3QSU A;  1VQK T;  1G3Y A;  3S3M A;  2O4X A;  2ZPB B;  2EJG A;  1U1S A;  4HA8 A;  3FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...