5FU6B

Not module of the human ccr4-not complex (crystallization mutant)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
192
structure length
192
Chain Sequence
EMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 31
structure length 192
sequence length 192
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu6B00
4C0GA 5FU7B 4BY6B 4BY6C 4C0FA 5FU7C 5FU6B 4C0DB 5FU6C 4C0DC
chains in the Genus database with same CATH superfamily
1YI2Q 3CCSQ 5GAOp 2JTEA 2DTIA 1G3WA 1TG0A 3JB9J 2BTTA 1HXDA 2SEMA 5GMKh 4BDYA 1ABQA 1X2QA 2KE9A 3ULRB 3CCQQ 3CMEQ 1BIBA 1T0JA 3HP9A 2DPPB 2ZCFB 4OMQA 2E6ZA 1E6GA 3QJYA 3A8MB 5AT1B 2LJ1A 2I0NA 5ECAA 5GAMh 2PUOB 2RI5A 4F7UA 2JS2A 1PRLC 3THKA 4WTOB 1K9MC 2X3XD 1G8XA 1WHGA 3MEUA 2FRWA 2D1XA 1NG2A 2Z0WA 2DX1A 1IRXA 2HNIA 3UDCA 1G3TA 4RTYA 4LDXA 3Q1JA 3CCVT 2ENMA 5KYUA 4XTVA 4A54A 1IZ6A 2PVDB 1OI1A 2JNGA 3FC3A 3CCMQ 3I5RA 3H0HA 4J6WA 1YITT 3V8LA 2QI2A 2H8HA 4D8DA 2O4XB 4M78E 5L8RE 2Y4YA 3LH5A 3CC4T 1M2VA 1XNIA 4DEXA 1GCQC 4XQ3A 4C92B 4E7IA 4M7AA 3QUIA 1NPRA 3KXTA 2LJ0A 1X6OA 4M77A 1VQOA 4XTYA 4C0ZA 1WHJA 3CPWP 3LX7A 4M7DE 1CKBA 4M75G 2RQRA 4RTWA 1SHGA 2HAXA 1PD1A 2O2OA 2LQNA 3C4SA 2ZPGB 1RAEB 5J3BA 5GAOm 3G6EA 4ZGJB 1D1BA 1VQPA 1M90R 2CYZB 4QQDA 1WHMA 5KCHA 2GTJA 4NS5A 2FL7A 5I2SA 2EPDA 1D09B 2P4TA 2VXEA 2RK1A 4V2SA 4LDUA 3CCRQ 1M3BA 2BZXA 4J7FA 4CC4B 5FRNA 2CZ7B 2X3WD 4RTUA 5CO7A 1F1BB 5GMKm 5CKHA 3H8ZA 1D0YA 4J9EA 3PVLA 5KYUB 1ZBXA 2QGGA 3OBYA 1TUCA 2E70A 2XDPA 1O75A 3M58A 2MF2A 1OQKA 1PKTA 2K9GA 4Y92A 2CP3A 4BE0A 2BUDA 3T9NA 3M0QA 2QQ9A 2E65A 3A98A 3ZBDA 1WYXA 4PLIA 3G71A 3CPWS 4M75F 3R6OA 3JCMh 1M8MA 3MPUB 2KT1A 2KT8A 2OTJT 4JRKA 4M78A 3LW5E 4C5HA 1ZSZA 3GIBA 1NBEB 3LH0A 4CC2A 4ATOA 3NPFA 4RTXA 2GGRA 3L42A 1BU1A 1SRLA 3LGLA 4MZPA 4M7DA 2DKGA 2GNCA 2HSPA 3VS4A 2AT1B 4KT0E 3JCMQ 2HBWA 3CCJA 2KSSA 1RADB 1UE9A 4FM4B 4IIOA 3CC2A 1X6BA 1PWTA 2CT3A 2AKLA 2RNAA 2D0NA 5CCAA 1KQSP 2HKQB 4R56A 1G2BA 2DBKA 2JTMA 4C5GA 1TUDA 4DBHA 5GJVB 3CCVQ 3QWXX 2DK3A 4II1A 3RR6A 2DAQA 3CXCA 1M5Q1 1PSFA 2CP7A 2AZVA 3MEVA 3FDRA 2DRMA 5LJ3j 2X4JA 2VB6A 4RG2A 1I4K1 1YJ9T 1YITQ 2R57A 2LX7A 2E6NA 2BE9B 2HL5C 2ROLA 3FB9A 5GAN5 4L59A 1UJYA 3CC4Q 2XDBA 2AK5A 2DZ9A 5KYYA 4DEYA 4RCBA 1Q7YC 2HKNA 4M7AC 4Y91A 2XMFA 2J7IA 4M77C 2LQWA 4QQGA 3A8OB 1YCSB 1M3CA 2BZYA 2QEXT 2P84A 2YLCA 3FLGA 2DTHA 1X01A 1K73U 4AT1B 3SB2A 3VJPA 2EW3A 3I55T 4OMLA 3FJ5A 5IXFA 4FT4A 2QDYB 2CH4W 4JRIA 1JQQA 2VKNA 3VS6A 4J5YA 2RQUA 1ABOA 2K7AA 1VQ8T 4N4HA 4N0AA 1MUZA 4E7ZA 1R8OB 1KQSS 1UHCA 2QQRA 2G3RA 3M4YA 1D3BB 5M9OA 2ECZA 1VQPT 2DLPA 3RNJA 3REBB 2HCKA 2VASA 3HFNA 3LWIA 2NUTB 4RG8A 1WJSA 3QIIA 1WXBA 2DRKA 1VQNA 3PIPA 3SWNA 3MO8A 3LYIA 1ZUUA 3CQTA 3VS2A 4DBQA 2EVRA 3M0SA 4IUPA 1PCXA 1QP3A 3I5SA 2HMAA 4LDVA 4DA4A 4HKEA 2VV5A 3E1SA 5CVIA 2EWNA 1VQLT 2LJ3A 2LZ6B 4M78C 2CSQA 1BCOA 2EYZA 1HD3A 1WXTA 1VQ7T 4TVRA 4PJOA 1OV3A 2ZGWA 3AHUA 1ZSZC 5LJ5j 2WSEE 2DL3A 3E19A 1FX7A 3M4GA 3PNWC 1CSKA 2MI6A 3JCMX 4QVZA 2DJZA 4M75B 2LT4A 1D1CA 4FL6A 4HT9A 3G71T 4M7DC 4HCCA 2RM4A 3OYKA 1WJRA 1M90C 3GP8A 5LJ5g 4KGXB 2JS0A 2HQHA 1XTDA 4ZTJA 4HCZA 1LPLA 3MHXA 4FYYB 1I81A 2YLBA 4M77D 1YWOA 5KYXA 3LWHA 3I9QA 4PJMA 2MYSA 4BDZA 1OZ2A 5GMKl 2D6FA 4C8QD 2YRDA 3EHQA 4X9DA 1YJ9Q 2JUFA 1AVZC 4BY6B 2J6KA 2YUQA 1Q82R 1U5SA 4LN2A 3HHTB 3L2VA 2EKHA 2RHIA 1VQ4A 5DLQE 4GY5A 3EGXB 2E1HA 2RB6A 2LCSA 5KYWA 1KG1A 1BIAA 1Q81R 3CPWA 2COZA 4JJCA 2VVKA 1YI2T 2MAMA 5EC7A 3V8JA 1T3LA 2QEXQ 2LTOA 2MOXA 4FSSA 5C0MA 5IH2A 3OS5A 3I55Q 1CKAA 1O9SA 2RF0A 1M2OA 5CK9A 2EFIA 3X25B 3PMTA 3AT1B 4ZTFA 1UUEA 3OYDA 1WLPB 1N5ZA 2M0YA 2MIOA 1VQ8Q 2PVGB 1GXIE 4F7UG 4N0AC 1VYUA 4F17A 4M78D 1TTHB 2ZPBB 3S3MA 2L3QA 1KD1U 2RI3A 3GOXA 1VOMA 5KCOA 5GMKi 3G6EQ 1QCNA 2MWPA 2DMOA 2A0FB 5CKEA 4A4KA 3A5ZB 1VQPQ 2IPOB 4IIMA 1WQ7A 4HT8A 1RAIB 2QK0A 4QQ6A 1TUGB 3PIOA 3N5BB 4M7DD 2XU8A 1N8RU 4LE9A 3SWNC 4NL2A 2QQSA 1X6GA 2X9HA 5IHNA 4KUDK 2Y4XA 4J6XA 3RIRA 2CZ0B 5KE2A 3CCMT 1QVGP 4J9IA 3REAB 2QGFB 5D6YA 4PFOA 2CT4A 2W0ZA 2F1LA 1OZ3A 4MDWA 1M30A 2DXTA 4XTZA 1OX9A 3M0TA 2J06A 3META 1VQ7Q 3QBYA 1SSFA 5FW9A 4PJOC 1VQNT 1VQ5A 4M7AG 3EG2A 5KE3A 2RJFA 1OULA 2AIRB 3P8HA 4M77G 3SHWA 2H3JA 2GFUA 3LGFA 3FIFA 2F2WA 3G71Q 1UTIA 4F7UF 2F2VA 1S72A 2DJQA 5GANj 1IXDA 1KC8R 2E3IA 4J6YA 2KEAA 2PVOB 1Q7YU 3M0UA 3TCJA 1RL2A 4KUIA 1MMGA 5J39A 3KFVA 2KRNA 2NLUA 5FWBA 3VUZA 1B34B 2LC4A 1TXQA 4RKUE 5GANg 2FPEA 2KYMA 2EYXA 3UA6A 3HKSA 2MK5A 3NTIA 3CCJQ 4CC3A 1BBZA 5LL6S 4YTLA 3ASKA 3QG1A 1OPLA 4D8KA 3CC2Q 2KY9A 2LQKA 1WGSA 1QVGS 1ZLMA 3JV3A 1B07A 4PJJA 4HCKA 2DIQA 4OP0A 4BD3A 1K73C 1K8AR 3E2UA 3G7ZA 3MP1A 1AD5A 2V1RA 4M7AF 2ZAEA 1D0XA 4M77F 2OAWA 2K2MA 2KK4A 1QWEA 1GBQA 5IXBA 2JZ2A 4HCBA 2COYA 4PL6A 2EGAA 2CP0A 2RHYA 3DLMA 4FW2A 3SDZA 5FWCA 4C8QE 4M78G 5LJ3e 2XHCA 2P4RA 4QVCA 1TH7A 5AYFA 1H641 4Z88A 3EAEA 4DBRA 5CAIA 4RCCA 2O9SA 4PJLA 2EIFA 2FVUA 2FO0A 3JCMV 3EFOA 4M7DG 4JRQA 5HK0A 3C0CA 3WXMB 1GBRA 1VIFA 1KHCA 2F2XA 3VS1A 4PJOD 1RAGB 4FW1A 5A0GA 1G3SA 5HCKA 2JM9A 2DL7A 1XOVA 3KUFA 3OS1A 3TEEA 1Y96A 1G83A 3V7RA 2L5QA 3TSZA 2FB7A 4RUGA 2YT6A 1M90U 5I2MA 3M0PA 4RTVA 3UF4A 3EG9A 2DE0X 1K0SA 1IO6A 2MPXC 4J9GA 4FYVB 5HK3A 2KDSA 1Q81C 1WHHA 1YN8A 4VUBA 1Q86R 3M59A 2IIMA 3O8VA 4PLLA 3L2WA 1YHQA 4NOYA 1BI3A 4M78F 1VQMA 3NHNA 5FU7C 1QVPA 1WDXA 1VQNQ 2DYIA 2M1HA 2L3SA 3RDVA 2ZPEB 4J7IA 5GAOr 4ZGEB 4AFSC 1X43A 1MV0B 1X27A 2X4WA 4WF2A 2LCCA 4GBQA 3OA6A 1UEBA 4RMOA 1J3TA 4LDWA 2B8AA 4M7DF 3JB9G 1W2BA 1N9RA 2M16A 4C8QA 1WJQA 2RQWA 3CBMA 1Y0MA 1SF9A 2DNUA 1VQ5T 1LVKA 1ZUYA 2RMOA 4LD9K 1W1FA 2A28A 2JMCA 2VGMA 1I8FA 3QDFA 5GMKj 2RO0A 2C06A 4F7UB 4UC4A 3ZL7C 2O31A 2YRVA 2QAZA 5LJ5e 1ACMB 3VS7A 4OMPA 4OMMA 1D1AA 1S72T 1TSFA 4Q5WA 4OB2B 1QQJA 1WZOA 3JCMP 3OW2P 1SKUB 2X35A 3PE0A 2DIGA 4EIKA 5LJ3d 2D8JA 3HRUA 2WSFE 2OI3A 5FU6C 5GAMj 4ELZC 2LNVA 1S1NA 4JJBA 3INZA 1KSWA 2GF7A 3EH2A 1LOJA 5DLOA 2VWFA 1OPKA 1K0XA 2FPFA 3J7AF 4EDUA 2E4HA 2W10A 3PT9A 3TU4K 5GAMg 1PM3A 3OMCA 3RESA 3L2UA 2IVWA 1M2VB 4KH0B 2LVMA 2NYSA 1VQ4Q 3HSBA 3JB9F 1KD1C 4F16A 2L3PA 4J9FA 4PJOG 2NWMA 4M7AB 4J9BA 2EGEA 3GBQA 1TWBA 4M77B 2BKDN 3CCUA 3JCMJ 1NLPC 3MP8A 3CBOA 3NTHA 3WVEB 1SSHA 1N8RC 3OSSC 1NPPA 1I5OB 2LP5A 5GAN4 1HYOA 2SRCA 2FRYA 4EMGA 1ZA1B 3F70A 3OW2S 4OF1A 1PKSA 3EGDA 1I07A 3I35A 1Y57A 1QVGA 2C0TA 2JM8A 3EHRA 2X4XA 1U8RA 1V76A 1I5LA 1M1KR 1NM7A 1TU0B 1UECA 1JBMA 4E7HA 1X75C 4PKCC 1VQKA 1BI0A 1JXMA 5D7UA 1WFWA 2KRSA 4PJNA 3G4SA 1OU8A 4PJOE 2DXBA 2DEUA 2FZKB 1W70A 5LJ3g 3URGA 1HJDA 2ZPFB 3CCSA 1V29B 2YXYA 5LJ5d 1V1CA 3ER0A 3WVDB 1M3AA 1RABB 5KH6A 1WHLA 3UA7A 1IB8A 4M78B 4ELYC 1MMAA 1PHTA 2KYBA 2JN0A 1OU9A 1C6VX 4C8QC 1ZSZB 3G1JA 3MEWA 4Z02A 1VQ5Q 1SG5A 1VQOT 4RTZA 1EZZB 3A8LB 1PG5B 4M7DB 4J83A 4O5VA 1QKXA 4IUTA 5GAOq 2K5LA 4DOWA 1BCMA 1R0BG 4OB1B 2XICA 1S72Q 5I22A 4PFPA 4ZGDB 2DETA 3G6ET 4C92D 1RI9A 3OY9A 2KI7A 3U23A 2OTLA 3H0IA 3M57A 1JO8A 5GANe 3JCMg 4R55A 4CRIA 4HVVA 2YWWA 2DL4A 3V7SA 1FMVA 4XU0A 1GFCA 3MJXA 2V8JA 2M51A 1B7TA 2RHZA 4AG2C 2EJGA 1YCYA 2CREA 4IUUA 3CD6A 1MHNA 3V7CA 2EYQA 1PNJA 4B9WA 1PSEA 2XI9A 5KYYB 1UFFA 2XKOC 3DKMA 3OBWA 2LMJA 2LRQA 2QTXA 2ZPIB 1Q82U 1UGSB 1XJWB 2OX7A 5CQXA 3X20B 5I11A 1Y71A 1VUBA 5GAOl 3L2QA 1Q81U 1P92A 1C1AA 1NE8A 2GFAA 3QXEB 2AHJB 1ZQ1A 3OYHA 3VYGA 3QWYA 1GFDA 3BW1A 4HVWA 1YIJA 4L5GA 2P0KA 2KGTA 4JS4A 1H92A 4BI3A 1H3ZA 1KJWA 2KAFA 1WA7A 3VYHB 1NJIR 2FZCB 4DBFA 1EIFA 2EQMA 5LJ3f 3CCRA 3M54A 3FRNA 1AT1B 2ATCB 3CCJT 3GLXA 1GRIA 1PD0A 1AHJB 2A36A 3CC2T 3JB9H 2CDTA 2F69A 5KYNA 2EJFA 1K9MR 1AZGB 1YBYA 3D7SB 2L0AA 2R5MA 6AT1B 3O5ZA 1VQ9A 1RUWA 3SWNB 2CP5A 2DF6A 2EBPA 3QSUA 2QYZA 4IUVA 4N4GA 2GCXA 3C95A 1VYTA 1TOVA 1Y7XA 5GAN3 3JRZA 4J8OA 1RI0A 1YHQQ 1ZSGA 9ATCB 2E3HA 4E47A 1QLYA 4PJOB 3X24B 2DL8A 1ZUKA 5GANd 1U3OA 2AZSA 1RAAB 4LXCA 1VQOQ 1JJ2P 3H6ZA 3RKYA 4ZNXA 5CR2A 2CZ6B 1K4US 4IUQA 4QW2A 2A3LA 4DOVA 2FYKA 1NYGA 4LNPA 4JPBW 4OMFB 1LNXA 1WXUA 2R5AA 4JUVA 4MMKA 1KK7A 5KYXB 4AFZC 2E5QA 4KH1B 2HQXA 2E64A 1KC8U 3RMSA 1I0CA 1FWZA 2LDMA 3CCVA 2DVJA 2PNIA 2V8KA 3L1AA 1M1KC 1IGQA 3PVQA 2GQIA 1MNEA 2FPDA 5GMKe 4CI0C 3EFRA 2MWOA 1YITA 7AT1B 2K3XA 3VS3A 1UJ0A 1W4SA 2KVQG 5J26A 1T3SA 4OGEA 3L2RA 1X2KA 4X34A 3L2ZA 3CC4A 5KYWB 2V8IA 5LJ5f 4BE2A 4C92E 3H0FA 3CC7A 4EMKA 3SEMA 2K57A 5GAMe 1Z9ZA 4XK8E 5GAN6 3CXCP 3QYGB 1FMWA 2RHUA 2VC8A 5GAN8 3CD6T 3EH1A 4JLGA 1JJ2S 2DL5A 2JJ9A 2HL3A 4C8QG 3PMIA 2LQ8A 1H8KA 2DM1A 1KQSA 3C94A 1UG1A 4FU6A 1OYXA 2RH2A 3CBPA 2CKKA 1NZ9A 3BDLA 5A0DA 4FIBA 4BUGA 4IURA 2GTOA 2YDLA 1KIKA 1NEBA 2MMPA 2RA2A 2RJEA 2DEQA 3GPLA 4X9CA 4B6MA 5IAYA 3NMZC 2M9UA 4LD6A 2O9VA 2QXFA 3OS0A 2OAUA 4HVUA 4OMOA 3VRZA 3MCAB 4M75D 2LT1A 4ORZA 1ZHIA 2G6FX 3BDUA 2QA4A 3VS5A 1WNLA 3NFCA 4XTUA 2DD5A 4Z89A 1VA7A 2JMAA 3CCEA 4C5EA 4JJNK 2DZCA 2I2LA 2WACA 1VQKQ 2OTJA 4P5NA 1VQ4T 5FU7B 3G4SQ 4C0DC 1BB9A 4DQ2A 1M8VA 1YWPA 2DA9A 1M9SA 4C8QF 2JOYA 3H9NA 4C92A 2IG0A 4MZMA 1Q86U 4BI4A 3LLRA 3FEOA 2GBQA 3M5AA 1Q7YR 1BI2A 2M02A 4EPCA 2DXUA 2AKKA 1Y07A 4PFZA 2RJDA 4FCYA 1NLOC 5HKCA 3UATA 2KNBB 1YP5A 3CEYA 1NJIC 2BIVA 2YRCA 3DLLA 3E9GA 2EJ9A 4JZ4A 5IHIA 1QMCA 1GL5A 3X28B 1OEBA 2CP6A 3BFMA 4ZN1A 4IKFA 5GAMd 3RKXA 3EG0A 2ED1A 1SRMA 1Q82C 2HSEB 4AMCA 1U1TA 4FSXA 1G5VA 3S6WA 1XQHA 3M56A 1YJ9A 1BYMA 1KFZA 1QKWA 4KGZB 2EQUA 3DB4A 3JCMe 2OTLQ 2NUPA 5FU6B 5DM7R 1KHIA 3I56A 4FYXB 3MEAA 2ROTA 5IT9E 4GLKA 4EMKC 2RHXA 4AFUC 2BZ8A 4LUEA 2CGHA 2QEXA 2CUBA 3JSCA 1WX6A 1U1SA 4JDSA 1A0NB 5GANf 3CD6Q 2YHTA 1PC0A 3CMAA 2ABLA 2VGNA 2EYWA 1HSQA 1JEGA 3I55A 2LX9A 4NL3A 5IN1A 1M4ZA 5A0LA 3CC7T 2HD0A 4J9HA 2D0QB 1VQ6A 1AEYA 3QZ5B 1G3YA 2PUKB 3OYCA 1MV3A 1VQ8A 2KXDA 3EFOB 3X26B 1OOTA 2J6OA 3M0RA 1AZEA 2X4YA 1KQ2A 2ZZDA 2VUBA 2K6DA 1QVFP 2RD1A 4CC7A 2F5TX 1AOJA 5LJ3h 1YIJQ 2DYBA 4ME7A 4QVDA 5CKDA 3PGGA 5GJWB 2YUOA 3NTKA 3OYJA 1JU5C 2R58A 3FJPA 1Y96B 3OYBA 2CS7A 4Y28E 1FXXA 2JW4A 2EGCA 2RI2A 2ED0A 3EG9B 4JZ3A 4LDYA 4ESRA 3P8DA 3IQLA 3J81E 4EMHA 1UHFA 2RJCA 2XDDA 2NUPB 2J05A 1BI1A 5GAN2 2QDLA 1HK9A 1D0ZA 1BK2A 4JRPA 1VQLA 1YJNA 2WSCE 4MMLA 1SEMA 1VQ9Q 1WQWA 1VQ7A 2QA4T 3BE3A 4KULA 2BE7D 3OSVA 2RPNA 1M1KU 1UDLA 4ZN3A 3KBGA 2NUZA 1JJ2A 4C92C 1YNZA 4MZTA 1QCFA 3CCLA 3EGUA 4A4FA 1ZBJA 2V1QA 3CCET 1KC8C 4M75E 4XU3A 1QP2A 1N9SA 2EQKA 4BACA 5D6XA 1JRIA 4C8QB 1C0MA 2FZGB 4A63B 3JCMd 3S3NA 4A4GA 5DY9A 3JCMb 4OB0B 2A08A 2E12A 4C5IA 1QVFS 1K76A 4C0GA 3JCMc 2YUPA 3HTRA 4E7KA 2KR3A 2DILA 4WCIA 2QG9B 2CH4A 2A37A 1LJOA 4XU1A 2XIDA 2DXCA 1AWWA 5HY6A 1K8AC 3S3OA 5CIUA 2F5KA 1WI7A 1H3HA 1D3BA 1K1ZA 1VYVA 3M9QA 1YJWA 5EG2A 1OX8A 1DJ7B 1KQ1A 3OB9A 1GCPA 2NUTA 2HBPA 4X1VA 4M4ZA 2V26A 4PJOF 1YI2A 2KXCA 3MP6A 5LJ5h 1TS9A 4E7LA 3RBBB 3OYFA 3TVTA 3OYIA 2OJ2A 4FT2A 2PU9B 2YSQA 5FROA 1MNDA 2FHDA 3I56T 3CCQA 3CMEA 1YHQT 3QJ6A 1VQMT 5FLXE 3E9FA 4F04B 3CC7Q 4PK4A 2L8DA 1LCKA 3HPWA 3EG3A 1B3QA 4PNOA 3ZFJA 4MDXA 5I21A 3A1PA 4D6WA 4XTWA 2E41A 3A8HB 4M75A 2QASA 3TQ7P 5L23A 3CMAT 2KBTA 4RTTA 2YUNA 1UGRB 5GAMf 4Z8AA 1QW1A 1VQ6T 2XD0A 1FYNA 2DERA 3EGDB 2XG8D 1FMKA 4QKUA 3VS0A 2DTOA 1MMNA 3MKDA 4E7JA 3EFSA 1ARKA 2VXFA 4BI8B 3CCMA 1Q86C 1MMDA 1WIEA 2QQAA 2CSIA 2L89A 1NJIU 2KQWA 1Z9QA 4AFQC 2JXBA 3A8GB 1JXOA 3PTAA 4OMNA 2JVVA 2HZYA 3RUXA 2QA4Q 3EGXA 1NYFA 3VKIA 2EKOA 1K9MU 2PQWA 1K73R 3P8BB 3TSWA 1ZX6A 3QYHB 4A4HA 3CCEQ 1IHWA 2RK2A 3CPFA 1EFNA 1RAFB 2DBMA 4J9CA 2X51A 2DFUA 1YJNT 2FEIA 2OTJQ 4GLMA 1M1GA 2VYTA 2PTKA 4OVAA 3RMQA 1ZA2B 1AWOA 2CP2A 2E5KA 4L6V5 2DD4A 3CCLT 2ZPHB 3CCUT 3R6NA 3OYMA 2K3BA 3OMGA 4XTXA 3M53A 8ATCB 4E2FB 3OYNA 2EQIA 3H41A 3HRSA 2KROA 4BE1A 1M27C 1UB4A 3JAME 1PRMC 1UGVA 2P0PA 1W2BP 4M7AD 1AWXA 4KGVB 3RERA 3TREA 2LCLA 3OYEA 4A53A 4HXJA 3JB9I 3VU3C 1E6HA 4HA8A 1QWFA 1R77A 3J80E 3QDRB 4JLIA 3UPUA 2LNHB 1WHKA 3VRYA 2EYYA 2K5FA 1AWJA 1U06A 2MCNA 3GF5A 1N27A 1R0CB 4QT7A 1WPYA 2K4YA 1YJWT 3I56Q 2QQBA 4OB3B 1VQKT 3EG1A 4JS5A 4B9XA 5GANh 3G4ST 1X69A 5CKBA 1VQMQ 2DO3A 1K9AA 4C92G 3CCST 2D8HA 3VUBA 1N6AA 2ESWA 3OQ5A 3JCMf 2PZ1A 3OYYA 1BKBA 3QO3A 4M75C 1QVFA 4J9DA 3CMAQ 5GAN7 2COWA 2H3EB 3OW2A 1Q95G 2K79A 2L2PA 3CCQT 3CMET 3QKJA 2E10A 5A2QE 4FYWB 4JJDA 4XU2A 2M0OA 1MGQA 1EX4A 1NEGA 1W2BS 1VQ6Q 1B34A 1VIEA 3QPHA 1RLPC 2K3YA 1RAHB 3NGPA 4O6JA 2XK0A 2KRMA 4N4IA 4AG1C 3RKWA 4OGCA 3V8KA 1SPKA 2OTLT 4BY6C 1QCOA 4E7SA 3VV0A 2RQVA 5CQYA 2CZ1B 5CKFA 5IHKA 4LUDA 4A4EA 2HEQA 2EQJA 3DB3A 2O01E 2CUDA 2FG0A 3GNFB 3C12A 1RACB 4C92F 2A7YA 2DVEA 1T0HA 4XAXB 1K8AU 2C0OA 5C6SA 4E6RA 1YJNQ 1VQLQ 8AT1B 2C0IA 4C0DB 3OS2A 2P0QA 1GCQA 2RN8A 1IGUA 2O88A 1YFNA 1E7OA 2J6FA 4F14A 4KRTA 4R0KA 4BB7A 3CCLQ 3CCUQ 3JCMW 2QTVA 1KD1R 4KBMB 3UWNA 4F7UE 4C0FA 3OYGA 2JTFA 3HFOA 1IHVA 1M1FA 2Y90A 3SFMA 1SHFA 2EAYA 1YIJT 1JB0E 1N8RR 1UGPB 3ZEHA 5FRMA 2B86A 3GNGA 3HRTA 2K5IA 4ANJA 1W6XA 3M55A 1UGQB 5GAOn 3JB9D 2HDAA 2L3RA 3QHSA 3OYAA 2K2VA 3UT1A 3OYLA 3CCRT 2D9TA 1I1JA 3PFSA 3HL8A 1IREB 4K11A 2GQVA 3ME9A 5D6WA 2JT4A 2RQTA 3CXCS 1YJWQ 3QZ9B 2O4XA 1VQ9T 3SD4A 4M7AE 2KMTA 2HQEA 1RLQC 3BY7A 4M77E 4EMKB
chains in the Genus database with same CATH topology
3G6ET 3J81E 4C92D 4EMHA 5GAOp 2XDDA 2RJCA 2DTIA 4ZTFA 1G3WA 1BI1A 3OY9A 3JB9J 2OTLA 5GAN2 3OYDA 3M57A 1HK9A 1HXDA 5GMKh 5GANe 3JCMg 4JRPA 1VQLA 1YJNA 2WSCE 4R55A 4BDYA 2PVGB 4MMLA 1GXIE 4F7UG 4N0AC 4CRIA 1WQWA 1VQ7A 2QA4T 4M78D 4KULA 3S3MA 2ZPBB 3OSVA 1KD1U 1M1KU 1BIBA 2RI3A 4ZN3A 3KBGA 3GOXA 3HP9A 5KCOA 4C92C 5GMKi 1JJ2A 2MWPA 3V7SA 2DPPB 4MZTA 4XU0A 5CKEA 3CCLA 2V8JA 4A4FA 2ZCFB 4A4KA 2E6ZA 3A5ZB 2RHZA 3QJYA 1KC8C 3CCET 4M75E 3A8MB 2EJGA 1YCYA 4IUUA 5GAMh 1WQ7A 4HT8A 2PUOB 3CD6A 4XU3A 1MHNA 3V7CA 1QP2A 2EYQA 1N9SA 2RI5A 2EQKA 4QQ6A 4B9WA 4F7UA 3PIOA 4BACA 3N5BB 5D6XA 4M7DD 1PSEA 2XI9A 1JRIA 2XU8A 1N8RU 4C8QB 2XKOC 3SWNC 4NL2A 1K9MC 3JCMd 2QQSA 3DKMA 3OBWA 3S3NA 4A4GA 2LRQA 2QTXA 5DY9A 2ZPIB 2Y4XA 4J6XA 3RIRA 2CZ0B 5KE2A 3CCMT 3JCMb 1Q82U 4OB0B 1QVFS 2E12A 4C5IA 1UGSB 3MEUA 5CQXA 3X20B 1Y71A 5D6YA 1VUBA 5GAOl 4C0GA 3JCMc 3L2QA 2HNIA 1Q81U 1OZ3A 1P92A 1NE8A 4E7KA 4MDWA 3UDCA 2GFAA 1G3TA 3QXEB 2DXTA 4LDXA 3Q1JA 4XTZA 2AHJB 3CCVT 1LJOA 3META 4XTVA 1ZQ1A 4A54A 3OYHA 1IZ6A 2PVDB 1OI1A 4XU1A 2JNGA 2XIDA 3QBYA 1SSFA 3BW1A 3VYGA 1VQNT 4PJOC 1VQ5A 4M7AG 2DXCA 3FC3A 5KE3A 1YIJA 2RJFA 5HY6A 3P8HA 4L5GA 4M77G 1K8AC 2P0KA 4J6WA 5CIUA 3S3OA 4JS4A 4BI3A 2F5KA 2H3JA 1H3ZA 2GFUA 1YITT 3LGFA 1D3BA 3V8LA 2QI2A 3M9QA 2KAFA 3FIFA 1YJWA 5EG2A 3VYHB 2O4XB 4ZGDB 1DJ7B 4M78E 5L8RE 1KQ1A 3OB9A 2Y4YA 4F7UF 2HBPA 1EIFA 3CC4T 1XNIA 1S72A 5GANj 2EQMA 5LJ3f 3CCRA 4XQ3A 3M54A 3FRNA 4PJOF 4J6YA 3CCJT 4C92B 1YI2A 3MP6A 4E7IA 3QUIA 5LJ5h 1NPRA 3GLXA 3KXTA 4M7AA 2PVOB 1X6OA 4E7LA 1Q7YU 3TCJA 4M77A 1RL2A 3OYFA 4KUIA 4XTYA 4C0ZA 1VQOA 1AHJB 3OYIA 3CC2T 3JB9H 5J39A 4FT2A 2F69A 2NLUA 2PU9B 3VUZA 3LX7A 1B34B 2EJFA 2LC4A 4M7DE 1YBYA 5FROA 2FHDA 2R5MA 4M75G 4RKUE 3I56T 2HAXA 5GANg 1VQ9A 3CCQA 3CMEA 3HKSA 1YHQT 3QJ6A 3SWNB 3C4SA 3NTIA 1VQMT 2ZPGB 5J3BA 3E9FA 5FLXE 5GAOm 3G6EA 3QSUA 2L8DA 3HPWA 5LL6S 4YTLA 3ASKA 3QG1A 4ZGJB 4PNOA 3ZFJA 4MDXA 5I21A 1VQPA 4IUVA 2KY9A 4N4GA 2LQKA 2GCXA 2CYZB 1WGSA 3C95A 4QQDA 4D6WA 4XTWA 2E41A 5KCHA 1QVGS 1Y7XA 4NS5A 2FL7A 3A8HB 4M75A 5I2SA 5GAN3 2DIQA 4OP0A 4BD3A 1K73C 3JRZA 3G7ZA 4J8OA 2P4TA 3CMAT 3MP1A 1RI0A 2VXEA 2RK1A 4E47A 4PJOB 4V2SA 4LDUA 3X24B 4J7FA 4M7AF 5FRNA 2CZ7B 5GANd 4M77F 5CO7A 1UGRB 5GAMf 2KK4A 1QW1A 2JZ2A 4HCBA 3P8DA 5GMKm 1VQ6T 5CKHA 2XD0A 3H6ZA 3RKYA 5CR2A 2XG8D 3H8ZA 2CZ6B 4PL6A 2RHYA 3DLMA 4IUQA 4QW2A 2A3LA 4DOVA 2FYKA 2DTOA 1ZBXA 3SDZA 5LJ3e 4C8QE 4M78G 3OBYA 2XHCA 2E70A 2XDPA 4E7JA 4QVCA 1TH7A 4OMFB 1LNXA 3EFSA 1O75A 2VXFA 3M58A 5AYFA 1H641 4BI8B 2R5AA 2MF2A 3EAEA 4JUVA 5CAIA 3CCMA 4RCCA 4BE0A 1Q86C 2BUDA 3T9NA 2QQAA 4MMKA 2L89A 1NJIU 2QQ9A 2KQWA 2E5QA 2E65A 2EIFA 2FVUA 2HQXA 2E64A 3ZBDA 4PLIA 1KC8U 3JCMV 3G71A 3CPWS 3RMSA 4M75F 3A8GB 1FWZA 4M7DG 3R6OA 3JCMh 2LDMA 3PTAA 3CCVA 4JRQA 2JVVA 2OTJT 5HK0A 4JRKA 2V8KA 3L1AA 4M78A 3RUXA 1M1KC 3WXMB 3LW5E 1VIFA 1KHCA 4C5HA 4PJOD 3VKIA 5A0GA 2EKOA 1K9MU 5GMKe 2PQWA 1G3SA 4CI0C 3GIBA 3EFRA 2MWOA 3LH0A 3P8BB 4ATOA 1YITA 2K3XA 3QYHB 1XOVA 1W4SA 3KUFA 4A4HA 2KVQG 2RK2A 3L42A 5J26A 3OS1A 4OGEA 3CPFA 3L2RA 3TEEA 1Y96A 3LGLA 4MZPA 3L2ZA 4X34A 1YJNT 2DKGA 3CC4A 4M7DA 3V7RA 1M1GA 2L5QA 2VYTA 2FB7A 2V8IA 4KT0E 3JCMQ 5LJ5f 4BE2A 4OVAA 3RMQA 3CCJA 4C92E 1M90U 5I2MA 3CC7A 2KSSA 4EMKA 5GAMe 2K57A 4FM4B 3CC2A 4L6V5 4XK8E 2DD4A 5GAN6 2ZPHB 3CCLT 3CCUT 3OYMA 3QYGB 5HK3A 2KDSA 1Q81C 3OMGA 4XTXA 2RHUA 3M53A 5CCAA 2VC8A 4VUBA 5GAN8 2JTMA 4R56A 3CD6T 3M59A 3O8VA 4PLLA 4JLGA 4C5GA 3L2WA 4NOYA 1BI3A 1YHQA 3OYNA 1JJ2S 3HRSA 4M78F 1VQMA 2DK3A 4II1A 5FU7C 2DAQA 1QVPA 4C8QG 1M5Q1 1PSFA 3MEVA 3CXCA 1UB4A 4BE1A 2M1HA 3FDRA 3PMIA 3JAME 2LQ8A 2P0PA 2ZPEB 4J7IA 2X4JA 5LJ3j 5GAOr 4M7AD 4ZGEB 4RG2A 1I4K1 1KQSA 3C94A 4FU6A 1YJ9T 3RERA 2RH2A 1OYXA 2X4WA 3CBPA 2LCLA 2R57A 2LCCA 2E6NA 2CKKA 4WF2A 3TREA 3OYEA 1NZ9A 1UEBA 3BDLA 3OA6A 5A0DA 4FIBA 4RMOA 3FB9A 4BUGA 4IURA 4A53A 5GAN5 3JB9I 4L59A 4LDWA 3VU3C 2B8AA 4M7DF 3JB9G 1W2BA 2MMPA 2RA2A 2RJEA 2XDBA 1N9RA 2DEQA 4HA8A 2M16A 2DZ9A 3GPLA 4C8QA 1WJQA 4X9CA 4RCBA 3QDRB 4JLIA 3J80E 3CBMA 3UPUA 1Q7YC 4M7AC 4Y91A 5IAYA 1VQ5T 2M9UA 4M77C 4QQGA 3A8OB 2K5FA 4LD6A 4LD9K 3GF5A 2QEXT 1N27A 2VGMA 1I8FA 2QXFA 5GMKj 2YLCA 2RO0A 3OS0A 2OAUA 1WPYA 2K4YA 3FLGA 2C06A 4F7UB 1YJWT 2DTHA 2QQBA 4UC4A 3MCAB 4M75D 1X01A 2LT1A 4OB3B 1VQKT 2YRVA 5LJ5e 1ZHIA 3BDUA 2QA4A 1K73U 4JS5A 4B9XA 5GANh 3G4ST 3SB2A 3VJPA 5CKBA 1S72T 1WNLA 3I55T 3NFCA 4XTUA 2DO3A 4Q5WA 4OB2B 4C92G 2DD5A 4FT4A 3CCST 2QDYB 3JCMP 3VUBA 1N6AA 2X35A 4JRIA 3CCEA 4C5EA 3OQ5A 2DIGA 4JJNK 2DZCA 2I2LA 5LJ3d 3HRUA 2WSFE 4J5YA 3JCMf 3OYYA 1BKBA 5FU6C 3QO3A 4ELZC 5GAMj 1VQ8T 2LNVA 4M75C 1QVFA 2WACA 3INZA 2OTJA 4N4HA 4N0AA 4P5NA 5GAN7 1VQ4T 5FU7B 1R8OB 3OW2A 2GF7A 4C0DC 3CCQT 4DQ2A 1KQSS 1LOJA 5DLOA 3CMET 3QKJA 1M8VA 2E10A 1M9SA 4C8QF 2JOYA 3J7AF 5A2QE 4EDUA 4C92A 3PT9A 2IG0A 2G3RA 2QQRA 3M4YA 4MZMA 4XU2A 3TU4K 2M0OA 1MGQA 1D3BB 5M9OA 4BI4A 3LLRA 1Q86U 5GAMg 3FEOA 1VQPT 1W2BS 3OMCA 3RESA 3M5AA 3L2UA 1B34A 1VIEA 3QPHA 1BI2A 3HFNA 3LWIA 4EPCA 2IVWA 2DXUA 2LVMA 4RG8A 3HSBA 3JB9F 1KD1C 1WJSA 2K3YA 3QIIA 1Y07A 4O6JA 2RJDA 1VQNA 3PIPA 4PJOG 3SWNA 5HKCA 4M7AB 3MO8A 3LYIA 2XK0A 3CEYA 4M77B 1NJIC 2BIVA 4N4IA 2BKDN 3DLLA 3CCUA 3RKWA 3E9GA 4OGCA 4EMKB 4IUPA 3V8KA 3JCMJ 2OTLT 1QP3A 2EJ9A 4LDVA 3MP8A 4BY6C 4DA4A 4HKEA 3CBOA 2VV5A 3E1SA 5CVIA 3NTHA 3VV0A 3WVEB 5CQYA 2EWNA 1VQLT 2CZ1B 3X28B 1N8RC 5CKFA 3BFMA 3OSSC 4ZN1A 4IKFA 4M78C 4A4EA 1NPPA 2EQJA 5GAMd 3RKXA 1VQ7T 3DB3A 2O01E 4TVRA 4PJOA 1Q82C 2ZGWA 5GAN4 3GNFB 1U1TA 4FSXA 3AHUA 3C12A 5LJ5j 1G5VA 3S6WA 2A7YA 2WSEE 2DVEA 4C92F 3E19A 1XQHA 3M56A 4XAXB 1FX7A 1YJ9A 1BYMA 4EMGA 2EQUA 3DB4A 1K8AU 3M4GA 3JCMe 3PNWC 3F70A 2MI6A 3OW2S 5FU6B 5DM7R 4OF1A 3JCMX 4QVZA 2DJZA 4M75B 1KHIA 3I56A 2LT4A 4FL6A 5C6SA 3G71T 4HT9A 4M7DC 4HCCA 2RM4A 4C0DB 3OS2A 3OYKA 1WJRA 2P0QA 1M90C 1QVGA 3MEAA 3GP8A 5LJ5g 1XTDA 2X4XA 4ZTJA 1U8RA 5IT9E 4GLKA 4HCZA 4EMKC 3MHXA 2RHXA 1I81A 2YLBA 1I5LA 4M77D 4BB7A 2CGHA 3JCMW 2QEXA 1JBMA 4KBMB 3JSCA 3UWNA 3LWHA 4F7UE 4E7HA 1X75C 1U1SA 4JDSA 4PKCC 4C0FA 1VQKA 5GANf 1BI0A 2YHTA 3CMAA 2VGNA 3OYGA 3G4SA 4PJOE 2JTFA 4BDZA 2DXBA 1OZ2A 5GMKl 3I55A 2LX9A 3HFOA 5LJ3g 4NL3A 5IN1A 2D6FA 3URGA 1M1FA 2Y90A 3SFMA 1M4ZA 4C8QD 5A0LA 2ZPFB 3CC7T 2HD0A 3CCSA 4X9DA 2EAYA 1YIJT 1JB0E 1V29B 1UGPB 3ZEHA 5FRMA 2D0QB 2JUFA 1VQ6A 4BY6B 5LJ5d 3QZ5B 1G3YA 2PUKB 3ER0A 3GNGA 3HRTA 3WVDB 3OYCA 5KH6A 1VQ8A 3X26B 2K5IA 3HHTB 3L2VA 2X4YA 1KQ2A 3M55A 1UGQB 2RHIA 2VUBA 2ZZDA 4M78B 4ELYC 1VQ4A 5DLQE 4GY5A 5GAOn 2E1HA 3JB9D 2RB6A 2L3RA 3QHSA 3OYAA 2JN0A 2K2VA 1KG1A 1BIAA 4C8QC 3UT1A 3OYLA 3CPWA 3CCRT 2D9TA 2RD1A 3MEWA 2F5TX 3PFSA 4Z02A 3HL8A 5LJ3h 1YI2T 4KUDK 1IREB 2MAMA 2GQVA 3ME9A 4ME7A 5D6WA 3V8JA 4QVDA 1VQOT 5CKDA 3PGGA 3A8LB 3NTKA 3OYJA 2R58A 3FJPA 1Y96B 3OYBA 2CS7A 3CXCS 4M7DB 4J83A 4Y28E 4O5VA 2LTOA 3QZ9B 2O4XA 1FXXA 4IUTA 2K5LA 4DOWA 5C0MA 5GAOq 1VQ9T 3SD4A 4OB1B 4M7AE 2XICA 2KMTA 2HQEA 3OS5A 1O9SA 2RI2A 4LDYA 3BY7A 5CK9A 4M77E 2EFIA 3X25B 3PMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0G A;  5FU7 B;  4BY6 B;  4BY6 C;  4C0F A;  5FU7 C;  5FU6 B;  4C0D B;  5FU6 C;  4C0D C; 
#chains in the Genus database with same CATH topology
 1YI2 Q;  3CCS Q;  5GAO p;  2JTE A;  2DTI A;  1G3W A;  1TG0 A;  3JB9 J;  2BTT A;  1HXD A;  2SEM A;  5GMK h;  4BDY A;  1ABQ A;  1X2Q A;  2KE9 A;  3ULR B;  3CCQ Q;  3CME Q;  1BIB A;  1T0J A;  3HP9 A;  2DPP B;  2ZCF B;  4OMQ A;  2E6Z A;  1E6G A;  3QJY A;  3A8M B;  5AT1 B;  2LJ1 A;  2I0N A;  5ECA A;  5GAM h;  2PUO B;  2RI5 A;  4F7U A;  2JS2 A;  1PRL C;  3THK A;  4WTO B;  1K9M C;  2X3X D;  1G8X A;  1WHG A;  3MEU A;  2FRW A;  2D1X A;  1NG2 A;  2Z0W A;  2DX1 A;  1IRX A;  2HNI A;  3UDC A;  1G3T A;  4RTY A;  4LDX A;  3Q1J A;  3CCV T;  2ENM A;  5KYU A;  4XTV A;  4A54 A;  1IZ6 A;  2PVD B;  1OI1 A;  2JNG A;  3FC3 A;  3CCM Q;  3I5R A;  3H0H A;  4J6W A;  1YIT T;  3V8L A;  2QI2 A;  2H8H A;  4D8D A;  2O4X B;  4M78 E;  5L8R E;  2Y4Y A;  3LH5 A;  3CC4 T;  1M2V A;  1XNI A;  4DEX A;  1GCQ C;  4XQ3 A;  4C92 B;  4E7I A;  4M7A A;  3QUI A;  1NPR A;  3KXT A;  2LJ0 A;  1X6O A;  4M77 A;  1VQO A;  4XTY A;  4C0Z A;  1WHJ A;  3CPW P;  3LX7 A;  4M7D E;  1CKB A;  4M75 G;  2RQR A;  4RTW A;  1SHG A;  2HAX A;  1PD1 A;  2O2O A;  2LQN A;  3C4S A;  2ZPG B;  1RAE B;  5J3B A;  5GAO m;  3G6E A;  4ZGJ B;  1D1B A;  1VQP A;  1M90 R;  2CYZ B;  4QQD A;  1WHM A;  5KCH A;  2GTJ A;  4NS5 A;  2FL7 A;  5I2S A;  2EPD A;  1D09 B;  2P4T A;  2VXE A;  2RK1 A;  4V2S A;  4LDU A;  3CCR Q;  1M3B A;  2BZX A;  4J7F A;  4CC4 B;  5FRN A;  2CZ7 B;  2X3W D;  4RTU A;  5CO7 A;  1F1B B;  5GMK m;  5CKH A;  3H8Z A;  1D0Y A;  4J9E A;  3PVL A;  5KYU B;  1ZBX A;  2QGG A;  3OBY A;  1TUC A;  2E70 A;  2XDP A;  1O75 A;  3M58 A;  2MF2 A;  1OQK A;  1PKT A;  2K9G A;  4Y92 A;  2CP3 A;  4BE0 A;  2BUD A;  3T9N A;  3M0Q A;  2QQ9 A;  2E65 A;  3A98 A;  3ZBD A;  1WYX A;  4PLI A;  3G71 A;  3CPW S;  4M75 F;  3R6O A;  3JCM h;  1M8M A;  3MPU B;  2KT1 A;  2KT8 A;  2OTJ T;  4JRK A;  4M78 A;  3LW5 E;  4C5H A;  1ZSZ A;  3GIB A;  1NBE B;  3LH0 A;  4CC2 A;  4ATO A;  3NPF A;  4RTX A;  2GGR A;  3L42 A;  1BU1 A;  1SRL A;  3LGL A;  4MZP A;  4M7D A;  2DKG A;  2GNC A;  2HSP A;  3VS4 A;  2AT1 B;  4KT0 E;  3JCM Q;  2HBW A;  3CCJ A;  2KSS A;  1RAD B;  1UE9 A;  4FM4 B;  4IIO A;  3CC2 A;  1X6B A;  1PWT A;  2CT3 A;  2AKL A;  2RNA A;  2D0N A;  5CCA A;  1KQS P;  2HKQ B;  4R56 A;  1G2B A;  2DBK A;  2JTM A;  4C5G A;  1TUD A;  4DBH A;  5GJV B;  3CCV Q;  3QWX X;  2DK3 A;  4II1 A;  3RR6 A;  2DAQ A;  3CXC A;  1M5Q 1;  1PSF A;  2CP7 A;  2AZV A;  3MEV A;  3FDR A;  2DRM A;  5LJ3 j;  2X4J A;  2VB6 A;  4RG2 A;  1I4K 1;  1YJ9 T;  1YIT Q;  2R57 A;  2LX7 A;  2E6N A;  2BE9 B;  2HL5 C;  2ROL A;  3FB9 A;  5GAN 5;  4L59 A;  1UJY A;  3CC4 Q;  2XDB A;  2AK5 A;  2DZ9 A;  5KYY A;  4DEY A;  4RCB A;  1Q7Y C;  2HKN A;  4M7A C;  4Y91 A;  2XMF A;  2J7I A;  4M77 C;  2LQW A;  4QQG A;  3A8O B;  1YCS B;  1M3C A;  2BZY A;  2QEX T;  2P84 A;  2YLC A;  3FLG A;  2DTH A;  1X01 A;  1K73 U;  4AT1 B;  3SB2 A;  3VJP A;  2EW3 A;  3I55 T;  4OML A;  3FJ5 A;  5IXF A;  4FT4 A;  2QDY B;  2CH4 W;  4JRI A;  1JQQ A;  2VKN A;  3VS6 A;  4J5Y A;  2RQU A;  1ABO A;  2K7A A;  1VQ8 T;  4N4H A;  4N0A A;  1MUZ A;  4E7Z A;  1R8O B;  1KQS S;  1UHC A;  2QQR A;  2G3R A;  3M4Y A;  1D3B B;  5M9O A;  2ECZ A;  1VQP T;  2DLP A;  3RNJ A;  3REB B;  2HCK A;  2VAS A;  3HFN A;  3LWI A;  2NUT B;  4RG8 A;  1WJS A;  3QII A;  1WXB A;  2DRK A;  1VQN A;  3PIP A;  3SWN A;  3MO8 A;  3LYI A;  1ZUU A;  3CQT A;  3VS2 A;  4DBQ A;  2EVR A;  3M0S A;  4IUP A;  1PCX A;  1QP3 A;  3I5S A;  2HMA A;  4LDV A;  4DA4 A;  4HKE A;  2VV5 A;  3E1S A;  5CVI A;  2EWN A;  1VQL T;  2LJ3 A;  2LZ6 B;  4M78 C;  2CSQ A;  1BCO A;  2EYZ A;  1HD3 A;  1WXT A;  1VQ7 T;  4TVR A;  4PJO A;  1OV3 A;  2ZGW A;  3AHU A;  1ZSZ C;  5LJ5 j;  2WSE E;  2DL3 A;  3E19 A;  1FX7 A;  3M4G A;  3PNW C;  1CSK A;  2MI6 A;  3JCM X;  4QVZ A;  2DJZ A;  4M75 B;  2LT4 A;  1D1C A;  4FL6 A;  4HT9 A;  3G71 T;  4M7D C;  4HCC A;  2RM4 A;  3OYK A;  1WJR A;  1M90 C;  3GP8 A;  5LJ5 g;  4KGX B;  2JS0 A;  2HQH A;  1XTD A;  4ZTJ A;  4HCZ A;  1LPL A;  3MHX A;  4FYY B;  1I81 A;  2YLB A;  4M77 D;  1YWO A;  5KYX A;  3LWH A;  3I9Q A;  4PJM A;  2MYS A;  4BDZ A;  1OZ2 A;  5GMK l;  2D6F A;  4C8Q D;  2YRD A;  3EHQ A;  4X9D A;  1YJ9 Q;  2JUF A;  1AVZ C;  4BY6 B;  2J6K A;  2YUQ A;  1Q82 R;  1U5S A;  4LN2 A;  3HHT B;  3L2V A;  2EKH A;  2RHI A;  1VQ4 A;  5DLQ E;  4GY5 A;  3EGX B;  2E1H A;  2RB6 A;  2LCS A;  5KYW A;  1KG1 A;  1BIA A;  1Q81 R;  3CPW A;  2COZ A;  4JJC A;  2VVK A;  1YI2 T;  2MAM A;  5EC7 A;  3V8J A;  1T3L A;  2QEX Q;  2LTO A;  2MOX A;  4FSS A;  5C0M A;  5IH2 A;  3OS5 A;  3I55 Q;  1CKA A;  1O9S A;  2RF0 A;  1M2O A;  5CK9 A;  2EFI A;  3X25 B;  3PMT A;  3AT1 B;  4ZTF A;  1UUE A;  3OYD A;  1WLP B;  1N5Z A;  2M0Y A;  2MIO A;  1VQ8 Q;  2PVG B;  1GXI E;  4F7U G;  4N0A C;  1VYU A;  4F17 A;  4M78 D;  1TTH B;  2ZPB B;  3S3M A;  2L3Q A;  1KD1 U;  2RI3 A;  3GOX A;  1VOM A;  5KCO A;  5GMK i;  3G6E Q;  1QCN A;  2MWP A;  2DMO A;  2A0F B;  5CKE A;  4A4K A;  3A5Z B;  1VQP Q;  2IPO B;  4IIM A;  1WQ7 A;  4HT8 A;  1RAI B;  2QK0 A;  4QQ6 A;  1TUG B;  3PIO A;  3N5B B;  4M7D D;  2XU8 A;  1N8R U;  4LE9 A;  3SWN C;  4NL2 A;  2QQS A;  1X6G A;  2X9H A;  5IHN A;  4KUD K;  2Y4X A;  4J6X A;  3RIR A;  2CZ0 B;  5KE2 A;  3CCM T;  1QVG P;  4J9I A;  3REA B;  2QGF B;  5D6Y A;  4PFO A;  2CT4 A;  2W0Z A;  2F1L A;  1OZ3 A;  4MDW A;  1M30 A;  2DXT A;  4XTZ A;  1OX9 A;  3M0T A;  2J06 A;  3MET A;  1VQ7 Q;  3QBY A;  1SSF A;  5FW9 A;  4PJO C;  1VQN T;  1VQ5 A;  4M7A G;  3EG2 A;  5KE3 A;  2RJF A;  1OUL A;  2AIR B;  3P8H A;  4M77 G;  3SHW A;  2H3J A;  2GFU A;  3LGF A;  3FIF A;  2F2W A;  3G71 Q;  1UTI A;  4F7U F;  2F2V A;  1S72 A;  2DJQ A;  5GAN j;  1IXD A;  1KC8 R;  2E3I A;  4J6Y A;  2KEA A;  2PVO B;  1Q7Y U;  3M0U A;  3TCJ A;  1RL2 A;  4KUI A;  1MMG A;  5J39 A;  3KFV A;  2KRN A;  2NLU A;  5FWB A;  3VUZ A;  1B34 B;  2LC4 A;  1TXQ A;  4RKU E;  5GAN g;  2FPE A;  2KYM A;  2EYX A;  3UA6 A;  3HKS A;  2MK5 A;  3NTI A;  3CCJ Q;  4CC3 A;  1BBZ A;  5LL6 S;  4YTL A;  3ASK A;  3QG1 A;  1OPL A;  4D8K A;  3CC2 Q;  2KY9 A;  2LQK A;  1WGS A;  1QVG S;  1ZLM A;  3JV3 A;  1B07 A;  4PJJ A;  4HCK A;  2DIQ A;  4OP0 A;  4BD3 A;  1K73 C;  1K8A R;  3E2U A;  3G7Z A;  3MP1 A;  1AD5 A;  2V1R A;  4M7A F;  2ZAE A;  1D0X A;  4M77 F;  2OAW A;  2K2M A;  2KK4 A;  1QWE A;  1GBQ A;  5IXB A;  2JZ2 A;  4HCB A;  2COY A;  4PL6 A;  2EGA A;  2CP0 A;  2RHY A;  3DLM A;  4FW2 A;  3SDZ A;  5FWC A;  4C8Q E;  4M78 G;  5LJ3 e;  2XHC A;  2P4R A;  4QVC A;  1TH7 A;  5AYF A;  1H64 1;  4Z88 A;  3EAE A;  4DBR A;  5CAI A;  4RCC A;  2O9S A;  4PJL A;  2EIF A;  2FVU A;  2FO0 A;  3JCM V;  3EFO A;  4M7D G;  4JRQ A;  5HK0 A;  3C0C A;  3WXM B;  1GBR A;  1VIF A;  1KHC A;  2F2X A;  3VS1 A;  4PJO D;  1RAG B;  4FW1 A;  5A0G A;  1G3S A;  5HCK A;  2JM9 A;  2DL7 A;  1XOV A;  3KUF A;  3OS1 A;  3TEE A;  1Y96 A;  1G83 A;  3V7R A;  2L5Q A;  3TSZ A;  2FB7 A;  4RUG A;  2YT6 A;  1M90 U;  5I2M A;  3M0P A;  4RTV A;  3UF4 A;  3EG9 A;  2DE0 X;  1K0S A;  1IO6 A;  2MPX C;  4J9G A;  4FYV B;  5HK3 A;  2KDS A;  1Q81 C;  1WHH A;  1YN8 A;  4VUB A;  1Q86 R;  3M59 A;  2IIM A;  3O8V A;  4PLL A;  3L2W A;  1YHQ A;  4NOY A;  1BI3 A;  4M78 F;  1VQM A;  3NHN A;  5FU7 C;  1QVP A;  1WDX A;  1VQN Q;  2DYI A;  2M1H A;  2L3S A;  3RDV A;  2ZPE B;  4J7I A;  5GAO r;  4ZGE B;  4AFS C;  1X43 A;  1MV0 B;  1X27 A;  2X4W A;  4WF2 A;  2LCC A;  4GBQ A;  3OA6 A;  1UEB A;  4RMO A;  1J3T A;  4LDW A;  2B8A A;  4M7D F;  3JB9 G;  1W2B A;  1N9R A;  2M16 A;  4C8Q A;  1WJQ A;  2RQW A;  3CBM A;  1Y0M A;  1SF9 A;  2DNU A;  1VQ5 T;  1LVK A;  1ZUY A;  2RMO A;  4LD9 K;  1W1F A;  2A28 A;  2JMC A;  2VGM A;  1I8F A;  3QDF A;  5GMK j;  2RO0 A;  2C06 A;  4F7U B;  4UC4 A;  3ZL7 C;  2O31 A;  2YRV A;  2QAZ A;  5LJ5 e;  1ACM B;  3VS7 A;  4OMP A;  4OMM A;  1D1A A;  1S72 T;  1TSF A;  4Q5W A;  4OB2 B;  1QQJ A;  1WZO A;  3JCM P;  3OW2 P;  1SKU B;  2X35 A;  3PE0 A;  2DIG A;  4EIK A;  5LJ3 d;  2D8J A;  3HRU A;  2WSF E;  2OI3 A;  5FU6 C;  5GAM j;  4ELZ C;  2LNV A;  1S1N A;  4JJB A;  3INZ A;  1KSW A;  2GF7 A;  3EH2 A;  1LOJ A;  5DLO A;  2VWF A;  1OPK A;  1K0X A;  2FPF A;  3J7A F;  4EDU A;  2E4H A;  2W10 A;  3PT9 A;  3TU4 K;  5GAM g;  1PM3 A;  3OMC A;  3RES A;  3L2U A;  2IVW A;  1M2V B;  4KH0 B;  2LVM A;  2NYS A;  1VQ4 Q;  3HSB A;  3JB9 F;  1KD1 C;  4F16 A;  2L3P A;  4J9F A;  4PJO G;  2NWM A;  4M7A B;  4J9B A;  2EGE A;  3GBQ A;  1TWB A;  4M77 B;  2BKD N;  3CCU A;  3JCM J;  1NLP C;  3MP8 A;  3CBO A;  3NTH A;  3WVE B;  1SSH A;  1N8R C;  3OSS C;  1NPP A;  1I5O B;  2LP5 A;  5GAN 4;  1HYO A;  2SRC A;  2FRY A;  4EMG A;  1ZA1 B;  3F70 A;  3OW2 S;  4OF1 A;  1PKS A;  3EGD A;  1I07 A;  3I35 A;  1Y57 A;  1QVG A;  2C0T A;  2JM8 A;  3EHR A;  2X4X A;  1U8R A;  1V76 A;  1I5L A;  1M1K R;  1NM7 A;  1TU0 B;  1UEC A;  1JBM A;  4E7H A;  1X75 C;  4PKC C;  1VQK A;  1BI0 A;  1JXM A;  5D7U A;  1WFW A;  2KRS A;  4PJN A;  3G4S A;  1OU8 A;  4PJO E;  2DXB A;  2DEU A;  2FZK B;  1W70 A;  5LJ3 g;  3URG A;  1HJD A;  2ZPF B;  3CCS A;  1V29 B;  2YXY A;  5LJ5 d;  1V1C A;  3ER0 A;  3WVD B;  1M3A A;  1RAB B;  5KH6 A;  1WHL A;  3UA7 A;  1IB8 A;  4M78 B;  4ELY C;  1MMA A;  1PHT A;  2KYB A;  2JN0 A;  1OU9 A;  1C6V X;  4C8Q C;  1ZSZ B;  3G1J A;  3MEW A;  4Z02 A;  1VQ5 Q;  1SG5 A;  1VQO T;  4RTZ A;  1EZZ B;  3A8L B;  1PG5 B;  4M7D B;  4J83 A;  4O5V A;  1QKX A;  4IUT A;  5GAO q;  2K5L A;  4DOW A;  1BCM A;  1R0B G;  4OB1 B;  2XIC A;  1S72 Q;  5I22 A;  4PFP A;  4ZGD B;  2DET A;  3G6E T;  4C92 D;  1RI9 A;  3OY9 A;  2KI7 A;  3U23 A;  2OTL A;  3H0I A;  3M57 A;  1JO8 A;  5GAN e;  3JCM g;  4R55 A;  4CRI A;  4HVV A;  2YWW A;  2DL4 A;  3V7S A;  1FMV A;  4XU0 A;  1GFC A;  3MJX A;  2V8J A;  2M51 A;  1B7T A;  2RHZ A;  4AG2 C;  2EJG A;  1YCY A;  2CRE A;  4IUU A;  3CD6 A;  1MHN A;  3V7C A;  2EYQ A;  1PNJ A;  4B9W A;  1PSE A;  2XI9 A;  5KYY B;  1UFF A;  2XKO C;  3DKM A;  3OBW A;  2LMJ A;  2LRQ A;  2QTX A;  2ZPI B;  1Q82 U;  1UGS B;  1XJW B;  2OX7 A;  5CQX A;  3X20 B;  5I11 A;  1Y71 A;  1VUB A;  5GAO l;  3L2Q A;  1Q81 U;  1P92 A;  1C1A A;  1NE8 A;  2GFA A;  3QXE B;  2AHJ B;  1ZQ1 A;  3OYH A;  3VYG A;  3QWY A;  1GFD A;  3BW1 A;  4HVW A;  1YIJ A;  4L5G A;  2P0K A;  2KGT A;  4JS4 A;  1H92 A;  4BI3 A;  1H3Z A;  1KJW A;  2KAF A;  1WA7 A;  3VYH B;  1NJI R;  2FZC B;  4DBF A;  1EIF A;  2EQM A;  5LJ3 f;  3CCR A;  3M54 A;  3FRN A;  1AT1 B;  2ATC B;  3CCJ T;  3GLX A;  1GRI A;  1PD0 A;  1AHJ B;  2A36 A;  3CC2 T;  3JB9 H;  2CDT A;  2F69 A;  5KYN A;  2EJF A;  1K9M R;  1AZG B;  1YBY A;  3D7S B;  2L0A A;  2R5M A;  6AT1 B;  3O5Z A;  1VQ9 A;  1RUW A;  3SWN B;  2CP5 A;  2DF6 A;  2EBP A;  3QSU A;  2QYZ A;  4IUV A;  4N4G A;  2GCX A;  3C95 A;  1VYT A;  1TOV A;  1Y7X A;  5GAN 3;  3JRZ A;  4J8O A;  1RI0 A;  1YHQ Q;  1ZSG A;  9ATC B;  2E3H A;  4E47 A;  1QLY A;  4PJO B;  3X24 B;  2DL8 A;  1ZUK A;  5GAN d;  1U3O A;  2AZS A;  1RAA B;  4LXC A;  1VQO Q;  1JJ2 P;  3H6Z A;  3RKY A;  4ZNX A;  5CR2 A;  2CZ6 B;  1K4U S;  4IUQ A;  4QW2 A;  2A3L A;  4DOV A;  2FYK A;  1NYG A;  4LNP A;  4JPB W;  4OMF B;  1LNX A;  1WXU A;  2R5A A;  4JUV A;  4MMK A;  1KK7 A;  5KYX B;  4AFZ C;  2E5Q A;  4KH1 B;  2HQX A;  2E64 A;  1KC8 U;  3RMS A;  1I0C A;  1FWZ A;  2LDM A;  3CCV A;  2DVJ A;  2PNI A;  2V8K A;  3L1A A;  1M1K C;  1IGQ A;  3PVQ A;  2GQI A;  1MNE A;  2FPD A;  5GMK e;  4CI0 C;  3EFR A;  2MWO A;  1YIT A;  7AT1 B;  2K3X A;  3VS3 A;  1UJ0 A;  1W4S A;  2KVQ G;  5J26 A;  1T3S A;  4OGE A;  3L2R A;  1X2K A;  4X34 A;  3L2Z A;  3CC4 A;  5KYW B;  2V8I A;  5LJ5 f;  4BE2 A;  4C92 E;  3H0F A;  3CC7 A;  4EMK A;  3SEM A;  2K57 A;  5GAM e;  1Z9Z A;  4XK8 E;  5GAN 6;  3CXC P;  3QYG B;  1FMW A;  2RHU A;  2VC8 A;  5GAN 8;  3CD6 T;  3EH1 A;  4JLG A;  1JJ2 S;  2DL5 A;  2JJ9 A;  2HL3 A;  4C8Q G;  3PMI A;  2LQ8 A;  1H8K A;  2DM1 A;  1KQS A;  3C94 A;  1UG1 A;  4FU6 A;  1OYX A;  2RH2 A;  3CBP A;  2CKK A;  1NZ9 A;  3BDL A;  5A0D A;  4FIB A;  4BUG A;  4IUR A;  2GTO A;  2YDL A;  1KIK A;  1NEB A;  2MMP A;  2RA2 A;  2RJE A;  2DEQ A;  3GPL A;  4X9C A;  4B6M A;  5IAY A;  3NMZ C;  2M9U A;  4LD6 A;  2O9V A;  2QXF A;  3OS0 A;  2OAU A;  4HVU A;  4OMO A;  3VRZ A;  3MCA B;  4M75 D;  2LT1 A;  4ORZ A;  1ZHI A;  2G6F X;  3BDU A;  2QA4 A;  3VS5 A;  1WNL A;  3NFC A;  4XTU A;  2DD5 A;  4Z89 A;  1VA7 A;  2JMA A;  3CCE A;  4C5E A;  4JJN K;  2DZC A;  2I2L A;  2WAC A;  1VQK Q;  2OTJ A;  4P5N A;  1VQ4 T;  5FU7 B;  3G4S Q;  4C0D C;  1BB9 A;  4DQ2 A;  1M8V A;  1YWP A;  2DA9 A;  1M9S A;  4C8Q F;  2JOY A;  3H9N A;  4C92 A;  2IG0 A;  4MZM A;  1Q86 U;  4BI4 A;  3LLR A;  3FEO A;  2GBQ A;  3M5A A;  1Q7Y R;  1BI2 A;  2M02 A;  4EPC A;  2DXU A;  2AKK A;  1Y07 A;  4PFZ A;  2RJD A;  4FCY A;  1NLO C;  5HKC A;  3UAT A;  2KNB B;  1YP5 A;  3CEY A;  1NJI C;  2BIV A;  2YRC A;  3DLL A;  3E9G A;  2EJ9 A;  4JZ4 A;  5IHI A;  1QMC A;  1GL5 A;  3X28 B;  1OEB A;  2CP6 A;  3BFM A;  4ZN1 A;  4IKF A;  5GAM d;  3RKX A;  3EG0 A;  2ED1 A;  1SRM A;  1Q82 C;  2HSE B;  4AMC A;  1U1T A;  4FSX A;  1G5V A;  3S6W A;  1XQH A;  3M56 A;  1YJ9 A;  1BYM A;  1KFZ A;  1QKW A;  4KGZ B;  2EQU A;  3DB4 A;  3JCM e;  2OTL Q;  2NUP A;  5FU6 B;  5DM7 R;  1KHI A;  3I56 A;  4FYX B;  3MEA A;  2ROT A;  5IT9 E;  4GLK A;  4EMK C;  2RHX A;  4AFU C;  2BZ8 A;  4LUE A;  2CGH A;  2QEX A;  2CUB A;  3JSC A;  1WX6 A;  1U1S A;  4JDS A;  1A0N B;  5GAN f;  3CD6 Q;  2YHT A;  1PC0 A;  3CMA A;  2ABL A;  2VGN A;  2EYW A;  1HSQ A;  1JEG A;  3I55 A;  2LX9 A;  4NL3 A;  5IN1 A;  1M4Z A;  5A0L A;  3CC7 T;  2HD0 A;  4J9H A;  2D0Q B;  1VQ6 A;  1AEY A;  3QZ5 B;  1G3Y A;  2PUK B;  3OYC A;  1MV3 A;  1VQ8 A;  2KXD A;  3EFO B;  3X26 B;  1OOT A;  2J6O A;  3M0R A;  1AZE A;  2X4Y A;  1KQ2 A;  2ZZD A;  2VUB A;  2K6D A;  1QVF P;  2RD1 A;  4CC7 A;  2F5T X;  1AOJ A;  5LJ3 h;  1YIJ Q;  2DYB A;  4ME7 A;  4QVD A;  5CKD A;  3PGG A;  5GJW B;  2YUO A;  3NTK A;  3OYJ A;  1JU5 C;  2R58 A;  3FJP A;  1Y96 B;  3OYB A;  2CS7 A;  4Y28 E;  1FXX A;  2JW4 A;  2EGC A;  2RI2 A;  2ED0 A;  3EG9 B;  4JZ3 A;  4LDY A;  4ESR A;  3P8D A;  3IQL A;  3J81 E;  4EMH A;  1UHF A;  2RJC A;  2XDD A;  2NUP B;  2J05 A;  1BI1 A;  5GAN 2;  2QDL A;  1HK9 A;  1D0Z A;  1BK2 A;  4JRP A;  1VQL A;  1YJN A;  2WSC E;  4MML A;  1SEM A;  1VQ9 Q;  1WQW A;  1VQ7 A;  2QA4 T;  3BE3 A;  4KUL A;  2BE7 D;  3OSV A;  2RPN A;  1M1K U;  1UDL A;  4ZN3 A;  3KBG A;  2NUZ A;  1JJ2 A;  4C92 C;  1YNZ A;  4MZT A;  1QCF A;  3CCL A;  3EGU A;  4A4F A;  1ZBJ A;  2V1Q A;  3CCE T;  1KC8 C;  4M75 E;  4XU3 A;  1QP2 A;  1N9S A;  2EQK A;  4BAC A;  5D6X A;  1JRI A;  4C8Q B;  1C0M A;  2FZG B;  4A63 B;  3JCM d;  3S3N A;  4A4G A;  5DY9 A;  3JCM b;  4OB0 B;  2A08 A;  2E12 A;  4C5I A;  1QVF S;  1K76 A;  4C0G A;  3JCM c;  2YUP A;  3HTR A;  4E7K A;  2KR3 A;  2DIL A;  4WCI A;  2QG9 B;  2CH4 A;  2A37 A;  1LJO A;  4XU1 A;  2XID A;  2DXC A;  1AWW A;  5HY6 A;  1K8A C;  3S3O A;  5CIU A;  2F5K A;  1WI7 A;  1H3H A;  1D3B A;  1K1Z A;  1VYV A;  3M9Q A;  1YJW A;  5EG2 A;  1OX8 A;  1DJ7 B;  1KQ1 A;  3OB9 A;  1GCP A;  2NUT A;  2HBP A;  4X1V A;  4M4Z A;  2V26 A;  4PJO F;  1YI2 A;  2KXC A;  3MP6 A;  5LJ5 h;  1TS9 A;  4E7L A;  3RBB B;  3OYF A;  3TVT A;  3OYI A;  2OJ2 A;  4FT2 A;  2PU9 B;  2YSQ A;  5FRO A;  1MND A;  2FHD A;  3I56 T;  3CCQ A;  3CME A;  1YHQ T;  3QJ6 A;  1VQM T;  5FLX E;  3E9F A;  4F04 B;  3CC7 Q;  4PK4 A;  2L8D A;  1LCK A;  3HPW A;  3EG3 A;  1B3Q A;  4PNO A;  3ZFJ A;  4MDX A;  5I21 A;  3A1P A;  4D6W A;  4XTW A;  2E41 A;  3A8H B;  4M75 A;  2QAS A;  3TQ7 P;  5L23 A;  3CMA T;  2KBT A;  4RTT A;  2YUN A;  1UGR B;  5GAM f;  4Z8A A;  1QW1 A;  1VQ6 T;  2XD0 A;  1FYN A;  2DER A;  3EGD B;  2XG8 D;  1FMK A;  4QKU A;  3VS0 A;  2DTO A;  1MMN A;  3MKD A;  4E7J A;  3EFS A;  1ARK A;  2VXF A;  4BI8 B;  3CCM A;  1Q86 C;  1MMD A;  1WIE A;  2QQA A;  2CSI A;  2L89 A;  1NJI U;  2KQW A;  1Z9Q A;  4AFQ C;  2JXB A;  3A8G B;  1JXO A;  3PTA A;  4OMN A;  2JVV A;  2HZY A;  3RUX A;  2QA4 Q;  3EGX A;  1NYF A;  3VKI A;  2EKO A;  1K9M U;  2PQW A;  1K73 R;  3P8B B;  3TSW A;  1ZX6 A;  3QYH B;  4A4H A;  3CCE Q;  1IHW A;  2RK2 A;  3CPF A;  1EFN A;  1RAF B;  2DBM A;  4J9C A;  2X51 A;  2DFU A;  1YJN T;  2FEI A;  2OTJ Q;  4GLM A;  1M1G A;  2VYT A;  2PTK A;  4OVA A;  3RMQ A;  1ZA2 B;  1AWO A;  2CP2 A;  2E5K A;  4L6V 5;  2DD4 A;  3CCL T;  2ZPH B;  3CCU T;  3R6N A;  3OYM A;  2K3B A;  3OMG A;  4XTX A;  3M53 A;  8ATC B;  4E2F B;  3OYN A;  2EQI A;  3H41 A;  3HRS A;  2KRO A;  4BE1 A;  1M27 C;  1UB4 A;  3JAM E;  1PRM C;  1UGV A;  2P0P A;  1W2B P;  4M7A D;  1AWX A;  4KGV B;  3RER A;  3TRE A;  2LCL A;  3OYE A;  4A53 A;  4HXJ A;  3JB9 I;  3VU3 C;  1E6H A;  4HA8 A;  1QWF A;  1R77 A;  3J80 E;  3QDR B;  4JLI A;  3UPU A;  2LNH B;  1WHK A;  3VRY A;  2EYY A;  2K5F A;  1AWJ A;  1U06 A;  2MCN A;  3GF5 A;  1N27 A;  1R0C B;  4QT7 A;  1WPY A;  2K4Y A;  1YJW T;  3I56 Q;  2QQB A;  4OB3 B;  1VQK T;  3EG1 A;  4JS5 A;  4B9X A;  5GAN h;  3G4S T;  1X69 A;  5CKB A;  1VQM Q;  2DO3 A;  1K9A A;  4C92 G;  3CCS T;  2D8H A;  3VUB A;  1N6A A;  2ESW A;  3OQ5 A;  3JCM f;  2PZ1 A;  3OYY A;  1BKB A;  3QO3 A;  4M75 C;  1QVF A;  4J9D A;  3CMA Q;  5GAN 7;  2COW A;  2H3E B;  3OW2 A;  1Q95 G;  2K79 A;  2L2P A;  3CCQ T;  3CME T;  3QKJ A;  2E10 A;  5A2Q E;  4FYW B;  4JJD A;  4XU2 A;  2M0O A;  1MGQ A;  1EX4 A;  1NEG A;  1W2B S;  1VQ6 Q;  1B34 A;  1VIE A;  3QPH A;  1RLP C;  2K3Y A;  1RAH B;  3NGP A;  4O6J A;  2XK0 A;  2KRM A;  4N4I A;  4AG1 C;  3RKW A;  4OGC A;  3V8K A;  1SPK A;  2OTL T;  4BY6 C;  1QCO A;  4E7S A;  3VV0 A;  2RQV A;  5CQY A;  2CZ1 B;  5CKF A;  5IHK A;  4LUD A;  4A4E A;  2HEQ A;  2EQJ A;  3DB3 A;  2O01 E;  2CUD A;  2FG0 A;  3GNF B;  3C12 A;  1RAC B;  4C92 F;  2A7Y A;  2DVE A;  1T0H A;  4XAX B;  1K8A U;  2C0O A;  5C6S A;  4E6R A;  1YJN Q;  1VQL Q;  8AT1 B;  2C0I A;  4C0D B;  3OS2 A;  2P0Q A;  1GCQ A;  2RN8 A;  1IGU A;  2O88 A;  1YFN A;  1E7O A;  2J6F A;  4F14 A;  4KRT A;  4R0K A;  4BB7 A;  3CCL Q;  3CCU Q;  3JCM W;  2QTV A;  1KD1 R;  4KBM B;  3UWN A;  4F7U E;  4C0F A;  3OYG A;  2JTF A;  3HFO A;  1IHV A;  1M1F A;  2Y90 A;  3SFM A;  1SHF A;  2EAY A;  1YIJ T;  1JB0 E;  1N8R R;  1UGP B;  3ZEH A;  5FRM A;  2B86 A;  3GNG A;  3HRT A;  2K5I A;  4ANJ A;  1W6X A;  3M55 A;  1UGQ B;  5GAO n;  3JB9 D;  2HDA A;  2L3R A;  3QHS A;  3OYA A;  2K2V A;  3UT1 A;  3OYL A;  3CCR T;  2D9T A;  1I1J A;  3PFS A;  3HL8 A;  1IRE B;  4K11 A;  2GQV A;  3ME9 A;  5D6W A;  2JT4 A;  2RQT A;  3CXC S;  1YJW Q;  3QZ9 B;  2O4X A;  1VQ9 T;  3SD4 A;  4M7A E;  2KMT A;  2HQE A;  1RLQ C;  3BY7 A;  4M77 E;  4EMK B; 
#chains in the Genus database with same CATH homology
 3G6E T;  3J81 E;  4C92 D;  4EMH A;  5GAO p;  2XDD A;  2RJC A;  2DTI A;  4ZTF A;  1G3W A;  1BI1 A;  3OY9 A;  3JB9 J;  2OTL A;  5GAN 2;  3OYD A;  3M57 A;  1HK9 A;  1HXD A;  5GMK h;  5GAN e;  3JCM g;  4JRP A;  1VQL A;  1YJN A;  2WSC E;  4R55 A;  4BDY A;  2PVG B;  4MML A;  1GXI E;  4F7U G;  4N0A C;  4CRI A;  1WQW A;  1VQ7 A;  2QA4 T;  4M78 D;  4KUL A;  3S3M A;  2ZPB B;  3OSV A;  1KD1 U;  1M1K U;  1BIB A;  2RI3 A;  4ZN3 A;  3KBG A;  3GOX A;  3HP9 A;  5KCO A;  4C92 C;  5GMK i;  1JJ2 A;  2MWP A;  3V7S A;  2DPP B;  4MZT A;  4XU0 A;  5CKE A;  3CCL A;  2V8J A;  4A4F A;  2ZCF B;  4A4K A;  2E6Z A;  3A5Z B;  2RHZ A;  3QJY A;  1KC8 C;  3CCE T;  4M75 E;  3A8M B;  2EJG A;  1YCY A;  4IUU A;  5GAM h;  1WQ7 A;  4HT8 A;  2PUO B;  3CD6 A;  4XU3 A;  1MHN A;  3V7C A;  1QP2 A;  2EYQ A;  1N9S A;  2RI5 A;  2EQK A;  4QQ6 A;  4B9W A;  4F7U A;  3PIO A;  4BAC A;  3N5B B;  5D6X A;  4M7D D;  1PSE A;  2XI9 A;  1JRI A;  2XU8 A;  1N8R U;  4C8Q B;  2XKO C;  3SWN C;  4NL2 A;  1K9M C;  3JCM d;  2QQS A;  3DKM A;  3OBW A;  3S3N A;  4A4G A;  2LRQ A;  2QTX A;  5DY9 A;  2ZPI B;  2Y4X A;  4J6X A;  3RIR A;  2CZ0 B;  5KE2 A;  3CCM T;  3JCM b;  1Q82 U;  4OB0 B;  1QVF S;  2E12 A;  4C5I A;  1UGS B;  3MEU A;  5CQX A;  3X20 B;  1Y71 A;  5D6Y A;  1VUB A;  5GAO l;  4C0G A;  3JCM c;  3L2Q A;  2HNI A;  1Q81 U;  1OZ3 A;  1P92 A;  1NE8 A;  4E7K A;  4MDW A;  3UDC A;  2GFA A;  1G3T A;  3QXE B;  2DXT A;  4LDX A;  3Q1J A;  4XTZ A;  2AHJ B;  3CCV T;  1LJO A;  3MET A;  4XTV A;  1ZQ1 A;  4A54 A;  3OYH A;  1IZ6 A;  2PVD B;  1OI1 A;  4XU1 A;  2JNG A;  2XID A;  3QBY A;  1SSF A;  3BW1 A;  3VYG A;  1VQN T;  4PJO C;  1VQ5 A;  4M7A G;  2DXC A;  3FC3 A;  5KE3 A;  1YIJ A;  2RJF A;  5HY6 A;  3P8H A;  4L5G A;  4M77 G;  1K8A C;  2P0K A;  4J6W A;  5CIU A;  3S3O A;  4JS4 A;  4BI3 A;  2F5K A;  2H3J A;  1H3Z A;  2GFU A;  1YIT T;  3LGF A;  1D3B A;  3V8L A;  2QI2 A;  3M9Q A;  2KAF A;  3FIF A;  1YJW A;  5EG2 A;  3VYH B;  2O4X B;  4ZGD B;  1DJ7 B;  4M78 E;  5L8R E;  1KQ1 A;  3OB9 A;  2Y4Y A;  4F7U F;  2HBP A;  1EIF A;  3CC4 T;  1XNI A;  1S72 A;  5GAN j;  2EQM A;  5LJ3 f;  3CCR A;  4XQ3 A;  3M54 A;  3FRN A;  4PJO F;  4J6Y A;  3CCJ T;  4C92 B;  1YI2 A;  3MP6 A;  4E7I A;  3QUI A;  5LJ5 h;  1NPR A;  3GLX A;  3KXT A;  4M7A A;  2PVO B;  1X6O A;  4E7L A;  1Q7Y U;  3TCJ A;  4M77 A;  1RL2 A;  3OYF A;  4KUI A;  4XTY A;  4C0Z A;  1VQO A;  1AHJ B;  3OYI A;  3CC2 T;  3JB9 H;  5J39 A;  4FT2 A;  2F69 A;  2NLU A;  2PU9 B;  3VUZ A;  3LX7 A;  1B34 B;  2EJF A;  2LC4 A;  4M7D E;  1YBY A;  5FRO A;  2FHD A;  2R5M A;  4M75 G;  4RKU E;  3I56 T;  2HAX A;  5GAN g;  1VQ9 A;  3CCQ A;  3CME A;  3HKS A;  1YHQ T;  3QJ6 A;  3SWN B;  3C4S A;  3NTI A;  1VQM T;  2ZPG B;  5J3B A;  3E9F A;  5FLX E;  5GAO m;  3G6E A;  3QSU A;  2L8D A;  3HPW A;  5LL6 S;  4YTL A;  3ASK A;  3QG1 A;  4ZGJ B;  4PNO A;  3ZFJ A;  4MDX A;  5I21 A;  1VQP A;  4IUV A;  2KY9 A;  4N4G A;  2LQK A;  2GCX A;  2CYZ B;  1WGS A;  3C95 A;  4QQD A;  4D6W A;  4XTW A;  2E41 A;  5KCH A;  1QVG S;  1Y7X A;  4NS5 A;  2FL7 A;  3A8H B;  4M75 A;  5I2S A;  5GAN 3;  2DIQ A;  4OP0 A;  4BD3 A;  1K73 C;  3JRZ A;  3G7Z A;  4J8O A;  2P4T A;  3CMA T;  3MP1 A;  1RI0 A;  2VXE A;  2RK1 A;  4E47 A;  4PJO B;  4V2S A;  4LDU A;  3X24 B;  4J7F A;  4M7A F;  5FRN A;  2CZ7 B;  5GAN d;  4M77 F;  5CO7 A;  1UGR B;  5GAM f;  2KK4 A;  1QW1 A;  2JZ2 A;  4HCB A;  3P8D A;  5GMK m;  1VQ6 T;  5CKH A;  2XD0 A;  3H6Z A;  3RKY A;  5CR2 A;  2XG8 D;  3H8Z A;  2CZ6 B;  4PL6 A;  2RHY A;  3DLM A;  4IUQ A;  4QW2 A;  2A3L A;  4DOV A;  2FYK A;  2DTO A;  1ZBX A;  3SDZ A;  5LJ3 e;  4C8Q E;  4M78 G;  3OBY A;  2XHC A;  2E70 A;  2XDP A;  4E7J A;  4QVC A;  1TH7 A;  4OMF B;  1LNX A;  3EFS A;  1O75 A;  2VXF A;  3M58 A;  5AYF A;  1H64 1;  4BI8 B;  2R5A A;  2MF2 A;  3EAE A;  4JUV A;  5CAI A;  3CCM A;  4RCC A;  4BE0 A;  1Q86 C;  2BUD A;  3T9N A;  2QQA A;  4MMK A;  2L89 A;  1NJI U;  2QQ9 A;  2KQW A;  2E5Q A;  2E65 A;  2EIF A;  2FVU A;  2HQX A;  2E64 A;  3ZBD A;  4PLI A;  1KC8 U;  3JCM V;  3G71 A;  3CPW S;  3RMS A;  4M75 F;  3A8G B;  1FWZ A;  4M7D G;  3R6O A;  3JCM h;  2LDM A;  3PTA A;  3CCV A;  4JRQ A;  2JVV A;  2OTJ T;  5HK0 A;  4JRK A;  2V8K A;  3L1A A;  4M78 A;  3RUX A;  1M1K C;  3WXM B;  3LW5 E;  1VIF A;  1KHC A;  4C5H A;  4PJO D;  3VKI A;  5A0G A;  2EKO A;  1K9M U;  5GMK e;  2PQW A;  1G3S A;  4CI0 C;  3GIB A;  3EFR A;  2MWO A;  3LH0 A;  3P8B B;  4ATO A;  1YIT A;  2K3X A;  3QYH B;  1XOV A;  1W4S A;  3KUF A;  4A4H A;  2KVQ G;  2RK2 A;  3L42 A;  5J26 A;  3OS1 A;  4OGE A;  3CPF A;  3L2R A;  3TEE A;  1Y96 A;  3LGL A;  4MZP A;  3L2Z A;  4X34 A;  1YJN T;  2DKG A;  3CC4 A;  4M7D A;  3V7R A;  1M1G A;  2L5Q A;  2VYT A;  2FB7 A;  2V8I A;  4KT0 E;  3JCM Q;  5LJ5 f;  4BE2 A;  4OVA A;  3RMQ A;  3CCJ A;  4C92 E;  1M90 U;  5I2M A;  3CC7 A;  2KSS A;  4EMK A;  5GAM e;  2K57 A;  4FM4 B;  3CC2 A;  4L6V 5;  4XK8 E;  2DD4 A;  5GAN 6;  2ZPH B;  3CCL T;  3CCU T;  3OYM A;  3QYG B;  5HK3 A;  2KDS A;  1Q81 C;  3OMG A;  4XTX A;  2RHU A;  3M53 A;  5CCA A;  2VC8 A;  4VUB A;  5GAN 8;  2JTM A;  4R56 A;  3CD6 T;  3M59 A;  3O8V A;  4PLL A;  4JLG A;  4C5G A;  3L2W A;  4NOY A;  1BI3 A;  1YHQ A;  3OYN A;  1JJ2 S;  3HRS A;  4M78 F;  1VQM A;  2DK3 A;  4II1 A;  5FU7 C;  2DAQ A;  1QVP A;  4C8Q G;  1M5Q 1;  1PSF A;  3MEV A;  3CXC A;  1UB4 A;  4BE1 A;  2M1H A;  3FDR A;  3PMI A;  3JAM E;  2LQ8 A;  2P0P A;  2ZPE B;  4J7I A;  2X4J A;  5LJ3 j;  5GAO r;  4M7A D;  4ZGE B;  4RG2 A;  1I4K 1;  1KQS A;  3C94 A;  4FU6 A;  1YJ9 T;  3RER A;  2RH2 A;  1OYX A;  2X4W A;  3CBP A;  2LCL A;  2R57 A;  2LCC A;  2E6N A;  2CKK A;  4WF2 A;  3TRE A;  3OYE A;  1NZ9 A;  1UEB A;  3BDL A;  3OA6 A;  5A0D A;  4FIB A;  4RMO A;  3FB9 A;  4BUG A;  4IUR A;  4A53 A;  5GAN 5;  3JB9 I;  4L59 A;  4LDW A;  3VU3 C;  2B8A A;  4M7D F;  3JB9 G;  1W2B A;  2MMP A;  2RA2 A;  2RJE A;  2XDB A;  1N9R A;  2DEQ A;  4HA8 A;  2M16 A;  2DZ9 A;  3GPL A;  4C8Q A;  1WJQ A;  4X9C A;  4RCB A;  3QDR B;  4JLI A;  3J80 E;  3CBM A;  3UPU A;  1Q7Y C;  4M7A C;  4Y91 A;  5IAY A;  1VQ5 T;  2M9U A;  4M77 C;  4QQG A;  3A8O B;  2K5F A;  4LD6 A;  4LD9 K;  3GF5 A;  2QEX T;  1N27 A;  2VGM A;  1I8F A;  2QXF A;  5GMK j;  2YLC A;  2RO0 A;  3OS0 A;  2OAU A;  1WPY A;  2K4Y A;  3FLG A;  2C06 A;  4F7U B;  1YJW T;  2DTH A;  2QQB A;  4UC4 A;  3MCA B;  4M75 D;  1X01 A;  2LT1 A;  4OB3 B;  1VQK T;  2YRV A;  5LJ5 e;  1ZHI A;  3BDU A;  2QA4 A;  1K73 U;  4JS5 A;  4B9X A;  5GAN h;  3G4S T;  3SB2 A;  3VJP A;  5CKB A;  1S72 T;  1WNL A;  3I55 T;  3NFC A;  4XTU A;  2DO3 A;  4Q5W A;  4OB2 B;  4C92 G;  2DD5 A;  4FT4 A;  3CCS T;  2QDY B;  3JCM P;  3VUB A;  1N6A A;  2X35 A;  4JRI A;  3CCE A;  4C5E A;  3OQ5 A;  2DIG A;  4JJN K;  2DZC A;  2I2L A;  5LJ3 d;  3HRU A;  2WSF E;  4J5Y A;  3JCM f;  3OYY A;  1BKB A;  5FU6 C;  3QO3 A;  4ELZ C;  5GAM j;  1VQ8 T;  2LNV A;  4M75 C;  1QVF A;  2WAC A;  3INZ A;  2OTJ A;  4N4H A;  4N0A A;  4P5N A;  5GAN 7;  1VQ4 T;  5FU7 B;  1R8O B;  3OW2 A;  2GF7 A;  4C0D C;  3CCQ T;  4DQ2 A;  1KQS S;  1LOJ A;  5DLO A;  3CME T;  3QKJ A;  1M8V A;  2E10 A;  1M9S A;  4C8Q F;  2JOY A;  3J7A F;  5A2Q E;  4EDU A;  4C92 A;  3PT9 A;  2IG0 A;  2G3R A;  2QQR A;  3M4Y A;  4MZM A;  4XU2 A;  3TU4 K;  2M0O A;  1MGQ A;  1D3B B;  5M9O A;  4BI4 A;  3LLR A;  1Q86 U;  5GAM g;  3FEO A;  1VQP T;  1W2B S;  3OMC A;  3RES A;  3M5A A;  3L2U A;  1B34 A;  1VIE A;  3QPH A;  1BI2 A;  3HFN A;  3LWI A;  4EPC A;  2IVW A;  2DXU A;  2LVM A;  4RG8 A;  3HSB A;  3JB9 F;  1KD1 C;  1WJS A;  2K3Y A;  3QII A;  1Y07 A;  4O6J A;  2RJD A;  1VQN A;  3PIP A;  4PJO G;  3SWN A;  5HKC A;  4M7A B;  3MO8 A;  3LYI A;  2XK0 A;  3CEY A;  4M77 B;  1NJI C;  2BIV A;  4N4I A;  2BKD N;  3DLL A;  3CCU A;  3RKW A;  3E9G A;  4OGC A;  4EMK B;  4IUP A;  3V8K A;  3JCM J;  2OTL T;  1QP3 A;  2EJ9 A;  4LDV A;  3MP8 A;  4BY6 C;  4DA4 A;  4HKE A;  3CBO A;  2VV5 A;  3E1S A;  5CVI A;  3NTH A;  3VV0 A;  3WVE B;  5CQY A;  2EWN A;  1VQL T;  2CZ1 B;  3X28 B;  1N8R C;  5CKF A;  3BFM A;  3OSS C;  4ZN1 A;  4IKF A;  4M78 C;  4A4E A;  1NPP A;  2EQJ A;  5GAM d;  3RKX A;  1VQ7 T;  3DB3 A;  2O01 E;  4TVR A;  4PJO A;  1Q82 C;  2ZGW A;  5GAN 4;  3GNF B;  1U1T A;  4FSX A;  3AHU A;  3C12 A;  5LJ5 j;  1G5V A;  3S6W A;  2A7Y A;  2WSE E;  2DVE A;  4C92 F;  3E19 A;  1XQH A;  3M56 A;  4XAX B;  1FX7 A;  1YJ9 A;  1BYM A;  4EMG A;  2EQU A;  3DB4 A;  1K8A U;  3M4G A;  3JCM e;  3PNW C;  3F70 A;  2MI6 A;  3OW2 S;  5FU6 B;  5DM7 R;  4OF1 A;  3JCM X;  4QVZ A;  2DJZ A;  4M75 B;  1KHI A;  3I56 A;  2LT4 A;  4FL6 A;  5C6S A;  3G71 T;  4HT9 A;  4M7D C;  4HCC A;  2RM4 A;  4C0D B;  3OS2 A;  3OYK A;  1WJR A;  2P0Q A;  1M90 C;  1QVG A;  3MEA A;  3GP8 A;  5LJ5 g;  1XTD A;  2X4X A;  4ZTJ A;  1U8R A;  5IT9 E;  4GLK A;  4HCZ A;  4EMK C;  3MHX A;  2RHX A;  1I81 A;  2YLB A;  1I5L A;  4M77 D;  4BB7 A;  2CGH A;  3JCM W;  2QEX A;  1JBM A;  4KBM B;  3JSC A;  3UWN A;  3LWH A;  4F7U E;  4E7H A;  1X75 C;  1U1S A;  4JDS A;  4PKC C;  4C0F A;  1VQK A;  5GAN f;  1BI0 A;  2YHT A;  3CMA A;  2VGN A;  3OYG A;  3G4S A;  4PJO E;  2JTF A;  4BDZ A;  2DXB A;  1OZ2 A;  5GMK l;  3I55 A;  2LX9 A;  3HFO A;  5LJ3 g;  4NL3 A;  5IN1 A;  2D6F A;  3URG A;  1M1F A;  2Y90 A;  3SFM A;  1M4Z A;  4C8Q D;  5A0L A;  2ZPF B;  3CC7 T;  2HD0 A;  3CCS A;  4X9D A;  2EAY A;  1YIJ T;  1JB0 E;  1V29 B;  1UGP B;  3ZEH A;  5FRM A;  2D0Q B;  2JUF A;  1VQ6 A;  4BY6 B;  5LJ5 d;  3QZ5 B;  1G3Y A;  2PUK B;  3ER0 A;  3GNG A;  3HRT A;  3WVD B;  3OYC A;  5KH6 A;  1VQ8 A;  3X26 B;  2K5I A;  3HHT B;  3L2V A;  2X4Y A;  1KQ2 A;  3M55 A;  1UGQ B;  2RHI A;  2VUB A;  2ZZD A;  4M78 B;  4ELY C;  1VQ4 A;  5DLQ E;  4GY5 A;  5GAO n;  2E1H A;  3JB9 D;  2RB6 A;  2L3R A;  3QHS A;  3OYA A;  2JN0 A;  2K2V A;  1KG1 A;  1BIA A;  4C8Q C;  3UT1 A;  3OYL A;  3CPW A;  3CCR T;  2D9T A;  2RD1 A;  3MEW A;  2F5T X;  3PFS A;  4Z02 A;  3HL8 A;  5LJ3 h;  1YI2 T;  4KUD K;  1IRE B;  2MAM A;  2GQV A;  3ME9 A;  4ME7 A;  5D6W A;  3V8J A;  4QVD A;  1VQO T;  5CKD A;  3PGG A;  3A8L B;  3NTK A;  3OYJ A;  2R58 A;  3FJP A;  1Y96 B;  3OYB A;  2CS7 A;  3CXC S;  4M7D B;  4J83 A;  4Y28 E;  4O5V A;  2LTO A;  3QZ9 B;  2O4X A;  1FXX A;  4IUT A;  2K5L A;  4DOW A;  5C0M A;  5GAO q;  1VQ9 T;  3SD4 A;  4OB1 B;  4M7A E;  2XIC A;  2KMT A;  2HQE A;  3OS5 A;  1O9S A;  2RI2 A;  4LDY A;  3BY7 A;  5CK9 A;  4M77 E;  2EFI A;  3X25 B;  3PMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...