5FUIA

Crystal structure of the c-terminal cbm6 of lamc a marine laminarianse from zobellia galactanivorans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
NTLKIEAESYLYSNDVQKEPCSEGGENVGYINNGSWMSYPGINFPSSGNYLIEYRVASAVDGGRFSSDLEAGETVLGELSVPNTGGWQNWTTVSQTVNVSAGTYQFGLYSISGGWNINWIRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unraveling the Multivalent Binding of a Marine Family 6 Carbohydrate-Binding Module with its Native Laminarin Ligand.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
molecule keywords ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5fuiA00
1O8PA 3HEIA 4JKKA 3C8XA 1ULOA 3K46A 4ARXA 2LW8A 1SG3A 1UYYA 4JX0A 4YPJA 4P00B 3T08A 2QQMA 4KI5M 4IUGA 2V72A 1NKGA 4PT6A 4A41A 3FHQA 5JMOA 2LS6A 2VC9A 5JR2A 4CUCA 1KEXA 3OB8A 3DYOA 2E26A 4DUWA 1GU3A 2W1QA 2BGOA 3GM8A 1OD3A 1ULPA 1CZVA 1K45A 1PX4A 1UY1A 4P08A 2QBXA 5J1XA 2W3JA 5IHRA 1K12A 1I5PA 5EJZB 2VZSA 2L9LA 4MGQA 4XUPA 1R64A 4LQRA 3LQCA 4XUTA 4XUOA 3MO4A 1UMIA 4DEVA 4E8CA 5DMYA 5IJRA 3LEKA 3K75B 2XONA 4RYDA 4QAWA 3A22A 1GUIA 3VD4A 1PMJX 4D8MA 2JE8A 4GWIA 1L7QA 3K4DA 1JZ8A 4OUEA 3WF0A 3OG2A 4KMQA 3I2HA 3I3EA 1LNSA 2HYXA 3T0AA 4PQQA 2J1VA 3HNMA 2WZ8A 1XC6A 3I3DA 3P6BA 3DYMA 2VZPA 3GDBA 3FHAA 2W92A 3AC0A 3WQBA 4A4AA 5JXIA 1GMMA 4DUXA 2VTFA 2E33A 4MOAA 1GQPA 3ECQA 4QDRA 2VQUA 4OMDA 2ZEZA 3VDCA 2E31A 4P02B 1P8JA 3VD5A 4OZOA 2VZUA 3CZUA 4XUQA 2WZEA 2CDPA 2VZVA 3HN3A 2EIBA 4BK5A 3LPFA 3VDAA 1UWWA 1DLCA 4UAPA 2QQKA 3K4AA 3WNKA 2XQXA 2QQOA 3HJRA 1JZ6A 3CZJA 4L0PA 2KD7A 2WO3A 1KGYA 4DUVA 2JDAA 1W0NA 3ACFA 4A44A 4P5YA 4ET7A 1EUUA 2B4KA 2VZ3A 4ZXEA 2Y8KA 4OYUA 1CX1A 3THDA 4ZZ5A 1W8OA 2CDOA 4BXSV 4AAXA 3WNOA 1HN1A 3T2OA 3UESA 3I2GA 2VCAA 3OGSA 3MBWA 4OMCA 5G05L 2YFUA 3VDBA 1SDDB 2WDBA 3THCA 5CYYA 1UY4A 5C70A 2C26A 3P1IA 4A3ZA 1H6YA 1GOGA 4QB2A 3NQHA 3BGAA 3NJVA 3MV01 5JXHA 3LEGA 4LHSA 1O59A 2W1SA 1O8SA 2VMCA 2W94A 3GXUA 4CU6A 3WNNA 2JKXA 2YC4A 2YB7A 5F7UA 3CIHA 3IIIA 3ACIA 2VZTA 5C7GA 3T09A 2BZDA 2VR4A 5HXMA 1XNTA 1JYNA 4QX1A 1GOHA 1W9WA 2DDUA 2W5FA 4E8DA 1UYZA 2J1UA 2VOTA 2XHNA 3CQOA 2Y64A 1L7RA 3IAPA 1GOFA 3T0DA 3PUHA 1XNAA 1UZ0A 1NAEA 2QQNA 5DQ0A 3C7GA 3I3BA 4W50A 3A23A 3DYPA 2X10A 2E32A 4QB6A 3WNPA 1JZ7A 2VZRA 5DN2A 5I0DA 5G04L 1H6XA 3W5NA 1NX9A 2QQJA 3ACHA 4GZ9A 2DCKA 5IFTA 2J22A 1JZ5A 1UY3A 5IFPA 3CDZB 4DXRA 3JXSA 1IQDC 3I97A 4QX0A 4QX3A 3VD3A 3VD9A 4M4RA 1UX7A 2J1EA 4CU9A 1JYWA 2VCCA 2W46A 2W95A 3SEPA 3WNMA 3WNLA 2WYSA 2WN2A 4QDQA 2BGPA 2OKXA 2W87A 3J7HA 1W99A 4ZY9A 3IDAA 3OEAA 1DYOA 1PX3A 3ABZA 3I2FA 4JKLA 4TTGA 4A42A 1UMHA 1UYXA 2J1AA 3OGRA 4BDVB 3I2KA 3MV11 2WO2A 1XPWA 2X05A 2VJXA 1YQ2A 5DPNA 1JYVA 3NNGA 2YC2A 5LA0A 3NRUA 4CU8A 1CZTA 1UXZA 2VZ1A 1WCQA 2RJ2A 2WAAA 2BERA 2WABA 4QX2A 2QQLA 3WSOA 3HPNA 2R7EB 2YFZA 3IB3A 3OGVA 3SKJE 3F2ZA 2ORXA 3GGLA 4HG6B 2ZEXA 4CVUA 2Y6HA 4DXSA 2WO1A 2JD9A 2J1RA 5FUIA 3VD7A 1W8NA 2VMEA 3EB7A 2C4XA 3T2PA 3HNYM 2EIDA 4UOJA 3SKVA 4CUAA 2Z4FA 4CUBA 1OH4A 1D7PM 4XZUG 1F4HA 2DCJA 2PQSA 1WKYA 1UXXX 4QDSA 2VZQA 2Y6GA 4MO3M 3I2IA 2RVAA 1K42A 2Y6JA 1MPXA 5JUVA 4XURA 3IAQA 4LPLA 4MGSA 1F4AA 2C9KA 4Z2AA 1W9SA 5B4NA 4BJ0A 4DEQA 1US3A 2VQTA 2XOMA 4QPWA 2WUHA 2VMFA 3LE0A 3K77A 1PMHX 3ZM8A 5HPOA 4RN5A 1T2XA 3C7HA 2W91A 2X09A 3I2JA 2RV9A 2VZOA 3WF3A 2BBAA 2WAOA 5EIYB 5A1AA 5C71A 3C7EA 1JHJA 2ZEYA 5EJ1B 5JXGA 1RYYA 3EYPA 1JYXA 1UY0A 3A7QA 3OBAA 3WF2A 5IYYA 1EUTA 1W9TA 1OF4A 4LKSA 2ID4A 2VCBA 3PUIA 3UNPA 4TXWA 1K3IA 3T2QA 3CMGA 3WEZA 4ARYA 4A45A 1JZ2A 2ZEWA 1BHGA 2J1TA 1OT5A 2VL4A 4FI9A 2W47A 1US2A 1JZ4A 3WF1A 4CU7A 3ACGA 3SEEA 1NUKA 3FN9A 2ZXQA 3HNBM 2WQ8A 3MUY1 5CZKA 4DXTA 3A21A 2VM9A 4ZZ8A 4PF1A 2J1SA 2WBKA 3E1F1 4UI9L 4AG4A 1J84A 1OF3A 1CIYA 3K4ZA 2V5DA 2B9VA 3T0BA 3WF4A 1GNYA 1JU4A 3NJXA 2EICA 4D0QA 2J7MA 3U37A 3LEIA 4XUNA 1TG7A 2W1UA 3C7OA 2Y6LA 5LA2A 2ORZA 3UETA 2Y6KA 3OEBA 3C7FA 2WN3A 1JU3A 3MUZ1 3FL7A 2W9XA 4M4PA 4JHZA 2EIEA 5LA1A 1UY2A 4KWUA 4JKMA 1TVGA 2YG0A 3HOBA 2VO5A 3BN6A 4QB1A 1CZSA 2QQIA 4W4ZA 1DP0A 4GWJA 4W8JA 2W1WA 2VMDA 1J83A 1JZ3A 1SHWB 1JI6A 3D3AA 5B4XA 2HLEA 4MADA 3LPGA 3DECA 4BK4A 3W5MA 5LCWL 4A6OA 2V4VA 4XVHA 5JXJA 3CKHA 3ETPA
chains in the Genus database with same CATH superfamily
1HB2A 3NNFA 2E63A 4CEYA 3FMGA 1LOBA 2RS33 5GZDA 4XHXA 5CKQA 4EZHA 1W6OB 2LW8A 1SG3A 4XFGA 3VBHB 1W2NA 3BYWA 4YPJA 3ZVXA 4F83A 5JZGC 3T08A 4KI5M 2RS53 3POFA 1OLRA 4OLLA 1N1YA 2D6KA 3OUJA 3PJYA 4RGGA 2PHXA 3POEA 4BLJA 2VE1A 3ZXJA 4A7KA 5FXWA 5FUNA 2E26A 1H2MA 1Z7S1 4DUWA 5BNNB 1HRV2 2FBEA 1W39A 2P3JA 2W1QA 5LA9A 3LOBA 1MQTA 4FSJA 1C5HA 1YIFA 4D0QA 1ULPA 1E57A 2WYFA 4Q1PA 1PVC3 3RWKX 1BK1A 5ANQA 3WY6A 5LBEA 1UY1A 1Y9MA 4E4DX 2UU8A 5A3PA 5LY1A 2JG8A 5J1XA 2W3JA 3AM2A 2XJSA 1UU6A 4YW7A 3BI3A 5BNQA 4E4HA 2MPFA 4QPGC 5BV6A 4PHZA 3GZEA 2BP6A 4QQHA 5EJZB 2VZSA 1SEFA 2D3PA 5ACA2 2R073 3KVBA 2L9LA 4KBZA 5DDJ2 5C33A 4MGQA 1V6MA 5I0RA 4LQRA 3LQCA 2JD4A 3K2OA 3V64A 1MEC2 1CR7A 1QJX2 1OOPB 1HW5A 4CCKA 4EWAA 1NCQC 3BTXA 4DEVA 3UKTA 4M3CF 4E8CA 4FOQA 4H3WA 5LK7B 5IVCA 1C1FA 1OHFA 5H9SA 1ULCA 1O4ZA 2GC2A 2GH2A 2XONA 5L7OA 5I0TA 2KA3A 5A7WB 1ST8A 4X8NA 4CE8A 1VAVA 2AREA 5FYYA 4B7KA 2Q30A 4JGZB 1SPPA 4WM8B 3VD4A 1CWPA 2Y6FA 5FZLA 1AXYA 3K4DA 4GB33 2H6BA 4JDMA 4G4FA 5FJKA 3JBG3 4UYBA 3I54A 5FPZA 3I2HA 4D94A 3MIEA 1BKZA 1CAUB 5J09A 1SLIA 2ZGNA 3IM0A 1AX0A 4QPGA 3W59A 4RS5C 4Y33A 3I3DA 3VBSA 1OPOA 3CHXA 4YSFA 5A3TA 1VBE3 3FHAA 3CU7A 1NY71 2K9ZA 1UPSA 2JDZA 1HN0A 4LBMA 3LZZA 4HK8A 4MOAA 3ECQA 2HWD3 3USUB 1XU2A 5FMOS 3ZSLA 3AP7A 1UOBA 2EF6A 3O0WA 2AENA 1H30A 2XB6C 4RL7A 4P02B 2FDGA 5K7PA 3EO6A 1AYN1 2VPVA 1PK6A 2XXZA 1LOAA 2CNAA 1XB9A 2VZVA 4DB5A 1Q8VA 1RUC1 4BK5A 4EWEA 1W3VA 1FPN3 3HQUA 1RUC3 5GLUA 3M70A 3ZKUA 3K4AA 4MGZE 1ZBE3 5FP9A 1KFXL 1W6OA 3CZJA 4HN1A 2KD7A 3LFIA 4Q4X1 4Q4V1 5FRAA 2ZHMA 4P9IA 5FZCA 1W0NA 3VBHA 1AR82 1WLDA 5FOJB 2D6PA 2F17A 4CDWA 4JRAA 3P3PA 2CGOA 4LO5B 4XQWA 5BNPB 4MLOA 2Y8KA 1FOD3 4ZXEA 5C9AA 1D2SA 3ES4A 4NWVA 5LEJA 1VBE1 4OI0A 1PNGA 1W8HA 3AJYA 4DRVA 4UW5A 5I0SA 2DVBA 1YQCA 3VBRA 4B4PA 5FO7B 3WT3A 2MNGA 5ACA1 1YJKA 4FPJA 4CPBD 3KHBA 4K6BA 1MQTC 1HN1A 1W6MB 3T2OA 4OHVA 1UU4A 4GB31 3MBWA 3NV1A 2EXHA 3LOIA 4JDNA 4XJAA 1QQP1 4EJRA 1FT9A 2DTYA 3H3UA 1WUVA 1DQ1A 2YU1A 1COV1 4W6WA 4EN7B 2UY8A 3N9QA 3WDYA 4AVBA 3THCA 3DXUA 1JYIA 4FAGA 5FYSA 3IT8A 5APAA 3P1IA 4JGYA 5FP3A 1ZRIA 5IT6A 4QX8A 3ZN5A 1S0DA 1ZZCA 4L8QA 4L9BA 4FFGA 5E16A 3QH6A 3MV01 5C4WA 1RUJ3 4LBNA 4O9EA 1FOD2 3LEGA 4LHSA 2YV8A 3WX5A 2BTVC 4P9LA 1O59A 4UWDA 3I59A 5FYBA 1BLZA 2Y0IA 4GWMA 5BNNA 1ULFA 1V6NA 5JSOA 4CEYC 5JWPA 1ZZ6A 3EQEA 2QVSB 4GIQA 2ZGRA 5FYZA 3WDTA 1C5IA 1MQTB 5A7WA 4Q8LA 3WNNA 4I09A 2R1BA 5FY1A 2XJRA 2F6BA 2ZX2A 3NKTA 4HN0A 2H0VA 4HMZA 4CDUA 1ASJ2 1PO13 1GZ9A 4QXCA 3BALA 5D1IA 3ACIA 4YW1A 1DZQA 5FZOA 2BFUL 1TE1B 1NY72 5GLVA 2BZDA 5HXMA 1CAUA 5F1RA 2FCUA 5A70A 1QJU3 2A6ZA 4OULA 4NHMA 3WP3A 4BYYA 4I3PA 5KHGA 1W9WA 2IFRA 5DAPA 2HWE3 4XF9A 3VBSC 2GH8A 1UYZA 2J1UA 1CD3G 2QDRA 5JIUA 5A3MA 1WGPA 1SLBA 3NMBA 4KG8A 2NN8A 4MH0E 4YVWA 4MHUA 5FYCA 3CQOA 5A3OA 3ZR6A 4D7TA 5EPAA 1L7RA 4YFWA 4LULA 3T0DA 5FLJA 1QXJA 2K2SA 4FP3A 1WLCA 2IFWA 1UMZA 3JQXA 2FDIA 3JD71 3OD4A 4PCRA 1OPMA 2BWAA 4K8FA 2ZGOA 4QB6A 4RFRB 3WNPA 4GKYA 3RRDA 2OYZA 3JB8A 3D8CA 4YVWC 3OYWA 3RGBA 4BQ4A 1U5ZA 1Y4WA 5G04L 2VOXA 1LGBA 4FP2A 3DEMA 4AVCA 3JBG2 3RQ0A 4XJ8A 2AC1A 1NX9A 3ACHA 4GZ9A 1NA1B 3ZN4A 5JOWA 1UAIA 1Q8PA 2B45X 1BXHA 4G3YC 1RUJ1 1PO11 2ADDA 1CAXA 1SLAA 4Q4W2 5CU1A 4KWKA 2BOJA 5GZEA 4AR2A 4D3WA 1HB4A 5IFPA 4JZRA 2QKDA 3CDZB 1PGW2 4PBPA 4XMAA 2X53S 1OSGA 3N3HA 3S0MA 1W2UA 4GD4A 4XBLA 1IPKA 1CJPA 1HRV3 1XJAA 1YI7A 4Y26A 3LSEA 3ZYHA 4RR3C 2W46A 2K46A 5T55A 1W6MA 1OI6A 4YVSC 2FD8A 4CDXC 3Q8AA 1TNRA 3HAGA 3TRSB 2BGPA 2VMIA 1AL23 2W87A 4E9KA 3QBQA 5HCBA 4ITCA 3HWJA 1O6UA 1PX3A 3I2FA 1WMXA 1QNYA 4GULA 3GBGA 4CEYB 3W21A 1UYXA 2J1AA 2B8MA 4LIVA 2XBO3 4A3XA 2P2KA 1X36A 1UN1A 5JSRA 5BNPA 2LROA 4UFKA 1UL9A 5CKNA 3I2KA 3MV11 1DU3D 4W6XA 2BV4A 4LBQD 4YLZA 4CDXA 2X05A 5L19A 3L9JT 1JYVA 4Q4X3 4Q4V3 4XQDA 3KS7A 3Q8CA 3LWCA 1UXZA 4NHLA 4PI2A 3N36A 5K0UA 4BIFA 5IAXA 4S2GA 4Q0SA 2A75A 2HWB2 1MS8A 1MS5A 1BEV3 5L9VA 3I3MA 3ZFGB 2JICA 4Q27A 5FYUA 5IW0A 5KC5A 2P34A 1AYM1 3B9IA 4QMAA 4DNYA 4AQ6A 4HG6B 5GLWA 3WCRA 1JUIA 2QZ2A 4UXAA 3TEZA 1WWYA 4XHBA 2GU9A 3ZDSA 3VBFB 4IV3B 5FUIA 1CGPA 3S57A 2XBO2 2WT1A 1W6PB 2VMEA 4ASMB 2Z69A 3PNAA 4DXZA 1ZX5A 1N3QA 5FMBA 3V0BA 1HRI3 5GLZA 2ZGKA 1JXNA 4TZDA 3ZFFC 4CUBA 5F37A 1OH4A 4YRDA 3AZYA 2G9FA 1F4HA 4XZUG 2DCJA 2PQSA 1V6LA 3HR9A 4C0HA 4CCMA 2ZZQA 3GF6A 3ZYIB 3LAGA 4KH9A 4AE2A 4IEPA 5AFBA 1RMU3 2JG8B 5HV0A 2VTXJ 1MPXA 3B94A 1GWMA 2OVUA 3DPRA 5HBAA 3D4KA 3TEXA 3JCIA 4B7EA 5BPXA 4BJ0A 1OQEA 3ZLIA 1QOOA 1SACA 1WA6X 1US3A 1O4TA 1H8VA 3NJYA 5DUVA 5EP9A 4DEQA 3BIEA 5F5QA 2XH6A 3JBG1 2VQTA 1XNBA 1CAXB 1OVPA 1MVQA 3KQ4B 3LE0A 3ILRA 3MF9A 4B4RA 3K77A 1PM7A 3ZSKA 5L7OB 3PTYA 4JGYC 1YNAA 1KD7A 2X09A 2BUKA 3KV5A 1XE7A 2VZOA 3FFZA 2NMOA 3APBA 4UBHA 2QQWA 4KGGA 3SMHA 4LA2A 4WVMA 2BNOA 2JDYA 5A1AA 2VQ0A 2R0FA 2QNKA 1JHJA 3MYXA 3BU0A 4OZXA 1F5JA 5JXGA 4PIXA 1R081 2UWCA 2XQRA 1JYXA 3WG1A 1UY0A 1VRH1 3MICA 5IYYA 4LE3A 1EUTA 5D8AA 2VBDA 1OLQA 4COWA 3AXEA 4H7MA 1IPSA 3PUIA 4IE5A 4XF3A 3UNPA 4LEJA 4FQZA 1PIV2 3HQXA 1RUI1 4LKEA 5H9RA 4GWNA 3WW2A 1REFA 4HKOA 3T2QA 4FTBA 2RS51 4IL7A 4A45A 3NV2A 5FYHA 3B3QE 4NIAA 4F7ZA 5LRRA 1KQRA 2NQYA 3VZOA 4QGLA 4XXPA 4CDWB 4X8PA 1HB1A 1S0FA 1C8M1 2VW0A 4XXAA 1V70A 5FPVA 2W47A 5D8AC 2BPA2 3S5QA 2RS13 1US2A 2AYHA 2ZMLA 1JZ4A 5FZGA 4XE9A 3NKGA 1EPZA 1LAJA 2ZGTA 4XPVA 3SISA 4HOOA 2XWBB 4XTMA 5CZKA 3RZLA 2C5DA 2VM9A 2WS91 2YROA 3HBKA 2XBO1 2ZKNA 2BRTA 2W0XA 4V2VA 4YYOA 5A3WA 4Y4RA 3RSJA 3HT2A 1RIRA 1OD5A 1VJ2A 1SCSA 1RUF3 1LOEA 1SLTA 2RR13 4UI9L 4AG4A 3MF6A 5FMDA 3K4ZA 2R041 2B9VA 4CEWA 2BNNA 3J7MA 2GNDA 5C9AB 1W6PA 2LRPA 2R063 2A73B 2YXSA 4OHYA 3FHIB 3U4SA 5FZ6A 2VECA 4IE6A 2IUWA 3KV6A 4QQ2A 2HEWF 2J7MA 1GANA 4OI2A 1IS5A 1DGLA 1V6IA 3ZMOA 4I2OA 2GALA 1QJY1 1OBNA 2VOVA 4R9AA 3H50A 2W1UA 3C7OA 1CPMA 3M4FA 4KQ7A 1LULA 2ZX0A 3NW4A 2XR4A 4HT1T 4MZUA 1V0AA 1ULEA 3WDUA 2HYKA 3AKQA 1UZYA 4RHV1 1RUG1 1UU5A 1BZWA 2DTWA 2DUQA 2RDSA 3OJBA 4YFZA 5FYMA 1ZZ8A 1IS6A 2WR9A 2AH2A 1CIWA 3OGJA 1W06A 2ZHKA 2EIEA 1OUSA 4JGYB 1MS1A 2YMZA 3E97A 4RR3A 4CDUB 2JECA 3VBFA 2ZKLA 1KDMA 4FOYA 3M3CA 1RUE1 5FZOB 1WCSA 4AGGA 4OVEA 1CZSA 1PNFA 2Q4SA 3V0AA 5J37A 5C3PA 2D5HA 2FCVA 1XSQA 1DP0A 3KHCA 2VMDA 1S2EA 1OA3A 1WMEA 3M3EA 1W8ZA 4Z92B 2RS11 1APNA 2Y0OA 1XYOA 4NOTA 4U2AA 1BBT1 3KT4A 3D3AA 2UWBA 3MIDA 3D0SA 4AI2A 1GNZA 3LPGA 5F3GA 1LHNA 2JB8A 4COZA 1W05A 2VTXA 3H1WA 3V65A 2B5HA 3MFCA 1S55A 3MPBA 1O3QA 4MXVA 3LA3A 2HWE1 4QGNA 1ZBA3 2WT0A 5K0UC 1O8PA 3VBUC 5LY2A 2EA7A 2NMNA 1SBEA 1ULOA 3K46A 1WMDA 2CGPA 1QJY2 1UYYA 1YFYA 1AR71 4XABA 3WV6A 5BNPC 2YHJA 2ZX3A 3MZHA 1AR73 4P00B 3ATGA 1W90A 1X9PA 1NXD1 2V72A 1JBCA 4XJ9A 2LS6A 1GNHA 3TN93 2ARXA 1HIXA 4LO7A 4NO4A 2A3WA 1GU3A 2PXJA 2BGOA 3PU3A 1AHSA 2ZGSA 4QT6A 3IDBB 4OCTA 1EAH1 1OD3A 4CCEA 5JSPA 2FQPA 1CZVA 3ZIXA 2GP5A 4NPMA 5C8WA 3KT7A 4AQ2A 1PX4A 4UFLA 1ZBE2 2QBXA 5JI7A 5LW9A 1RINA 2NLRA 2PLV2 3PDQA 5A7QA 1R092 1SBFA 2GMPA 3THTA 3IDCB 5FZ9A 1K12A 1OC1A 2JDHA 2P4EA 2VULA 1I5PA 2PAKA 4ZS2A 4R4XA 1WLWA 4YG6A 5J7MA 3O0XA 2AEZA 2R072 2D43A 4E27A 1GBGA 1R64A 4XIKA 3ZN6A 1S0GA 1FX5A 1O4YA 4XACA 4YG3A 3MO4A 1HLCA 3GYDA 1WA4A 1FAYA 5IJRA 3LEKA 4AFCA 2R1DA 5FPXA 1W9YA 3FLPA 4RYDA 5CEHA 2ES3A 2TUNA 2JE9A 1HXS2 2RS12 3N7LA 3A22A 4LJHA 4LR4A 5T50A 3SITA 2HWB1 1K5JA 5A7NA 4ZONA 5KBFA 3PLQA 2ZGMA 2Z2SB 3KB5A 1LB2A 2JE8A 2IXLA 1JZ8A 1ASJ1 4HK9A 2PHLA 3VUOA 3JB4C 4CP1A 3WHUA 1X9TA 3L2YA 1AYM3 1TEIA 1ZVFA 1LNSA 5EWSA 2HYXA 1VAKA 2WNUB 3NJZA 3T0AA 4PQQA 1SLLA 5KHJA 1REDA 3HNMA 1LEDA 1OQ1A 4LLFA 2R0HA 2WSUA 3N7JA 3DYMA 3QLQA 1AX1A 1J3PA 5FZIA 3ENRA 1DLLA 1UOJA 2DU1A 2E51A 1IG0A 3CO2A 5FFOC 2YYOA 1S0BA 1ODMA 4OMDA 1OKQA 3J7NA 3VDCA 5BNOC 5F3IA 3VD5A 2DVGA 1H1MA 3B7MA 3ZFGA 2RM22 3AP5A 1LHUA 1VBA2 4XF0A 3ZYRA 2JIGA 4BA6A 2WZEA 5J96B 4UW4A 3HN3A 5T52A 1ASJ3 3HT1A 2ZJCA 3N9PA 4EWDA 2G19A 3VDAA 2HBUA 4UFHA 1GYKA 4YZ2A 2VMHA 1O91A 2HEYF 2QQKA 1D0GA 4AZZA 4HZFA 1R083 4AI3A 2OT7A 2ADEA 3FWEA 1C8M3 5FY7A 5FOBB 3ME2A 1PO12 2QQOA 4XFIA 5HCHA 4L0PA 2WO3A 1KGYA 1IOAA 2CAUA 2E7TA 5A7SA 1U5XA 4Y5TA 3KF3A 4Q0VA 4ET7A 3ETQA 2DBNA 1ZRFA 3DN7A 1CESA 4I0WB 4ZZ5A 4P9JA 5EFUA 1YQ5A 2VW2A 1AYN2 3KV4A 3IWZA 3R4SA 4AVAA 4MV2A 1WW7A 5JMCA 5FV3A 4JHTA 3A0NA 3IN9A 5A3UA 4I3GA 1FMD3 2HWB3 5KHKA 4YZ1A 2XHKA 1IS4A 3M8LA 3B9CA 3JQWA 3VKNA 3WNOA 2NM1A 2LUWA 4XAEA 5FZEA 4AQSA 1GWLA 1VRBA 4DZGA 2G4IA 3D82A 5AC92 3O1SA 4PDWC 2Y60A 2QQVA 2BDRA 4KGQA 1LGCA 1HKDA 3EBRA 4XJUA 1XU1A 1JOPA 1ZBA2 1VBB2 4FBFA 4N43B 3KD4A 5JOXA 2FDJA 5CISA 1XE0A 2C26A 2DUPA 2YBPA 4A3ZA 5L9RA 1G9FA 3RMXA 1GOGA 2ZABA 4QB2A 1LODA 3BGAA 3LA2A 1RUOA 4BH9A 4QQOA 2XJTA 4FTEA 2OA2A 2W1SA 3ZXEA 3JUUA 4IE7A 4DQAA 2GC3A 2VMCA 2E7QA 1RMU1 3MI8A 4I0BA 1W2OA 2UYBA 3WOGA 3VDDA 1G8WA 1ZBA1 2R16A 1IZ3A 1V9U1 3BOPA 3MLJA 3POBA 2QE3A 3OF1A 3WP5A 1GQHA 1ZZ9A 1VP6A 4ORFA 1R1A1 4V2WA 3FLRA 2PHWA 5FWEA 3IIIA 1PZ8A 4Y22A 2AGSA 5FO9B 2RS31 4GXLA 1JYNA 1NA1A 1C1LA 3PL0A 1GOHA 3PVNA 1BBT3 4LK7A 4LO8A 5JVVA 2W2IA 1WCDJ 2PELA 4N9HA 4MGYE 2ZX4A 2VOTA 1WBLA 2PHFA 2XHNA 1RGSA 2SLIA 1GOFA 3WCSA 5C8CB 2OIIA 3PUHA 4HBNA 2PN5A 4ZS3A 1OUXA 1UZ0A 3O14A 3I49A 3H7YA 5DQ0A 4W50A 1BEV2 3A23A 3DYPA 1BEV1 3ON7A 2BOIA 4Q0PA 3ZXGA 2D6MA 2DYCA 2ZOEB 5JPNB 3KT1A 1F35A 2QJVA 4XW3A 4R9BA 2ATFA 2YGMA 4NMIA 2X29A 3UL2A 5FY8A 5I0DA 5A6YA 5CVRA 4N8MA 3ZYFA 3AMNA 2JE7A 1H6XA 2W68A 3ZOIA 4AQTA 2QQJA 2OX0A 5F32A 5LRSA 2DCKA 4RA0A 2EIGA 4N90A 2R042 1RUE3 4K3UA 1RJ8A 4QX7A 1HRV1 4BQYA 3T2TA 4AFMA 4ATEA 3R4UA 1N3PA 2BU9A 3FJSA 3NV3A 2ARBA 2ZGQA 4CDXB 4NHKA 1W8UA 4NAMA 3AMHA 1Y3TA 5EJ3A 3JXSA 1JOBA 1RVF1 1AL0G 2JG9B 2PQQA 4FPGA 4M4RA 3NAPB 3VD3A 3RNSA 4CPBA 1RB8G 3RZMA 4RHV3 2FCTA 4JGZC 2F4PA 3I4IA 5CB7A 1UYPA 1X8MA 3N9LA 5LBBA 1VBC2 2RR11 3HN1A 4I01A 5L73A 4MG2A 1UOGA 3OSDA 4NRQA 5FZ8A 3WNMA 3WDXA 1YFWA 3B00A 3P5BA 1IS3A 1H2NA 1BMV1 3I3QA 1O5LA 3RJ2X 4COUA 2PHTA 5LBFA 4CP2A 2HWF3 3DXTA 4ZY9A 3VB9A 1DQ6A 3IDAA 2X5IA 4P14A 3WG2A 3ABZA 2DURA 4JKLA 4K7JA 2R061 3U75A 4TTGA 3KV9A 4EN8B 1PIV1 1MACA 2AZ5A 2R043 2HWC3 4IV3A 4XFBA 4AEJA 3WZ1A 4BDVB 1V6OA 3OGGA 1DQ4A 1GLHA 5I0UA 5BUVA 1XPWA 1S4CA 4TWTA 4AW7A 5F9TA 4QU2A 2ZA9A 3M7AA 1K5MB 2VJXA 5DPNA 5FP4A 1TME3 3G6JB 3NNGA 4XQ4A 2YC2A 4HPKB 5IVFA 1YFXA 3GCXA 3NRUA 3Q8FA 2HWD1 1CZTA 2VZ1A 3D0JA 4S2DA 3O1MA 5KC6A 4IDZA 3GZUC 3GZTB 3HBZA 1VIWB 2QQLA 3JD73 4IEWA 4PJYA 4Y1ZA 3WSOA 4AVVA 3NWKA 2R7EB 2YFZA 3OGVA 4LTAA 5AVAA 3RDIA 3KWVA 2O0OA 5BNOA 2OPWA 4NRMA 1NQDA 5KXBA 3V0AB 4Y22B 4LUMA 1ENQA 4CDQC 1A78A 2XLGA 1FV3A 1S2BA 1YI9A 4LNVA 4A6SA 1Q8OA 4D7SA 4CZSA 1QOTA 3TEWA 2E9QA 3FUOA 1ZNPA 2HWC2 1POV0 2V5YA 2D97A 3LIGA 4Y3OA 1LJ7A 3KGZA 2EIDA 4YGEA 4UOJA 2IZWA 1SDWA 4D69A 4BMEA 1DGWA 1C57A 4I0AA 1XYNA 3I7DA 2ARAA 3S6PA 5CA6A 3LA7A 4Q4Y3 5F3CA 4WBBA 5CADA 4YW2A 1W03A 4Q4Y1 1WKYA 3NNMA 5FY5A 1UXXX 2G1MA 2RM21 2VZQA 3OBTA 1IHMA 1IQAA 4QHOA 3MEPA 3I2IA 2A5ZA 5CG9A 5FZ1A 3O1TA 4CP9B 1XYPA 1AXZA 5C3RA 3ZMNA 1I9RA 1JYTA 1COV3 1FXZA 3B93A 3UJOA 3PTRB 2XLFA 1RUF2 2Y34A 4CCNA 2VVFA 4P9YA 2HBTA 2XKOA 4YGDA 3UGGA 2GC1A 4Z2AA 1NCQA 1BYHA 1LOFC 1Q56A 3CJIB 1S2KA 5H9PA 1K5MC 1V6JA 5FZ7A 2CSGA 4IEOA 1VBC1 1PVC1 2RR12 5DUWA 2Q8CA 3ZN6B 4V1PA 3I2OA 2ET7A 3B69A 5JLVA 3MIBA 4QWNA 4IGOA 1WD4A 1BBT2 4QPWA 2D7FA 2WUHA 3BIWE 3T1MA 5GZCA 1HRI2 3ZM8A 1I1EA 3O1RA 4RN5A 4KG0A 3VBUA 2EVXA 3IIAA 4MGKE 3SH4A 1S1AA 1FOD1 1DGWX 1H9PA 1WLTA 3C3VA 3VBRB 1QQP3 5B2GB 4WV8A 4UFIA 3C7HA 3I2JA 2RV9A 2IVIB 4GMP1 5FWJA 4LLOA 5EQUA 3S5AA 4IE0A 3SQOA 3CJXA 3C7EA 3W58A 2VXJA 2ZEYA 1W2AX 3IPVA 3H7JA 4WM8C 1RYYA 3EYPA 4LBOA 2H0BA 2P6HA 3A7QA 4OI4A 5FYTA 1XXNA 4QHZA 4CSWA 2JG9C 2BBVA 2X5IB 1A8DA 2VCBA 1ZM1A 4P9XA 1UZVA 1O3TA 4Z8BA 1K3IA 3R4DB 3E5QA 1NE4A 1RUD1 2OZJA 3CMGA 4LKFA 5F3EA 2WNEA 2VVEA 4CP0A 2WNVB 1NLRA 2OQ7A 3S7EA 4LKDA 1W0PA 4FOVA 2J1TA 5ABJB 3KLSA 3VLBB 2G9ZA 4LBKA 2JG9A 2ZCWA 1UZZA 4PLMA 2VGDA 1GWKA 4AEMA 2VUJA 3S7IA 2WZR3 1JW6A 2ZS6B 3FUQA 4NIIA 3WF1A 4CU7A 3ACGA 3SEEA 4CCJA 3NVCA 1ULGA 3VDDC 4W6YA 4F3JA 1U5YA 1VBC3 2HWF2 2WQ8A 2OS2A 1BCXA 1HQWA 1PZ9A 4DXTA 4EN9B 5BNOB 1JTZX 5KHIA 2VNRA 4XDPA 1YWKA 5FZFA 5FAXA 1HJGA 2ZGLA 2WBKA 1KDKA 3NV4A 4E4SA 1NYWA 2C6SA 3HIFA 4QX5A 3T0BA 3WD5A 4MVTA 4LXLA 4XBNA 4AOCA 1SLCA 4NVPA 4XJWA 4BB3A 1BVVA 2VMGA 4YM1A 5IWFA 3OD0A 5LZ6A 4AHWA 1GNYA 1GZWB 2DU0A 2VCMA 1JU4A 1S0EA 4N7IA 3TNQA 2ZHNA 3H8XA 2EICA 1KRIA 5A6XA 3AFGA 3U37A 5FXZA 3ZYJB 5FY9A 2A7AA 1N1VA 4Q26A 1YHFA 5JI9A 1O5UA 1TG7A 2P1BA 3R6SA 1L3JA 2ENRA 2XGXA 2Y6LA 5E6HA 4F8AA 1PGL1 3ST7A 4YW3A 3IKWA 2DCYA 2Y6KA 1JOJA 4ZU4A 4CCLA 1KS4A 4BQ1A 3C7FA 1RJ7A 4N9IA 2WN3A 1JU3A 3O7OA 5KR7A 3DKWA 4QXHA 5CIRA 5E89A 2BWCA 3AP4A 2W9XA 4NE9A 1FNZA 4M4PA 4LHKA 3HMYA 5A1LA 1NT0A 2AR6A 3D6EA 4L97A 4JKMA 4BLIA 2YG0A 4IEQA 1YO8A 3VBOA 1OOPA 2QTWB 2R062 1GP4A 5EXOA 5AC91 3W20A 3BU7A 2OPKA 4GWJA 5HCAA 4UF0B 4N7UA 3UJQA 3ZXKA 3WVJA 3THPA 1SHWB 1JODA 4YW6A 3ZO0B 4D6QA 1RHI3 1LKNA 2VNVA 4JGZA 3J9SA 1QJEA 5B4XA 2HLEA 1GP6A 2NYYA 1W2TA 4MADA 4AEDC 1QU0A 4YM2A 2GZWA 4BK4A 1MEC1 1QJX1 2ETEA 3LGRA 3VV1A 2Q1FA 5LCWL 5TSWA 4XVHA 5JXJA 1AL22 4JCKA 4LO4B 3J8F3 4PI0A 1A8MA 4N43A 1MS3A 1UCXA 4LA3A 1GQGA 2D6OX 1A6CA 2HWF1 3JU9A 3FZ3A 4FFFA 4JKKA 4COVA 3Q9OA 1OMIA 1FATA 1QJY3 5LATA 3PUSA 3DUIA 1ALYA 1LOCA 2QQMA 5C5UA 2RHPA 1DQ0A 3SHRA 4ES8A 2FDFA 3B5LB 3RI8A 1NKGA 1B35C 2LTNA 3FHQA 5JMOA 4ISQA 1CAWB 5F2WA 2DFBA 4AL9A 4RQPA 2R6QA 3ZX7A 1FMD1 1H4GA 2VC9A 3POYA 1KEXA 1PK6B 1Z7S2 1VPHA 3DYOA 3QOPA 4NR1A 5EYXA 5JR2A 3GBWA 3GM8A 2PAEA 5D2AA 4EN6B 3R0RA 4LUKA 3WR0A 1LOGA 3VKMA 1HQLA 2B46X 3KCXA 3AKTA 4UW3A 1W9FA 1HV0A 2JDUA 3NNJA 5J3UA 1STMA 4AFBA 1VBA3 2C0ZA 3J8F2 4HFSA 1RUG2 3AYEA 4P08A 4YW4A 2WSVA 2Q5TA 3GBFA 1W8WA 3PURA 2XVKA 1RVF2 4MGIE 4X6QB 1HX6A 3WP6A 2DWRA 1RUH2 4Y1XA 2B9UA 4DPNA 4XJZA 4RSUA 3BTAA 1XQNA 1LENA 5K4LA 4Y24A 4XUPA 3RVHA 4CDWC 5J98B 5GALA 1HB3A 1O7FA 4XFCA 4MSVA 4CDUC 2IXCA 4XUTA 3SCHA 3TAYA 3AMMA 2XDVA 2XL9A 1KS5A 3W9AA 4Q4Y2 5DMYA 3TB0A 1T6GC 4AHZA 3K75B 3U11A 3BUCA 4M3CA 4QAWA 1RMU2 2FHRA 4IV1B 1YCIA 1LEMA 3EJKA 1ZZBA 4MXWB 1JYCA 3BTZA 2ARCA 3N9OA 1J3RA 1C28A 1PMJX 3WG4A 2W52A 5T5JA 3WG3A 4D8MA 3AYAA 3DGTA 3DPRC 3PIGA 1C8NA 5FPUA 5KXCA 2ZPXA 3H3LA 2OQ6A 3I3EA 3PMSA 2WQZC 3ZSEA 1BJQA 1H8TC 4FFHA 5C4WB 4QPIB 1IKQA 1V9U3 2FZ1A 4U36A 5FLHA 2J1VA 1AR93 4A2UA 3U0ZA 4R4ZA 1EV12 4L11A 2P3KA 4FPHA 3GDBA 3BOWA 5FZAA 2D98A 2W92A 2JWPA 1DDLA 1VB2A 2ZHLA 4DUXA 1NOVA 2RS52 1AR81 1SFNA 1GQPA 5HXVA 4QDRA 2VQUA 2YDEA 4YNIA 4BQ5A 4BQ2A 5IVEA 4H14A 2ZEZA 4XOGA 2E31A 4FTSA 3ELNA 3UKVA 2DUOA 5CNAA 1P8JA 4WVMB 3ZR5A 4C1XA 1UKGA 4OZOA 2VZUA 4Z2WA 3NNLA 3WLUA 1R1A2 2ZACA 3ITQA 4INDA 3MW4A 1RUC2 3H0OA 4ZXKA 1J1TA 2EIBA 1QH6A 3M1HA 4E4ZA 2I45A 3LPFA 2VBBA 1UWWA 1Z78A 1ND3A 4UAPA 3ZYPA 4W65A 5D8AB 5A3NA 4B29A 3KM5A 5FPBA 1KXGA 3ROUA 1Z0HA 3ZYBA 2XQXA 2JDKA 4DUVA 5T5PA 2JDAA 1UKRA 3WINE 2WNUC 1YQ6A 3LCPA 3ACFA 3BVCA 4A44A 2JEMA 1TMF2 2I07B 2DFCA 2EAAA 4GKXA 5A80A 1AXKA 1AR83 2B4KA 2VZ3A 3R05A 4KL1A 4AGRA 2Q1MA 3AFKA 4OYUA 1OLMA 1UO9A 5E1RA 4UBGA 3THDA 4NROA 2D40A 4RQPB 2VUAA 3K51A 1QEXA 3OPWA 1PO21 4TLGA 4AAXA 1H9WA 5JDBA 3CEWA 4KBBA 1QDOA 2CYFA 4UT5A 3MIHA 3UK9A 1F8VA 5F6KA 3LDBA 5LEKA 5T54A 3PVOA 2VCAA 4FPLA 5J36A 3U4XA 4O9GA 3ZFGC 1DGRA 3ZXFA 4AEDB 4CUCA 4OMCA 1NCQB 3BTYA 2YFUA 3CJIA 1POV1 1SDDB 2P6CA 3IPVB 5C3SA 5CBLA 2WDBA 3G7DA 3H9AA 1S0JA 4CEWB 3ALQA 3OUHA 3AB0A 3DV8A 4LORA 1UY4A 4XF4A 3VHPA 5C70A 5DUXA 3ORJA 1Q43A 5DAXA 4NWWA 2E7AA 3OTFA 1H6YA 2JKBA 4GJZA 4JVAA 3VHNA 3WW3A 4GAZA 3NQHA 2ZAAA 4AK3A 2ERFA 1GSLA 5C3QA 5FDBA 2UWAA 1GFF2 1TME1 4UFJA 3CJIC 5CFCB 2JG8C 2AACA 4UW6A 1NCRB 4FT8A 5DABA 5FIXA 1W6QB 4Q1RA 1OVSA 4XZPA 4FOWA 2CY6A 3TEYA 2W94A 1M06G 4CU6A 2GC0A 4FQ4A 4DINB 2JKXA 4Q0QA 3OBZA 2YC4A 2YB7A 1RUG3 4HETA 4ZPIA 3CIHA 1HJFA 1VBA1 4XIOA 5T5LA 5CFDB 2YGLA 5FZ3A 4RR3B 1UD1A 1QJU2 1XE8A 2ET1A 4IEXA 4FPKA 4IEVA 4QM9A 4Y1VA 3WDVA 3NL1A 2EXJA 3Q8EA 4AVTA 4WVVA 4QPIA 3VBFC 3LF7A 3VBHC 1CPNA 1D4VB 4XMIA 5EV7A 1QHDA 2DDUA 4BXFA 1GR3A 4NN0A 5CG8A 1J1LA 3O12A 4NPLA 1AL21 4KU7A 4E8DA 2CL2A 4Q0UA 3RYKA 5C9AC 1H4HA 2CWSA 5K0UB 5C7GA 2RDNA 3AYCA 2DCZA 2I2SA 5LB6A 2I74A 2PAMA 2WNOA 3IAPA 1ZA4A 2ZMKA 1AX2A 1UPIA 2YBSA 4TLFA 1TNFA 4M3CB 5DZFA 2QQNA 3NAPA 4IV1A 3C7GA 4SLIA 1EAH2 3RJRA 3JD72 3LFMA 3AMQA 2X10A 2E32A 1RXGA 3ZXLA 1E5RA 2DF7A 3A4UA 3AZWA 2Q8OA 4R9DA 5GZGA 4H55A 1WW5A 4GH4A 2WFPA 1JZ7A 4ASKA 4LMFA 4E2GA 3WQ7A 4EV0A 1F9KA 1G6NA 5DN2A 3TYJA 4CXXA 5FKBA 4Y1YA 1G9BA 3KVAA 4OFGA 2ZAHA 4URTA 3H3ZA 5FUPA 4YZ5A 4OHXA 5IFTA 4Y20B 3VKFC 3V0BB 4XFAA 4RS5B 3AVSA 2WS93 3B01A 1V00A 2ZBJA 1PVXA 3GALA 4M3CE 3AX4A 2ZGPA 1DHKB 4IW3A 4MX3A 4NHXA 3VL9A 3QD6A 4J6GA 1VR3A 3KF5A 5DG2A 1DZTA 2G9GA 3BKZA 4LT5A 4DXRA 2GAUA 2LM3A 3J8F1 1JHNA 3I97A 4QX3A 3OPZA 2B42B 3VD9A 1ODNA 2J1EA 4LOSA 5F39A 5FZ0A 4CU9A 3DPRB 5IAVA 1D4M3 2VCCA 1HV1A 1MS0A 1I3HA 3LSDA 4QKFA 2W95A 3ILFA 1W3XA 5A7OA 3WW1A 1VALA 3WNLA 1KJLA 3O0VA 1IPJA 1BQPA 2WYSA 4MUVA 3RZZA 1WMFA 3T4VA 4GH4C 4QDQA 1ZZ7A 2D3RA 4WZCA 2XWJB 2GSYA 5ANNA 2OKXA 3U07A 1W99A 2XJUA 2R32A 5DUUA 3OEAA 4AXOA 4MGTA 4IEUA 3HVDA 5L7OC 1ZRRA 2TBVA 4R9CA 2OUHA 4YGCA 4AI8A 3CLPA 2XJPA 3E5XA 3PIJA 1OKOA 3GJBA 2DVDA 3URFA 1RUE2 4BM8A 3I8TA 1O3SA 4ES9A 5CFCC 1VMJA 1FYUA 4QKBA 1QKQA 4K20A 2BJSA 2WQ4A 3U10A 2A6YA 2ZZJA 4WVZA 1H8TA 1LHOA 5J48A 1YQ2A 3FX3A 4M0HA 5LA0A 4CU8A 2A6WA 4YVWB 1CAWA 4RHV2 4CEWC 3LIHA 1WCQA 1F2NA 5KHHA 2RJ2A 2WAAA 4R8HA 3WDWA 5DXDA 3LEMA 3K48A 2WABA 1DZRA 4QX2A 4PDWB 3IB3A 1YIPA 3VZKA 3K3OA 3E5UA 1C8M2 4XEZA 5FTTC 3VBOB 5FBZA 3GGLA 5BNNC 4OUSA 1EY2A 2Y6HA 5K8SA 4DXSA 1N1SA 2PMWB 4TYSA 5K9YA 2J1RA 2WZR1 4K21A 5FKCA 4ASLA 1PO22 3AJZA 3ZFFB 1W8NA 1B35A 3AXDA 2C4XA 3EB7A 3HNYM 4GQ7A 1OQDA 4IQPA 2IXJA 3T2PA 3UV9A 1ZYBA 2YY1A 1C3HA 4E2QA 3SKVA 4CUAA 3MDPA 4HLTA 4ONUA 2WZR2 4TSVA 5JR7B 3LDKA 4H7LA 3TN92 3VZNA 4CDQB 4XBQA 1W6QA 4YWAA 3ES1A 3VBOC 2WIIB 1RXFA 5DG1A 4BMBA 2XJVA 2JX9A 4QDSA 2Y6GA 5F8PA 3LD8A 4IEYA 4MO3M 3VL8A 1ND2A 1DYPA 4P9WA 2RVAA 2Y6JA 5JUVA 1TMF1 1PVC2 2MEV2 4LPLA 4MGSA 1RUF1 2CU5A 4XETA 4CTEA 5JIAA 2XPJA 1Q8SA 5B4NA 3TOJA 3ZDVA 1AR91 1ONAA 1R1ZA 1WCKA 3M3QA 4AHYA 1OLME 1LR5A 1RUD3 1BK0A 3PVBB 3O1OA 2WA4A 3M2MA 1AUYA 1OURA 2BQPA 4YM0A 1TMF3 3AK0A 2XOMA 3VHOA 4LOTA 4MYEA 3L2HA 3RZKA 4B1LA 4GMP0 1RUNA 3E6BA 4OQ8A 3H42B 1H2LA 4NUBA 3ZXAC 2WA3A 4A7YA 1T2XA 4Q4W1 1NZIA 1AYN3 3POWA 4C0BA 3K3NA 4MXWA 4DRRA 1YC61 1QOSA 5FP7A 2XUEA 2IVJA 4Z1VA 3WF3A 2XG3A 4GH4B 5C71A 4TN7A 3OPTA 2FZ2A 4KNCA 4JQRA 4LITA 4YVSB 2WWSA 5F6LB 2D5FA 2WLQA 4Q5OA 1UZWA 2GP3A 5FZDA 5A6QA 1XNCA 1A3KA 3PJQA 4AI1A 1MZEA 4ATFA 4AI9A 1OF4A 2YUEA 3EMRA 4LKSA 4BQ3A 4KU8A 3PVEA 4BHPA 4AF9A 3NAPC 4TXWA 4HXCA 3RZGA 4B1MA 1VBB3 1D0HA 4PBOA 4D6SA 2HWE2 1NXMA 1N1TA 1JZ2A 4JC1A 3IMNA 4N53C 2ZEWA 4QGMA 2BNMA 2KXLA 4HVRA 4K9SA 1BHGA 2VL4A 1OT5A 1UNBA 3UGFA 1RUI2 3RMYA 3MHZA 1J59A 1OH3A 2IC1A 3Q8BA 4EYUA 2ILMA 1OXCA 2HWD2 2UY9A 5JCTA 4FCAA 2F4LA 3POSA 4C8DA 1VRH2 2RM23 1IKPA 4PIYA 2ZXQA 5CKMA 5AFEA 4CCCA 1G86A 1ND3C 1ND3B 1XNKA 2VNGA 3ILNA 4J1XA 1KFUL 1LU2A 4JDOA 2RMU2 5FZBA 3MUY1 3A21A 4NHYA 2BFUS 2H6CA 1GP5A 2P3IA 3HD8B 3ZFEC 2J1SA 1LTEA 1QMJA 4FPCA 4EE2A 1EPWA 4SBVA 2Y38A 1BMV2 3E1F1 2QFEA 3FBMA 1J84A 1OF3A 3LB9A 3X29B 3TWIA 4DOUA 3B02A 2V5DA 4Q2FA 4OHZA 4D6RA 5IVBA 3WF4A 4BWOA 1EV13 2K0GA 4M01A 1ENSA 5GJ6A 1B35B 4IEZA 1QGLA 1X33A 3HQRA 4Y5SA 2CWMA 3VGIA 3NJXA 1H8TB 4N53A 2O8OA 1SQ4A 3VN4A 3LEIA 4XUNA 2OW4A 4CXWA 4FFIA 2WKKA 2WWJA 5A32B 4JQTA 5A3LA 2HKXA 2WLPA 2WRAA 1Z7S3 1RUH1 3AVRA 3NO8A 2GNBA 1ZA7A 3KZ4C 3OEBA 4DMIA 2QUOA 2V09A 4FO9A 5FYVA 3MIFA 4XF1A 2BVVA 4KWLA 3PU8A 3T30A 1COV2 2RDRA 2XMLA 4NJ4A 1PGW1 3FL7A 2JIJA 1OFSA 2DCTA 1LU1A 4IERA 1ZRDA 3PHMA 3O1PA 3AKRA 3KMHA 4KWUA 1A34A 4CUGA 3RWNA 2ZMNA 4QXBA 1I5ZA 1S0CA 2QQIA 1RVF3 4AVSA 4AI0A 3T3YA 3TNPB 5HI0A 1H0BA 1NCRA 4BQWA 3UYJA 1HDKA 3T4HB 4XAAA 2B39A 3EHKA 1JI6A 2D3SA 3N35A 1DIWA 3DKQA 5E88A 1LRHA 3DECA 4EQVA 1SBDA 3O1VA 2FDHA 3W5MA 2SBAA 4IGQA 1X8EA 2V4VA 3CKHA 5FP8A 5KWRA 5AVPA 3IBMA 1XNDA 3HEIA 4PIZA 1FNYA 1HXS1 2RS32 3CBNA 2EXKA 2J42A 2PHUA 2E53A 2XJQA 3C8XA 1SFPA 1AJKA 2CV6A 4HANA 4ARXA 2JXAA 3SH3A 1GV9A 4G9SB 1AR72 5EHDA 3KSCA 1MZ5A 5CFCA 4JX0A 5FMOL 3ASIA 4CXYA 1SCRA 1PGL2 3ZKYA 4IUGA 2WWUA 1AR61 2GNMA 2RE9A 4PT6A 4HPKA 4Y1UA 5T5OA 3SLIA 4JTOA 4A41A 1AR62 1G9DA 4O65A 2GN3A 3OB8A 1RC6A 2VW1A 5HV4A 1ZREA 1UIKA 5A33B 4D7YA 2WZPP 2DV9A 2GDFA 3WQ1A 1AVBA 1K45A 1R1A3 2D6LX 1G9AA 3ZSMA 3WQ0A 4DY3A 5D21A 1R082 5JOYA 2BW8A 4QU1A 4Y20A 2D93A 4MHRA 4RS5A 5IHRA 1RTVA 1Q3EA 2XUMA 4Y5Z0 3RS6A 5BY5A 4LO6B 1FPN1 3J4UH 3A0KA 3CF6E 1RUJ2 1JN2P 2JJ6A 2QZ3A 4IGPA 1QQP2 5FXXA 4ZU7A 5C5TA 4XUOA 1VBD3 1UMIA 2BYVE 1WZXA 5FMCA 4QQLA 2WJSA 1QJFA 4Z07A 4GMP3 2YZ4A 2X5IC 2Z5WA 4FXGB 5FK7A 1KJRA 3VZLA 5GZFA 3D5OA 4H2AA 1ND2C 4GJYA 4JV4A 4R52A 5DZEA 4CP9A 4RGAA 4CA9A 1GUIA 1FI2A 4JAAA 3RG0A 4M00A 1QJU1 2C24A 3FBYA 4QD2A 5I8TA 2O8QA 2P37A 4YGBA 4GWIA 1L7QA 4ZHNA 5LASA 3IDEA 2VOKA 2AUYA 3OBRA 4QKDA 4OUEA 2WT2A 3WF0A 4YG0A 3OG2A 4KMQA 1W6NA 4XFHA 1ENRA 1OA2A 3POJA 3RYRA 1DF0A 3OUIA 2NZ9A 1CAVB 1F5FA 1HQNA 3O1UA 5IVVA 2WZ8A 1XC6A 4B8EA 2VOWA 3GCWA 3P6BA 1SFYA 1NA1C 2Q0AA 2VZPA 3POGA 3AC0A 3WQBA 4A4AA 5JXIA 1GMMA 5FBJA 2VTFA 2E33A 1CN1A 3POIA 2UYAA 3M3OA 4FAHA 5FZMA 4C1WA 3AKPA 3VDDB 4XILA 1RITA 1TZOA 4LK6A 4QM8A 4CDQA 2PHDA 5IK7A 3INAA 3CZUA 3TBDA 4QKNA 3N7MA 4XUQA 4Y4YA 2CDPA 1DQ2A 2GMMA 5FPLA 3U14A 1MS9A 2O14A 1KITA 1DLCA 1QJZA 2R071 3BCWA 4LBQA 2D6NA 1WW4A 3JZVA 5F5CA 4IE4A 3WNKA 4C91A 1PM4A 4OQ9A 4WVWA 4EZ4A 3HJRA 1JZ6A 2BVBA 2PLV1 4CCOA 5C4WC 4RFT0 3VBSB 4P5YA 2GMEA 1VE0A 1EUUA 2RMU1 5HCFA 5ACA3 1VBB1 2CTVA 3ZFEA 5ABJA 4FPEA 4JTNA 4BISA 1CX1A 3S30A 5JZGB 3ZPYA 2QDNA 4Z82A 1HRI1 1N3OA 2XVGA 3MW2A 5C3OA 1W8OA 1AJOA 2Y33A 4I30A 4GALA 1OA4A 5I8SA 2GNTA 2CDOA 1LGNA 1ND2B 4DO0A 4BXSV 1PHMA 4BCUA 1JMUB 3ZYGA 4NRPA 4GB32 3I2GA 3OGSA 3UESA 1DYKA 5FREA 3BODA 1J3QA 5JOZA 5G05L 1NCRC 1N47A 1ZBE1 1YXWA 2WFF1 5DAVA 5CFDA 3VDBA 1MVEA 3C2UA 4I02A 2CAVA 1PIV3 2VUDA 3IZOA 5C8CA 5CYYA 2IXKA 4B4QA 2W08A 3N4MA 4LE4A 1VBE2 2WFF2 4IESA 1GZWA 1VLNA 4FVVA 4J25A 1ZRCA 3N9NA 4J1WA 2A3XA 3NJVA 1AR63 5JXHA 2WNUA 2YC0A 2YPJA 2BEOA 4HSJA 1YYNA 1F31A 4QQPA 5L9BA 2VAUA 1O8SA 3RZJA 4AEKA 4FPFA 1DG6A 1EYBA 2DVFA 5IK5A 4E2SA 2VQAA 3GXUA 5I8YA 2A71A 1XOYA 1AF9A 3AYDA 2X8KA 3ZPOA 5F7UA 1G7YA 1H1AA 1NLQA 1UW8A 1T6BX 1Y7BA 3WNXA 4QPYA 4K40A 1X50A 1TQ5A 4NIHA 1JH5A 2VZTA 2D44A 1QNWA 3T09A 2VR4A 1JS9A 2E6VA 1XNTA 1RUD2 4QX1A 1VB4A 3LDRA 5C8CC 4AGVA 3QCWA 3F95A 2KR2A 2W5FA 3PUAA 4IV3C 5DDJ3 4UF0A 3IMMA 4LIUA 5FYIA 1VBD2 5FQ0A 4OI1A 4AYUA 1MEC3 1QJX3 2Y64A 3SCFA 2UURA 1XNAA 3RFRA 5DZGA 1NAEA 4YM3A 3BPZA 1QWRA 3I3BA 3MLLA 3AKSA 1FMD2 4HONA 1EAH3 4XYXA 4YVSA 2QCSB 4LHLA 1YUDA 4K8RB 3AZZA 1W0OA 1V6KA 1DGRN 2HH9A 1W28A 2EALA 4CRQA 4HVQA 2Q1ZB 1VMFA 2VZRA 5AC93 3N9MA 4QHBA 3U78A 1UX6A 4AAPA 1OFNA 2KM2A 1NZCA 1RUH3 1W8FA 3DL3A 1YEWA 2JB4A 4AHXA 3W5NA 1J58A 4RD7A 1W04A 2V4AA 4DFSA 3WXPA 3FE5A 1XSRA 5FO8B 2J22A 5F2SA 3QH7A 1LESA 4N53B 4META 1JZ5A 2WS92 2YU2A 1U12A 1UQXA 2VBPA 3KCCA 4RGKA 1UY3A 5GKAC 5FZ4A 5DDJ1 3AP6A 5GLTA 1WW6A 3CNAA 5EZWA 2PA7A 3UKNA 1REEA 1IQDC 1Y9GA 2VVDA 4LHNA 4OUMA 4P5HA 4QX0A 3RYPA 4CCDA 5IK4A 2A6XA 1GZCA 1UX7A 2XL7A 3H8UA 3SC7X 5I91A 3USUA 1JYWA 1WD3A 4L92A 1D4M2 3U1XA 3SEPA 4PDWA 1YLLA 1Q5OA 2MEV3 1ACCA 3PUQA 2XVLA 5ERLA 2MHFA 1FPN2 1Q8QA 4EN0A 2WN2A 5FZHA 3PMEA 3J7HA 4XCBA 5A1FA 2RJLA 1DYOA 1NQJA 1E5IA 5C6CA 1IG3A 3N7KA 1RL3A 2YPDA 3E6DA 2Z79A 1EV11 4A42A 1UMHA 3VBRC 3OGRA 2N7GA 4M0NA 3ZFFA 1MZ6A 2A6VA 4LBJA 2WO2A 1WBFA 3ZXDA 4O61A 2WO7A 5A7PA 3O5SA 2LALA 2V73A 4BOWA 2XKPA 2JDPA 5IK8A 1VAMA 4PQ9A 1URXA 1DCSA 1PGSA 4K1YA 5DAQA 2NPIA 2ZTNA 3GHMA 2QQPA 4YARA 2WC2A 4HKWA 5BYNA 2R49A 2BERA 2VUCA 1VMHA 4CYDA 3GHNA 4UFMA 4B3NA 2TNFA 4ZKTB 3HPNA 1F15A 3LKJA 5H9QA 3H8RA 1QIQA 3J7LA 2B7YA 3SKJE 4HKLA 2P17A 4O7XA 2JDMA 1E5HA 1R093 2ZGUA 3F2ZA 2RJKA 2WINB 2ORXA 2Y26A 3MGUA 3OOXA 4FXKB 2ZEXA 1V9U2 1YQ8A 4CVUA 1U0AA 1YFUA 5IVYA 2WNVA 4DY5A 2WO1A 2JD9A 4Q4W3 4Q8KA 3VD7A 3H1YA 5IVJA 1LHVA 2GN7A 1AR92 4XDOA 2WFF3 1B09A 1UIJA 5BXXA 4JRLA 4BQXA 1Y43B 2C9AA 4KWJA 1W8TA 3T1LA 3H8OA 1GKBA 5A6ZA 2Z4FA 1LOFA 5A33A 5CFDC 2TEPA 1D7PM 1RUI3 1SMVA 2PTMA 1UOFA 1R091 3BPSA 1Y9QA 2NP0A 2IXIA 4AFDA 3I59B 2R30A 4WM7B 4NIGA 3DCQA 2A3YA 2FMYA 1K42A 4Q29A 1VRH3 1U5IA 2EXIA 2A70A 5FLIA 4XURA 2JENA 3FFQA 1LHWA 3IAQA 4ZU5A 2RMU3 2Q8EA 1D2QA 1F4AA 2C9KA 1W9SA 3OY8B 4L99A 3UT0A 1CVNA 5JAXA 1G9CA 4BU2A 4NAOA 2PLV3 1E5SA 3KCYA 3FLTA 4COYA 1MZFA 1PO23 5FR3A 2FMDA 2VXRA 1YJLA 2VH9A 3GJAA 1QDCA 2VMFA 3MPPG 4N43C 4DIQA 1QXPA 2FDKA 1PMHX 2AEYA 5HPOA 2OXBA 5KXEA 1WCUA 5FY0A 2IWGB 4AFAA 1JUHA 1TME2 3AZVA 3WP4A 1NLSA 1POV3 3AP9A 2PFWA 4ISRA 2W91A 3GNEA 4LBLA 3KGLA 4WM7C 1K5MA 1XRUA 4YZ3A 3VKLA 3VZJA 2IXHA 2MEV1 1QH7A 1QXRA 1L7LA 1MS4A 1NG0A 2BBAA 2PHRA 2WAOA 5EIYB 5LWBA 4AEDA 2P5BA 2EAKA 5EJ1B 3WHTA 1W6NB 3MLKA 5FK8A 5L36A 3OBAA 3WF2A 2CHHA 4RQPC 4XTPA 2DBIA 2PYTA 1W9TA 5DAWA 4IXLA 5T3NA 2ID4A 4LBQB 5FY4A 4NPRA 3VKOA 1AYM2 2RDQA 3NSTA 5SV8A 3RI9A 3TN91 2O1QA 5CAZA 4BPZA 1OOPC 3I2DA 3WEZA 4ARYA 2HJIA 3ZIWA 1I6XA 1CX4A 4DS0A 4OHWA 1DFQA 3ZFEB 2OZ6A 1RHI1 4FI9A 5M0TA 5IUQA 3FC0A 1S0IA 5A32A 5ISLA 2A1XA 5GM0A 1AZDA 4FPYA 1QY4A 1NUKA 3J26N 3FN9A 3HNBM 1VBD1 5FCCA 3AL6A 4HSLA 4URAA 1EP0A 1PMIA 4BE3A 3H1MA 5JPMB 5FXVA 4FPOB 1POQA 4ZZ8A 2HWC1 3RPQA 2C1FA 1CAVA 4PF1A 3KQRA 5FZKA 5I93A 1FV2A 2CGNA 5FPAA 3AL5A 1PZ7A 1CIYA 2WNVC 1NE6A 5E8AA 3SNMA 3RZHA 4QPIC 3WUDA 1GICA 1X7NA 3SH5A 1H1IA 3SXWA 5ABJC 3AZXA 2QQUA 3CL1A 4S2FA 4XCAA 5LK5A 2VY0A 3DF0A 5F5IA 2YBKA 3BB6A 3QACA 4BZ4A 1CJDA 1O3RA 1DBNA 2P3YA 4YW5A 4EROA 1M4WA 4Q4X2 4Q4V2 3WW4A 2VU9A 4P9GA 5LA2A 2ORZA 1ENXA 1DQ5A 1ULDA 2HEVF 3MIGA 4IV1C 1D4M1 1HXS3 3VBUB 3UETA 4AWDA 1CQ9A 4HVOA 3WUCA 4WZFA 3OYWB 1GZTA 3VZMA 2OUJA 1SPPB 1X82A 4WM8A 1MR5A 2XLAA 1QF3A 3MUZ1 3MW3A 1BVP1 4QXKA 4GA9A 4YZ4A 5FJHA 1SZBA 3OY8A 1XBFA 1UF2C 2DVAA 4JHZA 5LA1A 1UY2A 3UGHA 3VHRA 1IGOA 2BGCA 1TVGA 3MFAA 3HOBA 4PF5A 4NIDA 1H2KA 2VO5A 4PLOA 3BN6A 4QB1A 5SV5A 4IETA 5EYYA 4QPGB 5JZGA 4XDQA 2VG9A 3ACLA 3OCPA 4W4ZA 1CONA 3AMPA 4W8JA 2W39A 2W1WA 4K1ZA 5F5AA 3ZSJA 2JDNA 1J83A 2WL1A 3M3IA 4XC9A 4BIOA 1JZ3A 3E6CC 3GZAA 1YRZA 3P3NA 4A7ZA 5FQ0B 3EXUA 4XFFA 2Q8DA 3V56A 5IATA 5KXDA 4WM7A 1C4RA 2RG4A 3USSA 1RHI2 4C90A 5LBCA 1LCLA 2Z42A 4X6RB 2ZX1A 4S2HA 1PK6C 1LECA 2VD7A 2VNOA 4PLNA 3SCGA 4A6OA 4HL0A 4L2NA 3ETPA
chains in the Genus database with same CATH topology
1O8PA 3HEIA 4JKKA 3C8XA 1ULOA 3K46A 4ARXA 2LW8A 1SG3A 1UYYA 4JX0A 4YPJA 4P00B 3T08A 2QQMA 4KI5M 4IUGA 2V72A 1NKGA 4PT6A 4A41A 3FHQA 5JMOA 2LS6A 2VC9A 5JR2A 4CUCA 1KEXA 3OB8A 3DYOA 2E26A 4DUWA 1GU3A 2W1QA 2BGOA 3GM8A 1OD3A 1ULPA 1CZVA 1K45A 1PX4A 1UY1A 4P08A 2QBXA 5J1XA 2W3JA 5IHRA 1K12A 1I5PA 5EJZB 2VZSA 2L9LA 4MGQA 4XUPA 1R64A 4LQRA 3LQCA 4XUTA 4XUOA 3MO4A 1UMIA 4DEVA 4E8CA 5DMYA 5IJRA 3LEKA 3K75B 2XONA 4RYDA 4QAWA 3A22A 1GUIA 3VD4A 1PMJX 4D8MA 2JE8A 4GWIA 1L7QA 3K4DA 1JZ8A 4OUEA 3WF0A 3OG2A 4KMQA 3I2HA 3I3EA 1LNSA 2HYXA 3T0AA 4PQQA 2J1VA 3HNMA 2WZ8A 1XC6A 3I3DA 3P6BA 3DYMA 2VZPA 3GDBA 3FHAA 2W92A 3AC0A 3WQBA 4A4AA 5JXIA 1GMMA 4DUXA 2VTFA 2E33A 4MOAA 1GQPA 3ECQA 4QDRA 2VQUA 4OMDA 2ZEZA 3VDCA 2E31A 4P02B 1P8JA 3VD5A 4OZOA 2VZUA 3CZUA 4XUQA 2WZEA 2CDPA 2VZVA 3HN3A 2EIBA 4BK5A 3LPFA 3VDAA 1UWWA 1DLCA 4UAPA 2QQKA 3K4AA 3WNKA 2XQXA 2QQOA 3HJRA 1JZ6A 3CZJA 4L0PA 2KD7A 2WO3A 1KGYA 4DUVA 2JDAA 1W0NA 3ACFA 4A44A 4P5YA 4ET7A 1EUUA 2B4KA 2VZ3A 4ZXEA 2Y8KA 4OYUA 1CX1A 3THDA 4ZZ5A 1W8OA 2CDOA 4BXSV 4AAXA 3WNOA 1HN1A 3T2OA 3UESA 3I2GA 2VCAA 3OGSA 3MBWA 4OMCA 5G05L 2YFUA 3VDBA 1SDDB 2WDBA 3THCA 5CYYA 1UY4A 5C70A 2C26A 3P1IA 4A3ZA 1H6YA 1GOGA 4QB2A 3NQHA 3BGAA 3NJVA 3MV01 5JXHA 3LEGA 4LHSA 1O59A 2W1SA 1O8SA 2VMCA 2W94A 3GXUA 4CU6A 3WNNA 2JKXA 2YC4A 2YB7A 5F7UA 3CIHA 3IIIA 3ACIA 2VZTA 5C7GA 3T09A 2BZDA 2VR4A 5HXMA 1XNTA 1JYNA 4QX1A 1GOHA 1W9WA 2DDUA 2W5FA 4E8DA 1UYZA 2J1UA 2VOTA 2XHNA 3CQOA 2Y64A 1L7RA 3IAPA 1GOFA 3T0DA 3PUHA 1XNAA 1UZ0A 1NAEA 2QQNA 5DQ0A 3C7GA 3I3BA 4W50A 3A23A 3DYPA 2X10A 2E32A 4QB6A 3WNPA 1JZ7A 2VZRA 5DN2A 5I0DA 5G04L 1H6XA 3W5NA 1NX9A 2QQJA 3ACHA 4GZ9A 2DCKA 5IFTA 2J22A 1JZ5A 1UY3A 5IFPA 3CDZB 4DXRA 3JXSA 1IQDC 3I97A 4QX0A 4QX3A 3VD3A 3VD9A 4M4RA 1UX7A 2J1EA 4CU9A 1JYWA 2VCCA 2W46A 2W95A 3SEPA 3WNMA 3WNLA 2WYSA 2WN2A 4QDQA 2BGPA 2OKXA 2W87A 3J7HA 1W99A 4ZY9A 3IDAA 3OEAA 1DYOA 1PX3A 3ABZA 3I2FA 4JKLA 4TTGA 4A42A 1UMHA 1UYXA 2J1AA 3OGRA 4BDVB 3I2KA 3MV11 2WO2A 1XPWA 2X05A 2VJXA 1YQ2A 5DPNA 1JYVA 3NNGA 2YC2A 5LA0A 3NRUA 4CU8A 1CZTA 1UXZA 2VZ1A 1WCQA 2RJ2A 2WAAA 2BERA 2WABA 4QX2A 2QQLA 3WSOA 3HPNA 2R7EB 2YFZA 3IB3A 3OGVA 3SKJE 3F2ZA 2ORXA 3GGLA 4HG6B 2ZEXA 4CVUA 2Y6HA 4DXSA 2WO1A 2JD9A 2J1RA 5FUIA 3VD7A 1W8NA 2VMEA 3EB7A 2C4XA 3T2PA 3HNYM 2EIDA 4UOJA 3SKVA 4CUAA 2Z4FA 4CUBA 1OH4A 1D7PM 4XZUG 1F4HA 2DCJA 2PQSA 1WKYA 1UXXX 4QDSA 2VZQA 2Y6GA 4MO3M 3I2IA 2RVAA 1K42A 2Y6JA 1MPXA 5JUVA 4XURA 3IAQA 4LPLA 4MGSA 1F4AA 2C9KA 4Z2AA 1W9SA 5B4NA 4BJ0A 4DEQA 1US3A 2VQTA 2XOMA 4QPWA 2WUHA 2VMFA 3LE0A 3K77A 1PMHX 3ZM8A 5HPOA 4RN5A 1T2XA 3C7HA 2W91A 2X09A 3I2JA 2RV9A 2VZOA 3WF3A 2BBAA 2WAOA 5EIYB 5A1AA 5C71A 3C7EA 1JHJA 2ZEYA 5EJ1B 5JXGA 1RYYA 3EYPA 1JYXA 1UY0A 3A7QA 3OBAA 3WF2A 5IYYA 1EUTA 1W9TA 1OF4A 4LKSA 2ID4A 2VCBA 3PUIA 3UNPA 4TXWA 1K3IA 3T2QA 3CMGA 3WEZA 4ARYA 4A45A 1JZ2A 2ZEWA 1BHGA 2J1TA 1OT5A 2VL4A 4FI9A 2W47A 1US2A 1JZ4A 3WF1A 4CU7A 3ACGA 3SEEA 1NUKA 3FN9A 2ZXQA 3HNBM 2WQ8A 3MUY1 5CZKA 4DXTA 3A21A 2VM9A 4ZZ8A 4PF1A 2J1SA 2WBKA 3E1F1 4UI9L 4AG4A 1J84A 1OF3A 1CIYA 3K4ZA 2V5DA 2B9VA 3T0BA 3WF4A 1GNYA 1JU4A 3NJXA 2EICA 4D0QA 2J7MA 3U37A 3LEIA 4XUNA 1TG7A 2W1UA 3C7OA 2Y6LA 5LA2A 2ORZA 3UETA 2Y6KA 3OEBA 3C7FA 2WN3A 1JU3A 3MUZ1 3FL7A 2W9XA 4M4PA 4JHZA 2EIEA 5LA1A 1UY2A 4KWUA 4JKMA 1TVGA 2YG0A 3HOBA 2VO5A 3BN6A 4QB1A 1CZSA 2QQIA 4W4ZA 1DP0A 4GWJA 4W8JA 2W1WA 2VMDA 1J83A 1JZ3A 1SHWB 1JI6A 3D3AA 5B4XA 2HLEA 4MADA 3LPGA 3DECA 4BK4A 3W5MA 5LCWL 4A6OA 2V4VA 4XVHA 5JXJA 3CKHA 3ETPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8P A;  3HEI A;  4JKK A;  3C8X A;  1ULO A;  3K46 A;  4ARX A;  2LW8 A;  1SG3 A;  1UYY A;  4JX0 A;  4YPJ A;  4P00 B;  3T08 A;  2QQM A;  4KI5 M;  4IUG A;  2V72 A;  1NKG A;  4PT6 A;  4A41 A;  3FHQ A;  5JMO A;  2LS6 A;  2VC9 A;  5JR2 A;  4CUC A;  1KEX A;  3OB8 A;  3DYO A;  2E26 A;  4DUW A;  1GU3 A;  2W1Q A;  2BGO A;  3GM8 A;  1OD3 A;  1ULP A;  1CZV A;  1K45 A;  1PX4 A;  1UY1 A;  4P08 A;  2QBX A;  5J1X A;  2W3J A;  5IHR A;  1K12 A;  1I5P A;  5EJZ B;  2VZS A;  2L9L A;  4MGQ A;  4XUP A;  1R64 A;  4LQR A;  3LQC A;  4XUT A;  4XUO A;  3MO4 A;  1UMI A;  4DEV A;  4E8C A;  5DMY A;  5IJR A;  3LEK A;  3K75 B;  2XON A;  4RYD A;  4QAW A;  3A22 A;  1GUI A;  3VD4 A;  1PMJ X;  4D8M A;  2JE8 A;  4GWI A;  1L7Q A;  3K4D A;  1JZ8 A;  4OUE A;  3WF0 A;  3OG2 A;  4KMQ A;  3I2H A;  3I3E A;  1LNS A;  2HYX A;  3T0A A;  4PQQ A;  2J1V A;  3HNM A;  2WZ8 A;  1XC6 A;  3I3D A;  3P6B A;  3DYM A;  2VZP A;  3GDB A;  3FHA A;  2W92 A;  3AC0 A;  3WQB A;  4A4A A;  5JXI A;  1GMM A;  4DUX A;  2VTF A;  2E33 A;  4MOA A;  1GQP A;  3ECQ A;  4QDR A;  2VQU A;  4OMD A;  2ZEZ A;  3VDC A;  2E31 A;  4P02 B;  1P8J A;  3VD5 A;  4OZO A;  2VZU A;  3CZU A;  4XUQ A;  2WZE A;  2CDP A;  2VZV A;  3HN3 A;  2EIB A;  4BK5 A;  3LPF A;  3VDA A;  1UWW A;  1DLC A;  4UAP A;  2QQK A;  3K4A A;  3WNK A;  2XQX A;  2QQO A;  3HJR A;  1JZ6 A;  3CZJ A;  4L0P A;  2KD7 A;  2WO3 A;  1KGY A;  4DUV A;  2JDA A;  1W0N A;  3ACF A;  4A44 A;  4P5Y A;  4ET7 A;  1EUU A;  2B4K A;  2VZ3 A;  4ZXE A;  2Y8K A;  4OYU A;  1CX1 A;  3THD A;  4ZZ5 A;  1W8O A;  2CDO A;  4BXS V;  4AAX A;  3WNO A;  1HN1 A;  3T2O A;  3UES A;  3I2G A;  2VCA A;  3OGS A;  3MBW A;  4OMC A;  5G05 L;  2YFU A;  3VDB A;  1SDD B;  2WDB A;  3THC A;  5CYY A;  1UY4 A;  5C70 A;  2C26 A;  3P1I A;  4A3Z A;  1H6Y A;  1GOG A;  4QB2 A;  3NQH A;  3BGA A;  3NJV A;  3MV0 1;  5JXH A;  3LEG A;  4LHS A;  1O59 A;  2W1S A;  1O8S A;  2VMC A;  2W94 A;  3GXU A;  4CU6 A;  3WNN A;  2JKX A;  2YC4 A;  2YB7 A;  5F7U A;  3CIH A;  3III A;  3ACI A;  2VZT A;  5C7G A;  3T09 A;  2BZD A;  2VR4 A;  5HXM A;  1XNT A;  1JYN A;  4QX1 A;  1GOH A;  1W9W A;  2DDU A;  2W5F A;  4E8D A;  1UYZ A;  2J1U A;  2VOT A;  2XHN A;  3CQO A;  2Y64 A;  1L7R A;  3IAP A;  1GOF A;  3T0D A;  3PUH A;  1XNA A;  1UZ0 A;  1NAE A;  2QQN A;  5DQ0 A;  3C7G A;  3I3B A;  4W50 A;  3A23 A;  3DYP A;  2X10 A;  2E32 A;  4QB6 A;  3WNP A;  1JZ7 A;  2VZR A;  5DN2 A;  5I0D A;  5G04 L;  1H6X A;  3W5N A;  1NX9 A;  2QQJ A;  3ACH A;  4GZ9 A;  2DCK A;  5IFT A;  2J22 A;  1JZ5 A;  1UY3 A;  5IFP A;  3CDZ B;  4DXR A;  3JXS A;  1IQD C;  3I97 A;  4QX0 A;  4QX3 A;  3VD3 A;  3VD9 A;  4M4R A;  1UX7 A;  2J1E A;  4CU9 A;  1JYW A;  2VCC A;  2W46 A;  2W95 A;  3SEP A;  3WNM A;  3WNL A;  2WYS A;  2WN2 A;  4QDQ A;  2BGP A;  2OKX A;  2W87 A;  3J7H A;  1W99 A;  4ZY9 A;  3IDA A;  3OEA A;  1DYO A;  1PX3 A;  3ABZ A;  3I2F A;  4JKL A;  4TTG A;  4A42 A;  1UMH A;  1UYX A;  2J1A A;  3OGR A;  4BDV B;  3I2K A;  3MV1 1;  2WO2 A;  1XPW A;  2X05 A;  2VJX A;  1YQ2 A;  5DPN A;  1JYV A;  3NNG A;  2YC2 A;  5LA0 A;  3NRU A;  4CU8 A;  1CZT A;  1UXZ A;  2VZ1 A;  1WCQ A;  2RJ2 A;  2WAA A;  2BER A;  2WAB A;  4QX2 A;  2QQL A;  3WSO A;  3HPN A;  2R7E B;  2YFZ A;  3IB3 A;  3OGV A;  3SKJ E;  3F2Z A;  2ORX A;  3GGL A;  4HG6 B;  2ZEX A;  4CVU A;  2Y6H A;  4DXS A;  2WO1 A;  2JD9 A;  2J1R A;  5FUI A;  3VD7 A;  1W8N A;  2VME A;  3EB7 A;  2C4X A;  3T2P A;  3HNY M;  2EID A;  4UOJ A;  3SKV A;  4CUA A;  2Z4F A;  4CUB A;  1OH4 A;  1D7P M;  4XZU G;  1F4H A;  2DCJ A;  2PQS A;  1WKY A;  1UXX X;  4QDS A;  2VZQ A;  2Y6G A;  4MO3 M;  3I2I A;  2RVA A;  1K42 A;  2Y6J A;  1MPX A;  5JUV A;  4XUR A;  3IAQ A;  4LPL A;  4MGS A;  1F4A A;  2C9K A;  4Z2A A;  1W9S A;  5B4N A;  4BJ0 A;  4DEQ A;  1US3 A;  2VQT A;  2XOM A;  4QPW A;  2WUH A;  2VMF A;  3LE0 A;  3K77 A;  1PMH X;  3ZM8 A;  5HPO A;  4RN5 A;  1T2X A;  3C7H A;  2W91 A;  2X09 A;  3I2J A;  2RV9 A;  2VZO A;  3WF3 A;  2BBA A;  2WAO A;  5EIY B;  5A1A A;  5C71 A;  3C7E A;  1JHJ A;  2ZEY A;  5EJ1 B;  5JXG A;  1RYY A;  3EYP A;  1JYX A;  1UY0 A;  3A7Q A;  3OBA A;  3WF2 A;  5IYY A;  1EUT A;  1W9T A;  1OF4 A;  4LKS A;  2ID4 A;  2VCB A;  3PUI A;  3UNP A;  4TXW A;  1K3I A;  3T2Q A;  3CMG A;  3WEZ A;  4ARY A;  4A45 A;  1JZ2 A;  2ZEW A;  1BHG A;  2J1T A;  1OT5 A;  2VL4 A;  4FI9 A;  2W47 A;  1US2 A;  1JZ4 A;  3WF1 A;  4CU7 A;  3ACG A;  3SEE A;  1NUK A;  3FN9 A;  2ZXQ A;  3HNB M;  2WQ8 A;  3MUY 1;  5CZK A;  4DXT A;  3A21 A;  2VM9 A;  4ZZ8 A;  4PF1 A;  2J1S A;  2WBK A;  3E1F 1;  4UI9 L;  4AG4 A;  1J84 A;  1OF3 A;  1CIY A;  3K4Z A;  2V5D A;  2B9V A;  3T0B A;  3WF4 A;  1GNY A;  1JU4 A;  3NJX A;  2EIC A;  4D0Q A;  2J7M A;  3U37 A;  3LEI A;  4XUN A;  1TG7 A;  2W1U A;  3C7O A;  2Y6L A;  5LA2 A;  2ORZ A;  3UET A;  2Y6K A;  3OEB A;  3C7F A;  2WN3 A;  1JU3 A;  3MUZ 1;  3FL7 A;  2W9X A;  4M4P A;  4JHZ A;  2EIE A;  5LA1 A;  1UY2 A;  4KWU A;  4JKM A;  1TVG A;  2YG0 A;  3HOB A;  2VO5 A;  3BN6 A;  4QB1 A;  1CZS A;  2QQI A;  4W4Z A;  1DP0 A;  4GWJ A;  4W8J A;  2W1W A;  2VMD A;  1J83 A;  1JZ3 A;  1SHW B;  1JI6 A;  3D3A A;  5B4X A;  2HLE A;  4MAD A;  3LPG A;  3DEC A;  4BK4 A;  3W5M A;  5LCW L;  4A6O A;  2V4V A;  4XVH A;  5JXJ A;  3CKH A;  3ETP A; 
#chains in the Genus database with same CATH topology
 1HB2 A;  3NNF A;  2E63 A;  4CEY A;  3FMG A;  1LOB A;  2RS3 3;  5GZD A;  4XHX A;  5CKQ A;  4EZH A;  1W6O B;  2LW8 A;  1SG3 A;  4XFG A;  3VBH B;  1W2N A;  3BYW A;  4YPJ A;  3ZVX A;  4F83 A;  5JZG C;  3T08 A;  4KI5 M;  2RS5 3;  3POF A;  1OLR A;  4OLL A;  1N1Y A;  2D6K A;  3OUJ A;  3PJY A;  4RGG A;  2PHX A;  3POE A;  4BLJ A;  2VE1 A;  3ZXJ A;  4A7K A;  5FXW A;  5FUN A;  2E26 A;  1H2M A;  1Z7S 1;  4DUW A;  5BNN B;  1HRV 2;  2FBE A;  1W39 A;  2P3J A;  2W1Q A;  5LA9 A;  3LOB A;  1MQT A;  4FSJ A;  1C5H A;  1YIF A;  4D0Q A;  1ULP A;  1E57 A;  2WYF A;  4Q1P A;  1PVC 3;  3RWK X;  1BK1 A;  5ANQ A;  3WY6 A;  5LBE A;  1UY1 A;  1Y9M A;  4E4D X;  2UU8 A;  5A3P A;  5LY1 A;  2JG8 A;  5J1X A;  2W3J A;  3AM2 A;  2XJS A;  1UU6 A;  4YW7 A;  3BI3 A;  5BNQ A;  4E4H A;  2MPF A;  4QPG C;  5BV6 A;  4PHZ A;  3GZE A;  2BP6 A;  4QQH A;  5EJZ B;  2VZS A;  1SEF A;  2D3P A;  5ACA 2;  2R07 3;  3KVB A;  2L9L A;  4KBZ A;  5DDJ 2;  5C33 A;  4MGQ A;  1V6M A;  5I0R A;  4LQR A;  3LQC A;  2JD4 A;  3K2O A;  3V64 A;  1MEC 2;  1CR7 A;  1QJX 2;  1OOP B;  1HW5 A;  4CCK A;  4EWA A;  1NCQ C;  3BTX A;  4DEV A;  3UKT A;  4M3C F;  4E8C A;  4FOQ A;  4H3W A;  5LK7 B;  5IVC A;  1C1F A;  1OHF A;  5H9S A;  1ULC A;  1O4Z A;  2GC2 A;  2GH2 A;  2XON A;  5L7O A;  5I0T A;  2KA3 A;  5A7W B;  1ST8 A;  4X8N A;  4CE8 A;  1VAV A;  2ARE A;  5FYY A;  4B7K A;  2Q30 A;  4JGZ B;  1SPP A;  4WM8 B;  3VD4 A;  1CWP A;  2Y6F A;  5FZL A;  1AXY A;  3K4D A;  4GB3 3;  2H6B A;  4JDM A;  4G4F A;  5FJK A;  3JBG 3;  4UYB A;  3I54 A;  5FPZ A;  3I2H A;  4D94 A;  3MIE A;  1BKZ A;  1CAU B;  5J09 A;  1SLI A;  2ZGN A;  3IM0 A;  1AX0 A;  4QPG A;  3W59 A;  4RS5 C;  4Y33 A;  3I3D A;  3VBS A;  1OPO A;  3CHX A;  4YSF A;  5A3T A;  1VBE 3;  3FHA A;  3CU7 A;  1NY7 1;  2K9Z A;  1UPS A;  2JDZ A;  1HN0 A;  4LBM A;  3LZZ A;  4HK8 A;  4MOA A;  3ECQ A;  2HWD 3;  3USU B;  1XU2 A;  5FMO S;  3ZSL A;  3AP7 A;  1UOB A;  2EF6 A;  3O0W A;  2AEN A;  1H30 A;  2XB6 C;  4RL7 A;  4P02 B;  2FDG A;  5K7P A;  3EO6 A;  1AYN 1;  2VPV A;  1PK6 A;  2XXZ A;  1LOA A;  2CNA A;  1XB9 A;  2VZV A;  4DB5 A;  1Q8V A;  1RUC 1;  4BK5 A;  4EWE A;  1W3V A;  1FPN 3;  3HQU A;  1RUC 3;  5GLU A;  3M70 A;  3ZKU A;  3K4A A;  4MGZ E;  1ZBE 3;  5FP9 A;  1KFX L;  1W6O A;  3CZJ A;  4HN1 A;  2KD7 A;  3LFI A;  4Q4X 1;  4Q4V 1;  5FRA A;  2ZHM A;  4P9I A;  5FZC A;  1W0N A;  3VBH A;  1AR8 2;  1WLD A;  5FOJ B;  2D6P A;  2F17 A;  4CDW A;  4JRA A;  3P3P A;  2CGO A;  4LO5 B;  4XQW A;  5BNP B;  4MLO A;  2Y8K A;  1FOD 3;  4ZXE A;  5C9A A;  1D2S A;  3ES4 A;  4NWV A;  5LEJ A;  1VBE 1;  4OI0 A;  1PNG A;  1W8H A;  3AJY A;  4DRV A;  4UW5 A;  5I0S A;  2DVB A;  1YQC A;  3VBR A;  4B4P A;  5FO7 B;  3WT3 A;  2MNG A;  5ACA 1;  1YJK A;  4FPJ A;  4CPB D;  3KHB A;  4K6B A;  1MQT C;  1HN1 A;  1W6M B;  3T2O A;  4OHV A;  1UU4 A;  4GB3 1;  3MBW A;  3NV1 A;  2EXH A;  3LOI A;  4JDN A;  4XJA A;  1QQP 1;  4EJR A;  1FT9 A;  2DTY A;  3H3U A;  1WUV A;  1DQ1 A;  2YU1 A;  1COV 1;  4W6W A;  4EN7 B;  2UY8 A;  3N9Q A;  3WDY A;  4AVB A;  3THC A;  3DXU A;  1JYI A;  4FAG A;  5FYS A;  3IT8 A;  5APA A;  3P1I A;  4JGY A;  5FP3 A;  1ZRI A;  5IT6 A;  4QX8 A;  3ZN5 A;  1S0D A;  1ZZC A;  4L8Q A;  4L9B A;  4FFG A;  5E16 A;  3QH6 A;  3MV0 1;  5C4W A;  1RUJ 3;  4LBN A;  4O9E A;  1FOD 2;  3LEG A;  4LHS A;  2YV8 A;  3WX5 A;  2BTV C;  4P9L A;  1O59 A;  4UWD A;  3I59 A;  5FYB A;  1BLZ A;  2Y0I A;  4GWM A;  5BNN A;  1ULF A;  1V6N A;  5JSO A;  4CEY C;  5JWP A;  1ZZ6 A;  3EQE A;  2QVS B;  4GIQ A;  2ZGR A;  5FYZ A;  3WDT A;  1C5I A;  1MQT B;  5A7W A;  4Q8L A;  3WNN A;  4I09 A;  2R1B A;  5FY1 A;  2XJR A;  2F6B A;  2ZX2 A;  3NKT A;  4HN0 A;  2H0V A;  4HMZ A;  4CDU A;  1ASJ 2;  1PO1 3;  1GZ9 A;  4QXC A;  3BAL A;  5D1I A;  3ACI A;  4YW1 A;  1DZQ A;  5FZO A;  2BFU L;  1TE1 B;  1NY7 2;  5GLV A;  2BZD A;  5HXM A;  1CAU A;  5F1R A;  2FCU A;  5A70 A;  1QJU 3;  2A6Z A;  4OUL A;  4NHM A;  3WP3 A;  4BYY A;  4I3P A;  5KHG A;  1W9W A;  2IFR A;  5DAP A;  2HWE 3;  4XF9 A;  3VBS C;  2GH8 A;  1UYZ A;  2J1U A;  1CD3 G;  2QDR A;  5JIU A;  5A3M A;  1WGP A;  1SLB A;  3NMB A;  4KG8 A;  2NN8 A;  4MH0 E;  4YVW A;  4MHU A;  5FYC A;  3CQO A;  5A3O A;  3ZR6 A;  4D7T A;  5EPA A;  1L7R A;  4YFW A;  4LUL A;  3T0D A;  5FLJ A;  1QXJ A;  2K2S A;  4FP3 A;  1WLC A;  2IFW A;  1UMZ A;  3JQX A;  2FDI A;  3JD7 1;  3OD4 A;  4PCR A;  1OPM A;  2BWA A;  4K8F A;  2ZGO A;  4QB6 A;  4RFR B;  3WNP A;  4GKY A;  3RRD A;  2OYZ A;  3JB8 A;  3D8C A;  4YVW C;  3OYW A;  3RGB A;  4BQ4 A;  1U5Z A;  1Y4W A;  5G04 L;  2VOX A;  1LGB A;  4FP2 A;  3DEM A;  4AVC A;  3JBG 2;  3RQ0 A;  4XJ8 A;  2AC1 A;  1NX9 A;  3ACH A;  4GZ9 A;  1NA1 B;  3ZN4 A;  5JOW A;  1UAI A;  1Q8P A;  2B45 X;  1BXH A;  4G3Y C;  1RUJ 1;  1PO1 1;  2ADD A;  1CAX A;  1SLA A;  4Q4W 2;  5CU1 A;  4KWK A;  2BOJ A;  5GZE A;  4AR2 A;  4D3W A;  1HB4 A;  5IFP A;  4JZR A;  2QKD A;  3CDZ B;  1PGW 2;  4PBP A;  4XMA A;  2X53 S;  1OSG A;  3N3H A;  3S0M A;  1W2U A;  4GD4 A;  4XBL A;  1IPK A;  1CJP A;  1HRV 3;  1XJA A;  1YI7 A;  4Y26 A;  3LSE A;  3ZYH A;  4RR3 C;  2W46 A;  2K46 A;  5T55 A;  1W6M A;  1OI6 A;  4YVS C;  2FD8 A;  4CDX C;  3Q8A A;  1TNR A;  3HAG A;  3TRS B;  2BGP A;  2VMI A;  1AL2 3;  2W87 A;  4E9K A;  3QBQ A;  5HCB A;  4ITC A;  3HWJ A;  1O6U A;  1PX3 A;  3I2F A;  1WMX A;  1QNY A;  4GUL A;  3GBG A;  4CEY B;  3W21 A;  1UYX A;  2J1A A;  2B8M A;  4LIV A;  2XBO 3;  4A3X A;  2P2K A;  1X36 A;  1UN1 A;  5JSR A;  5BNP A;  2LRO A;  4UFK A;  1UL9 A;  5CKN A;  3I2K A;  3MV1 1;  1DU3 D;  4W6X A;  2BV4 A;  4LBQ D;  4YLZ A;  4CDX A;  2X05 A;  5L19 A;  3L9J T;  1JYV A;  4Q4X 3;  4Q4V 3;  4XQD A;  3KS7 A;  3Q8C A;  3LWC A;  1UXZ A;  4NHL A;  4PI2 A;  3N36 A;  5K0U A;  4BIF A;  5IAX A;  4S2G A;  4Q0S A;  2A75 A;  2HWB 2;  1MS8 A;  1MS5 A;  1BEV 3;  5L9V A;  3I3M A;  3ZFG B;  2JIC A;  4Q27 A;  5FYU A;  5IW0 A;  5KC5 A;  2P34 A;  1AYM 1;  3B9I A;  4QMA A;  4DNY A;  4AQ6 A;  4HG6 B;  5GLW A;  3WCR A;  1JUI A;  2QZ2 A;  4UXA A;  3TEZ A;  1WWY A;  4XHB A;  2GU9 A;  3ZDS A;  3VBF B;  4IV3 B;  5FUI A;  1CGP A;  3S57 A;  2XBO 2;  2WT1 A;  1W6P B;  2VME A;  4ASM B;  2Z69 A;  3PNA A;  4DXZ A;  1ZX5 A;  1N3Q A;  5FMB A;  3V0B A;  1HRI 3;  5GLZ A;  2ZGK A;  1JXN A;  4TZD A;  3ZFF C;  4CUB A;  5F37 A;  1OH4 A;  4YRD A;  3AZY A;  2G9F A;  1F4H A;  4XZU G;  2DCJ A;  2PQS A;  1V6L A;  3HR9 A;  4C0H A;  4CCM A;  2ZZQ A;  3GF6 A;  3ZYI B;  3LAG A;  4KH9 A;  4AE2 A;  4IEP A;  5AFB A;  1RMU 3;  2JG8 B;  5HV0 A;  2VTX J;  1MPX A;  3B94 A;  1GWM A;  2OVU A;  3DPR A;  5HBA A;  3D4K A;  3TEX A;  3JCI A;  4B7E A;  5BPX A;  4BJ0 A;  1OQE A;  3ZLI A;  1QOO A;  1SAC A;  1WA6 X;  1US3 A;  1O4T A;  1H8V A;  3NJY A;  5DUV A;  5EP9 A;  4DEQ A;  3BIE A;  5F5Q A;  2XH6 A;  3JBG 1;  2VQT A;  1XNB A;  1CAX B;  1OVP A;  1MVQ A;  3KQ4 B;  3LE0 A;  3ILR A;  3MF9 A;  4B4R A;  3K77 A;  1PM7 A;  3ZSK A;  5L7O B;  3PTY A;  4JGY C;  1YNA A;  1KD7 A;  2X09 A;  2BUK A;  3KV5 A;  1XE7 A;  2VZO A;  3FFZ A;  2NMO A;  3APB A;  4UBH A;  2QQW A;  4KGG A;  3SMH A;  4LA2 A;  4WVM A;  2BNO A;  2JDY A;  5A1A A;  2VQ0 A;  2R0F A;  2QNK A;  1JHJ A;  3MYX A;  3BU0 A;  4OZX A;  1F5J A;  5JXG A;  4PIX A;  1R08 1;  2UWC A;  2XQR A;  1JYX A;  3WG1 A;  1UY0 A;  1VRH 1;  3MIC A;  5IYY A;  4LE3 A;  1EUT A;  5D8A A;  2VBD A;  1OLQ A;  4COW A;  3AXE A;  4H7M A;  1IPS A;  3PUI A;  4IE5 A;  4XF3 A;  3UNP A;  4LEJ A;  4FQZ A;  1PIV 2;  3HQX A;  1RUI 1;  4LKE A;  5H9R A;  4GWN A;  3WW2 A;  1REF A;  4HKO A;  3T2Q A;  4FTB A;  2RS5 1;  4IL7 A;  4A45 A;  3NV2 A;  5FYH A;  3B3Q E;  4NIA A;  4F7Z A;  5LRR A;  1KQR A;  2NQY A;  3VZO A;  4QGL A;  4XXP A;  4CDW B;  4X8P A;  1HB1 A;  1S0F A;  1C8M 1;  2VW0 A;  4XXA A;  1V70 A;  5FPV A;  2W47 A;  5D8A C;  2BPA 2;  3S5Q A;  2RS1 3;  1US2 A;  2AYH A;  2ZML A;  1JZ4 A;  5FZG A;  4XE9 A;  3NKG A;  1EPZ A;  1LAJ A;  2ZGT A;  4XPV A;  3SIS A;  4HOO A;  2XWB B;  4XTM A;  5CZK A;  3RZL A;  2C5D A;  2VM9 A;  2WS9 1;  2YRO A;  3HBK A;  2XBO 1;  2ZKN A;  2BRT A;  2W0X A;  4V2V A;  4YYO A;  5A3W A;  4Y4R A;  3RSJ A;  3HT2 A;  1RIR A;  1OD5 A;  1VJ2 A;  1SCS A;  1RUF 3;  1LOE A;  1SLT A;  2RR1 3;  4UI9 L;  4AG4 A;  3MF6 A;  5FMD A;  3K4Z A;  2R04 1;  2B9V A;  4CEW A;  2BNN A;  3J7M A;  2GND A;  5C9A B;  1W6P A;  2LRP A;  2R06 3;  2A73 B;  2YXS A;  4OHY A;  3FHI B;  3U4S A;  5FZ6 A;  2VEC A;  4IE6 A;  2IUW A;  3KV6 A;  4QQ2 A;  2HEW F;  2J7M A;  1GAN A;  4OI2 A;  1IS5 A;  1DGL A;  1V6I A;  3ZMO A;  4I2O A;  2GAL A;  1QJY 1;  1OBN A;  2VOV A;  4R9A A;  3H50 A;  2W1U A;  3C7O A;  1CPM A;  3M4F A;  4KQ7 A;  1LUL A;  2ZX0 A;  3NW4 A;  2XR4 A;  4HT1 T;  4MZU A;  1V0A A;  1ULE A;  3WDU A;  2HYK A;  3AKQ A;  1UZY A;  4RHV 1;  1RUG 1;  1UU5 A;  1BZW A;  2DTW A;  2DUQ A;  2RDS A;  3OJB A;  4YFZ A;  5FYM A;  1ZZ8 A;  1IS6 A;  2WR9 A;  2AH2 A;  1CIW A;  3OGJ A;  1W06 A;  2ZHK A;  2EIE A;  1OUS A;  4JGY B;  1MS1 A;  2YMZ A;  3E97 A;  4RR3 A;  4CDU B;  2JEC A;  3VBF A;  2ZKL A;  1KDM A;  4FOY A;  3M3C A;  1RUE 1;  5FZO B;  1WCS A;  4AGG A;  4OVE A;  1CZS A;  1PNF A;  2Q4S A;  3V0A A;  5J37 A;  5C3P A;  2D5H A;  2FCV A;  1XSQ A;  1DP0 A;  3KHC A;  2VMD A;  1S2E A;  1OA3 A;  1WME A;  3M3E A;  1W8Z A;  4Z92 B;  2RS1 1;  1APN A;  2Y0O A;  1XYO A;  4NOT A;  4U2A A;  1BBT 1;  3KT4 A;  3D3A A;  2UWB A;  3MID A;  3D0S A;  4AI2 A;  1GNZ A;  3LPG A;  5F3G A;  1LHN A;  2JB8 A;  4COZ A;  1W05 A;  2VTX A;  3H1W A;  3V65 A;  2B5H A;  3MFC A;  1S55 A;  3MPB A;  1O3Q A;  4MXV A;  3LA3 A;  2HWE 1;  4QGN A;  1ZBA 3;  2WT0 A;  5K0U C;  1O8P A;  3VBU C;  5LY2 A;  2EA7 A;  2NMN A;  1SBE A;  1ULO A;  3K46 A;  1WMD A;  2CGP A;  1QJY 2;  1UYY A;  1YFY A;  1AR7 1;  4XAB A;  3WV6 A;  5BNP C;  2YHJ A;  2ZX3 A;  3MZH A;  1AR7 3;  4P00 B;  3ATG A;  1W90 A;  1X9P A;  1NXD 1;  2V72 A;  1JBC A;  4XJ9 A;  2LS6 A;  1GNH A;  3TN9 3;  2ARX A;  1HIX A;  4LO7 A;  4NO4 A;  2A3W A;  1GU3 A;  2PXJ A;  2BGO A;  3PU3 A;  1AHS A;  2ZGS A;  4QT6 A;  3IDB B;  4OCT A;  1EAH 1;  1OD3 A;  4CCE A;  5JSP A;  2FQP A;  1CZV A;  3ZIX A;  2GP5 A;  4NPM A;  5C8W A;  3KT7 A;  4AQ2 A;  1PX4 A;  4UFL A;  1ZBE 2;  2QBX A;  5JI7 A;  5LW9 A;  1RIN A;  2NLR A;  2PLV 2;  3PDQ A;  5A7Q A;  1R09 2;  1SBF A;  2GMP A;  3THT A;  3IDC B;  5FZ9 A;  1K12 A;  1OC1 A;  2JDH A;  2P4E A;  2VUL A;  1I5P A;  2PAK A;  4ZS2 A;  4R4X A;  1WLW A;  4YG6 A;  5J7M A;  3O0X A;  2AEZ A;  2R07 2;  2D43 A;  4E27 A;  1GBG A;  1R64 A;  4XIK A;  3ZN6 A;  1S0G A;  1FX5 A;  1O4Y A;  4XAC A;  4YG3 A;  3MO4 A;  1HLC A;  3GYD A;  1WA4 A;  1FAY A;  5IJR A;  3LEK A;  4AFC A;  2R1D A;  5FPX A;  1W9Y A;  3FLP A;  4RYD A;  5CEH A;  2ES3 A;  2TUN A;  2JE9 A;  1HXS 2;  2RS1 2;  3N7L A;  3A22 A;  4LJH A;  4LR4 A;  5T50 A;  3SIT A;  2HWB 1;  1K5J A;  5A7N A;  4ZON A;  5KBF A;  3PLQ A;  2ZGM A;  2Z2S B;  3KB5 A;  1LB2 A;  2JE8 A;  2IXL A;  1JZ8 A;  1ASJ 1;  4HK9 A;  2PHL A;  3VUO A;  3JB4 C;  4CP1 A;  3WHU A;  1X9T A;  3L2Y A;  1AYM 3;  1TEI A;  1ZVF A;  1LNS A;  5EWS A;  2HYX A;  1VAK A;  2WNU B;  3NJZ A;  3T0A A;  4PQQ A;  1SLL A;  5KHJ A;  1RED A;  3HNM A;  1LED A;  1OQ1 A;  4LLF A;  2R0H A;  2WSU A;  3N7J A;  3DYM A;  3QLQ A;  1AX1 A;  1J3P A;  5FZI A;  3ENR A;  1DLL A;  1UOJ A;  2DU1 A;  2E51 A;  1IG0 A;  3CO2 A;  5FFO C;  2YYO A;  1S0B A;  1ODM A;  4OMD A;  1OKQ A;  3J7N A;  3VDC A;  5BNO C;  5F3I A;  3VD5 A;  2DVG A;  1H1M A;  3B7M A;  3ZFG A;  2RM2 2;  3AP5 A;  1LHU A;  1VBA 2;  4XF0 A;  3ZYR A;  2JIG A;  4BA6 A;  2WZE A;  5J96 B;  4UW4 A;  3HN3 A;  5T52 A;  1ASJ 3;  3HT1 A;  2ZJC A;  3N9P A;  4EWD A;  2G19 A;  3VDA A;  2HBU A;  4UFH A;  1GYK A;  4YZ2 A;  2VMH A;  1O91 A;  2HEY F;  2QQK A;  1D0G A;  4AZZ A;  4HZF A;  1R08 3;  4AI3 A;  2OT7 A;  2ADE A;  3FWE A;  1C8M 3;  5FY7 A;  5FOB B;  3ME2 A;  1PO1 2;  2QQO A;  4XFI A;  5HCH A;  4L0P A;  2WO3 A;  1KGY A;  1IOA A;  2CAU A;  2E7T A;  5A7S A;  1U5X A;  4Y5T A;  3KF3 A;  4Q0V A;  4ET7 A;  3ETQ A;  2DBN A;  1ZRF A;  3DN7 A;  1CES A;  4I0W B;  4ZZ5 A;  4P9J A;  5EFU A;  1YQ5 A;  2VW2 A;  1AYN 2;  3KV4 A;  3IWZ A;  3R4S A;  4AVA A;  4MV2 A;  1WW7 A;  5JMC A;  5FV3 A;  4JHT A;  3A0N A;  3IN9 A;  5A3U A;  4I3G A;  1FMD 3;  2HWB 3;  5KHK A;  4YZ1 A;  2XHK A;  1IS4 A;  3M8L A;  3B9C A;  3JQW A;  3VKN A;  3WNO A;  2NM1 A;  2LUW A;  4XAE A;  5FZE A;  4AQS A;  1GWL A;  1VRB A;  4DZG A;  2G4I A;  3D82 A;  5AC9 2;  3O1S A;  4PDW C;  2Y60 A;  2QQV A;  2BDR A;  4KGQ A;  1LGC A;  1HKD A;  3EBR A;  4XJU A;  1XU1 A;  1JOP A;  1ZBA 2;  1VBB 2;  4FBF A;  4N43 B;  3KD4 A;  5JOX A;  2FDJ A;  5CIS A;  1XE0 A;  2C26 A;  2DUP A;  2YBP A;  4A3Z A;  5L9R A;  1G9F A;  3RMX A;  1GOG A;  2ZAB A;  4QB2 A;  1LOD A;  3BGA A;  3LA2 A;  1RUO A;  4BH9 A;  4QQO A;  2XJT A;  4FTE A;  2OA2 A;  2W1S A;  3ZXE A;  3JUU A;  4IE7 A;  4DQA A;  2GC3 A;  2VMC A;  2E7Q A;  1RMU 1;  3MI8 A;  4I0B A;  1W2O A;  2UYB A;  3WOG A;  3VDD A;  1G8W A;  1ZBA 1;  2R16 A;  1IZ3 A;  1V9U 1;  3BOP A;  3MLJ A;  3POB A;  2QE3 A;  3OF1 A;  3WP5 A;  1GQH A;  1ZZ9 A;  1VP6 A;  4ORF A;  1R1A 1;  4V2W A;  3FLR A;  2PHW A;  5FWE A;  3III A;  1PZ8 A;  4Y22 A;  2AGS A;  5FO9 B;  2RS3 1;  4GXL A;  1JYN A;  1NA1 A;  1C1L A;  3PL0 A;  1GOH A;  3PVN A;  1BBT 3;  4LK7 A;  4LO8 A;  5JVV A;  2W2I A;  1WCD J;  2PEL A;  4N9H A;  4MGY E;  2ZX4 A;  2VOT A;  1WBL A;  2PHF A;  2XHN A;  1RGS A;  2SLI A;  1GOF A;  3WCS A;  5C8C B;  2OII A;  3PUH A;  4HBN A;  2PN5 A;  4ZS3 A;  1OUX A;  1UZ0 A;  3O14 A;  3I49 A;  3H7Y A;  5DQ0 A;  4W50 A;  1BEV 2;  3A23 A;  3DYP A;  1BEV 1;  3ON7 A;  2BOI A;  4Q0P A;  3ZXG A;  2D6M A;  2DYC A;  2ZOE B;  5JPN B;  3KT1 A;  1F35 A;  2QJV A;  4XW3 A;  4R9B A;  2ATF A;  2YGM A;  4NMI A;  2X29 A;  3UL2 A;  5FY8 A;  5I0D A;  5A6Y A;  5CVR A;  4N8M A;  3ZYF A;  3AMN A;  2JE7 A;  1H6X A;  2W68 A;  3ZOI A;  4AQT A;  2QQJ A;  2OX0 A;  5F32 A;  5LRS A;  2DCK A;  4RA0 A;  2EIG A;  4N90 A;  2R04 2;  1RUE 3;  4K3U A;  1RJ8 A;  4QX7 A;  1HRV 1;  4BQY A;  3T2T A;  4AFM A;  4ATE A;  3R4U A;  1N3P A;  2BU9 A;  3FJS A;  3NV3 A;  2ARB A;  2ZGQ A;  4CDX B;  4NHK A;  1W8U A;  4NAM A;  3AMH A;  1Y3T A;  5EJ3 A;  3JXS A;  1JOB A;  1RVF 1;  1AL0 G;  2JG9 B;  2PQQ A;  4FPG A;  4M4R A;  3NAP B;  3VD3 A;  3RNS A;  4CPB A;  1RB8 G;  3RZM A;  4RHV 3;  2FCT A;  4JGZ C;  2F4P A;  3I4I A;  5CB7 A;  1UYP A;  1X8M A;  3N9L A;  5LBB A;  1VBC 2;  2RR1 1;  3HN1 A;  4I01 A;  5L73 A;  4MG2 A;  1UOG A;  3OSD A;  4NRQ A;  5FZ8 A;  3WNM A;  3WDX A;  1YFW A;  3B00 A;  3P5B A;  1IS3 A;  1H2N A;  1BMV 1;  3I3Q A;  1O5L A;  3RJ2 X;  4COU A;  2PHT A;  5LBF A;  4CP2 A;  2HWF 3;  3DXT A;  4ZY9 A;  3VB9 A;  1DQ6 A;  3IDA A;  2X5I A;  4P14 A;  3WG2 A;  3ABZ A;  2DUR A;  4JKL A;  4K7J A;  2R06 1;  3U75 A;  4TTG A;  3KV9 A;  4EN8 B;  1PIV 1;  1MAC A;  2AZ5 A;  2R04 3;  2HWC 3;  4IV3 A;  4XFB A;  4AEJ A;  3WZ1 A;  4BDV B;  1V6O A;  3OGG A;  1DQ4 A;  1GLH A;  5I0U A;  5BUV A;  1XPW A;  1S4C A;  4TWT A;  4AW7 A;  5F9T A;  4QU2 A;  2ZA9 A;  3M7A A;  1K5M B;  2VJX A;  5DPN A;  5FP4 A;  1TME 3;  3G6J B;  3NNG A;  4XQ4 A;  2YC2 A;  4HPK B;  5IVF A;  1YFX A;  3GCX A;  3NRU A;  3Q8F A;  2HWD 1;  1CZT A;  2VZ1 A;  3D0J A;  4S2D A;  3O1M A;  5KC6 A;  4IDZ A;  3GZU C;  3GZT B;  3HBZ A;  1VIW B;  2QQL A;  3JD7 3;  4IEW A;  4PJY A;  4Y1Z A;  3WSO A;  4AVV A;  3NWK A;  2R7E B;  2YFZ A;  3OGV A;  4LTA A;  5AVA A;  3RDI A;  3KWV A;  2O0O A;  5BNO A;  2OPW A;  4NRM A;  1NQD A;  5KXB A;  3V0A B;  4Y22 B;  4LUM A;  1ENQ A;  4CDQ C;  1A78 A;  2XLG A;  1FV3 A;  1S2B A;  1YI9 A;  4LNV A;  4A6S A;  1Q8O A;  4D7S A;  4CZS A;  1QOT A;  3TEW A;  2E9Q A;  3FUO A;  1ZNP A;  2HWC 2;  1POV 0;  2V5Y A;  2D97 A;  3LIG A;  4Y3O A;  1LJ7 A;  3KGZ A;  2EID A;  4YGE A;  4UOJ A;  2IZW A;  1SDW A;  4D69 A;  4BME A;  1DGW A;  1C57 A;  4I0A A;  1XYN A;  3I7D A;  2ARA A;  3S6P A;  5CA6 A;  3LA7 A;  4Q4Y 3;  5F3C A;  4WBB A;  5CAD A;  4YW2 A;  1W03 A;  4Q4Y 1;  1WKY A;  3NNM A;  5FY5 A;  1UXX X;  2G1M A;  2RM2 1;  2VZQ A;  3OBT A;  1IHM A;  1IQA A;  4QHO A;  3MEP A;  3I2I A;  2A5Z A;  5CG9 A;  5FZ1 A;  3O1T A;  4CP9 B;  1XYP A;  1AXZ A;  5C3R A;  3ZMN A;  1I9R A;  1JYT A;  1COV 3;  1FXZ A;  3B93 A;  3UJO A;  3PTR B;  2XLF A;  1RUF 2;  2Y34 A;  4CCN A;  2VVF A;  4P9Y A;  2HBT A;  2XKO A;  4YGD A;  3UGG A;  2GC1 A;  4Z2A A;  1NCQ A;  1BYH A;  1LOF C;  1Q56 A;  3CJI B;  1S2K A;  5H9P A;  1K5M C;  1V6J A;  5FZ7 A;  2CSG A;  4IEO A;  1VBC 1;  1PVC 1;  2RR1 2;  5DUW A;  2Q8C A;  3ZN6 B;  4V1P A;  3I2O A;  2ET7 A;  3B69 A;  5JLV A;  3MIB A;  4QWN A;  4IGO A;  1WD4 A;  1BBT 2;  4QPW A;  2D7F A;  2WUH A;  3BIW E;  3T1M A;  5GZC A;  1HRI 2;  3ZM8 A;  1I1E A;  3O1R A;  4RN5 A;  4KG0 A;  3VBU A;  2EVX A;  3IIA A;  4MGK E;  3SH4 A;  1S1A A;  1FOD 1;  1DGW X;  1H9P A;  1WLT A;  3C3V A;  3VBR B;  1QQP 3;  5B2G B;  4WV8 A;  4UFI A;  3C7H A;  3I2J A;  2RV9 A;  2IVI B;  4GMP 1;  5FWJ A;  4LLO A;  5EQU A;  3S5A A;  4IE0 A;  3SQO A;  3CJX A;  3C7E A;  3W58 A;  2VXJ A;  2ZEY A;  1W2A X;  3IPV A;  3H7J A;  4WM8 C;  1RYY A;  3EYP A;  4LBO A;  2H0B A;  2P6H A;  3A7Q A;  4OI4 A;  5FYT A;  1XXN A;  4QHZ A;  4CSW A;  2JG9 C;  2BBV A;  2X5I B;  1A8D A;  2VCB A;  1ZM1 A;  4P9X A;  1UZV A;  1O3T A;  4Z8B A;  1K3I A;  3R4D B;  3E5Q A;  1NE4 A;  1RUD 1;  2OZJ A;  3CMG A;  4LKF A;  5F3E A;  2WNE A;  2VVE A;  4CP0 A;  2WNV B;  1NLR A;  2OQ7 A;  3S7E A;  4LKD A;  1W0P A;  4FOV A;  2J1T A;  5ABJ B;  3KLS A;  3VLB B;  2G9Z A;  4LBK A;  2JG9 A;  2ZCW A;  1UZZ A;  4PLM A;  2VGD A;  1GWK A;  4AEM A;  2VUJ A;  3S7I A;  2WZR 3;  1JW6 A;  2ZS6 B;  3FUQ A;  4NII A;  3WF1 A;  4CU7 A;  3ACG A;  3SEE A;  4CCJ A;  3NVC A;  1ULG A;  3VDD C;  4W6Y A;  4F3J A;  1U5Y A;  1VBC 3;  2HWF 2;  2WQ8 A;  2OS2 A;  1BCX A;  1HQW A;  1PZ9 A;  4DXT A;  4EN9 B;  5BNO B;  1JTZ X;  5KHI A;  2VNR A;  4XDP A;  1YWK A;  5FZF A;  5FAX A;  1HJG A;  2ZGL A;  2WBK A;  1KDK A;  3NV4 A;  4E4S A;  1NYW A;  2C6S A;  3HIF A;  4QX5 A;  3T0B A;  3WD5 A;  4MVT A;  4LXL A;  4XBN A;  4AOC A;  1SLC A;  4NVP A;  4XJW A;  4BB3 A;  1BVV A;  2VMG A;  4YM1 A;  5IWF A;  3OD0 A;  5LZ6 A;  4AHW A;  1GNY A;  1GZW B;  2DU0 A;  2VCM A;  1JU4 A;  1S0E A;  4N7I A;  3TNQ A;  2ZHN A;  3H8X A;  2EIC A;  1KRI A;  5A6X A;  3AFG A;  3U37 A;  5FXZ A;  3ZYJ B;  5FY9 A;  2A7A A;  1N1V A;  4Q26 A;  1YHF A;  5JI9 A;  1O5U A;  1TG7 A;  2P1B A;  3R6S A;  1L3J A;  2ENR A;  2XGX A;  2Y6L A;  5E6H A;  4F8A A;  1PGL 1;  3ST7 A;  4YW3 A;  3IKW A;  2DCY A;  2Y6K A;  1JOJ A;  4ZU4 A;  4CCL A;  1KS4 A;  4BQ1 A;  3C7F A;  1RJ7 A;  4N9I A;  2WN3 A;  1JU3 A;  3O7O A;  5KR7 A;  3DKW A;  4QXH A;  5CIR A;  5E89 A;  2BWC A;  3AP4 A;  2W9X A;  4NE9 A;  1FNZ A;  4M4P A;  4LHK A;  3HMY A;  5A1L A;  1NT0 A;  2AR6 A;  3D6E A;  4L97 A;  4JKM A;  4BLI A;  2YG0 A;  4IEQ A;  1YO8 A;  3VBO A;  1OOP A;  2QTW B;  2R06 2;  1GP4 A;  5EXO A;  5AC9 1;  3W20 A;  3BU7 A;  2OPK A;  4GWJ A;  5HCA A;  4UF0 B;  4N7U A;  3UJQ A;  3ZXK A;  3WVJ A;  3THP A;  1SHW B;  1JOD A;  4YW6 A;  3ZO0 B;  4D6Q A;  1RHI 3;  1LKN A;  2VNV A;  4JGZ A;  3J9S A;  1QJE A;  5B4X A;  2HLE A;  1GP6 A;  2NYY A;  1W2T A;  4MAD A;  4AED C;  1QU0 A;  4YM2 A;  2GZW A;  4BK4 A;  1MEC 1;  1QJX 1;  2ETE A;  3LGR A;  3VV1 A;  2Q1F A;  5LCW L;  5TSW A;  4XVH A;  5JXJ A;  1AL2 2;  4JCK A;  4LO4 B;  3J8F 3;  4PI0 A;  1A8M A;  4N43 A;  1MS3 A;  1UCX A;  4LA3 A;  1GQG A;  2D6O X;  1A6C A;  2HWF 1;  3JU9 A;  3FZ3 A;  4FFF A;  4JKK A;  4COV A;  3Q9O A;  1OMI A;  1FAT A;  1QJY 3;  5LAT A;  3PUS A;  3DUI A;  1ALY A;  1LOC A;  2QQM A;  5C5U A;  2RHP A;  1DQ0 A;  3SHR A;  4ES8 A;  2FDF A;  3B5L B;  3RI8 A;  1NKG A;  1B35 C;  2LTN A;  3FHQ A;  5JMO A;  4ISQ A;  1CAW B;  5F2W A;  2DFB A;  4AL9 A;  4RQP A;  2R6Q A;  3ZX7 A;  1FMD 1;  1H4G A;  2VC9 A;  3POY A;  1KEX A;  1PK6 B;  1Z7S 2;  1VPH A;  3DYO A;  3QOP A;  4NR1 A;  5EYX A;  5JR2 A;  3GBW A;  3GM8 A;  2PAE A;  5D2A A;  4EN6 B;  3R0R A;  4LUK A;  3WR0 A;  1LOG A;  3VKM A;  1HQL A;  2B46 X;  3KCX A;  3AKT A;  4UW3 A;  1W9F A;  1HV0 A;  2JDU A;  3NNJ A;  5J3U A;  1STM A;  4AFB A;  1VBA 3;  2C0Z A;  3J8F 2;  4HFS A;  1RUG 2;  3AYE A;  4P08 A;  4YW4 A;  2WSV A;  2Q5T A;  3GBF A;  1W8W A;  3PUR A;  2XVK A;  1RVF 2;  4MGI E;  4X6Q B;  1HX6 A;  3WP6 A;  2DWR A;  1RUH 2;  4Y1X A;  2B9U A;  4DPN A;  4XJZ A;  4RSU A;  3BTA A;  1XQN A;  1LEN A;  5K4L A;  4Y24 A;  4XUP A;  3RVH A;  4CDW C;  5J98 B;  5GAL A;  1HB3 A;  1O7F A;  4XFC A;  4MSV A;  4CDU C;  2IXC A;  4XUT A;  3SCH A;  3TAY A;  3AMM A;  2XDV A;  2XL9 A;  1KS5 A;  3W9A A;  4Q4Y 2;  5DMY A;  3TB0 A;  1T6G C;  4AHZ A;  3K75 B;  3U11 A;  3BUC A;  4M3C A;  4QAW A;  1RMU 2;  2FHR A;  4IV1 B;  1YCI A;  1LEM A;  3EJK A;  1ZZB A;  4MXW B;  1JYC A;  3BTZ A;  2ARC A;  3N9O A;  1J3R A;  1C28 A;  1PMJ X;  3WG4 A;  2W52 A;  5T5J A;  3WG3 A;  4D8M A;  3AYA A;  3DGT A;  3DPR C;  3PIG A;  1C8N A;  5FPU A;  5KXC A;  2ZPX A;  3H3L A;  2OQ6 A;  3I3E A;  3PMS A;  2WQZ C;  3ZSE A;  1BJQ A;  1H8T C;  4FFH A;  5C4W B;  4QPI B;  1IKQ A;  1V9U 3;  2FZ1 A;  4U36 A;  5FLH A;  2J1V A;  1AR9 3;  4A2U A;  3U0Z A;  4R4Z A;  1EV1 2;  4L11 A;  2P3K A;  4FPH A;  3GDB A;  3BOW A;  5FZA A;  2D98 A;  2W92 A;  2JWP A;  1DDL A;  1VB2 A;  2ZHL A;  4DUX A;  1NOV A;  2RS5 2;  1AR8 1;  1SFN A;  1GQP A;  5HXV A;  4QDR A;  2VQU A;  2YDE A;  4YNI A;  4BQ5 A;  4BQ2 A;  5IVE A;  4H14 A;  2ZEZ A;  4XOG A;  2E31 A;  4FTS A;  3ELN A;  3UKV A;  2DUO A;  5CNA A;  1P8J A;  4WVM B;  3ZR5 A;  4C1X A;  1UKG A;  4OZO A;  2VZU A;  4Z2W A;  3NNL A;  3WLU A;  1R1A 2;  2ZAC A;  3ITQ A;  4IND A;  3MW4 A;  1RUC 2;  3H0O A;  4ZXK A;  1J1T A;  2EIB A;  1QH6 A;  3M1H A;  4E4Z A;  2I45 A;  3LPF A;  2VBB A;  1UWW A;  1Z78 A;  1ND3 A;  4UAP A;  3ZYP A;  4W65 A;  5D8A B;  5A3N A;  4B29 A;  3KM5 A;  5FPB A;  1KXG A;  3ROU A;  1Z0H A;  3ZYB A;  2XQX A;  2JDK A;  4DUV A;  5T5P A;  2JDA A;  1UKR A;  3WIN E;  2WNU C;  1YQ6 A;  3LCP A;  3ACF A;  3BVC A;  4A44 A;  2JEM A;  1TMF 2;  2I07 B;  2DFC A;  2EAA A;  4GKX A;  5A80 A;  1AXK A;  1AR8 3;  2B4K A;  2VZ3 A;  3R05 A;  4KL1 A;  4AGR A;  2Q1M A;  3AFK A;  4OYU A;  1OLM A;  1UO9 A;  5E1R A;  4UBG A;  3THD A;  4NRO A;  2D40 A;  4RQP B;  2VUA A;  3K51 A;  1QEX A;  3OPW A;  1PO2 1;  4TLG A;  4AAX A;  1H9W A;  5JDB A;  3CEW A;  4KBB A;  1QDO A;  2CYF A;  4UT5 A;  3MIH A;  3UK9 A;  1F8V A;  5F6K A;  3LDB A;  5LEK A;  5T54 A;  3PVO A;  2VCA A;  4FPL A;  5J36 A;  3U4X A;  4O9G A;  3ZFG C;  1DGR A;  3ZXF A;  4AED B;  4CUC A;  4OMC A;  1NCQ B;  3BTY A;  2YFU A;  3CJI A;  1POV 1;  1SDD B;  2P6C A;  3IPV B;  5C3S A;  5CBL A;  2WDB A;  3G7D A;  3H9A A;  1S0J A;  4CEW B;  3ALQ A;  3OUH A;  3AB0 A;  3DV8 A;  4LOR A;  1UY4 A;  4XF4 A;  3VHP A;  5C70 A;  5DUX A;  3ORJ A;  1Q43 A;  5DAX A;  4NWW A;  2E7A A;  3OTF A;  1H6Y A;  2JKB A;  4GJZ A;  4JVA A;  3VHN A;  3WW3 A;  4GAZ A;  3NQH A;  2ZAA A;  4AK3 A;  2ERF A;  1GSL A;  5C3Q A;  5FDB A;  2UWA A;  1GFF 2;  1TME 1;  4UFJ A;  3CJI C;  5CFC B;  2JG8 C;  2AAC A;  4UW6 A;  1NCR B;  4FT8 A;  5DAB A;  5FIX A;  1W6Q B;  4Q1R A;  1OVS A;  4XZP A;  4FOW A;  2CY6 A;  3TEY A;  2W94 A;  1M06 G;  4CU6 A;  2GC0 A;  4FQ4 A;  4DIN B;  2JKX A;  4Q0Q A;  3OBZ A;  2YC4 A;  2YB7 A;  1RUG 3;  4HET A;  4ZPI A;  3CIH A;  1HJF A;  1VBA 1;  4XIO A;  5T5L A;  5CFD B;  2YGL A;  5FZ3 A;  4RR3 B;  1UD1 A;  1QJU 2;  1XE8 A;  2ET1 A;  4IEX A;  4FPK A;  4IEV A;  4QM9 A;  4Y1V A;  3WDV A;  3NL1 A;  2EXJ A;  3Q8E A;  4AVT A;  4WVV A;  4QPI A;  3VBF C;  3LF7 A;  3VBH C;  1CPN A;  1D4V B;  4XMI A;  5EV7 A;  1QHD A;  2DDU A;  4BXF A;  1GR3 A;  4NN0 A;  5CG8 A;  1J1L A;  3O12 A;  4NPL A;  1AL2 1;  4KU7 A;  4E8D A;  2CL2 A;  4Q0U A;  3RYK A;  5C9A C;  1H4H A;  2CWS A;  5K0U B;  5C7G A;  2RDN A;  3AYC A;  2DCZ A;  2I2S A;  5LB6 A;  2I74 A;  2PAM A;  2WNO A;  3IAP A;  1ZA4 A;  2ZMK A;  1AX2 A;  1UPI A;  2YBS A;  4TLF A;  1TNF A;  4M3C B;  5DZF A;  2QQN A;  3NAP A;  4IV1 A;  3C7G A;  4SLI A;  1EAH 2;  3RJR A;  3JD7 2;  3LFM A;  3AMQ A;  2X10 A;  2E32 A;  1RXG A;  3ZXL A;  1E5R A;  2DF7 A;  3A4U A;  3AZW A;  2Q8O A;  4R9D A;  5GZG A;  4H55 A;  1WW5 A;  4GH4 A;  2WFP A;  1JZ7 A;  4ASK A;  4LMF A;  4E2G A;  3WQ7 A;  4EV0 A;  1F9K A;  1G6N A;  5DN2 A;  3TYJ A;  4CXX A;  5FKB A;  4Y1Y A;  1G9B A;  3KVA A;  4OFG A;  2ZAH A;  4URT A;  3H3Z A;  5FUP A;  4YZ5 A;  4OHX A;  5IFT A;  4Y20 B;  3VKF C;  3V0B B;  4XFA A;  4RS5 B;  3AVS A;  2WS9 3;  3B01 A;  1V00 A;  2ZBJ A;  1PVX A;  3GAL A;  4M3C E;  3AX4 A;  2ZGP A;  1DHK B;  4IW3 A;  4MX3 A;  4NHX A;  3VL9 A;  3QD6 A;  4J6G A;  1VR3 A;  3KF5 A;  5DG2 A;  1DZT A;  2G9G A;  3BKZ A;  4LT5 A;  4DXR A;  2GAU A;  2LM3 A;  3J8F 1;  1JHN A;  3I97 A;  4QX3 A;  3OPZ A;  2B42 B;  3VD9 A;  1ODN A;  2J1E A;  4LOS A;  5F39 A;  5FZ0 A;  4CU9 A;  3DPR B;  5IAV A;  1D4M 3;  2VCC A;  1HV1 A;  1MS0 A;  1I3H A;  3LSD A;  4QKF A;  2W95 A;  3ILF A;  1W3X A;  5A7O A;  3WW1 A;  1VAL A;  3WNL A;  1KJL A;  3O0V A;  1IPJ A;  1BQP A;  2WYS A;  4MUV A;  3RZZ A;  1WMF A;  3T4V A;  4GH4 C;  4QDQ A;  1ZZ7 A;  2D3R A;  4WZC A;  2XWJ B;  2GSY A;  5ANN A;  2OKX A;  3U07 A;  1W99 A;  2XJU A;  2R32 A;  5DUU A;  3OEA A;  4AXO A;  4MGT A;  4IEU A;  3HVD A;  5L7O C;  1ZRR A;  2TBV A;  4R9C A;  2OUH A;  4YGC A;  4AI8 A;  3CLP A;  2XJP A;  3E5X A;  3PIJ A;  1OKO A;  3GJB A;  2DVD A;  3URF A;  1RUE 2;  4BM8 A;  3I8T A;  1O3S A;  4ES9 A;  5CFC C;  1VMJ A;  1FYU A;  4QKB A;  1QKQ A;  4K20 A;  2BJS A;  2WQ4 A;  3U10 A;  2A6Y A;  2ZZJ A;  4WVZ A;  1H8T A;  1LHO A;  5J48 A;  1YQ2 A;  3FX3 A;  4M0H A;  5LA0 A;  4CU8 A;  2A6W A;  4YVW B;  1CAW A;  4RHV 2;  4CEW C;  3LIH A;  1WCQ A;  1F2N A;  5KHH A;  2RJ2 A;  2WAA A;  4R8H A;  3WDW A;  5DXD A;  3LEM A;  3K48 A;  2WAB A;  1DZR A;  4QX2 A;  4PDW B;  3IB3 A;  1YIP A;  3VZK A;  3K3O A;  3E5U A;  1C8M 2;  4XEZ A;  5FTT C;  3VBO B;  5FBZ A;  3GGL A;  5BNN C;  4OUS A;  1EY2 A;  2Y6H A;  5K8S A;  4DXS A;  1N1S A;  2PMW B;  4TYS A;  5K9Y A;  2J1R A;  2WZR 1;  4K21 A;  5FKC A;  4ASL A;  1PO2 2;  3AJZ A;  3ZFF B;  1W8N A;  1B35 A;  3AXD A;  2C4X A;  3EB7 A;  3HNY M;  4GQ7 A;  1OQD A;  4IQP A;  2IXJ A;  3T2P A;  3UV9 A;  1ZYB A;  2YY1 A;  1C3H A;  4E2Q A;  3SKV A;  4CUA A;  3MDP A;  4HLT A;  4ONU A;  2WZR 2;  4TSV A;  5JR7 B;  3LDK A;  4H7L A;  3TN9 2;  3VZN A;  4CDQ B;  4XBQ A;  1W6Q A;  4YWA A;  3ES1 A;  3VBO C;  2WII B;  1RXF A;  5DG1 A;  4BMB A;  2XJV A;  2JX9 A;  4QDS A;  2Y6G A;  5F8P A;  3LD8 A;  4IEY A;  4MO3 M;  3VL8 A;  1ND2 A;  1DYP A;  4P9W A;  2RVA A;  2Y6J A;  5JUV A;  1TMF 1;  1PVC 2;  2MEV 2;  4LPL A;  4MGS A;  1RUF 1;  2CU5 A;  4XET A;  4CTE A;  5JIA A;  2XPJ A;  1Q8S A;  5B4N A;  3TOJ A;  3ZDV A;  1AR9 1;  1ONA A;  1R1Z A;  1WCK A;  3M3Q A;  4AHY A;  1OLM E;  1LR5 A;  1RUD 3;  1BK0 A;  3PVB B;  3O1O A;  2WA4 A;  3M2M A;  1AUY A;  1OUR A;  2BQP A;  4YM0 A;  1TMF 3;  3AK0 A;  2XOM A;  3VHO A;  4LOT A;  4MYE A;  3L2H A;  3RZK A;  4B1L A;  4GMP 0;  1RUN A;  3E6B A;  4OQ8 A;  3H42 B;  1H2L A;  4NUB A;  3ZXA C;  2WA3 A;  4A7Y A;  1T2X A;  4Q4W 1;  1NZI A;  1AYN 3;  3POW A;  4C0B A;  3K3N A;  4MXW A;  4DRR A;  1YC6 1;  1QOS A;  5FP7 A;  2XUE A;  2IVJ A;  4Z1V A;  3WF3 A;  2XG3 A;  4GH4 B;  5C71 A;  4TN7 A;  3OPT A;  2FZ2 A;  4KNC A;  4JQR A;  4LIT A;  4YVS B;  2WWS A;  5F6L B;  2D5F A;  2WLQ A;  4Q5O A;  1UZW A;  2GP3 A;  5FZD A;  5A6Q A;  1XNC A;  1A3K A;  3PJQ A;  4AI1 A;  1MZE A;  4ATF A;  4AI9 A;  1OF4 A;  2YUE A;  3EMR A;  4LKS A;  4BQ3 A;  4KU8 A;  3PVE A;  4BHP A;  4AF9 A;  3NAP C;  4TXW A;  4HXC A;  3RZG A;  4B1M A;  1VBB 3;  1D0H A;  4PBO A;  4D6S A;  2HWE 2;  1NXM A;  1N1T A;  1JZ2 A;  4JC1 A;  3IMN A;  4N53 C;  2ZEW A;  4QGM A;  2BNM A;  2KXL A;  4HVR A;  4K9S A;  1BHG A;  2VL4 A;  1OT5 A;  1UNB A;  3UGF A;  1RUI 2;  3RMY A;  3MHZ A;  1J59 A;  1OH3 A;  2IC1 A;  3Q8B A;  4EYU A;  2ILM A;  1OXC A;  2HWD 2;  2UY9 A;  5JCT A;  4FCA A;  2F4L A;  3POS A;  4C8D A;  1VRH 2;  2RM2 3;  1IKP A;  4PIY A;  2ZXQ A;  5CKM A;  5AFE A;  4CCC A;  1G86 A;  1ND3 C;  1ND3 B;  1XNK A;  2VNG A;  3ILN A;  4J1X A;  1KFU L;  1LU2 A;  4JDO A;  2RMU 2;  5FZB A;  3MUY 1;  3A21 A;  4NHY A;  2BFU S;  2H6C A;  1GP5 A;  2P3I A;  3HD8 B;  3ZFE C;  2J1S A;  1LTE A;  1QMJ A;  4FPC A;  4EE2 A;  1EPW A;  4SBV A;  2Y38 A;  1BMV 2;  3E1F 1;  2QFE A;  3FBM A;  1J84 A;  1OF3 A;  3LB9 A;  3X29 B;  3TWI A;  4DOU A;  3B02 A;  2V5D A;  4Q2F A;  4OHZ A;  4D6R A;  5IVB A;  3WF4 A;  4BWO A;  1EV1 3;  2K0G A;  4M01 A;  1ENS A;  5GJ6 A;  1B35 B;  4IEZ A;  1QGL A;  1X33 A;  3HQR A;  4Y5S A;  2CWM A;  3VGI A;  3NJX A;  1H8T B;  4N53 A;  2O8O A;  1SQ4 A;  3VN4 A;  3LEI A;  4XUN A;  2OW4 A;  4CXW A;  4FFI A;  2WKK A;  2WWJ A;  5A32 B;  4JQT A;  5A3L A;  2HKX A;  2WLP A;  2WRA A;  1Z7S 3;  1RUH 1;  3AVR A;  3NO8 A;  2GNB A;  1ZA7 A;  3KZ4 C;  3OEB A;  4DMI A;  2QUO A;  2V09 A;  4FO9 A;  5FYV A;  3MIF A;  4XF1 A;  2BVV A;  4KWL A;  3PU8 A;  3T30 A;  1COV 2;  2RDR A;  2XML A;  4NJ4 A;  1PGW 1;  3FL7 A;  2JIJ A;  1OFS A;  2DCT A;  1LU1 A;  4IER A;  1ZRD A;  3PHM A;  3O1P A;  3AKR A;  3KMH A;  4KWU A;  1A34 A;  4CUG A;  3RWN A;  2ZMN A;  4QXB A;  1I5Z A;  1S0C A;  2QQI A;  1RVF 3;  4AVS A;  4AI0 A;  3T3Y A;  3TNP B;  5HI0 A;  1H0B A;  1NCR A;  4BQW A;  3UYJ A;  1HDK A;  3T4H B;  4XAA A;  2B39 A;  3EHK A;  1JI6 A;  2D3S A;  3N35 A;  1DIW A;  3DKQ A;  5E88 A;  1LRH A;  3DEC A;  4EQV A;  1SBD A;  3O1V A;  2FDH A;  3W5M A;  2SBA A;  4IGQ A;  1X8E A;  2V4V A;  3CKH A;  5FP8 A;  5KWR A;  5AVP A;  3IBM A;  1XND A;  3HEI A;  4PIZ A;  1FNY A;  1HXS 1;  2RS3 2;  3CBN A;  2EXK A;  2J42 A;  2PHU A;  2E53 A;  2XJQ A;  3C8X A;  1SFP A;  1AJK A;  2CV6 A;  4HAN A;  4ARX A;  2JXA A;  3SH3 A;  1GV9 A;  4G9S B;  1AR7 2;  5EHD A;  3KSC A;  1MZ5 A;  5CFC A;  4JX0 A;  5FMO L;  3ASI A;  4CXY A;  1SCR A;  1PGL 2;  3ZKY A;  4IUG A;  2WWU A;  1AR6 1;  2GNM A;  2RE9 A;  4PT6 A;  4HPK A;  4Y1U A;  5T5O A;  3SLI A;  4JTO A;  4A41 A;  1AR6 2;  1G9D A;  4O65 A;  2GN3 A;  3OB8 A;  1RC6 A;  2VW1 A;  5HV4 A;  1ZRE A;  1UIK A;  5A33 B;  4D7Y A;  2WZP P;  2DV9 A;  2GDF A;  3WQ1 A;  1AVB A;  1K45 A;  1R1A 3;  2D6L X;  1G9A A;  3ZSM A;  3WQ0 A;  4DY3 A;  5D21 A;  1R08 2;  5JOY A;  2BW8 A;  4QU1 A;  4Y20 A;  2D93 A;  4MHR A;  4RS5 A;  5IHR A;  1RTV A;  1Q3E A;  2XUM A;  4Y5Z 0;  3RS6 A;  5BY5 A;  4LO6 B;  1FPN 1;  3J4U H;  3A0K A;  3CF6 E;  1RUJ 2;  1JN2 P;  2JJ6 A;  2QZ3 A;  4IGP A;  1QQP 2;  5FXX A;  4ZU7 A;  5C5T A;  4XUO A;  1VBD 3;  1UMI A;  2BYV E;  1WZX A;  5FMC A;  4QQL A;  2WJS A;  1QJF A;  4Z07 A;  4GMP 3;  2YZ4 A;  2X5I C;  2Z5W A;  4FXG B;  5FK7 A;  1KJR A;  3VZL A;  5GZF A;  3D5O A;  4H2A A;  1ND2 C;  4GJY A;  4JV4 A;  4R52 A;  5DZE A;  4CP9 A;  4RGA A;  4CA9 A;  1GUI A;  1FI2 A;  4JAA A;  3RG0 A;  4M00 A;  1QJU 1;  2C24 A;  3FBY A;  4QD2 A;  5I8T A;  2O8Q A;  2P37 A;  4YGB A;  4GWI A;  1L7Q A;  4ZHN A;  5LAS A;  3IDE A;  2VOK A;  2AUY A;  3OBR A;  4QKD A;  4OUE A;  2WT2 A;  3WF0 A;  4YG0 A;  3OG2 A;  4KMQ A;  1W6N A;  4XFH A;  1ENR A;  1OA2 A;  3POJ A;  3RYR A;  1DF0 A;  3OUI A;  2NZ9 A;  1CAV B;  1F5F A;  1HQN A;  3O1U A;  5IVV A;  2WZ8 A;  1XC6 A;  4B8E A;  2VOW A;  3GCW A;  3P6B A;  1SFY A;  1NA1 C;  2Q0A A;  2VZP A;  3POG A;  3AC0 A;  3WQB A;  4A4A A;  5JXI A;  1GMM A;  5FBJ A;  2VTF A;  2E33 A;  1CN1 A;  3POI A;  2UYA A;  3M3O A;  4FAH A;  5FZM A;  4C1W A;  3AKP A;  3VDD B;  4XIL A;  1RIT A;  1TZO A;  4LK6 A;  4QM8 A;  4CDQ A;  2PHD A;  5IK7 A;  3INA A;  3CZU A;  3TBD A;  4QKN A;  3N7M A;  4XUQ A;  4Y4Y A;  2CDP A;  1DQ2 A;  2GMM A;  5FPL A;  3U14 A;  1MS9 A;  2O14 A;  1KIT A;  1DLC A;  1QJZ A;  2R07 1;  3BCW A;  4LBQ A;  2D6N A;  1WW4 A;  3JZV A;  5F5C A;  4IE4 A;  3WNK A;  4C91 A;  1PM4 A;  4OQ9 A;  4WVW A;  4EZ4 A;  3HJR A;  1JZ6 A;  2BVB A;  2PLV 1;  4CCO A;  5C4W C;  4RFT 0;  3VBS B;  4P5Y A;  2GME A;  1VE0 A;  1EUU A;  2RMU 1;  5HCF A;  5ACA 3;  1VBB 1;  2CTV A;  3ZFE A;  5ABJ A;  4FPE A;  4JTN A;  4BIS A;  1CX1 A;  3S30 A;  5JZG B;  3ZPY A;  2QDN A;  4Z82 A;  1HRI 1;  1N3O A;  2XVG A;  3MW2 A;  5C3O A;  1W8O A;  1AJO A;  2Y33 A;  4I30 A;  4GAL A;  1OA4 A;  5I8S A;  2GNT A;  2CDO A;  1LGN A;  1ND2 B;  4DO0 A;  4BXS V;  1PHM A;  4BCU A;  1JMU B;  3ZYG A;  4NRP A;  4GB3 2;  3I2G A;  3OGS A;  3UES A;  1DYK A;  5FRE A;  3BOD A;  1J3Q A;  5JOZ A;  5G05 L;  1NCR C;  1N47 A;  1ZBE 1;  1YXW A;  2WFF 1;  5DAV A;  5CFD A;  3VDB A;  1MVE A;  3C2U A;  4I02 A;  2CAV A;  1PIV 3;  2VUD A;  3IZO A;  5C8C A;  5CYY A;  2IXK A;  4B4Q A;  2W08 A;  3N4M A;  4LE4 A;  1VBE 2;  2WFF 2;  4IES A;  1GZW A;  1VLN A;  4FVV A;  4J25 A;  1ZRC A;  3N9N A;  4J1W A;  2A3X A;  3NJV A;  1AR6 3;  5JXH A;  2WNU A;  2YC0 A;  2YPJ A;  2BEO A;  4HSJ A;  1YYN A;  1F31 A;  4QQP A;  5L9B A;  2VAU A;  1O8S A;  3RZJ A;  4AEK A;  4FPF A;  1DG6 A;  1EYB A;  2DVF A;  5IK5 A;  4E2S A;  2VQA A;  3GXU A;  5I8Y A;  2A71 A;  1XOY A;  1AF9 A;  3AYD A;  2X8K A;  3ZPO A;  5F7U A;  1G7Y A;  1H1A A;  1NLQ A;  1UW8 A;  1T6B X;  1Y7B A;  3WNX A;  4QPY A;  4K40 A;  1X50 A;  1TQ5 A;  4NIH A;  1JH5 A;  2VZT A;  2D44 A;  1QNW A;  3T09 A;  2VR4 A;  1JS9 A;  2E6V A;  1XNT A;  1RUD 2;  4QX1 A;  1VB4 A;  3LDR A;  5C8C C;  4AGV A;  3QCW A;  3F95 A;  2KR2 A;  2W5F A;  3PUA A;  4IV3 C;  5DDJ 3;  4UF0 A;  3IMM A;  4LIU A;  5FYI A;  1VBD 2;  5FQ0 A;  4OI1 A;  4AYU A;  1MEC 3;  1QJX 3;  2Y64 A;  3SCF A;  2UUR A;  1XNA A;  3RFR A;  5DZG A;  1NAE A;  4YM3 A;  3BPZ A;  1QWR A;  3I3B A;  3MLL A;  3AKS A;  1FMD 2;  4HON A;  1EAH 3;  4XYX A;  4YVS A;  2QCS B;  4LHL A;  1YUD A;  4K8R B;  3AZZ A;  1W0O A;  1V6K A;  1DGR N;  2HH9 A;  1W28 A;  2EAL A;  4CRQ A;  4HVQ A;  2Q1Z B;  1VMF A;  2VZR A;  5AC9 3;  3N9M A;  4QHB A;  3U78 A;  1UX6 A;  4AAP A;  1OFN A;  2KM2 A;  1NZC A;  1RUH 3;  1W8F A;  3DL3 A;  1YEW A;  2JB4 A;  4AHX A;  3W5N A;  1J58 A;  4RD7 A;  1W04 A;  2V4A A;  4DFS A;  3WXP A;  3FE5 A;  1XSR A;  5FO8 B;  2J22 A;  5F2S A;  3QH7 A;  1LES A;  4N53 B;  4MET A;  1JZ5 A;  2WS9 2;  2YU2 A;  1U12 A;  1UQX A;  2VBP A;  3KCC A;  4RGK A;  1UY3 A;  5GKA C;  5FZ4 A;  5DDJ 1;  3AP6 A;  5GLT A;  1WW6 A;  3CNA A;  5EZW A;  2PA7 A;  3UKN A;  1REE A;  1IQD C;  1Y9G A;  2VVD A;  4LHN A;  4OUM A;  4P5H A;  4QX0 A;  3RYP A;  4CCD A;  5IK4 A;  2A6X A;  1GZC A;  1UX7 A;  2XL7 A;  3H8U A;  3SC7 X;  5I91 A;  3USU A;  1JYW A;  1WD3 A;  4L92 A;  1D4M 2;  3U1X A;  3SEP A;  4PDW A;  1YLL A;  1Q5O A;  2MEV 3;  1ACC A;  3PUQ A;  2XVL A;  5ERL A;  2MHF A;  1FPN 2;  1Q8Q A;  4EN0 A;  2WN2 A;  5FZH A;  3PME A;  3J7H A;  4XCB A;  5A1F A;  2RJL A;  1DYO A;  1NQJ A;  1E5I A;  5C6C A;  1IG3 A;  3N7K A;  1RL3 A;  2YPD A;  3E6D A;  2Z79 A;  1EV1 1;  4A42 A;  1UMH A;  3VBR C;  3OGR A;  2N7G A;  4M0N A;  3ZFF A;  1MZ6 A;  2A6V A;  4LBJ A;  2WO2 A;  1WBF A;  3ZXD A;  4O61 A;  2WO7 A;  5A7P A;  3O5S A;  2LAL A;  2V73 A;  4BOW A;  2XKP A;  2JDP A;  5IK8 A;  1VAM A;  4PQ9 A;  1URX A;  1DCS A;  1PGS A;  4K1Y A;  5DAQ A;  2NPI A;  2ZTN A;  3GHM A;  2QQP A;  4YAR A;  2WC2 A;  4HKW A;  5BYN A;  2R49 A;  2BER A;  2VUC A;  1VMH A;  4CYD A;  3GHN A;  4UFM A;  4B3N A;  2TNF A;  4ZKT B;  3HPN A;  1F15 A;  3LKJ A;  5H9Q A;  3H8R A;  1QIQ A;  3J7L A;  2B7Y A;  3SKJ E;  4HKL A;  2P17 A;  4O7X A;  2JDM A;  1E5H A;  1R09 3;  2ZGU A;  3F2Z A;  2RJK A;  2WIN B;  2ORX A;  2Y26 A;  3MGU A;  3OOX A;  4FXK B;  2ZEX A;  1V9U 2;  1YQ8 A;  4CVU A;  1U0A A;  1YFU A;  5IVY A;  2WNV A;  4DY5 A;  2WO1 A;  2JD9 A;  4Q4W 3;  4Q8K A;  3VD7 A;  3H1Y A;  5IVJ A;  1LHV A;  2GN7 A;  1AR9 2;  4XDO A;  2WFF 3;  1B09 A;  1UIJ A;  5BXX A;  4JRL A;  4BQX A;  1Y43 B;  2C9A A;  4KWJ A;  1W8T A;  3T1L A;  3H8O A;  1GKB A;  5A6Z A;  2Z4F A;  1LOF A;  5A33 A;  5CFD C;  2TEP A;  1D7P M;  1RUI 3;  1SMV A;  2PTM A;  1UOF A;  1R09 1;  3BPS A;  1Y9Q A;  2NP0 A;  2IXI A;  4AFD A;  3I59 B;  2R30 A;  4WM7 B;  4NIG A;  3DCQ A;  2A3Y A;  2FMY A;  1K42 A;  4Q29 A;  1VRH 3;  1U5I A;  2EXI A;  2A70 A;  5FLI A;  4XUR A;  2JEN A;  3FFQ A;  1LHW A;  3IAQ A;  4ZU5 A;  2RMU 3;  2Q8E A;  1D2Q A;  1F4A A;  2C9K A;  1W9S A;  3OY8 B;  4L99 A;  3UT0 A;  1CVN A;  5JAX A;  1G9C A;  4BU2 A;  4NAO A;  2PLV 3;  1E5S A;  3KCY A;  3FLT A;  4COY A;  1MZF A;  1PO2 3;  5FR3 A;  2FMD A;  2VXR A;  1YJL A;  2VH9 A;  3GJA A;  1QDC A;  2VMF A;  3MPP G;  4N43 C;  4DIQ A;  1QXP A;  2FDK A;  1PMH X;  2AEY A;  5HPO A;  2OXB A;  5KXE A;  1WCU A;  5FY0 A;  2IWG B;  4AFA A;  1JUH A;  1TME 2;  3AZV A;  3WP4 A;  1NLS A;  1POV 3;  3AP9 A;  2PFW A;  4ISR A;  2W91 A;  3GNE A;  4LBL A;  3KGL A;  4WM7 C;  1K5M A;  1XRU A;  4YZ3 A;  3VKL A;  3VZJ A;  2IXH A;  2MEV 1;  1QH7 A;  1QXR A;  1L7L A;  1MS4 A;  1NG0 A;  2BBA A;  2PHR A;  2WAO A;  5EIY B;  5LWB A;  4AED A;  2P5B A;  2EAK A;  5EJ1 B;  3WHT A;  1W6N B;  3MLK A;  5FK8 A;  5L36 A;  3OBA A;  3WF2 A;  2CHH A;  4RQP C;  4XTP A;  2DBI A;  2PYT A;  1W9T A;  5DAW A;  4IXL A;  5T3N A;  2ID4 A;  4LBQ B;  5FY4 A;  4NPR A;  3VKO A;  1AYM 2;  2RDQ A;  3NST A;  5SV8 A;  3RI9 A;  3TN9 1;  2O1Q A;  5CAZ A;  4BPZ A;  1OOP C;  3I2D A;  3WEZ A;  4ARY A;  2HJI A;  3ZIW A;  1I6X A;  1CX4 A;  4DS0 A;  4OHW A;  1DFQ A;  3ZFE B;  2OZ6 A;  1RHI 1;  4FI9 A;  5M0T A;  5IUQ A;  3FC0 A;  1S0I A;  5A32 A;  5ISL A;  2A1X A;  5GM0 A;  1AZD A;  4FPY A;  1QY4 A;  1NUK A;  3J26 N;  3FN9 A;  3HNB M;  1VBD 1;  5FCC A;  3AL6 A;  4HSL A;  4URA A;  1EP0 A;  1PMI A;  4BE3 A;  3H1M A;  5JPM B;  5FXV A;  4FPO B;  1POQ A;  4ZZ8 A;  2HWC 1;  3RPQ A;  2C1F A;  1CAV A;  4PF1 A;  3KQR A;  5FZK A;  5I93 A;  1FV2 A;  2CGN A;  5FPA A;  3AL5 A;  1PZ7 A;  1CIY A;  2WNV C;  1NE6 A;  5E8A A;  3SNM A;  3RZH A;  4QPI C;  3WUD A;  1GIC A;  1X7N A;  3SH5 A;  1H1I A;  3SXW A;  5ABJ C;  3AZX A;  2QQU A;  3CL1 A;  4S2F A;  4XCA A;  5LK5 A;  2VY0 A;  3DF0 A;  5F5I A;  2YBK A;  3BB6 A;  3QAC A;  4BZ4 A;  1CJD A;  1O3R A;  1DBN A;  2P3Y A;  4YW5 A;  4ERO A;  1M4W A;  4Q4X 2;  4Q4V 2;  3WW4 A;  2VU9 A;  4P9G A;  5LA2 A;  2ORZ A;  1ENX A;  1DQ5 A;  1ULD A;  2HEV F;  3MIG A;  4IV1 C;  1D4M 1;  1HXS 3;  3VBU B;  3UET A;  4AWD A;  1CQ9 A;  4HVO A;  3WUC A;  4WZF A;  3OYW B;  1GZT A;  3VZM A;  2OUJ A;  1SPP B;  1X82 A;  4WM8 A;  1MR5 A;  2XLA A;  1QF3 A;  3MUZ 1;  3MW3 A;  1BVP 1;  4QXK A;  4GA9 A;  4YZ4 A;  5FJH A;  1SZB A;  3OY8 A;  1XBF A;  1UF2 C;  2DVA A;  4JHZ A;  5LA1 A;  1UY2 A;  3UGH A;  3VHR A;  1IGO A;  2BGC A;  1TVG A;  3MFA A;  3HOB A;  4PF5 A;  4NID A;  1H2K A;  2VO5 A;  4PLO A;  3BN6 A;  4QB1 A;  5SV5 A;  4IET A;  5EYY A;  4QPG B;  5JZG A;  4XDQ A;  2VG9 A;  3ACL A;  3OCP A;  4W4Z A;  1CON A;  3AMP A;  4W8J A;  2W39 A;  2W1W A;  4K1Z A;  5F5A A;  3ZSJ A;  2JDN A;  1J83 A;  2WL1 A;  3M3I A;  4XC9 A;  4BIO A;  1JZ3 A;  3E6C C;  3GZA A;  1YRZ A;  3P3N A;  4A7Z A;  5FQ0 B;  3EXU A;  4XFF A;  2Q8D A;  3V56 A;  5IAT A;  5KXD A;  4WM7 A;  1C4R A;  2RG4 A;  3USS A;  1RHI 2;  4C90 A;  5LBC A;  1LCL A;  2Z42 A;  4X6R B;  2ZX1 A;  4S2H A;  1PK6 C;  1LEC A;  2VD7 A;  2VNO A;  4PLN A;  3SCG A;  4A6O A;  4HL0 A;  4L2N A;  3ETP A; 
#chains in the Genus database with same CATH homology
 1O8P A;  3HEI A;  4JKK A;  3C8X A;  1ULO A;  3K46 A;  4ARX A;  2LW8 A;  1SG3 A;  1UYY A;  4JX0 A;  4YPJ A;  4P00 B;  3T08 A;  2QQM A;  4KI5 M;  4IUG A;  2V72 A;  1NKG A;  4PT6 A;  4A41 A;  3FHQ A;  5JMO A;  2LS6 A;  2VC9 A;  5JR2 A;  4CUC A;  1KEX A;  3OB8 A;  3DYO A;  2E26 A;  4DUW A;  1GU3 A;  2W1Q A;  2BGO A;  3GM8 A;  1OD3 A;  1ULP A;  1CZV A;  1K45 A;  1PX4 A;  1UY1 A;  4P08 A;  2QBX A;  5J1X A;  2W3J A;  5IHR A;  1K12 A;  1I5P A;  5EJZ B;  2VZS A;  2L9L A;  4MGQ A;  4XUP A;  1R64 A;  4LQR A;  3LQC A;  4XUT A;  4XUO A;  3MO4 A;  1UMI A;  4DEV A;  4E8C A;  5DMY A;  5IJR A;  3LEK A;  3K75 B;  2XON A;  4RYD A;  4QAW A;  3A22 A;  1GUI A;  3VD4 A;  1PMJ X;  4D8M A;  2JE8 A;  4GWI A;  1L7Q A;  3K4D A;  1JZ8 A;  4OUE A;  3WF0 A;  3OG2 A;  4KMQ A;  3I2H A;  3I3E A;  1LNS A;  2HYX A;  3T0A A;  4PQQ A;  2J1V A;  3HNM A;  2WZ8 A;  1XC6 A;  3I3D A;  3P6B A;  3DYM A;  2VZP A;  3GDB A;  3FHA A;  2W92 A;  3AC0 A;  3WQB A;  4A4A A;  5JXI A;  1GMM A;  4DUX A;  2VTF A;  2E33 A;  4MOA A;  1GQP A;  3ECQ A;  4QDR A;  2VQU A;  4OMD A;  2ZEZ A;  3VDC A;  2E31 A;  4P02 B;  1P8J A;  3VD5 A;  4OZO A;  2VZU A;  3CZU A;  4XUQ A;  2WZE A;  2CDP A;  2VZV A;  3HN3 A;  2EIB A;  4BK5 A;  3LPF A;  3VDA A;  1UWW A;  1DLC A;  4UAP A;  2QQK A;  3K4A A;  3WNK A;  2XQX A;  2QQO A;  3HJR A;  1JZ6 A;  3CZJ A;  4L0P A;  2KD7 A;  2WO3 A;  1KGY A;  4DUV A;  2JDA A;  1W0N A;  3ACF A;  4A44 A;  4P5Y A;  4ET7 A;  1EUU A;  2B4K A;  2VZ3 A;  4ZXE A;  2Y8K A;  4OYU A;  1CX1 A;  3THD A;  4ZZ5 A;  1W8O A;  2CDO A;  4BXS V;  4AAX A;  3WNO A;  1HN1 A;  3T2O A;  3UES A;  3I2G A;  2VCA A;  3OGS A;  3MBW A;  4OMC A;  5G05 L;  2YFU A;  3VDB A;  1SDD B;  2WDB A;  3THC A;  5CYY A;  1UY4 A;  5C70 A;  2C26 A;  3P1I A;  4A3Z A;  1H6Y A;  1GOG A;  4QB2 A;  3NQH A;  3BGA A;  3NJV A;  3MV0 1;  5JXH A;  3LEG A;  4LHS A;  1O59 A;  2W1S A;  1O8S A;  2VMC A;  2W94 A;  3GXU A;  4CU6 A;  3WNN A;  2JKX A;  2YC4 A;  2YB7 A;  5F7U A;  3CIH A;  3III A;  3ACI A;  2VZT A;  5C7G A;  3T09 A;  2BZD A;  2VR4 A;  5HXM A;  1XNT A;  1JYN A;  4QX1 A;  1GOH A;  1W9W A;  2DDU A;  2W5F A;  4E8D A;  1UYZ A;  2J1U A;  2VOT A;  2XHN A;  3CQO A;  2Y64 A;  1L7R A;  3IAP A;  1GOF A;  3T0D A;  3PUH A;  1XNA A;  1UZ0 A;  1NAE A;  2QQN A;  5DQ0 A;  3C7G A;  3I3B A;  4W50 A;  3A23 A;  3DYP A;  2X10 A;  2E32 A;  4QB6 A;  3WNP A;  1JZ7 A;  2VZR A;  5DN2 A;  5I0D A;  5G04 L;  1H6X A;  3W5N A;  1NX9 A;  2QQJ A;  3ACH A;  4GZ9 A;  2DCK A;  5IFT A;  2J22 A;  1JZ5 A;  1UY3 A;  5IFP A;  3CDZ B;  4DXR A;  3JXS A;  1IQD C;  3I97 A;  4QX0 A;  4QX3 A;  3VD3 A;  3VD9 A;  4M4R A;  1UX7 A;  2J1E A;  4CU9 A;  1JYW A;  2VCC A;  2W46 A;  2W95 A;  3SEP A;  3WNM A;  3WNL A;  2WYS A;  2WN2 A;  4QDQ A;  2BGP A;  2OKX A;  2W87 A;  3J7H A;  1W99 A;  4ZY9 A;  3IDA A;  3OEA A;  1DYO A;  1PX3 A;  3ABZ A;  3I2F A;  4JKL A;  4TTG A;  4A42 A;  1UMH A;  1UYX A;  2J1A A;  3OGR A;  4BDV B;  3I2K A;  3MV1 1;  2WO2 A;  1XPW A;  2X05 A;  2VJX A;  1YQ2 A;  5DPN A;  1JYV A;  3NNG A;  2YC2 A;  5LA0 A;  3NRU A;  4CU8 A;  1CZT A;  1UXZ A;  2VZ1 A;  1WCQ A;  2RJ2 A;  2WAA A;  2BER A;  2WAB A;  4QX2 A;  2QQL A;  3WSO A;  3HPN A;  2R7E B;  2YFZ A;  3IB3 A;  3OGV A;  3SKJ E;  3F2Z A;  2ORX A;  3GGL A;  4HG6 B;  2ZEX A;  4CVU A;  2Y6H A;  4DXS A;  2WO1 A;  2JD9 A;  2J1R A;  5FUI A;  3VD7 A;  1W8N A;  2VME A;  3EB7 A;  2C4X A;  3T2P A;  3HNY M;  2EID A;  4UOJ A;  3SKV A;  4CUA A;  2Z4F A;  4CUB A;  1OH4 A;  1D7P M;  4XZU G;  1F4H A;  2DCJ A;  2PQS A;  1WKY A;  1UXX X;  4QDS A;  2VZQ A;  2Y6G A;  4MO3 M;  3I2I A;  2RVA A;  1K42 A;  2Y6J A;  1MPX A;  5JUV A;  4XUR A;  3IAQ A;  4LPL A;  4MGS A;  1F4A A;  2C9K A;  4Z2A A;  1W9S A;  5B4N A;  4BJ0 A;  4DEQ A;  1US3 A;  2VQT A;  2XOM A;  4QPW A;  2WUH A;  2VMF A;  3LE0 A;  3K77 A;  1PMH X;  3ZM8 A;  5HPO A;  4RN5 A;  1T2X A;  3C7H A;  2W91 A;  2X09 A;  3I2J A;  2RV9 A;  2VZO A;  3WF3 A;  2BBA A;  2WAO A;  5EIY B;  5A1A A;  5C71 A;  3C7E A;  1JHJ A;  2ZEY A;  5EJ1 B;  5JXG A;  1RYY A;  3EYP A;  1JYX A;  1UY0 A;  3A7Q A;  3OBA A;  3WF2 A;  5IYY A;  1EUT A;  1W9T A;  1OF4 A;  4LKS A;  2ID4 A;  2VCB A;  3PUI A;  3UNP A;  4TXW A;  1K3I A;  3T2Q A;  3CMG A;  3WEZ A;  4ARY A;  4A45 A;  1JZ2 A;  2ZEW A;  1BHG A;  2J1T A;  1OT5 A;  2VL4 A;  4FI9 A;  2W47 A;  1US2 A;  1JZ4 A;  3WF1 A;  4CU7 A;  3ACG A;  3SEE A;  1NUK A;  3FN9 A;  2ZXQ A;  3HNB M;  2WQ8 A;  3MUY 1;  5CZK A;  4DXT A;  3A21 A;  2VM9 A;  4ZZ8 A;  4PF1 A;  2J1S A;  2WBK A;  3E1F 1;  4UI9 L;  4AG4 A;  1J84 A;  1OF3 A;  1CIY A;  3K4Z A;  2V5D A;  2B9V A;  3T0B A;  3WF4 A;  1GNY A;  1JU4 A;  3NJX A;  2EIC A;  4D0Q A;  2J7M A;  3U37 A;  3LEI A;  4XUN A;  1TG7 A;  2W1U A;  3C7O A;  2Y6L A;  5LA2 A;  2ORZ A;  3UET A;  2Y6K A;  3OEB A;  3C7F A;  2WN3 A;  1JU3 A;  3MUZ 1;  3FL7 A;  2W9X A;  4M4P A;  4JHZ A;  2EIE A;  5LA1 A;  1UY2 A;  4KWU A;  4JKM A;  1TVG A;  2YG0 A;  3HOB A;  2VO5 A;  3BN6 A;  4QB1 A;  1CZS A;  2QQI A;  4W4Z A;  1DP0 A;  4GWJ A;  4W8J A;  2W1W A;  2VMD A;  1J83 A;  1JZ3 A;  1SHW B;  1JI6 A;  3D3A A;  5B4X A;  2HLE A;  4MAD A;  3LPG A;  3DEC A;  4BK4 A;  3W5M A;  5LCW L;  4A6O A;  2V4V A;  4XVH A;  5JXJ A;  3CKH A;  3ETP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...