5FUIA

Crystal structure of the c-terminal cbm6 of lamc a marine laminarianse from zobellia galactanivorans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'NTLKIEAESYLYSNDVQKEPCSEGGENVGYINNGSWMSYPGINFPSSGNYLIEYRVASAVDGGRFSSDLEAGETVLGELSVPNTGGWQNWTTVSQTVNVSAGTYQFGLYSISGGWNINWIRITK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
publication title Unraveling the Multivalent Binding of a Marine Family 6 Carbohydrate-Binding Module with its Native Laminarin Ligand.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5fuiA00
2VCBA 5J1XA 1GQPA 4BK4A 3LPGA 1CZSA 2WQ8A 3T08A 3U37A 3A7QA 4XUPA 2J1RA 3HOBA 2BGPA 1XNTA 4CU8A 2RVAA 4JKKA 3DYOA 2WYSA 4GZ9A 2C4XA 4W8JA 2W91A 2V72A 2VQTA 4XUOA 4ZXEA 4QAWA 4QPWA 2VMDA 3CKHA 5FUIA 5JXGA 4XURA 3CMGA 1R64A 1GOHA 2J1UA 4A45A 2X10A 3K77A 1L7RA 1WCQA 3I3EA 2C9KA 1P8JA 1WKYA 1JU3A 2VZRA 2BZDA 3I3DA 2WO3A 1W8NA 1NKGA 3GGLA 4QDRA 1CIYA 2QBXA 2VCAA 4XUTA 2W1WA 3NJXA 3BN6A 4OMCA 2VC9A 2Y6GA 3ECQA 3MUZ1 4D0QA 3I2GA 2EICA 5EIYB 2KD7A 1YQ2A 5EJ1B 2L9LA 1UX7A 3ACFA 4XVHA 3THDA 1MPXA 4BXSV 2ZXQA 1ULPA 1GNYA 3GDBA 5JR2A 1K3IA 4ARYA 3UNPA 2BGOA 2OKXA 2W87A 3IB3A 1J83A 1GUIA 2W9XA 5CYYA 4CUBA 3NRUA 1W9WA 3I2FA 2HLEA 4D8MA 1PMHX 5LCWL 2ORXA 1PX3A 2WUHA 3VD7A 3WSOA 3WF3A 2W1UA 3CZJA 2VZ1A 3K4ZA 3MO4A 1OT5A 2VMEA 2WABA 3WF1A 1UY2A 2W46A 1K42A 3I2IA 2ZEYA 4QDSA 4MGSA 3T2OA 3HPNA 4JHZA 1ULOA 1UYZA 3MBWA 1PMJX 1DLCA 3P6BA 4DEQA 1JU4A 4QB2A 3WEZA 1JYWA 3A22A 3ABZA 2CDPA 4ARXA 4M4RA 1UY4A 2E33A 2W5FA 3VDAA 4JX0A 2VJXA 2W1SA 2VL4A 3W5NA 4QDQA 1L7QA 4DXSA 2DCKA 2BERA 1US2A 5B4XA 5JXJA 2WZ8A 2X09A 4L0PA 3AC0A 3VD3A 3HNBM 2X05A 2Y6HA 1F4HA 2V4VA 3HEIA 3ZM8A 1UY3A 3LPFA 3DYMA 3C7OA 4A42A 1XNAA 4CVUA 1HN1A 3MUY1 4LQRA 1IQDC 5DPNA 1PX4A 4BDVB 2DDUA 3I2KA 3FHQA 1UMIA 5G04L 3WQBA 2J1VA 2WO1A 3K46A 3BGAA 3OGRA 3J7HA 1KGYA 3OGSA 3JXSA 2B4KA 4IUGA 2Y6JA 5JMOA 2XOMA 3WNOA 4DUVA 1GOGA 2W1QA 1F4AA 3OEAA 2XONA 4W50A 5C7GA 2J7MA 4XUNA 2ZEWA 4W4ZA 2WZEA 1OF4A 2PQSA 2JE8A 1CZTA 2YG0A 1UY1A 4CUCA 1UXZA 4QX1A 4CU7A 1SDDB 2VMFA 5IFPA 2YB7A 3LE0A 3FL7A 3SKVA 2VZTA 1UZ0A 3A23A 5DMYA 3VD5A 2WAAA 2VR4A 5JXIA 3WF2A 2CDOA 4LPLA 3WNNA 2ZEZA 5C71A 1NUKA 1GOFA 3IIIA 3T0AA 4ZZ8A 2JD9A 2VTFA 2WO2A 1OF3A 1JYXA 2V5DA 3ETPA 3E1F1 3MV01 4ZY9A 1XC6A 1TG7A 4PF1A 1JZ8A 1JYVA 2Y6KA 3T0DA 2EIBA 3D3AA 3VDBA 4JKLA 3OG2A 2WN3A 2VZ3A 2Y6LA 1JYNA 1UWWA 3LEIA 4DXTA 4QB1A 4GWJA 2JDAA 4BK5A 2RJ2A 4QX0A 4HG6B 3LQCA 5A1AA 1H6XA 2J1EA 2VMCA 3HNYM 4UOJA 2VCCA 3WNLA 2VZQA 3CZUA 3ACGA 3VDCA 5JXHA 3EB7A 1K45A 4QX3A 1JZ7A 5CZKA 1O8SA 1RYYA 2QQOA 4UAPA 5C70A 3I2JA 3HJRA 2XQXA 1UY0A 3PUIA 4XZUG 4GWIA 4TTGA 2J1SA 4P02B 1I5PA 2WN2A 5B4NA 5LA2A 3WNMA 2LS6A 3C8XA 4QB6A 1JZ2A 2E26A 2Y8KA 2QQIA 3W5MA 2ID4A 2ORZA 4DUXA 2J22A 3A21A 3SKJE 3WF4A 4XUQA 4OZOA 3VD9A 3ACHA 2B9VA 3FHAA 1W9SA 2YFUA 4OYUA 1W8OA 2HYXA 5LA0A 2VZUA 3K75B 3THCA 3FN9A 2WBKA 2QQNA 2QQKA 4DEVA 3WNKA 3T2PA 4LKSA 3ACIA 2J1TA 3I2HA 1J84A 4QX2A 2WAOA 2C26A 2E31A 3C7HA 4DUWA 2YFZA 2W94A 1SG3A 3T2QA 4PT6A 2VQUA 4YPJA 1EUTA 2DCJA 3UETA 1OH4A 4M4PA 1TVGA 2W92A 3I97A 1JZ5A 1JZ6A 3VD4A 3WNPA 2VO5A 2W3JA 4ZZ5A 1D7PM 4A6OA 1JZ4A 4E8CA 5LA1A 4A3ZA 3OEBA 5IFTA 3OBAA 3SEPA 2LW8A 1UXXX 4JKMA 2QQLA 2QQJA 3K4DA 2XHNA 3CDZB 4Z2AA 1CX1A 5DQ0A 3DYPA 5IYYA 1CZVA 4MO3M 4P00B 2VZOA 2Y64A 2J1AA 3GXUA 5I0DA 1H6YA 3F2ZA 3CQOA 3NQHA 2WDBA 1XPWA 4AAXA 1O59A 4ET7A 1JZ3A 4PQQA 1W9TA 3NJVA 1US3A 1JHJA 4FI9A 4OUEA 2VOTA 4P5YA 3SEEA 1DP0A 3DECA 1NX9A 4MOAA 4KMQA 5IHRA 1KEXA 3T0BA 4RN5A 1EUUA 1W0NA 3OGVA 1UYXA 4CU6A 4KI5M 3K4AA 1BHGA 3HNMA 3T09A 2R7EB 5IJRA 4UI9L 5EJZB 5HXMA 1JI6A 5G05L 1GMMA 3LEKA 2QQMA 3C7FA 3C7GA 4A41A 2VM9A 1NAEA 5DN2A 4E8DA 2VZPA 3I3BA 4BJ0A 5HPOA 5JUVA 4AG4A 2EIEA 1O8PA 1SHWB 2YC2A 3LEGA 1LNSA 3WF0A 2JKXA 2VZSA 3MV11 4CU9A 1DYOA 2EIDA 3C7EA 1OD3A 3PUHA 4KWUA 2E32A 2VZVA 3HN3A 4CUAA 4LHSA 3OB8A 4MGQA 3CIHA 4DXRA 3GM8A 4RYDA 2YC4A 3NNGA 3IAPA 3EYPA 2RV9A 4A4AA 3IAQA 2Z4FA 1UMHA 1T2XA 4OMDA 2ZEXA 4MADA 4TXWA 3UESA 2BBAA 3IDAA 5F7UA 1UYYA 1K12A 2W47A 4P08A 4A44A 3P1IA 2W95A 1W99A 1GU3A
chains in the Genus database with same CATH superfamily
1ZA4A 5BPXA 3VBUB 4FPGA 4OI1A 5IK4A 1QXPA 4ZONA 2LRPA 4Q4X3 2YBKA 1G86A 3LPGA 5FV3A 5C4WC 5IVFA 4MXVA 2P5BA 3U37A 2WNUB 2A75A 4X6QB 5FZMA 3PMSA 2VBBA 4BQ1A 4Q4V1 2BGPA 1XNTA 3TAYA 5J48A 2MNGA 1LAJA 5IVBA 3ZYJB 3DUIA 5KC5A 1BVP1 1UO9A 2RVAA 2A6ZA 3VL9A 4AFCA 5C5TA 3AKTA 1MEC2 2F17A 3ORJA 3TWIA 4Q5OA 2R32A 2WYSA 4LTAA 2VQTA 4UFMA 4XBQA 3NV3A 1TQ5A 2F4LA 4QAWA 1X82A 3R4DB 1LCLA 3HAGA 1LKNA 4QXKA 3T1MA 3EJKA 5FUIA 3VN4A 4H7LA 4XURA 3KM5A 5LASA 1AYM1 1EV11 1PVC1 2J1UA 4UW4A 4A45A 1QIQA 2ZX4A 5J3UA 2X10A 2Y26A 3GJAA 1UPIA 4WM8C 4YG3A 4LT5A 1WCQA 5K7PA 4PI0A 2C9KA 1Y9QA 4CEYA 2OXBA 1JU3A 4XACA 2WQZC 4B1LA 2WO3A 1JUHA 3VBFB 5BNQA 5KHHA 4CEWC 2NZ9A 1HB4A 2PHDA 2AREA 3FLPA 2QBXA 1GZWB 1GZTA 1RHI2 5FZGA 3U4XA 4XUTA 2FCVA 1PIV2 2W1WA 4IETA 1O7FA 4AEDC 4B7KA 2ETEA 3BN6A 4ISRA 4YM1A 4OMCA 3JQXA 1X33A 3WT3A 2Q5TA 1KD7A 2VC9A 3H1YA 1ZBE1 2HWE1 3G7DA 4I0AA 3SISA 3GBGA 3ECQA 1IKPA 1J1LA 1Z7S2 3MUZ1 3ZFFB 4D0QA 1VRBA 1OD5A 4XOGA 2QQWA 3V0BA 2AGSA 2RR13 5EJ1B 1LHWA 3ACFA 5F3CA 3FHIB 1D4M3 1MPXA 2ZJCA 3H9AA 3NAPA 2JG8A 3T2TA 4N53B 2B9UA 4LE4A 5HI0A 1A8MA 1GNYA 1UIKA 3NW4A 1CAVB 4AQ6A 1K3IA 3ZYPA 4Q4V2 1PZ7A 4ZU5A 4B1MA 2WS91 2ZA9A 2ET7A 2ZPXA 3RI9A 3ZXFA 1ENQA 5A6XA 4DNYA 4GWMA 1RINA 3EQEA 2A3XA 1UZWA 2BGOA 2W87A 3IB3A 2OKXA 4IV3B 4YNIA 3WP3A 1GUIA 3FFQA 3KV5A 3VZNA 3KLSA 2E51A 5FMBA 4RD7A 5GZEA 4CXWA 2ZAAA 4MG2A 1PMHX 3USSA 2A73B 5LCWL 1X7NA 2Q8CA 2AEZA 3T4HB 3K51A 5A7QA 3PIGA 2FDFA 2E53A 1AYM2 4GMP0 1PVC2 3NKGA 1AX2A 1DZRA 4FCAA 5FLJA 4WVZA 1R083 3ILNA 4KGGA 4P5HA 4XXAA 3PU3A 4JRAA 2XXZA 3LDRA 2XVGA 2JDZA 1S1AA 1O3RA 3LOBA 1UY2A 2W46A 1DYPA 4IEXA 2ZEYA 3MPPG 1CR7A 3QACA 3VKOA 4D69A 4QPGC 4MGSA 1VALA 5JOYA 4XW3A 3T2OA 5FMOL 4OHWA 4PIXA 1ZBE2 1OOPB 2RMU3 1JBCA 1BBT2 2XJRA 3ZFEA 4IEQA 1PMJX 1H2NA 4XBLA 4CDWB 5AFEA 4LKEA 4LE3A 1CPNA 1KITA 3PTYA 5A3TA 1CWPA 3ABZA 3J7NA 2WYFA 4CXYA 5L9BA 2CDPA 4M4RA 5LRRA 1PO11 1DCSA 2XJTA 2WS92 4TWTA 1O3TA 4JX0A 1MZFA 2HWF3 1NG0A 1XU2A 4E9KA 5JSPA 4YSFA 3RQ0A 4WV8A 2I2SA 5ERLA 2ZHMA 2DCKA 1G9BA 1K5MC 2PHXA 4NE9A 3V64A 3BU0A 4YW7A 5A33B 4AI2A 3RZHA 3OUJA 1GNHA 4FOWA 4JQRA 4UWDA 2X09A 3O1OA 4Q1RA 5FP3A 1OUSA 3AP7A 3JB8A 3ZLIA 4KL1A 3NJYA 4JGYC 3ZYGA 1QJU3 4LO5B 1A78A 3Q8EA 4WM7B 3RWNA 4FAHA 3VDDA 5LA9A 2XWJB 3ZM8A 3DYMA 2ZBJA 4AWDA 3BPZA 5FMDA 3IKWA 2R072 1W8ZA 1OMIA 3VHRA 3RFRA 1G9AA 2EXHA 2PQQA 1CAWA 2D7FA 1PX4A 5LBFA 4AEJA 1GWKA 3I2KA 3OF1A 4IGOA 5L9RA 2UY9A 2WNVA 2EALA 1ZM1A 4UF0A 2BWCA 2HWD3 3I3QA 2ES3A 3IN9A 2UY8A 4SBVA 1WW4A 4ZU4A 1UMIA 2W39A 2KM2A 1HKDA 1QQP3 3KHCA 5GJ6A 3AMHA 4LUKA 1QJX1 3OGRA 3CJXA 4AQ2A 3OGSA 1OKOA 2ZX0A 3JXSA 4O65A 1PMIA 2C24A 3ASIA 1E5RA 4KGQA 1S55A 4LXLA 4P9GA 4AHZA 1T6GC 1TEIA 2B4KA 4FPKA 4MHRA 2Y6JA 3K2OA 2XOMA 4K40A 5A3WA 2JDHA 1EYBA 5LBCA 1SLTA 2DBNA 1ZRCA 3P5BA 3VUOA 5FZ0A 1NT0A 1V6KA 5BV6A 1XE0A 1YIPA 1HV0A 2DWRA 1RUG1 1YNAA 1O5UA 1PO12 1GOGA 1OLME 2FMYA 2WNVC 3WDXA 1F4AA 4BM8A 1H0BA 1RUJ3 3LIHA 3RDIA 3OTFA 4XQ4A 2BVBA 4W50A 2J7MA 2D44A 1AR93 5F5QA 1POV3 4P9IA 3MF9A 5BNNC 1ULDA 2CU5A 3FZ3A 1AL23 1FNZA 3ZO0B 2TNFA 3CLPA 3N3HA 1W9FA 1ZNPA 2GC2A 1DG6A 3WP4A 2IXCA 3VBOB 3WINE 2BRTA 2VTXJ 3I49A 1KXGA 1NCQA 1LOGA 5FYYA 1MS3A 3OYWA 5JI9A 3ZMNA 4Z1VA 1OLRA 2J42A 3KT7A 1RUC2 4YVSC 1OQDA 1HB2A 3LGRA 1VBE2 2AENA 1EPZA 2JDMA 4YGDA 4DMIA 5FO9B 1SDDB 2JD4A 3AMMA 4YYOA 2YB7A 3LSEA 3MW4A 3R4SA 4FPCA 4NVPA 5CKNA 4C1WA 4OI2A 1AHSA 3HQXA 4I0WB 3MI8A 2GNBA 3N7LA 4Q0SA 3WD5A 1ASJ3 3THTA 5DMYA 2JJ6A 4LBKA 4O9GA 2H0BA 1DGWA 1NCQC 2VR4A 4R8HA 3WNNA 2ZEZA 4DB5A 3H1MA 3PUSA 4GA9A 2ZKLA 1XQNA 4QX8A 3KV6A 1LB2A 4NROA 4HT1T 5FPZA 1QJX2 1YFWA 4P9LA 5FY9A 4AHYA 5JMCA 5D8AB 1NXD1 4NIAA 3T3YA 1D0HA 4IE5A 4BQWA 2P3IA 4BE3A 4CP2A 5A70A 3H8UA 3M3EA 2H6BA 1OF3A 4JDMA 5E6HA 4HOOA 1NE4A 2WFF3 1FOD1 4HVOA 4MLOA 3ZXAC 4F3JA 2V5DA 5FYSA 2HWC3 3PVNA 4QX5A 1XB9A 2GC3A 3N7JA 1RUG2 1TG7A 4Y1ZA 4YZ5A 5C8WA 3B9CA 5IK7A 4D3WA 1ND3C 5JSOA 4WVMA 3T0DA 1JOBA 1CD3G 2EIBA 3AKQA 3L9JT 4BISA 3DEMA 4L92A 1Q56A 2BPA2 2LUWA 1DFQA 3DL3A 1S2EA 5T5JA 1HIXA 2JDPA 2AH2A 3H7YA 2VVEA 3J8F1 1COV1 4FP2A 3RYKA 3MZHA 3N7KA 3ZXLA 4IEUA 4QU1A 3I2OA 4DXTA 4LULA 2BOJA 1FMD1 3MLJA 3MFCA 1UPSA 1CESA 4YGCA 5T5OA 3AKRA 4LKDA 5FAXA 4QX0A 4LBQB 4IE0A 5FY8A 3AKSA 2P17A 4KWKA 2V5YA 1PHMA 2XBO3 4D7TA 1S0GA 2AR6A 3N9NA 3B94A 4H14A 1CJDA 1ST8A 2PLV3 4IEOA 2O1QA 2NN8A 3CZUA 3ACGA 3WNLA 4AEMA 4Q4X1 1RMU3 3ST7A 5FZ1A 1K45A 4QX3A 1G9CA 1URXA 4XTMA 1JZ7A 1RYYA 1VAMA 1H8TC 2IXIA 4R9DA 2VUAA 3AKPA 5FJHA 1H8VA 1XBFA 5A6YA 5HXVA 1MS0A 1F15A 4Y22B 4CDUB 3RWKX 2NMNA 2VD7A 5CU1A 4QKNA 1W2AX 4GWIA 4OZXA 2YZ4A 1RGSA 4CRQA 2R1DA 5LBBA 1FOD2 2CWMA 1S4CA 5LA2A 1UD1A 1LESA 1VIWB 3WDTA 3AYCA 5BUVA 3S5QA 3C8XA 3PVOA 1VBC3 4EZ4A 4QB6A 3GZEA 4FTBA 2E26A 3MLLA 3N9OA 4KNCA 2QQUA 3UGHA 3W5MA 1REEA 1TNRA 3MLKA 2Q8DA 4DUXA 2G1MA 2KR2A 1SEFA 2RS33 3CEWA 5LWBA 3AL6A 4AE2A 3OUIA 4YGBA 5C8CB 4MYEA 3H3ZA 2DVBA 4RL7A 3HVDA 5JOXA 3AP6A 1ZRIA 5IVJA 3J8F2 4NHKA 3ILFA 5KHJA 1COV2 3VD9A 5FP4A 4BWOA 4LHNA 1FPN3 4W6YA 5FWEA 4BU2A 4P14A 5L7OC 4OYUA 2G9ZA 1LENA 3VV1A 1YYNA 2XDVA 4Y20A 1OQ1A 5FZIA 3NO8A 2VE1A 2VZUA 2WQ4A 1DBNA 1OPMA 4O61A 4YFWA 3S57A 5EXOA 1JYIA 4UFIA 5GLUA 3LA7A 2VW0A 4LKSA 4M3CA 1QGLA 4BCUA 2VMIA 4JGZA 2RR11 5C6CA 1F8VA 1I6XA 1UOJA 2J1TA 3AP9A 1D4M1 4Y3OA 4QX2A 4QWNA 2Z2SB 2LROA 2BWAA 5L9VA 2C26A 5FYUA 4UYBA 2ZGPA 3KB5A 1NA1C 2R49A 1PK6C 1SG3A 2B39A 1O4YA 2W94A 5EJ3A 2CAVA 2VQUA 1ODMA 4XFAA 1CAXB 4LITA 5FLHA 4R9CA 1JZ5A 1C3HA 4HVRA 3VD4A 5HV4A 2YUEA 2E7QA 1F5JA 2W3JA 4ZZ5A 1D7PM 3A0NA 4E8CA 3OD4A 1YJKA 4FAGA 3FC0A 3NV1A 4I30A 5DXDA 3HQRA 1C4RA 4PI2A 4G3YC 5IW0A 3OEBA 1VMFA 3ZXKA 1AR62 2Q8EA 5A6QA 5C33A 4E4HA 2V73A 4FBFA 2B42B 3SEPA 1S2KA 1UXXX 4JKMA 1O4ZA 1OXCA 2BNMA 4MGYE 3ZYFA 3R05A 3AFGA 1R081 3VHPA 5DQ0A 5IYYA 3B5LB 3E5XA 1LOFA 2R0FA 3LFMA 5I0DA 1BBT3 1RL3A 1NLRA 3F2ZA 4XCAA 4ASMB 1WGPA 2Y0IA 1O59A 3LKJA 4BQYA 1XNBA 1OURA 5GLZA 1CAUA 3HT2A 1AYN1 3NJVA 4JRLA 1WZXA 1JHJA 5FZ8A 5JAXA 3CBNA 4AVSA 2VOTA 5CNAA 2RMU1 1KJLA 4UW6A 4NIDA 2OVUA 4QPIC 5BYNA 4AGRA 2RR12 3HMYA 1EUUA 4TSVA 1UYXA 2WKKA 4CU6A 1D4M2 1W3XA 4KI5M 4YZ3A 1BHGA 1UOFA 5T5PA 5IJRA 3ENRA 1JW6A 1KFXL 2JXAA 2VXRA 4GH4C 4LKFA 3IPVB 4BLIA 4Q2FA 4RS5C 3RS6A 4A41A 3B02A 1W6NB 2VM9A 2HWF1 1W06A 3C7GA 3H3UA 1UKGA 4PLOA 5FZ3A 3M3QA 4FFHA 4E8DA 4N43B 1SLCA 5FYHA 4BJ0A 3AMQA 3PU8A 5FZEA 1QEXA 1F35A 1O8PA 1S0CA 3LEGA 3M1HA 1LNSA 3PJYA 3ZVXA 5A3NA 3SH3A 4Y24A 3OUHA 5FKBA 5A3MA 3SXWA 1JUIA 1DYOA 2DVDA 2EIDA 5FYCA 1OD3A 2R073 2GMMA 3Q8BA 2VQAA 5ANQA 2VZVA 3FUOA 1NY71 2FQPA 2KXLA 3POEA 3VHNA 3RG0A 4LHSA 1D2SA 1V6LA 1QJU1 2P6HA 1HLCA 1V70A 3QCWA 5FY7A 2EF6A 5T3NA 4BH9A 1R082 3CIHA 3ZXEA 4DXRA 1IPSA 4X6RB 2RV9A 3DKWA 1SCSA 1TNFA 3HIFA 3ZMOA 3W20A 1C1LA 3IMNA 3L2YA 4AI9A 1H1IA 2Q1ZB 4OMDA 1AZDA 4TXWA 3UKVA 5KXBA 3CU7A 1EY2A 4CP9B 2C5DA 2HWD1 1AYN2 1RUH3 4V2WA 3LOIA 4AFBA 4BQ5A 1XYOA 3OSDA 1GANA 2OPWA 4P08A 5L73A 1OBNA 3P1IA 2ZACA 4AI8A 5K9YA 1WLTA 4COUA 3VBSB 3M7AA 1MACA 1VBD2 1X9PA 1GQPA 4RGAA 1U5YA 4OHXA 4CCLA 4DQAA 4HL0A 4KQ7A 3CHXA 2YBSA 3PDQA 4BK4A 4NWVA 4EROA 5K0UB 3T08A 4DY3A 2Q30A 3SMHA 2WNUA 1QWRA 2J1RA 4XUPA 4YW3A 1W6OA 3HOBA 4LEJA 4LA2A 1AVBA 4LK6A 4AL9A 4C91A 4IEYA 1QXJA 1RUJ1 3EBRA 4Y26A 1W8WA 2K0GA 1WMFA 2HWF2 2OQ6A 2WNOA 2WO7A 1XE8A 4HSLA 3R6SA 3O14A 4AVVA 1AR91 1RUC3 3MIBA 5LEJA 1POV1 2ZMKA 3JB4C 3KVAA 4IEVA 1VBE3 3TEWA 4COVA 3RJ2X 1LTEA 2PHUA 3WDVA 1AL21 3GHMA 4B3NA 4GZ9A 1B35B 4META 4W8JA 1H1MA 4W65A 1S0DA 3DKQA 3MW3A 4XUOA 4C0BA 5KC6A 3KHBA 2E7TA 1NYWA 5FY5A 1ACCA 4NN0A 2JKBA 1NY72 3CKHA 3FMGA 1MS9A 2KA3A 1ENXA 1H30A 5A3OA 3RJRA 5FO8B 5J36A 5DG2A 4PDWB 5FLIA 1BKZA 4TLGA 3BYWA 1LEDA 2AACA 2GAUA 2GDFA 3CF6E 4GKXA 5FK7A 2VMHA 1E5IA 3I3EA 5HCFA 1P8JA 2A1XA 1FAYA 2BZDA 1GYKA 2GH8A 5KXEA 1PZ9A 4AVBA 1W8NA 2G4IA 4QDRA 2ET1A 2WA4A 3VBFA 4K8RB 2DTYA 3ZKYA 1ASJ1 1KDKA 2XPJA 2CAUA 5FZ9A 2HWD2 1GQHA 1MZEA 5A32B 1MVQA 4XF0A 2Y6GA 3ZPOA 3ZFFA 4BMEA 1RITA 5J09A 1ZBA3 2EIGA 1HXS1 1DQ6A 3T1LA 2L9LA 3THDA 2EAKA 2WFF1 2VTXA 3OPTA 3WW4A 4CCJA 3RZGA 1IPJA 1JS9A 2XVKA 2VW1A 2HWC1 4CCEA 2BUKA 1CAVA 1UU4A 3BOPA 4NHYA 4HKLA 1SCRA 4QXHA 3GZAA 5HCBA 4I2OA 1N1YA 3ZFGC 3NMBA 1SZBA 2FBEA 1DGWX 4LIUA 1AR92 4NIIA 4AVCA 4XFBA 1DQ5A 2ILMA 3CNAA 4HKOA 4IV3A 2FMDA 5F6LB 1AL22 1T6BX 3SH5A 3C3VA 3ZX7A 3NRUA 4ZKTB 4QPIB 2HLEA 1BYHA 4W6XA 1OSGA 3AK0A 5KXCA 3ON7A 4A7ZA 3BTXA 1YI7A 4AVAA 3WSOA 3S7EA 2LTNA 3WF3A 2W1UA 2ZABA 3M8LA 1YQCA 3N9LA 2BQPA 2QCSB 4YGEA 4U36A 4DY5A 2P4EA 4H7MA 1R093 1REFA 2VZ1A 2XBO1 2Z79A 4D7SA 3BKZA 4J1WA 2PLV1 2XJQA 3S0MA 3RMYA 1N3PA 1RMU1 2BVVA 1K42A 3GF6A 5JIUA 1DQ0A 1ASJ2 3LIGA 3MIEA 5CIRA 2WWUA 5LK7B 3APBA 4C0HA 4EWAA 2RE9A 5J7MA 1SFNA 3GCXA 4QMAA 3ZSJA 1OOPA 1V6JA 4FPLA 4GKYA 1PNGA 3MBWA 2QDRA 4NUBA 1FT9A 1SLIA 2ZZQA 5T54A 1D0GA 4CDWA 4S2FA 1HXS2 5DZFA 1JYWA 5AC92 2WFF2 2X29A 2N7GA 1A34A 4I0BA 3A22A 4UFLA 1Q8OA 1UL9A 2GU9A 2HWC2 2FDKA 5H9RA 1GV9A 4MGKE 1PGL1 1IS4A 2HYKA 1VBC1 2I45A 4Q27A 1W3VA 3DPRC 1PO23 4HN1A 2C6SA 2CYFA 4NAOA 5A7OA 2VJXA 2RS31 5FUNA 2VL4A 3FE5A 3W5NA 3TYJA 2JICA 3QLQA 3Q9OA 3KF3A 1L7QA 5HCHA 4DXSA 5T5LA 1N3QA 5JCTA 4I3PA 3ALQA 3BPSA 4YVWB 1US2A 5A33A 1FPN1 1Q3EA 5JXJA 4K6BA 5FYZA 1F5FA 2JENA 2ARAA 1ND2C 2VVFA 2WZ8A 3NNJA 4WVWA 5D21A 1AXKA 1AF9A 3HR9A 4HPKA 2UWBA 1OLQA 3AC0A 4UW5A 2JDYA 2R6QA 3IM0A 2XHKA 1UMZA 2BTVC 4HANA 4E2SA 5JZGC 3NKTA 2NYYA 4CSWA 4RQPB 2DF7A 2OA2A 4WM7A 5CEHA 2YDEA 1MS4A 2A6YA 1A8DA 2XBO2 1CX4A 3O1VA 2PLV2 4CVUA 5ACA3 1RMU2 1IKQA 3KT4A 4L99A 4LQRA 4XDOA 3O5SA 2VGDA 5DPNA 1VB2A 4AOCA 4BQ4A 5EPAA 4JDNA 1FATA 3H3LA 4YM2A 1C8NA 3TEXA 5FY1A 4X8PA 3USUB 5FZCA 2FDJA 3TNQA 2ZGSA 1ALYA 3WG3A 1G7YA 1AR63 5G04L 5K4LA 1ZZ6A 2HBTA 5DZGA 4P9YA 5CADA 4IV1A 5I8SA 2RDNA 1W90A 4NMIA 3SQOA 1PNFA 2XLAA 2GMEA 3O12A 2ZMLA 1NZCA 1ZZ7A 2ZGMA 3WXPA 2G9GA 3PJQA 5A1LA 1Y4WA 4PCRA 3WNOA 1PGL2 4DUVA 2JIJA 1VBC2 4YZ4A 4E4ZA 4ASKA 5I91A 2W1QA 3WLUA 1KRIA 2UYAA 4MGTA 4K8FA 2RS32 3UKTA 3RSJA 3FJSA 2Q4SA 1MR5A 1VE0A 5BNOB 2ZEWA 3PIJA 4IV1C 4W4ZA 3WR0A 5CG9A 3D5OA 4CE8A 5CFDB 1BBT1 3N9PA 3WP5A 2ZGLA 1FPN2 2PQSA 2JE8A 2D5FA 2HBUA 2IXJA 2X5IB 3GCWA 1HB3A 3JU9A 1J3RA 4G4FA 5F5CA 4CEYC 5L19A 1CZTA 4QGNA 2YG0A 1NQDA 4ZPIA 1BQPA 3I3MA 3LA3A 4GJZA 4CDXB 3LAGA 4DFSA 2K9ZA 1E5SA 1HRV2 4FPEA 3TEZA 3PUQA 4IEPA 4MUVA 4YW2A 3O1MA 3H1WA 4BA6A 4Z92B 2VMFA 1QU0A 3RVHA 1C8M3 1W2NA 2YPJA 3KS7A 3SKVA 4LOTA 5FR3A 2ZHNA 1QDOA 1YFYA 1UZ0A 3N36A 4XABA 1H2LA 2R16A 1POQA 3A23A 3K3OA 2AEYA 1TME2 5CFCA 2YBPA 4XHBA 3UJQA 1SBDA 1J1TA 3NAPC 3POYA 2JG8C 3TEYA 3KWVA 1GOFA 4AF9A 1IZ3A 5D8AA 3OPWA 2WZR2 4NOTA 2JD9A 3VBRB 4IEZA 1S0BA 1FI2A 3ZKUA 4OI0A 1LHOA 4LIVA 4LBQD 4NHLA 2BBVA 4RGGA 1LU2A 1DZTA 2R043 3WQ7A 4CCOA 3E1F1 3JD71 3UGFA 1NCRA 1XC6A 2R071 3BVCA 5CFCC 4XILA 5FP7A 1HDKA 4HXCA 1FYUA 1JYVA 3HQUA 1YUDA 1W2OA 5GALA 1MS5A 3MF6A 3POWA 2OW4A 3ZXGA 3AZXA 1NOVA 4YW6A 1AYN3 3OG2A 3WCRA 5C9AB 1I5ZA 4JQTA 4B4QA 2WZPP 5I8TA 1JYNA 4ISQA 1UWWA 3AP4A 3LEIA 3WG2A 2QJVA 4QB1A 1VBD3 4DIQA 3PUAA 4KWJA 3B00A 1NCRC 1RUH1 3ZN5A 4XZPA 1O4TA 5LY2A 1REDA 3OCPA 5CG8A 2GH2A 2IVJA 4LBQA 4HG6B 3LQCA 4KBBA 4BXFA 4LBJA 2CY6A 4MSVA 5LY1A 1J58A 4AI1A 2X8KA 4XJAA 5B2GB 3KVBA 4K1YA 2VZQA 1FX5A 1V0AA 1IPKA 1H4HA 2VNRA 4M3CF 3ZFEC 5FDBA 1H2KA 4URTA 3WV6A 5C70A 3VBHA 1H9WA 5L36A 3CJIB 3NV2A 4CTEA 1YQ6A 1Z78A 3AMNA 4LUMA 4PBOA 4K21A 1UY0A 4J1XA 4Y22A 3SNMA 4CDUA 3PUIA 4E4SA 1RUC1 5C4WB 4XZUG 1VBE1 5H9PA 4TTGA 2PHWA 1DF0A 1QH6A 2D6PA 3J9SA 4GQ7A 3E6DA 2WN2A 4XJ8A 4Y4YA 1G9DA 4H55A 3JD72 1RIRA 4NPRA 4YM3A 3WNMA 2E9QA 2OZ6A 3MIGA 1JZ2A 3VBHC 5H9QA 3D0JA 3I2DA 2BNOA 5GLVA 2ORZA 4N9IA 4R9BA 1VBB3 2Z69A 1UN1A 2JG9A 5F3EA 5C8CA 3RZLA 2NP0A 4IE4A 1MS8A 3M3IA 5C3RA 3SC7X 3O0XA 4YZ1A 3ACHA 2VOVA 3VDDC 3FHAA 1W9SA 3R4UA 2D97A 4HKWA 4BPZA 1RUH2 2HYXA 2FCUA 4WM8B 3VZKA 5C3PA 5LA0A 1WMDA 3K75B 1XRUA 1U5XA 3FN9A 2WBKA 5FP9A 2QQKA 4IE6A 1YQ5A 1FNYA 1ZBA1 4CEWB 5FYBA 2JG9C 5BY5A 2XUEA 4GXLA 4JTOA 3WDUA 4G9SB 4EN8B 4MH0E 5ANNA 3NNMA 1QJEA 2WIIB 5GLTA 4YG0A 3V65A 4HFSA 1J84A 4AEDB 2CSGA 2R30A 3KV4A 1AX1A 1LOEA 2ZZJA 4OLLA 2YFZA 1V6OA 3D0SA 3TOJA 3D82A 4LOSA 2DVGA 3AZZA 4MV2A 1OH4A 4FPHA 3UETA 4A7YA 1LGBA 4D6QA 1SMVA 1CAXA 3D8CA 4YLZA 1U12A 3ZYRA 5CKMA 4IGQA 1WBFA 4P9XA 2ADEA 1ZZCA 1N1VA 2YU1A 1BJQA 5DAWA 4A6OA 1S0FA 4XMAA 3WNXA 5FZLA 5BNPA 1JZ4A 4ZHNA 2VNGA 4MX3A 4TLFA 4ZS2A 1RC6A 4BZ4A 4EWDA 1QJY1 5IFTA 4XETA 5FZ4A 4XEZA 1IS6A 2CNAA 2DFCA 3OBAA 4XIOA 1WCSA 3JZVA 4Y1UA 1RUD1 2DUOA 3URFA 2YV8A 5ABJA 1SLBA 3V0BB 2QQJA 3OBTA 2IFWA 2PELA 4V1PA 2HWB2 1OPOA 4N9HA 5IAVA 2UWCA 4Z2AA 1VMJA 1OVSA 1R091 1ULEA 3DYPA 4MO3M 3O1RA 1DYKA 4P00B 3WHUA 5BNPC 1WW7A 1ULFA 2B46X 1H6YA 2VW2A 4BYYA 3P3NA 2D6NA 2WDBA 5EFUA 1XPWA 2D6KA 1HXS3 4S2DA 5F3GA 5M0TA 1WCUA 1OLMA 2LM3A 2JEMA 5JI7A 5AC93 3C2UA 4UFKA 4XF9A 1Y3TA 1QJFA 2YU2A 4GWNA 5ABJC 4E4DX 3GBFA 5JLVA 2WRAA 4RR3A 3WOGA 1ZBA2 5ISLA 5KHKA 3HN1A 3DECA 1NX9A 5JOWA 2VQ0A 5IHRA 2JIGA 2XLFA 1QJZA 3T0BA 2VMGA 1V00A 3DF0A 1W0NA 4K7JA 3TN93 5A3PA 1QH7A 3MEPA 3K4AA 4QPGB 3HNMA 2AC1A 5FYTA 1UKRA 2K46A 5A6ZA 1BLZA 4UI9L 4YW1A 4LK7A 2WWSA 2XGXA 1PO21 1CGPA 3IPVA 3WW3A 2QQMA 3NL1A 5DAVA 3M4FA 3RPQA 1W6NA 3WHTA 5LB6A 2QQVA 4KU7A 2MPFA 2PHRA 4RR3C 2D98A 2EIEA 3VZOA 3UKNA 3PL0A 3U4SA 1DZQA 2OUJA 3AVSA 2JKXA 3UJOA 1MQTA 3WF0A 1GZ9A 5LEKA 2VZSA 2GP3A 4KH9A 1AR83 2IC1A 1QJY2 1KDMA 5D1IA 1LGNA 1Y9GA 1RB8G 1RUD2 2E32A 4KWUA 3AYEA 3SHRA 2ZX1A 4XIKA 4CUAA 1UOBA 2TUNA 2VY0A 3ZN6B 1K5MB 1MVEA 4XF3A 2A6WA 2Y60A 1GQGA 1IGOA 1R092 3GM8A 3NNGA 5FOJB 3IAPA 5KR7A 4A4AA 1DGLA 5ACA1 3IAQA 1GR3A 1LOCA 2XJVA 4JGYB 1MQTC 1JXNA 1UMHA 4LNVA 4MADA 3AP5A 1E57A 5IVCA 4CP9A 4TZDA 1RUF3 3AL5A 4U2AA 4CZSA 3V0AA 2BBAA 3IDAA 3M3OA 1AR61 4EV0A 2Y0OA 4HK9A 4UXAA 5A7PA 3EHKA 2AZ5A 3A4UA 1FV2A 3I59B 4IL7A 5FY4A 2W52A 4A44A 5A3LA 5IK8A 2HJIA 5J1XA 4ES8A 4B8EA 1RJ8A 1IS5A 3QOPA 5E16A 5K0UA 2QE3A 4C1XA 1CZSA 2WQ8A 3A7QA 1LHNA 4Q1PA 2B5HA 1PO22 5DG1A 1UX6A 3IBMA 3O1UA 1SPPB 3FBYA 4L11A 3AFKA 2W2IA 3NJZA 4XF4A 2VBPA 3QH6A 3J7MA 1HRV3 5F6KA 2YXSA 4ATFA 4O9EA 3DYOA 2WNVB 1AR73 4UF0B 1YIFA 2W91A 2X53S 2XJPA 4P9WA 2VBDA 5FXWA 3WUDA 2PYTA 1VMHA 2VNOA 5IAXA 3O1TA 4ZXEA 5BXXA 4QPWA 2VMDA 3BTZA 1RUOA 3DXUA 5BNNB 5JXGA 1TME3 4FQZA 2PA7A 1FXZA 1R64A 4PDWA 1UNBA 5I0RA 1OH3A 2WWJA 5LW9A 1W6PB 1PM4A 3JBG3 1JODA 4GB33 1C8M1 4OQ9A 5ACA2 2XL9A 3TNPB 2VZRA 3I3DA 1DHKB 3KCYA 4FO9A 4BIOA 4Z8BA 3PLQA 3EXUA 3S7IA 1X8MA 5E1RA 4CCKA 4YVSB 1NKGA 1XXNA 2WZR3 1WMEA 3ETQA 1N47A 3AYAA 3GGLA 2C9AA 2Q1MA 4JGZC 4NRQA 3WG4A 1DU3D 3ZSKA 3MDPA 3TBDA 2XR4A 2UYBA 1ZVFA 1LGCA 1HRI1 5A32A 2MHFA 3NVCA 4YW4A 1C5IA 1ZREA 2DCZA 4YG6A 1W8TA 4HSJA 4M01A 3WZ1A 5EIYB 2HKXA 3GZUC 2JB8A 5CAZA 1UX7A 1NCQB 1WLCA 4BXSV 1QMJA 2R041 4UW3A 2FDHA 4Z07A 1EAH2 5KXDA 2YMZA 3GDBA 5JVVA 5JR2A 3VB9A 1WBLA 1UYPA 4R4XA 1BZWA 2HEWF 4CUGA 1I1EA 3WP6A 4DRRA 2B8MA 4XQWA 1R1ZA 1R1A2 3NNFA 4W6WA 2DCYA 3H8XA 1JOJA 1LEMA 1UZVA 2ZKNA 3H8RA 3BB6A 5FOBB 5CYYA 2EA7A 4XF1A 3E97A 2D3RA 3GJBA 4DOUA 1ND3B 5EV7A 5F2SA 1TE1B 1VBD1 1O5LA 1LOFC 2A3WA 4NRMA 4CDQA 3VD7A 3DV8A 5FXZA 2E6VA 2RM23 4OFGA 1AXYA 2IWGB 3CZJA 2UU8A 3SCFA 1JHNA 2PHTA 3DGTA 1C8M2 1IQAA 2E63A 4COYA 3F95A 4D7YA 5FWJA 3K4ZA 4FSJA 2GNMA 1QY4A 1S2BA 2DCTA 2VMEA 1LRHA 2WABA 3I2IA 1XU1A 4JCKA 4FOQA 4WVMB 1SBEA 1GWLA 5DDJ2 4XTPA 3OY8B 3MYXA 4FQ4A 2P34A 4CDQC 3JD73 3O1PA 1HRI2 1GICA 3U78A 1CQ9A 5DAPA 1HB1A 2D3PA 4FXGB 4AR2A 3VL8A 4YW5A 4RA0A 5A7SA 4JZRA 4Q0PA 4DEQA 1ZZBA 3P6BA 2UWAA 1H8TB 1JU4A 4QB2A 4DPNA 3MICA 4MGIE 5FYMA 4BQ2A 3WEZA 4LBMA 4PHZA 2RG4A 2R042 4R4ZA 4XFGA 3ZXJA 3OOXA 3LDBA 4OCTA 1GWMA 4GALA 2E33A 2W5FA 4AGGA 5FQ0A 4NWWA 2Q8OA 3DN7A 1RUE3 1VBB1 1H2MA 1GZCA 2XL7A 4QDQA 1XSQA 4MXWB 3E6BA 4JC1A 5D2AA 5FZOB 3FUQA 1LR5A 3M3CA 3N4MA 2BERA 2OS2A 3VHOA 1WCDJ 1HQWA 2WA3A 4YVWA 5B4XA 4PBPA 3VBUA 2IFRA 2YPDA 4LR4A 3DXTA 3VD3A 4AXOA 1W03A 3HNBM 4E2QA 5DAXA 2Y6HA 4IESA 5GZGA 1F4HA 2V4VA 2ZGNA 1UZZA 4ASLA 2DTWA 3Q8CA 1UY3A 3BALA 3LPFA 5L7OB 4A42A 2G19A 1XNAA 2WT2A 1YQ8A 4JHTA 5E89A 1ZRRA 5EZWA 1BK0A 2TEPA 1XYPA 1IQDC 1LECA 5DUUA 2YROA 3RZJA 4BDVB 3AZYA 4QX7A 1WD3A 4XFHA 3FHQA 4WBBA 3VBUC 2Z5WA 2PFWA 3X29B 3USUA 4M0NA 5E88A 2A71A 3RI8A 1WA6X 2WNUC 4Q4Y3 2PHLA 2FCTA 2PAEA 3J7HA 3PTRB 1SFYA 2MEV1 2RDRA 4K20A 1NA1B 1PK6B 4B29A 1SLLA 2HWB3 1WD4A 2GN7A 5FPVA 4IUGA 1OUXA 3GNEA 3GALA 1J59A 3KGLA 3W21A 1YFXA 2OIIA 3OEAA 1VBB2 5I0UA 3BUCA 4OVEA 1GZWA 5C7GA 1ENSA 3BIEA 4L8QA 1WW6A 1HJFA 2DURA 1NZIA 4MZUA 2WZEA 5FTTC 5BNOA 1VRH3 5GLWA 2XJUA 2WT1A 5CISA 2VG9A 4LHKA 4EYUA 5IATA 4C90A 4K3UA 1SFPA 2WNEA 5F39A 2ZX3A 4UBHA 5AC91 2BOIA 3ZYHA 2OYZA 1NXMA 4CDXA 4N53A 4CUCA 3VBFC 4QX1A 3WDYA 2XUMA 1PM7A 4F7ZA 2O0OA 3TN91 5IFPA 4Y1YA 3LE0A 3AZWA 3FL7A 5F9TA 3UK9A 1AX0A 1DGRN 5AVAA 3ZFFC 3OD0A 3WDWA 1JYCA 4XBNA 2EXKA 1V9U3 3VD5A 4ZU7A 2WLQA 2WAAA 2QKDA 4I02A 4MHUA 5DABA 5FZ7A 1I9RA 3WF2A 3WUCA 3MFAA 4UFJA 3ZYBA 5C71A 1QJY3 1W2TA 5FZAA 4N53C 1UZYA 1RUD3 1YCIA 5FP8A 1RXFA 4XDQA 1I3HA 1ZRFA 2MEV2 4ZZ8A 4EZHA 1W39A 4CCMA 3VBRA 1TZOA 4GH4B 2RS13 4A6SA 1CAUB 5EWSA 5LZ6A 4RS5B 4AQTA 3ME2A 1AR81 4FOYA 5FCCA 1XJAA 2BP6A 4IQPA 3BOWA 3MV01 4IV3C 4ZY9A 4WZCA 2VPVA 3GZTB 3VZMA 2W08A 2Y6KA 3AMPA 2Y33A 4LO6B 1H4GA 3ZDSA 2F4PA 3VDBA 4JKLA 3FX3A 3ZIWA 3S5AA 5C9AA 2XG3A 2Y6FA 2NLRA 1EPWA 2ARCA 4NPMA 2Y6LA 2Z42A 5FXXA 1POV0 2I74A 4JVAA 4FTSA 4Q0QA 2ZGOA 2JDAA 4BIFA 4QPYA 4XQDA 1RUF1 4Y5SA 4BK5A 3WQ1A 3KCXA 1JH5A 2RJ2A 4HN0A 5KHIA 5A1AA 1U5ZA 5CVRA 1H6XA 2J1EA 4ORFA 4FPFA 3TN92 3ACLA 2YY1A 3HNYM 4TYSA 5FFOC 3LB9A 4UOJA 5F8PA 1O91A 3POFA 1OOPC 3V56A 3VDCA 1XSRA 1ULCA 4CDWC 1O8SA 1C57A 1M4WA 2A70A 3SLIA 3I2JA 5FZHA 1GFF2 3CJIA 1H1AA 3M70A 5C3OA 1CVNA 2CGOA 3AM2A 1C1FA 2YGMA 4Q8LA 5EYXA 5H9SA 1VJ2A 2QZ2A 1DIWA 5JPNB 3IMMA 1L7LA 3AJYA 5C4WA 2D6OX 1HRV1 4L9BA 2J1SA 3WW2A 1I5PA 1AR71 3I4IA 3H42B 4AI0A 4QQLA 1AR82 1QKQA 2A5ZA 5B4NA 1Q8VA 4QGLA 1RVF3 3U75A 1DQ4A 2LS6A 1VAVA 3POBA 1Z0HA 2Y8KA 1YXWA 2QQIA 1TME1 1UW8A 2VH9A 2PN5A 3B7MA 3A21A 1BEV3 5FKCA 1W6MB 3WF4A 2OPKA 3W59A 1VR3A 2P3KA 3ILRA 4QD2A 1RUNA 3JBG1 4GB31 5FO7B 3ELNA 2JWPA 1EP0A 1MS1A 1W6OB 4XE9A 4WM7C 3ZSLA 1QF3A 5IWFA 2WZR1 2YFUA 4TN7A 5CB7A 1H9PA 3VGIA 4EN9B 1GNZA 3LCPA 1RUF2 1W8OA 2GSYA 3IT8A 4WM8A 2GZWA 1EAH3 3PURA 1KJRA 3WVJA 4H2AA 4WZFA 4CEWA 4PIZA 4YFZA 1NLQA 3ACIA 3J4UH 2Q1FA 1R1A3 1Y43B 3I2HA 4AEDA 1W0OA 3ZYIB 3WCSA 4CCNA 2WAOA 1LJ7A 4QQ2A 2E31A 5IUQA 3C7HA 4HVQA 1UF2C 2JDKA 3THPA 5C3QA 3T2QA 4PT6A 4YPJA 1EUTA 3FLTA 3OGJA 3S30A 2DCJA 3VBOA 5IVVA 1BMV1 2A6XA 4FPJA 1SQ4A 3DCQA 4KWLA 1YRZA 3RZZA 4CPBD 3LWCA 3MIHA 5IK5A 4GULA 3K3NA 2PAKA 4N7IA 3N35A 4XHXA 1AR72 4BLJA 4F8AA 3IZOA 5LA1A 2QQPA 5C3SA 4IEWA 2Y34A 4A3ZA 4PF5A 3ZFGB 3IIAA 3O7OA 4AFDA 3KD4A 3BTAA 3RNSA 3IDEA 2LW8A 3T30A 1LU1A 4E2GA 2YYOA 2QQLA 5DDJ3 3VBOC 2RM21 1ENRA 5HCAA 2JB4A 1OQEA 3CDZB 4DINB 1D2QA 3JBG2 1SBFA 4GB32 1CX1A 1HRI3 3B3QE 1CZVA 2ATFA 2VZOA 2J1AA 2ENRA 4CP1A 3MHZA 4Q29A 2A7AA 1SACA 5FYIA 1CJPA 1W6QB 3KQ4B 4CPBA 3WY6A 1YFUA 1FV3A 4PQQA 3IDCB 5LK5A 4LBOA 4OUEA 2P1BA 3G6JB 3ZR5A 2XQRA 3CJIC 4GJYA 4P5YA 5EP9A 5J98B 4XFCA 3SEEA 4QGMA 1B09A 2ZGRA 1QOTA 4AYUA 1Y9MA 1OI6A 3NSTA 3OGVA 1K5JA 2ZGUA 1VAKA 1XNKA 2QUOA 3LA2A 4QPGA 1GSLA 2R7EB 5A7NA 4L2NA 5D8AC 5EJZB 1EV12 1JI6A 1TMF3 1F2NA 2G9FA 1X9TA 1BMV2 4OHYA 4QKDA 5FJKA 5IVYA 3LEKA 1JYTA 1RUE1 3PMEA 2PTMA 2W68A 2D93A 1Q43A 2XLGA 1NAEA 4COWA 1O3SA 2VZPA 3I3BA 2ZGQA 5HPOA 5JUVA 1SHWB 4FPOB 3DPRB 1AUYA 1MZ5A 2RJKA 4EWEA 3C7EA 4FXKB 4LO8A 1XNDA 5A7WB 2HWE2 1W8UA 4LORA 3HN3A 4BQXA 4MGZE 3CO2A 4LLFA 2RM22 3OPZA 3PVBB 1LOBA 3OB8A 4MGQA 1K5MA 1Q8QA 2QDNA 2OQ7A 2AUYA 3GBWA 1W2UA 3ZN6A 4RHV3 2ZHKA 2YC4A 1ND2B 3EYPA 4CP0A 3P3PA 5A1FA 4PJYA 5JOZA 2FDIA 4NJ4A 2RDQA 1NQJA 2H0VA 1WLWA 1ULGA 1QNWA 4JGYA 4Z82A 3UL2A 4NAMA 1ZZ8A 4Q26A 5FRAA 1T2XA 5JZGB 1RJ7A 2ZEXA 4UBGA 2WR9A 4XJWA 3UESA 2R063 2ZHLA 2P37A 1OA3A 1WLDA 1UYYA 2DFBA 4QKFA 2XJSA 3KZ4C 3ZDVA 4Q4Y1 2W47A 4RFT0 4QKBA 1UCXA 1OFSA 3I59A 2W95A 2JX9A 2NMOA 3OBRA 1W99A 2IXHA 4XAAA 4Y4RA 3U14A 2VCBA 2Q0AA 2HWB1 3KCCA 2OX0A 4LLOA 4HPKB 4CDUC 2NQYA 4LA3A 5DZEA 1HQNA 2ZTNA 2VUJA 4NO4A 3VKLA 3KQRA 1RUE2 2IZWA 4CU8A 1SPPA 2D40A 3B01A 2LALA 2R1BA 2ZS6B 4JTNA 4JKKA 2F6BA 1VRH1 4N8MA 2ARBA 1WMXA 1YI9A 2RS53 3ZSEA 2OZJA 4XC9A 2C4XA 5JWPA 5C8CC 5FPBA 2V72A 5SV8A 3HBKA 2CTVA 3HD8B 4QXBA 4AFMA 1Y7BA 4S2GA 5GZCA 4IV1B 3I8TA 2RJLA 3T4VA 5BNNA 5I93A 3PHMA 3CMGA 2BU9A 1GOHA 2D5HA 4X8NA 2PHFA 2EAAA 3K77A 1L7RA 1W6PA 3ZN4A 1VLNA 4KU8A 4CEYB 5JDBA 1WKYA 2QFEA 4FFFA 3UV9A 1C28A 3ES1A 2MEV3 4YVSA 1DLLA 1E5HA 1KFUL 2K2SA 1V9U1 1ODNA 1CIYA 2BV4A 5FBJA 2VCAA 2EXIA 4PLNA 3SCGA 4A3XA 3NJXA 1N3OA 4CA9A 4EQVA 4AAPA 5J96B 2OUHA 1Q5OA 2JE9A 4N90A 4Q4Y2 1WUVA 3I2GA 4KG0A 2EICA 2WSVA 2VULA 2KD7A 1YQ2A 1QHDA 2DU0A 1IG3A 3KV9A 4XVHA 3NAPB 2RS11 2JG8B 2GN3A 2ZXQA 1IHMA 3I7DA 1ULPA 5F2WA 4J6GA 2WLPA 1UOGA 1YC61 4IE7A 4JDOA 5E8AA 4ARYA 4Q4W3 4JAAA 5FMCA 3S6PA 2XWBB 5KHGA 4PQ9A 3UNPA 5FZDA 4HZFA 4FP3A 1HV1A 1JOPA 2CL2A 4YARA 4CCDA 1VRH2 1X36A 3SCHA 1J83A 2W9XA 4CUBA 5CFCB 4LHLA 3O0VA 1LOAA 2PAMA 2O8QA 1W9WA 1ND3A 2WINB 3I2FA 1Q8PA 4D8MA 4J25A 5GKAC 3W9AA 3LFIA 4CXXA 3N9MA 4UFHA 2SLIA 3RRDA 3BI3A 3RMXA 2ORXA 4GIQA 1PX3A 2WUHA 2GC0A 2CGNA 4YRDA 2CWSA 5FZFA 1HJGA 1OVPA 2WT0A 2E7AA 1RUI3 5FZKA 4FFIA 4HETA 2D6LX 4B4PA 3AXDA 5DUXA 3KT1A 3FLRA 4XPVA 5GM0A 1NCRB 4N43A 3MO4A 4LO4B 1VBA3 2I07B 1OT5A 3LDKA 4K1ZA 4QHZA 3WF1A 3ZR6A 1ZX5A 1BK1A 2PXJA 3EO6A 1V9U2 1V6MA 4NHMA 3AXEA 1O3QA 3OY8A 4QDSA 1W8HA 4NIGA 2VCMA 2IVIB 3B93A 1CPMA 3HPNA 4JHZA 5GZFA 1ULOA 4D6RA 1UYZA 2DUQA 2R0HA 3HT1A 3POIA 1AXZA 4O7XA 3ZFEB 4C8DA 1DLCA 3GYDA 3SH4A 1H8TA 3PVEA 3WG1A 2RS12 2PMWB 3L2HA 4R52A 1S0IA 2BJSA 3RZKA 3FFZA 2BW8A 4N43C 1IG0A 1RVF1 2D3SA 3KF5A 3Q8AA 4ARXA 1UY4A 4AEKA 5FZ6A 4ZXKA 4DS0A 4Y1VA 4OI4A 3VDAA 1O6UA 2ZAHA 2W1SA 1BEV1 3NNLA 1F31A 1OKQA 1GBGA 1NE6A 2ADDA 3FBMA 4MXWA 4GAZA 4I09A 4M3CE 2JDUA 5FZOA 1MEC3 2HH9A 4SLIA 3VLBB 3B9IA 3VBHB 4KBZA 1G9FA 2O8OA 1L3JA 4INDA 4NHXA 4PIYA 4D6SA 3VBSA 1OC1A 3H8OA 2FZ2A 1GP6A 3LD8A 3BTYA 3MW2A 3TRSB 1HQLA 1S0EA 1GP5A 1LODA 4L0PA 2XB6C 2ZGTA 1KS4A 2V09A 3BCWA 4RGKA 1LHVA 2X05A 1EAH1 4ATEA 3HEIA 5FXVA 1RXGA 2EVXA 4NIHA 5IT6A 3VDDB 3J26N 3C7OA 5L7OA 1U5IA 4HMZA 4QT6A 2C0ZA 4LJHA 1HN1A 3H7JA 3A0KA 4Q8KA 1R1A1 3MUY1 3ZSMA 4BHPA 1CAWB 4DZGA 1YLLA 2D6MA 4XFFA 2FHRA 2DDUA 3VBSC 4XJZA 1B35A 2A3YA 1RHI3 2JG9B 3H50A 3K48A 1AL0G 1PIV3 5K8SA 5K0UC 2P3JA 4AI3A 3QD6A 3WQBA 2XVLA 4GMP3 5FPLA 2J1VA 2WO1A 3U11A 3K46A 2CV6A 1Z7S3 3BGAA 3LF7A 5APAA 1DQ2A 1KGYA 5A80A 3ES4A 1PGW1 4IERA 1NA1A 3AJZA 1PK6A 3HBZA 1FMD2 5LRSA 1N1TA 5JMOA 4QU2A 1RVF2 3LEMA 4B4RA 5EYYA 3RZMA 5FPXA 4ONUA 2ERFA 4Q4V3 1B35C 4Y1XA 4E27A 5DDJ1 3MPBA 2AYHA 2XONA 4WVVA 1BEV2 3VZLA 3CL1A 3MIFA 2YHJA 2A6VA 2VXJA 4OUMA 4XUNA 3WX5A 4FFGA 5FPAA 4HONA 1QNYA 4Q4X2 2RDSA 2DVAA 1OF4A 3RYRA 4PDWC 1DQ1A 1ZYBA 3AVRA 1ONAA 1APNA 3E5QA 4URAA 3OYWB 3D6EA 3M2MA 2RHPA 1UY1A 2BNNA 4Y33A 4AVTA 2VOXA 2P3YA 1UXZA 2BEOA 5GZDA 1AYM3 1EV13 3ITQA 1PVC3 2BFUS 4CU7A 5BNPB 2VNVA 3PNAA 2DBIA 1V6IA 1XYNA 4QHBA 2NPIA 4LO7A 2VZTA 4A7KA 3FWEA 2VUDA 3UT0A 1J3PA 3BU7A 5ABJB 3KMHA 1GLHA 4FT8A 2FDGA 1KS5A 4QPIA 1TMF1 5JXIA 5KWRA 4UT5A 2CDOA 4LPLA 4EN7B 4N7UA 2CHHA 1NUKA 5C5UA 1PGSA 4BQ3A 4XDPA 3POSA 1ZBE3 2HWE3 2VUCA 1YO8A 3IIIA 1OHFA 2ZCWA 1IOAA 3MGUA 1OA4A 1PGW2 4LBLA 3T0AA 4A2UA 3AX4A 2VTFA 2WO2A 5LBEA 2DV9A 1JYXA 2ZX2A 2UURA 1UU6A 4GH4A 5F5IA 5FUPA 1N1SA 4OHVA 4RS5A 3U1XA 1ZRDA 3UYJA 3ETPA 1PZ8A 5AVPA 1SLAA 1C5HA 4M00A 4PF1A 1JZ8A 4GD4A 4RR3B 2ZOEB 2YC0A 3KSCA 2EXJA 2WS93 1Q8SA 3ROUA 2P6CA 1XNCA 4OULA 4P9JA 3D3AA 1QXRA 4RHV1 2WN3A 4YZ2A 1DGRA 2VZ3A 4Y5Z0 1W8FA 2HEYF 4YM0A 5EHDA 3U10A 1ZA7A 5FBZA 5CA6A 3B69A 2DUPA 2VECA 2WFPA 4F83A 2IUWA 4GWJA 3Q8FA 4K9SA 1W0PA 4OQ8A 2R061 1ZZ9A 4BOWA 1MQTB 2DVFA 2JDNA 2GMPA 2VMCA 3AYDA 4EE2A 1WA4A 4YWAA 5JSRA 3IDBB 4HBNA 2VCCA 4AW7A 4QQOA 5JXHA 1X8EA 3EB7A 5HBAA 2QVSB 4DO0A 2ZGKA 5T52A 5CZKA 5DUVA 4UAPA 2QQOA 4AK3A 1W04A 4FTEA 1TMF2 4QM9A 4QQHA 3HJRA 2WC2A 4IW3A 5I8YA 2C1FA 2XQXA 3U07A 5A3UA 3OJBA 2GP5A 4AGVA 1A3KA 1UAIA 2OT7A 4JV4A 1YHFA 3TB0A 4P02B 2RS51 2WSUA 4RQPA 3H0OA 4Y5TA 3JUUA 4AZZA 3V0AB 4D94A 2XKOA 1CN1A 3O1SA 4Q0UA 1QOSA 3E6CC 2RMU2 4L97A 2DU1A 1QQP1 5JR7B 1PO13 2ID4A 3GHNA 4YVWC 1D4VB 3ZPYA 2J22A 4EN0A 1XE7A 3SKJE 2W0XA 3HWJA 1W6MA 3ATGA 4RHV2 5SV5A 3NV4A 4XUQA 2VOWA 4OZOA 5HV0A 5F37A 2QTWB 2H6CA 1VPHA 1M06G 5F5AA 2SBAA 2ZMNA 4RQPC 3QH7A 2B9VA 1IS3A 3ZIXA 4I01A 2P2KA 4IDZA 5CKQA 3UGGA 5FREA 4Y20B 4CCCA 2R062 4PLMA 1NLSA 2B7YA 4HLTA 1V6NA 4FPYA 3ZOIA 3N7MA 3AZVA 1QOOA 1MZ6A 2VU9A 2QQNA 1WW5A 3JCIA 3THCA 4QHOA 4DEVA 4M3CB 3T2PA 3WNKA 4AHWA 5FK8A 1JN2P 4JGZB 4LBNA 4XCBA 4ZS3A 1HW5A 3I54A 5FY0A 3VKMA 3LSDA 4NR1A 2CGPA 5FIXA 5CFDA 1QJU2 4OHZA 4DUWA 1W28A 2V4AA 1KQRA 1VP6A 2XH6A 4Q4W1 2WJSA 2X5IA 5I0SA 1X50A 4M4PA 2YGLA 1TVGA 4COZA 3POGA 4NRPA 2W92A 3I97A 4QM8A 4AFAA 4EN6B 3WNPA 1QJX3 2VO5A 1JZ6A 2B45X 2BGCA 1CIWA 4XXPA 2RS52 4Z2WA 3NWKA 3O0WA 2BYVE 2XKPA 1YEWA 2HEVF 1G8WA 2XMLA 5DUWA 3AB0A 5T50A 3ZFGA 4EJRA 1F9KA 5BNOC 1JMUB 1UIJA 3OBZA 5FMOS 1QQP2 1RUG3 5CFDC 3JQWA 5EQUA 5F3IA 4DRVA 2VOKA 2FD8A 1LULA 3K4DA 2X5IC 5F1RA 3E5UA 1CONA 1W05A 2WL1A 1G6NA 1RUI1 3D4KA 4DXZA 2TBVA 2XHNA 2IXLA 4CDXC 4V2VA 1XOYA 2Y64A 3IWZA 4S2HA 3GXUA 1VBA1 2GC1A 3CQOA 1WWYA 3INAA 3NQHA 2VVDA 4QQPA 3RYPA 1RUJ2 4AAXA 1W6QA 3VZJA 3KGZA 4ET7A 1JZ3A 1W9TA 2GALA 1JTZX 4AQSA 4RSUA 1US3A 2QNKA 4FI9A 3OGGA 1UU5A 3EMRA 1RTVA 1DP0A 4MOAA 4M0HA 4KMQA 1KEXA 2ARXA 4RN5A 5FYVA 3N9QA 2FZ1A 4XFIA 5T55A 5DAQA 2VAUA 2DYCA 3T09A 4CDQB 1HX6A 4XJ9A 5J37A 1U0AA 5FPUA 1UQXA 4Q0VA 5HXMA 3VBRC 4XJUA 4BB3A 5KBFA 5FZBA 1STMA 4Q4W2 5G05L 1GMMA 2JECA 3SITA 4OUSA 3C7FA 4I3GA 5DN2A 3LZZA 1WCKA 2GNDA 4IXLA 4MVTA 4R9AA 4XMIA 5AFBA 2O14A 2BFUL 2D43A 4AG4A 1BVVA 1LHUA 2YC2A 3U0ZA 1MEC1 4RFRB 1YJLA 3MIDA 4CYDA 3DPRA 1S0JA 3POJA 4IGPA 1FOD3 4LMFA 5C9AC 3MV11 5JIAA 4FVVA 4CU9A 1BCXA 1QDCA 4XYXA 3PUHA 5A7WA 2BDRA 4AHXA 4B7EA 3WQ0A 3VKNA 5IVEA 3W58A 3WW1A 1BXHA 1OA2A 3ZXDA 1RUI2 1W9YA 1YWKA 3BIWE 4KG8A 4XAEA 5LATA 1DDLA 3VKFC 4RYDA 4FOVA 1ND2A 1A6CA 1AJKA 2NM1A 3J7LA 2Y38A 2Z4FA 3J8F3 2QZ3A 4ITCA 1COV3 1VBA2 5CBLA 1HN0A 4QXCA 1GKBA 5FQ0B 2JE7A 3QBQA 1VB4A 5TSWA 5JZGA 4BMBA 2IXKA 1FMD3 1J3QA 1AJOA 4HK8A 3RGBA 1RHI1 4ES9A 3R0RA 1PVXA 5JPMB 1PIV1 5F7UA 1OFNA 4NPLA 5F32A 2GNTA 1K12A 3BODA 4GMP1 1SDWA 5I0TA 1Z7S1 1GP4A 4H3WA 1GU3A
chains in the Genus database with same CATH topology
2VCBA 5J1XA 1GQPA 4BK4A 3LPGA 1CZSA 2WQ8A 3T08A 3U37A 3A7QA 4XUPA 2J1RA 3HOBA 2BGPA 1XNTA 4CU8A 2RVAA 4JKKA 3DYOA 2WYSA 4GZ9A 2C4XA 4W8JA 2W91A 2V72A 2VQTA 4XUOA 4ZXEA 4QAWA 4QPWA 2VMDA 3CKHA 5FUIA 5JXGA 4XURA 3CMGA 1R64A 1GOHA 2J1UA 4A45A 2X10A 3K77A 1L7RA 1WCQA 3I3EA 2C9KA 1P8JA 1WKYA 1JU3A 2VZRA 2BZDA 3I3DA 2WO3A 1W8NA 1NKGA 3GGLA 4QDRA 1CIYA 2QBXA 2VCAA 4XUTA 2W1WA 3NJXA 3BN6A 4OMCA 2VC9A 2Y6GA 3ECQA 3MUZ1 4D0QA 3I2GA 2EICA 5EIYB 2KD7A 1YQ2A 5EJ1B 2L9LA 1UX7A 3ACFA 4XVHA 3THDA 1MPXA 4BXSV 2ZXQA 1ULPA 1GNYA 3GDBA 5JR2A 1K3IA 4ARYA 3UNPA 2BGOA 2OKXA 2W87A 3IB3A 1J83A 1GUIA 2W9XA 5CYYA 4CUBA 3NRUA 1W9WA 3I2FA 2HLEA 4D8MA 1PMHX 5LCWL 2ORXA 1PX3A 2WUHA 3VD7A 3WSOA 3WF3A 2W1UA 3CZJA 2VZ1A 3K4ZA 3MO4A 1OT5A 2VMEA 2WABA 3WF1A 1UY2A 2W46A 1K42A 3I2IA 2ZEYA 4QDSA 4MGSA 3T2OA 3HPNA 4JHZA 1ULOA 1UYZA 3MBWA 1PMJX 1DLCA 3P6BA 4DEQA 1JU4A 4QB2A 3WEZA 1JYWA 3A22A 3ABZA 2CDPA 4ARXA 4M4RA 1UY4A 2E33A 2W5FA 3VDAA 4JX0A 2VJXA 2W1SA 2VL4A 3W5NA 4QDQA 1L7QA 4DXSA 2DCKA 2BERA 1US2A 5B4XA 5JXJA 2WZ8A 2X09A 4L0PA 3AC0A 3VD3A 3HNBM 2X05A 2Y6HA 1F4HA 2V4VA 3HEIA 3ZM8A 1UY3A 3LPFA 3DYMA 3C7OA 4A42A 1XNAA 4CVUA 1HN1A 3MUY1 4LQRA 1IQDC 5DPNA 1PX4A 4BDVB 2DDUA 3I2KA 3FHQA 1UMIA 5G04L 3WQBA 2J1VA 2WO1A 3K46A 3BGAA 3OGRA 3J7HA 1KGYA 3OGSA 3JXSA 2B4KA 4IUGA 2Y6JA 5JMOA 2XOMA 3WNOA 4DUVA 1GOGA 2W1QA 1F4AA 3OEAA 2XONA 4W50A 5C7GA 2J7MA 4XUNA 2ZEWA 4W4ZA 2WZEA 1OF4A 2PQSA 2JE8A 1CZTA 2YG0A 1UY1A 4CUCA 1UXZA 4QX1A 4CU7A 1SDDB 2VMFA 5IFPA 2YB7A 3LE0A 3FL7A 3SKVA 2VZTA 1UZ0A 3A23A 5DMYA 3VD5A 2WAAA 2VR4A 5JXIA 3WF2A 2CDOA 4LPLA 3WNNA 2ZEZA 5C71A 1NUKA 1GOFA 3IIIA 3T0AA 4ZZ8A 2JD9A 2VTFA 2WO2A 1OF3A 1JYXA 2V5DA 3ETPA 3E1F1 3MV01 4ZY9A 1XC6A 1TG7A 4PF1A 1JZ8A 1JYVA 2Y6KA 3T0DA 2EIBA 3D3AA 3VDBA 4JKLA 3OG2A 2WN3A 2VZ3A 2Y6LA 1JYNA 1UWWA 3LEIA 4DXTA 4QB1A 4GWJA 2JDAA 4BK5A 2RJ2A 4QX0A 4HG6B 3LQCA 5A1AA 1H6XA 2J1EA 2VMCA 3HNYM 4UOJA 2VCCA 3WNLA 2VZQA 3CZUA 3ACGA 3VDCA 5JXHA 3EB7A 1K45A 4QX3A 1JZ7A 5CZKA 1O8SA 1RYYA 2QQOA 4UAPA 5C70A 3I2JA 3HJRA 2XQXA 1UY0A 3PUIA 4XZUG 4GWIA 4TTGA 2J1SA 4P02B 1I5PA 2WN2A 5B4NA 5LA2A 3WNMA 2LS6A 3C8XA 4QB6A 1JZ2A 2E26A 2Y8KA 2QQIA 3W5MA 2ID4A 2ORZA 4DUXA 2J22A 3A21A 3SKJE 3WF4A 4XUQA 4OZOA 3VD9A 3ACHA 2B9VA 3FHAA 1W9SA 2YFUA 4OYUA 1W8OA 2HYXA 5LA0A 2VZUA 3K75B 3THCA 3FN9A 2WBKA 2QQNA 2QQKA 4DEVA 3WNKA 3T2PA 4LKSA 3ACIA 2J1TA 3I2HA 1J84A 4QX2A 2WAOA 2C26A 2E31A 3C7HA 4DUWA 2YFZA 2W94A 1SG3A 3T2QA 4PT6A 2VQUA 4YPJA 1EUTA 2DCJA 3UETA 1OH4A 4M4PA 1TVGA 2W92A 3I97A 1JZ5A 1JZ6A 3VD4A 3WNPA 2VO5A 2W3JA 4ZZ5A 1D7PM 4A6OA 1JZ4A 4E8CA 5LA1A 4A3ZA 3OEBA 5IFTA 3OBAA 3SEPA 2LW8A 1UXXX 4JKMA 2QQLA 2QQJA 3K4DA 2XHNA 3CDZB 4Z2AA 1CX1A 5DQ0A 3DYPA 5IYYA 1CZVA 4MO3M 4P00B 2VZOA 2Y64A 2J1AA 3GXUA 5I0DA 1H6YA 3F2ZA 3CQOA 3NQHA 2WDBA 1XPWA 4AAXA 1O59A 4ET7A 1JZ3A 4PQQA 1W9TA 3NJVA 1US3A 1JHJA 4FI9A 4OUEA 2VOTA 4P5YA 3SEEA 1DP0A 3DECA 1NX9A 4MOAA 4KMQA 5IHRA 1KEXA 3T0BA 4RN5A 1EUUA 1W0NA 3OGVA 1UYXA 4CU6A 4KI5M 3K4AA 1BHGA 3HNMA 3T09A 2R7EB 5IJRA 4UI9L 5EJZB 5HXMA 1JI6A 5G05L 1GMMA 3LEKA 2QQMA 3C7FA 3C7GA 4A41A 2VM9A 1NAEA 5DN2A 4E8DA 2VZPA 3I3BA 4BJ0A 5HPOA 5JUVA 4AG4A 2EIEA 1O8PA 1SHWB 2YC2A 3LEGA 1LNSA 3WF0A 2JKXA 2VZSA 3MV11 4CU9A 1DYOA 2EIDA 3C7EA 1OD3A 3PUHA 4KWUA 2E32A 2VZVA 3HN3A 4CUAA 4LHSA 3OB8A 4MGQA 3CIHA 4DXRA 3GM8A 4RYDA 2YC4A 3NNGA 3IAPA 3EYPA 2RV9A 4A4AA 3IAQA 2Z4FA 1UMHA 1T2XA 4OMDA 2ZEXA 4MADA 4TXWA 3UESA 2BBAA 3IDAA 5F7UA 1UYYA 1K12A 2W47A 4P08A 4A44A 3P1IA 2W95A 1W99A 1GU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCB A;  5J1X A;  1GQP A;  4BK4 A;  3LPG A;  1CZS A;  2WQ8 A;  3T08 A;  3U37 A;  3A7Q A;  4XUP A;  2J1R A;  3HOB A;  2BGP A;  1XNT A;  4CU8 A;  2RVA A;  4JKK A;  3DYO A;  2WYS A;  4GZ9 A;  2C4X A;  4W8J A;  2W91 A;  2V72 A;  2VQT A;  4XUO A;  4ZXE A;  4QAW A;  4QPW A;  2VMD A;  3CKH A;  5FUI A;  5JXG A;  4XUR A;  3CMG A;  1R64 A;  1GOH A;  2J1U A;  4A45 A;  2X10 A;  3K77 A;  1L7R A;  1WCQ A;  3I3E A;  2C9K A;  1P8J A;  1WKY A;  1JU3 A;  2VZR A;  2BZD A;  3I3D A;  2WO3 A;  1W8N A;  1NKG A;  3GGL A;  4QDR A;  1CIY A;  2QBX A;  2VCA A;  4XUT A;  2W1W A;  3NJX A;  3BN6 A;  4OMC A;  2VC9 A;  2Y6G A;  3ECQ A;  3MUZ 1;  4D0Q A;  3I2G A;  2EIC A;  5EIY B;  2KD7 A;  1YQ2 A;  5EJ1 B;  2L9L A;  1UX7 A;  3ACF A;  4XVH A;  3THD A;  1MPX A;  4BXS V;  2ZXQ A;  1ULP A;  1GNY A;  3GDB A;  5JR2 A;  1K3I A;  4ARY A;  3UNP A;  2BGO A;  2OKX A;  2W87 A;  3IB3 A;  1J83 A;  1GUI A;  2W9X A;  5CYY A;  4CUB A;  3NRU A;  1W9W A;  3I2F A;  2HLE A;  4D8M A;  1PMH X;  5LCW L;  2ORX A;  1PX3 A;  2WUH A;  3VD7 A;  3WSO A;  3WF3 A;  2W1U A;  3CZJ A;  2VZ1 A;  3K4Z A;  3MO4 A;  1OT5 A;  2VME A;  2WAB A;  3WF1 A;  1UY2 A;  2W46 A;  1K42 A;  3I2I A;  2ZEY A;  4QDS A;  4MGS A;  3T2O A;  3HPN A;  4JHZ A;  1ULO A;  1UYZ A;  3MBW A;  1PMJ X;  1DLC A;  3P6B A;  4DEQ A;  1JU4 A;  4QB2 A;  3WEZ A;  1JYW A;  3A22 A;  3ABZ A;  2CDP A;  4ARX A;  4M4R A;  1UY4 A;  2E33 A;  2W5F A;  3VDA A;  4JX0 A;  2VJX A;  2W1S A;  2VL4 A;  3W5N A;  4QDQ A;  1L7Q A;  4DXS A;  2DCK A;  2BER A;  1US2 A;  5B4X A;  5JXJ A;  2WZ8 A;  2X09 A;  4L0P A;  3AC0 A;  3VD3 A;  3HNB M;  2X05 A;  2Y6H A;  1F4H A;  2V4V A;  3HEI A;  3ZM8 A;  1UY3 A;  3LPF A;  3DYM A;  3C7O A;  4A42 A;  1XNA A;  4CVU A;  1HN1 A;  3MUY 1;  4LQR A;  1IQD C;  5DPN A;  1PX4 A;  4BDV B;  2DDU A;  3I2K A;  3FHQ A;  1UMI A;  5G04 L;  3WQB A;  2J1V A;  2WO1 A;  3K46 A;  3BGA A;  3OGR A;  3J7H A;  1KGY A;  3OGS A;  3JXS A;  2B4K A;  4IUG A;  2Y6J A;  5JMO A;  2XOM A;  3WNO A;  4DUV A;  1GOG A;  2W1Q A;  1F4A A;  3OEA A;  2XON A;  4W50 A;  5C7G A;  2J7M A;  4XUN A;  2ZEW A;  4W4Z A;  2WZE A;  1OF4 A;  2PQS A;  2JE8 A;  1CZT A;  2YG0 A;  1UY1 A;  4CUC A;  1UXZ A;  4QX1 A;  4CU7 A;  1SDD B;  2VMF A;  5IFP A;  2YB7 A;  3LE0 A;  3FL7 A;  3SKV A;  2VZT A;  1UZ0 A;  3A23 A;  5DMY A;  3VD5 A;  2WAA A;  2VR4 A;  5JXI A;  3WF2 A;  2CDO A;  4LPL A;  3WNN A;  2ZEZ A;  5C71 A;  1NUK A;  1GOF A;  3III A;  3T0A A;  4ZZ8 A;  2JD9 A;  2VTF A;  2WO2 A;  1OF3 A;  1JYX A;  2V5D A;  3ETP A;  3E1F 1;  3MV0 1;  4ZY9 A;  1XC6 A;  1TG7 A;  4PF1 A;  1JZ8 A;  1JYV A;  2Y6K A;  3T0D A;  2EIB A;  3D3A A;  3VDB A;  4JKL A;  3OG2 A;  2WN3 A;  2VZ3 A;  2Y6L A;  1JYN A;  1UWW A;  3LEI A;  4DXT A;  4QB1 A;  4GWJ A;  2JDA A;  4BK5 A;  2RJ2 A;  4QX0 A;  4HG6 B;  3LQC A;  5A1A A;  1H6X A;  2J1E A;  2VMC A;  3HNY M;  4UOJ A;  2VCC A;  3WNL A;  2VZQ A;  3CZU A;  3ACG A;  3VDC A;  5JXH A;  3EB7 A;  1K45 A;  4QX3 A;  1JZ7 A;  5CZK A;  1O8S A;  1RYY A;  2QQO A;  4UAP A;  5C70 A;  3I2J A;  3HJR A;  2XQX A;  1UY0 A;  3PUI A;  4XZU G;  4GWI A;  4TTG A;  2J1S A;  4P02 B;  1I5P A;  2WN2 A;  5B4N A;  5LA2 A;  3WNM A;  2LS6 A;  3C8X A;  4QB6 A;  1JZ2 A;  2E26 A;  2Y8K A;  2QQI A;  3W5M A;  2ID4 A;  2ORZ A;  4DUX A;  2J22 A;  3A21 A;  3SKJ E;  3WF4 A;  4XUQ A;  4OZO A;  3VD9 A;  3ACH A;  2B9V A;  3FHA A;  1W9S A;  2YFU A;  4OYU A;  1W8O A;  2HYX A;  5LA0 A;  2VZU A;  3K75 B;  3THC A;  3FN9 A;  2WBK A;  2QQN A;  2QQK A;  4DEV A;  3WNK A;  3T2P A;  4LKS A;  3ACI A;  2J1T A;  3I2H A;  1J84 A;  4QX2 A;  2WAO A;  2C26 A;  2E31 A;  3C7H A;  4DUW A;  2YFZ A;  2W94 A;  1SG3 A;  3T2Q A;  4PT6 A;  2VQU A;  4YPJ A;  1EUT A;  2DCJ A;  3UET A;  1OH4 A;  4M4P A;  1TVG A;  2W92 A;  3I97 A;  1JZ5 A;  1JZ6 A;  3VD4 A;  3WNP A;  2VO5 A;  2W3J A;  4ZZ5 A;  1D7P M;  4A6O A;  1JZ4 A;  4E8C A;  5LA1 A;  4A3Z A;  3OEB A;  5IFT A;  3OBA A;  3SEP A;  2LW8 A;  1UXX X;  4JKM A;  2QQL A;  2QQJ A;  3K4D A;  2XHN A;  3CDZ B;  4Z2A A;  1CX1 A;  5DQ0 A;  3DYP A;  5IYY A;  1CZV A;  4MO3 M;  4P00 B;  2VZO A;  2Y64 A;  2J1A A;  3GXU A;  5I0D A;  1H6Y A;  3F2Z A;  3CQO A;  3NQH A;  2WDB A;  1XPW A;  4AAX A;  1O59 A;  4ET7 A;  1JZ3 A;  4PQQ A;  1W9T A;  3NJV A;  1US3 A;  1JHJ A;  4FI9 A;  4OUE A;  2VOT A;  4P5Y A;  3SEE A;  1DP0 A;  3DEC A;  1NX9 A;  4MOA A;  4KMQ A;  5IHR A;  1KEX A;  3T0B A;  4RN5 A;  1EUU A;  1W0N A;  3OGV A;  1UYX A;  4CU6 A;  4KI5 M;  3K4A A;  1BHG A;  3HNM A;  3T09 A;  2R7E B;  5IJR A;  4UI9 L;  5EJZ B;  5HXM A;  1JI6 A;  5G05 L;  1GMM A;  3LEK A;  2QQM A;  3C7F A;  3C7G A;  4A41 A;  2VM9 A;  1NAE A;  5DN2 A;  4E8D A;  2VZP A;  3I3B A;  4BJ0 A;  5HPO A;  5JUV A;  4AG4 A;  2EIE A;  1O8P A;  1SHW B;  2YC2 A;  3LEG A;  1LNS A;  3WF0 A;  2JKX A;  2VZS A;  3MV1 1;  4CU9 A;  1DYO A;  2EID A;  3C7E A;  1OD3 A;  3PUH A;  4KWU A;  2E32 A;  2VZV A;  3HN3 A;  4CUA A;  4LHS A;  3OB8 A;  4MGQ A;  3CIH A;  4DXR A;  3GM8 A;  4RYD A;  2YC4 A;  3NNG A;  3IAP A;  3EYP A;  2RV9 A;  4A4A A;  3IAQ A;  2Z4F A;  1UMH A;  1T2X A;  4OMD A;  2ZEX A;  4MAD A;  4TXW A;  3UES A;  2BBA A;  3IDA A;  5F7U A;  1UYY A;  1K12 A;  2W47 A;  4P08 A;  4A44 A;  3P1I A;  2W95 A;  1W99 A;  1GU3 A; 
#chains in the Genus database with same CATH topology
 1ZA4 A;  5BPX A;  3VBU B;  4FPG A;  4OI1 A;  5IK4 A;  1QXP A;  4ZON A;  2LRP A;  4Q4X 3;  2YBK A;  1G86 A;  3LPG A;  5FV3 A;  5C4W C;  5IVF A;  4MXV A;  2P5B A;  3U37 A;  2WNU B;  2A75 A;  4X6Q B;  5FZM A;  3PMS A;  2VBB A;  4BQ1 A;  4Q4V 1;  2BGP A;  1XNT A;  3TAY A;  5J48 A;  2MNG A;  1LAJ A;  5IVB A;  3ZYJ B;  3DUI A;  5KC5 A;  1BVP 1;  1UO9 A;  2RVA A;  2A6Z A;  3VL9 A;  4AFC A;  5C5T A;  3AKT A;  1MEC 2;  2F17 A;  3ORJ A;  3TWI A;  4Q5O A;  2R32 A;  2WYS A;  4LTA A;  2VQT A;  4UFM A;  4XBQ A;  3NV3 A;  1TQ5 A;  2F4L A;  4QAW A;  1X82 A;  3R4D B;  1LCL A;  3HAG A;  1LKN A;  4QXK A;  3T1M A;  3EJK A;  5FUI A;  3VN4 A;  4H7L A;  4XUR A;  3KM5 A;  5LAS A;  1AYM 1;  1EV1 1;  1PVC 1;  2J1U A;  4UW4 A;  4A45 A;  1QIQ A;  2ZX4 A;  5J3U A;  2X10 A;  2Y26 A;  3GJA A;  1UPI A;  4WM8 C;  4YG3 A;  4LT5 A;  1WCQ A;  5K7P A;  4PI0 A;  2C9K A;  1Y9Q A;  4CEY A;  2OXB A;  1JU3 A;  4XAC A;  2WQZ C;  4B1L A;  2WO3 A;  1JUH A;  3VBF B;  5BNQ A;  5KHH A;  4CEW C;  2NZ9 A;  1HB4 A;  2PHD A;  2ARE A;  3FLP A;  2QBX A;  1GZW B;  1GZT A;  1RHI 2;  5FZG A;  3U4X A;  4XUT A;  2FCV A;  1PIV 2;  2W1W A;  4IET A;  1O7F A;  4AED C;  4B7K A;  2ETE A;  3BN6 A;  4ISR A;  4YM1 A;  4OMC A;  3JQX A;  1X33 A;  3WT3 A;  2Q5T A;  1KD7 A;  2VC9 A;  3H1Y A;  1ZBE 1;  2HWE 1;  3G7D A;  4I0A A;  3SIS A;  3GBG A;  3ECQ A;  1IKP A;  1J1L A;  1Z7S 2;  3MUZ 1;  3ZFF B;  4D0Q A;  1VRB A;  1OD5 A;  4XOG A;  2QQW A;  3V0B A;  2AGS A;  2RR1 3;  5EJ1 B;  1LHW A;  3ACF A;  5F3C A;  3FHI B;  1D4M 3;  1MPX A;  2ZJC A;  3H9A A;  3NAP A;  2JG8 A;  3T2T A;  4N53 B;  2B9U A;  4LE4 A;  5HI0 A;  1A8M A;  1GNY A;  1UIK A;  3NW4 A;  1CAV B;  4AQ6 A;  1K3I A;  3ZYP A;  4Q4V 2;  1PZ7 A;  4ZU5 A;  4B1M A;  2WS9 1;  2ZA9 A;  2ET7 A;  2ZPX A;  3RI9 A;  3ZXF A;  1ENQ A;  5A6X A;  4DNY A;  4GWM A;  1RIN A;  3EQE A;  2A3X A;  1UZW A;  2BGO A;  2W87 A;  3IB3 A;  2OKX A;  4IV3 B;  4YNI A;  3WP3 A;  1GUI A;  3FFQ A;  3KV5 A;  3VZN A;  3KLS A;  2E51 A;  5FMB A;  4RD7 A;  5GZE A;  4CXW A;  2ZAA A;  4MG2 A;  1PMH X;  3USS A;  2A73 B;  5LCW L;  1X7N A;  2Q8C A;  2AEZ A;  3T4H B;  3K51 A;  5A7Q A;  3PIG A;  2FDF A;  2E53 A;  1AYM 2;  4GMP 0;  1PVC 2;  3NKG A;  1AX2 A;  1DZR A;  4FCA A;  5FLJ A;  4WVZ A;  1R08 3;  3ILN A;  4KGG A;  4P5H A;  4XXA A;  3PU3 A;  4JRA A;  2XXZ A;  3LDR A;  2XVG A;  2JDZ A;  1S1A A;  1O3R A;  3LOB A;  1UY2 A;  2W46 A;  1DYP A;  4IEX A;  2ZEY A;  3MPP G;  1CR7 A;  3QAC A;  3VKO A;  4D69 A;  4QPG C;  4MGS A;  1VAL A;  5JOY A;  4XW3 A;  3T2O A;  5FMO L;  4OHW A;  4PIX A;  1ZBE 2;  1OOP B;  2RMU 3;  1JBC A;  1BBT 2;  2XJR A;  3ZFE A;  4IEQ A;  1PMJ X;  1H2N A;  4XBL A;  4CDW B;  5AFE A;  4LKE A;  4LE3 A;  1CPN A;  1KIT A;  3PTY A;  5A3T A;  1CWP A;  3ABZ A;  3J7N A;  2WYF A;  4CXY A;  5L9B A;  2CDP A;  4M4R A;  5LRR A;  1PO1 1;  1DCS A;  2XJT A;  2WS9 2;  4TWT A;  1O3T A;  4JX0 A;  1MZF A;  2HWF 3;  1NG0 A;  1XU2 A;  4E9K A;  5JSP A;  4YSF A;  3RQ0 A;  4WV8 A;  2I2S A;  5ERL A;  2ZHM A;  2DCK A;  1G9B A;  1K5M C;  2PHX A;  4NE9 A;  3V64 A;  3BU0 A;  4YW7 A;  5A33 B;  4AI2 A;  3RZH A;  3OUJ A;  1GNH A;  4FOW A;  4JQR A;  4UWD A;  2X09 A;  3O1O A;  4Q1R A;  5FP3 A;  1OUS A;  3AP7 A;  3JB8 A;  3ZLI A;  4KL1 A;  3NJY A;  4JGY C;  3ZYG A;  1QJU 3;  4LO5 B;  1A78 A;  3Q8E A;  4WM7 B;  3RWN A;  4FAH A;  3VDD A;  5LA9 A;  2XWJ B;  3ZM8 A;  3DYM A;  2ZBJ A;  4AWD A;  3BPZ A;  5FMD A;  3IKW A;  2R07 2;  1W8Z A;  1OMI A;  3VHR A;  3RFR A;  1G9A A;  2EXH A;  2PQQ A;  1CAW A;  2D7F A;  1PX4 A;  5LBF A;  4AEJ A;  1GWK A;  3I2K A;  3OF1 A;  4IGO A;  5L9R A;  2UY9 A;  2WNV A;  2EAL A;  1ZM1 A;  4UF0 A;  2BWC A;  2HWD 3;  3I3Q A;  2ES3 A;  3IN9 A;  2UY8 A;  4SBV A;  1WW4 A;  4ZU4 A;  1UMI A;  2W39 A;  2KM2 A;  1HKD A;  1QQP 3;  3KHC A;  5GJ6 A;  3AMH A;  4LUK A;  1QJX 1;  3OGR A;  3CJX A;  4AQ2 A;  3OGS A;  1OKO A;  2ZX0 A;  3JXS A;  4O65 A;  1PMI A;  2C24 A;  3ASI A;  1E5R A;  4KGQ A;  1S55 A;  4LXL A;  4P9G A;  4AHZ A;  1T6G C;  1TEI A;  2B4K A;  4FPK A;  4MHR A;  2Y6J A;  3K2O A;  2XOM A;  4K40 A;  5A3W A;  2JDH A;  1EYB A;  5LBC A;  1SLT A;  2DBN A;  1ZRC A;  3P5B A;  3VUO A;  5FZ0 A;  1NT0 A;  1V6K A;  5BV6 A;  1XE0 A;  1YIP A;  1HV0 A;  2DWR A;  1RUG 1;  1YNA A;  1O5U A;  1PO1 2;  1GOG A;  1OLM E;  2FMY A;  2WNV C;  3WDX A;  1F4A A;  4BM8 A;  1H0B A;  1RUJ 3;  3LIH A;  3RDI A;  3OTF A;  4XQ4 A;  2BVB A;  4W50 A;  2J7M A;  2D44 A;  1AR9 3;  5F5Q A;  1POV 3;  4P9I A;  3MF9 A;  5BNN C;  1ULD A;  2CU5 A;  3FZ3 A;  1AL2 3;  1FNZ A;  3ZO0 B;  2TNF A;  3CLP A;  3N3H A;  1W9F A;  1ZNP A;  2GC2 A;  1DG6 A;  3WP4 A;  2IXC A;  3VBO B;  3WIN E;  2BRT A;  2VTX J;  3I49 A;  1KXG A;  1NCQ A;  1LOG A;  5FYY A;  1MS3 A;  3OYW A;  5JI9 A;  3ZMN A;  4Z1V A;  1OLR A;  2J42 A;  3KT7 A;  1RUC 2;  4YVS C;  1OQD A;  1HB2 A;  3LGR A;  1VBE 2;  2AEN A;  1EPZ A;  2JDM A;  4YGD A;  4DMI A;  5FO9 B;  1SDD B;  2JD4 A;  3AMM A;  4YYO A;  2YB7 A;  3LSE A;  3MW4 A;  3R4S A;  4FPC A;  4NVP A;  5CKN A;  4C1W A;  4OI2 A;  1AHS A;  3HQX A;  4I0W B;  3MI8 A;  2GNB A;  3N7L A;  4Q0S A;  3WD5 A;  1ASJ 3;  3THT A;  5DMY A;  2JJ6 A;  4LBK A;  4O9G A;  2H0B A;  1DGW A;  1NCQ C;  2VR4 A;  4R8H A;  3WNN A;  2ZEZ A;  4DB5 A;  3H1M A;  3PUS A;  4GA9 A;  2ZKL A;  1XQN A;  4QX8 A;  3KV6 A;  1LB2 A;  4NRO A;  4HT1 T;  5FPZ A;  1QJX 2;  1YFW A;  4P9L A;  5FY9 A;  4AHY A;  5JMC A;  5D8A B;  1NXD 1;  4NIA A;  3T3Y A;  1D0H A;  4IE5 A;  4BQW A;  2P3I A;  4BE3 A;  4CP2 A;  5A70 A;  3H8U A;  3M3E A;  2H6B A;  1OF3 A;  4JDM A;  5E6H A;  4HOO A;  1NE4 A;  2WFF 3;  1FOD 1;  4HVO A;  4MLO A;  3ZXA C;  4F3J A;  2V5D A;  5FYS A;  2HWC 3;  3PVN A;  4QX5 A;  1XB9 A;  2GC3 A;  3N7J A;  1RUG 2;  1TG7 A;  4Y1Z A;  4YZ5 A;  5C8W A;  3B9C A;  5IK7 A;  4D3W A;  1ND3 C;  5JSO A;  4WVM A;  3T0D A;  1JOB A;  1CD3 G;  2EIB A;  3AKQ A;  3L9J T;  4BIS A;  3DEM A;  4L92 A;  1Q56 A;  2BPA 2;  2LUW A;  1DFQ A;  3DL3 A;  1S2E A;  5T5J A;  1HIX A;  2JDP A;  2AH2 A;  3H7Y A;  2VVE A;  3J8F 1;  1COV 1;  4FP2 A;  3RYK A;  3MZH A;  3N7K A;  3ZXL A;  4IEU A;  4QU1 A;  3I2O A;  4DXT A;  4LUL A;  2BOJ A;  1FMD 1;  3MLJ A;  3MFC A;  1UPS A;  1CES A;  4YGC A;  5T5O A;  3AKR A;  4LKD A;  5FAX A;  4QX0 A;  4LBQ B;  4IE0 A;  5FY8 A;  3AKS A;  2P17 A;  4KWK A;  2V5Y A;  1PHM A;  2XBO 3;  4D7T A;  1S0G A;  2AR6 A;  3N9N A;  3B94 A;  4H14 A;  1CJD A;  1ST8 A;  2PLV 3;  4IEO A;  2O1Q A;  2NN8 A;  3CZU A;  3ACG A;  3WNL A;  4AEM A;  4Q4X 1;  1RMU 3;  3ST7 A;  5FZ1 A;  1K45 A;  4QX3 A;  1G9C A;  1URX A;  4XTM A;  1JZ7 A;  1RYY A;  1VAM A;  1H8T C;  2IXI A;  4R9D A;  2VUA A;  3AKP A;  5FJH A;  1H8V A;  1XBF A;  5A6Y A;  5HXV A;  1MS0 A;  1F15 A;  4Y22 B;  4CDU B;  3RWK X;  2NMN A;  2VD7 A;  5CU1 A;  4QKN A;  1W2A X;  4GWI A;  4OZX A;  2YZ4 A;  1RGS A;  4CRQ A;  2R1D A;  5LBB A;  1FOD 2;  2CWM A;  1S4C A;  5LA2 A;  1UD1 A;  1LES A;  1VIW B;  3WDT A;  3AYC A;  5BUV A;  3S5Q A;  3C8X A;  3PVO A;  1VBC 3;  4EZ4 A;  4QB6 A;  3GZE A;  4FTB A;  2E26 A;  3MLL A;  3N9O A;  4KNC A;  2QQU A;  3UGH A;  3W5M A;  1REE A;  1TNR A;  3MLK A;  2Q8D A;  4DUX A;  2G1M A;  2KR2 A;  1SEF A;  2RS3 3;  3CEW A;  5LWB A;  3AL6 A;  4AE2 A;  3OUI A;  4YGB A;  5C8C B;  4MYE A;  3H3Z A;  2DVB A;  4RL7 A;  3HVD A;  5JOX A;  3AP6 A;  1ZRI A;  5IVJ A;  3J8F 2;  4NHK A;  3ILF A;  5KHJ A;  1COV 2;  3VD9 A;  5FP4 A;  4BWO A;  4LHN A;  1FPN 3;  4W6Y A;  5FWE A;  4BU2 A;  4P14 A;  5L7O C;  4OYU A;  2G9Z A;  1LEN A;  3VV1 A;  1YYN A;  2XDV A;  4Y20 A;  1OQ1 A;  5FZI A;  3NO8 A;  2VE1 A;  2VZU A;  2WQ4 A;  1DBN A;  1OPM A;  4O61 A;  4YFW A;  3S57 A;  5EXO A;  1JYI A;  4UFI A;  5GLU A;  3LA7 A;  2VW0 A;  4LKS A;  4M3C A;  1QGL A;  4BCU A;  2VMI A;  4JGZ A;  2RR1 1;  5C6C A;  1F8V A;  1I6X A;  1UOJ A;  2J1T A;  3AP9 A;  1D4M 1;  4Y3O A;  4QX2 A;  4QWN A;  2Z2S B;  2LRO A;  2BWA A;  5L9V A;  2C26 A;  5FYU A;  4UYB A;  2ZGP A;  3KB5 A;  1NA1 C;  2R49 A;  1PK6 C;  1SG3 A;  2B39 A;  1O4Y A;  2W94 A;  5EJ3 A;  2CAV A;  2VQU A;  1ODM A;  4XFA A;  1CAX B;  4LIT A;  5FLH A;  4R9C A;  1JZ5 A;  1C3H A;  4HVR A;  3VD4 A;  5HV4 A;  2YUE A;  2E7Q A;  1F5J A;  2W3J A;  4ZZ5 A;  1D7P M;  3A0N A;  4E8C A;  3OD4 A;  1YJK A;  4FAG A;  3FC0 A;  3NV1 A;  4I30 A;  5DXD A;  3HQR A;  1C4R A;  4PI2 A;  4G3Y C;  5IW0 A;  3OEB A;  1VMF A;  3ZXK A;  1AR6 2;  2Q8E A;  5A6Q A;  5C33 A;  4E4H A;  2V73 A;  4FBF A;  2B42 B;  3SEP A;  1S2K A;  1UXX X;  4JKM A;  1O4Z A;  1OXC A;  2BNM A;  4MGY E;  3ZYF A;  3R05 A;  3AFG A;  1R08 1;  3VHP A;  5DQ0 A;  5IYY A;  3B5L B;  3E5X A;  1LOF A;  2R0F A;  3LFM A;  5I0D A;  1BBT 3;  1RL3 A;  1NLR A;  3F2Z A;  4XCA A;  4ASM B;  1WGP A;  2Y0I A;  1O59 A;  3LKJ A;  4BQY A;  1XNB A;  1OUR A;  5GLZ A;  1CAU A;  3HT2 A;  1AYN 1;  3NJV A;  4JRL A;  1WZX A;  1JHJ A;  5FZ8 A;  5JAX A;  3CBN A;  4AVS A;  2VOT A;  5CNA A;  2RMU 1;  1KJL A;  4UW6 A;  4NID A;  2OVU A;  4QPI C;  5BYN A;  4AGR A;  2RR1 2;  3HMY A;  1EUU A;  4TSV A;  1UYX A;  2WKK A;  4CU6 A;  1D4M 2;  1W3X A;  4KI5 M;  4YZ3 A;  1BHG A;  1UOF A;  5T5P A;  5IJR A;  3ENR A;  1JW6 A;  1KFX L;  2JXA A;  2VXR A;  4GH4 C;  4LKF A;  3IPV B;  4BLI A;  4Q2F A;  4RS5 C;  3RS6 A;  4A41 A;  3B02 A;  1W6N B;  2VM9 A;  2HWF 1;  1W06 A;  3C7G A;  3H3U A;  1UKG A;  4PLO A;  5FZ3 A;  3M3Q A;  4FFH A;  4E8D A;  4N43 B;  1SLC A;  5FYH A;  4BJ0 A;  3AMQ A;  3PU8 A;  5FZE A;  1QEX A;  1F35 A;  1O8P A;  1S0C A;  3LEG A;  3M1H A;  1LNS A;  3PJY A;  3ZVX A;  5A3N A;  3SH3 A;  4Y24 A;  3OUH A;  5FKB A;  5A3M A;  3SXW A;  1JUI A;  1DYO A;  2DVD A;  2EID A;  5FYC A;  1OD3 A;  2R07 3;  2GMM A;  3Q8B A;  2VQA A;  5ANQ A;  2VZV A;  3FUO A;  1NY7 1;  2FQP A;  2KXL A;  3POE A;  3VHN A;  3RG0 A;  4LHS A;  1D2S A;  1V6L A;  1QJU 1;  2P6H A;  1HLC A;  1V70 A;  3QCW A;  5FY7 A;  2EF6 A;  5T3N A;  4BH9 A;  1R08 2;  3CIH A;  3ZXE A;  4DXR A;  1IPS A;  4X6R B;  2RV9 A;  3DKW A;  1SCS A;  1TNF A;  3HIF A;  3ZMO A;  3W20 A;  1C1L A;  3IMN A;  3L2Y A;  4AI9 A;  1H1I A;  2Q1Z B;  4OMD A;  1AZD A;  4TXW A;  3UKV A;  5KXB A;  3CU7 A;  1EY2 A;  4CP9 B;  2C5D A;  2HWD 1;  1AYN 2;  1RUH 3;  4V2W A;  3LOI A;  4AFB A;  4BQ5 A;  1XYO A;  3OSD A;  1GAN A;  2OPW A;  4P08 A;  5L73 A;  1OBN A;  3P1I A;  2ZAC A;  4AI8 A;  5K9Y A;  1WLT A;  4COU A;  3VBS B;  3M7A A;  1MAC A;  1VBD 2;  1X9P A;  1GQP A;  4RGA A;  1U5Y A;  4OHX A;  4CCL A;  4DQA A;  4HL0 A;  4KQ7 A;  3CHX A;  2YBS A;  3PDQ A;  4BK4 A;  4NWV A;  4ERO A;  5K0U B;  3T08 A;  4DY3 A;  2Q30 A;  3SMH A;  2WNU A;  1QWR A;  2J1R A;  4XUP A;  4YW3 A;  1W6O A;  3HOB A;  4LEJ A;  4LA2 A;  1AVB A;  4LK6 A;  4AL9 A;  4C91 A;  4IEY A;  1QXJ A;  1RUJ 1;  3EBR A;  4Y26 A;  1W8W A;  2K0G A;  1WMF A;  2HWF 2;  2OQ6 A;  2WNO A;  2WO7 A;  1XE8 A;  4HSL A;  3R6S A;  3O14 A;  4AVV A;  1AR9 1;  1RUC 3;  3MIB A;  5LEJ A;  1POV 1;  2ZMK A;  3JB4 C;  3KVA A;  4IEV A;  1VBE 3;  3TEW A;  4COV A;  3RJ2 X;  1LTE A;  2PHU A;  3WDV A;  1AL2 1;  3GHM A;  4B3N A;  4GZ9 A;  1B35 B;  4MET A;  4W8J A;  1H1M A;  4W65 A;  1S0D A;  3DKQ A;  3MW3 A;  4XUO A;  4C0B A;  5KC6 A;  3KHB A;  2E7T A;  1NYW A;  5FY5 A;  1ACC A;  4NN0 A;  2JKB A;  1NY7 2;  3CKH A;  3FMG A;  1MS9 A;  2KA3 A;  1ENX A;  1H30 A;  5A3O A;  3RJR A;  5FO8 B;  5J36 A;  5DG2 A;  4PDW B;  5FLI A;  1BKZ A;  4TLG A;  3BYW A;  1LED A;  2AAC A;  2GAU A;  2GDF A;  3CF6 E;  4GKX A;  5FK7 A;  2VMH A;  1E5I A;  3I3E A;  5HCF A;  1P8J A;  2A1X A;  1FAY A;  2BZD A;  1GYK A;  2GH8 A;  5KXE A;  1PZ9 A;  4AVB A;  1W8N A;  2G4I A;  4QDR A;  2ET1 A;  2WA4 A;  3VBF A;  4K8R B;  2DTY A;  3ZKY A;  1ASJ 1;  1KDK A;  2XPJ A;  2CAU A;  5FZ9 A;  2HWD 2;  1GQH A;  1MZE A;  5A32 B;  1MVQ A;  4XF0 A;  2Y6G A;  3ZPO A;  3ZFF A;  4BME A;  1RIT A;  5J09 A;  1ZBA 3;  2EIG A;  1HXS 1;  1DQ6 A;  3T1L A;  2L9L A;  3THD A;  2EAK A;  2WFF 1;  2VTX A;  3OPT A;  3WW4 A;  4CCJ A;  3RZG A;  1IPJ A;  1JS9 A;  2XVK A;  2VW1 A;  2HWC 1;  4CCE A;  2BUK A;  1CAV A;  1UU4 A;  3BOP A;  4NHY A;  4HKL A;  1SCR A;  4QXH A;  3GZA A;  5HCB A;  4I2O A;  1N1Y A;  3ZFG C;  3NMB A;  1SZB A;  2FBE A;  1DGW X;  4LIU A;  1AR9 2;  4NII A;  4AVC A;  4XFB A;  1DQ5 A;  2ILM A;  3CNA A;  4HKO A;  4IV3 A;  2FMD A;  5F6L B;  1AL2 2;  1T6B X;  3SH5 A;  3C3V A;  3ZX7 A;  3NRU A;  4ZKT B;  4QPI B;  2HLE A;  1BYH A;  4W6X A;  1OSG A;  3AK0 A;  5KXC A;  3ON7 A;  4A7Z A;  3BTX A;  1YI7 A;  4AVA A;  3WSO A;  3S7E A;  2LTN A;  3WF3 A;  2W1U A;  2ZAB A;  3M8L A;  1YQC A;  3N9L A;  2BQP A;  2QCS B;  4YGE A;  4U36 A;  4DY5 A;  2P4E A;  4H7M A;  1R09 3;  1REF A;  2VZ1 A;  2XBO 1;  2Z79 A;  4D7S A;  3BKZ A;  4J1W A;  2PLV 1;  2XJQ A;  3S0M A;  3RMY A;  1N3P A;  1RMU 1;  2BVV A;  1K42 A;  3GF6 A;  5JIU A;  1DQ0 A;  1ASJ 2;  3LIG A;  3MIE A;  5CIR A;  2WWU A;  5LK7 B;  3APB A;  4C0H A;  4EWA A;  2RE9 A;  5J7M A;  1SFN A;  3GCX A;  4QMA A;  3ZSJ A;  1OOP A;  1V6J A;  4FPL A;  4GKY A;  1PNG A;  3MBW A;  2QDR A;  4NUB A;  1FT9 A;  1SLI A;  2ZZQ A;  5T54 A;  1D0G A;  4CDW A;  4S2F A;  1HXS 2;  5DZF A;  1JYW A;  5AC9 2;  2WFF 2;  2X29 A;  2N7G A;  1A34 A;  4I0B A;  3A22 A;  4UFL A;  1Q8O A;  1UL9 A;  2GU9 A;  2HWC 2;  2FDK A;  5H9R A;  1GV9 A;  4MGK E;  1PGL 1;  1IS4 A;  2HYK A;  1VBC 1;  2I45 A;  4Q27 A;  1W3V A;  3DPR C;  1PO2 3;  4HN1 A;  2C6S A;  2CYF A;  4NAO A;  5A7O A;  2VJX A;  2RS3 1;  5FUN A;  2VL4 A;  3FE5 A;  3W5N A;  3TYJ A;  2JIC A;  3QLQ A;  3Q9O A;  3KF3 A;  1L7Q A;  5HCH A;  4DXS A;  5T5L A;  1N3Q A;  5JCT A;  4I3P A;  3ALQ A;  3BPS A;  4YVW B;  1US2 A;  5A33 A;  1FPN 1;  1Q3E A;  5JXJ A;  4K6B A;  5FYZ A;  1F5F A;  2JEN A;  2ARA A;  1ND2 C;  2VVF A;  2WZ8 A;  3NNJ A;  4WVW A;  5D21 A;  1AXK A;  1AF9 A;  3HR9 A;  4HPK A;  2UWB A;  1OLQ A;  3AC0 A;  4UW5 A;  2JDY A;  2R6Q A;  3IM0 A;  2XHK A;  1UMZ A;  2BTV C;  4HAN A;  4E2S A;  5JZG C;  3NKT A;  2NYY A;  4CSW A;  4RQP B;  2DF7 A;  2OA2 A;  4WM7 A;  5CEH A;  2YDE A;  1MS4 A;  2A6Y A;  1A8D A;  2XBO 2;  1CX4 A;  3O1V A;  2PLV 2;  4CVU A;  5ACA 3;  1RMU 2;  1IKQ A;  3KT4 A;  4L99 A;  4LQR A;  4XDO A;  3O5S A;  2VGD A;  5DPN A;  1VB2 A;  4AOC A;  4BQ4 A;  5EPA A;  4JDN A;  1FAT A;  3H3L A;  4YM2 A;  1C8N A;  3TEX A;  5FY1 A;  4X8P A;  3USU B;  5FZC A;  2FDJ A;  3TNQ A;  2ZGS A;  1ALY A;  3WG3 A;  1G7Y A;  1AR6 3;  5G04 L;  5K4L A;  1ZZ6 A;  2HBT A;  5DZG A;  4P9Y A;  5CAD A;  4IV1 A;  5I8S A;  2RDN A;  1W90 A;  4NMI A;  3SQO A;  1PNF A;  2XLA A;  2GME A;  3O12 A;  2ZML A;  1NZC A;  1ZZ7 A;  2ZGM A;  3WXP A;  2G9G A;  3PJQ A;  5A1L A;  1Y4W A;  4PCR A;  3WNO A;  1PGL 2;  4DUV A;  2JIJ A;  1VBC 2;  4YZ4 A;  4E4Z A;  4ASK A;  5I91 A;  2W1Q A;  3WLU A;  1KRI A;  2UYA A;  4MGT A;  4K8F A;  2RS3 2;  3UKT A;  3RSJ A;  3FJS A;  2Q4S A;  1MR5 A;  1VE0 A;  5BNO B;  2ZEW A;  3PIJ A;  4IV1 C;  4W4Z A;  3WR0 A;  5CG9 A;  3D5O A;  4CE8 A;  5CFD B;  1BBT 1;  3N9P A;  3WP5 A;  2ZGL A;  1FPN 2;  2PQS A;  2JE8 A;  2D5F A;  2HBU A;  2IXJ A;  2X5I B;  3GCW A;  1HB3 A;  3JU9 A;  1J3R A;  4G4F A;  5F5C A;  4CEY C;  5L19 A;  1CZT A;  4QGN A;  2YG0 A;  1NQD A;  4ZPI A;  1BQP A;  3I3M A;  3LA3 A;  4GJZ A;  4CDX B;  3LAG A;  4DFS A;  2K9Z A;  1E5S A;  1HRV 2;  4FPE A;  3TEZ A;  3PUQ A;  4IEP A;  4MUV A;  4YW2 A;  3O1M A;  3H1W A;  4BA6 A;  4Z92 B;  2VMF A;  1QU0 A;  3RVH A;  1C8M 3;  1W2N A;  2YPJ A;  3KS7 A;  3SKV A;  4LOT A;  5FR3 A;  2ZHN A;  1QDO A;  1YFY A;  1UZ0 A;  3N36 A;  4XAB A;  1H2L A;  2R16 A;  1POQ A;  3A23 A;  3K3O A;  2AEY A;  1TME 2;  5CFC A;  2YBP A;  4XHB A;  3UJQ A;  1SBD A;  1J1T A;  3NAP C;  3POY A;  2JG8 C;  3TEY A;  3KWV A;  1GOF A;  4AF9 A;  1IZ3 A;  5D8A A;  3OPW A;  2WZR 2;  4NOT A;  2JD9 A;  3VBR B;  4IEZ A;  1S0B A;  1FI2 A;  3ZKU A;  4OI0 A;  1LHO A;  4LIV A;  4LBQ D;  4NHL A;  2BBV A;  4RGG A;  1LU2 A;  1DZT A;  2R04 3;  3WQ7 A;  4CCO A;  3E1F 1;  3JD7 1;  3UGF A;  1NCR A;  1XC6 A;  2R07 1;  3BVC A;  5CFC C;  4XIL A;  5FP7 A;  1HDK A;  4HXC A;  1FYU A;  1JYV A;  3HQU A;  1YUD A;  1W2O A;  5GAL A;  1MS5 A;  3MF6 A;  3POW A;  2OW4 A;  3ZXG A;  3AZX A;  1NOV A;  4YW6 A;  1AYN 3;  3OG2 A;  3WCR A;  5C9A B;  1I5Z A;  4JQT A;  4B4Q A;  2WZP P;  5I8T A;  1JYN A;  4ISQ A;  1UWW A;  3AP4 A;  3LEI A;  3WG2 A;  2QJV A;  4QB1 A;  1VBD 3;  4DIQ A;  3PUA A;  4KWJ A;  3B00 A;  1NCR C;  1RUH 1;  3ZN5 A;  4XZP A;  1O4T A;  5LY2 A;  1RED A;  3OCP A;  5CG8 A;  2GH2 A;  2IVJ A;  4LBQ A;  4HG6 B;  3LQC A;  4KBB A;  4BXF A;  4LBJ A;  2CY6 A;  4MSV A;  5LY1 A;  1J58 A;  4AI1 A;  2X8K A;  4XJA A;  5B2G B;  3KVB A;  4K1Y A;  2VZQ A;  1FX5 A;  1V0A A;  1IPK A;  1H4H A;  2VNR A;  4M3C F;  3ZFE C;  5FDB A;  1H2K A;  4URT A;  3WV6 A;  5C70 A;  3VBH A;  1H9W A;  5L36 A;  3CJI B;  3NV2 A;  4CTE A;  1YQ6 A;  1Z78 A;  3AMN A;  4LUM A;  4PBO A;  4K21 A;  1UY0 A;  4J1X A;  4Y22 A;  3SNM A;  4CDU A;  3PUI A;  4E4S A;  1RUC 1;  5C4W B;  4XZU G;  1VBE 1;  5H9P A;  4TTG A;  2PHW A;  1DF0 A;  1QH6 A;  2D6P A;  3J9S A;  4GQ7 A;  3E6D A;  2WN2 A;  4XJ8 A;  4Y4Y A;  1G9D A;  4H55 A;  3JD7 2;  1RIR A;  4NPR A;  4YM3 A;  3WNM A;  2E9Q A;  2OZ6 A;  3MIG A;  1JZ2 A;  3VBH C;  5H9Q A;  3D0J A;  3I2D A;  2BNO A;  5GLV A;  2ORZ A;  4N9I A;  4R9B A;  1VBB 3;  2Z69 A;  1UN1 A;  2JG9 A;  5F3E A;  5C8C A;  3RZL A;  2NP0 A;  4IE4 A;  1MS8 A;  3M3I A;  5C3R A;  3SC7 X;  3O0X A;  4YZ1 A;  3ACH A;  2VOV A;  3VDD C;  3FHA A;  1W9S A;  3R4U A;  2D97 A;  4HKW A;  4BPZ A;  1RUH 2;  2HYX A;  2FCU A;  4WM8 B;  3VZK A;  5C3P A;  5LA0 A;  1WMD A;  3K75 B;  1XRU A;  1U5X A;  3FN9 A;  2WBK A;  5FP9 A;  2QQK A;  4IE6 A;  1YQ5 A;  1FNY A;  1ZBA 1;  4CEW B;  5FYB A;  2JG9 C;  5BY5 A;  2XUE A;  4GXL A;  4JTO A;  3WDU A;  4G9S B;  4EN8 B;  4MH0 E;  5ANN A;  3NNM A;  1QJE A;  2WII B;  5GLT A;  4YG0 A;  3V65 A;  4HFS A;  1J84 A;  4AED B;  2CSG A;  2R30 A;  3KV4 A;  1AX1 A;  1LOE A;  2ZZJ A;  4OLL A;  2YFZ A;  1V6O A;  3D0S A;  3TOJ A;  3D82 A;  4LOS A;  2DVG A;  3AZZ A;  4MV2 A;  1OH4 A;  4FPH A;  3UET A;  4A7Y A;  1LGB A;  4D6Q A;  1SMV A;  1CAX A;  3D8C A;  4YLZ A;  1U12 A;  3ZYR A;  5CKM A;  4IGQ A;  1WBF A;  4P9X A;  2ADE A;  1ZZC A;  1N1V A;  2YU1 A;  1BJQ A;  5DAW A;  4A6O A;  1S0F A;  4XMA A;  3WNX A;  5FZL A;  5BNP A;  1JZ4 A;  4ZHN A;  2VNG A;  4MX3 A;  4TLF A;  4ZS2 A;  1RC6 A;  4BZ4 A;  4EWD A;  1QJY 1;  5IFT A;  4XET A;  5FZ4 A;  4XEZ A;  1IS6 A;  2CNA A;  2DFC A;  3OBA A;  4XIO A;  1WCS A;  3JZV A;  4Y1U A;  1RUD 1;  2DUO A;  3URF A;  2YV8 A;  5ABJ A;  1SLB A;  3V0B B;  2QQJ A;  3OBT A;  2IFW A;  2PEL A;  4V1P A;  2HWB 2;  1OPO A;  4N9H A;  5IAV A;  2UWC A;  4Z2A A;  1VMJ A;  1OVS A;  1R09 1;  1ULE A;  3DYP A;  4MO3 M;  3O1R A;  1DYK A;  4P00 B;  3WHU A;  5BNP C;  1WW7 A;  1ULF A;  2B46 X;  1H6Y A;  2VW2 A;  4BYY A;  3P3N A;  2D6N A;  2WDB A;  5EFU A;  1XPW A;  2D6K A;  1HXS 3;  4S2D A;  5F3G A;  5M0T A;  1WCU A;  1OLM A;  2LM3 A;  2JEM A;  5JI7 A;  5AC9 3;  3C2U A;  4UFK A;  4XF9 A;  1Y3T A;  1QJF A;  2YU2 A;  4GWN A;  5ABJ C;  4E4D X;  3GBF A;  5JLV A;  2WRA A;  4RR3 A;  3WOG A;  1ZBA 2;  5ISL A;  5KHK A;  3HN1 A;  3DEC A;  1NX9 A;  5JOW A;  2VQ0 A;  5IHR A;  2JIG A;  2XLF A;  1QJZ A;  3T0B A;  2VMG A;  1V00 A;  3DF0 A;  1W0N A;  4K7J A;  3TN9 3;  5A3P A;  1QH7 A;  3MEP A;  3K4A A;  4QPG B;  3HNM A;  2AC1 A;  5FYT A;  1UKR A;  2K46 A;  5A6Z A;  1BLZ A;  4UI9 L;  4YW1 A;  4LK7 A;  2WWS A;  2XGX A;  1PO2 1;  1CGP A;  3IPV A;  3WW3 A;  2QQM A;  3NL1 A;  5DAV A;  3M4F A;  3RPQ A;  1W6N A;  3WHT A;  5LB6 A;  2QQV A;  4KU7 A;  2MPF A;  2PHR A;  4RR3 C;  2D98 A;  2EIE A;  3VZO A;  3UKN A;  3PL0 A;  3U4S A;  1DZQ A;  2OUJ A;  3AVS A;  2JKX A;  3UJO A;  1MQT A;  3WF0 A;  1GZ9 A;  5LEK A;  2VZS A;  2GP3 A;  4KH9 A;  1AR8 3;  2IC1 A;  1QJY 2;  1KDM A;  5D1I A;  1LGN A;  1Y9G A;  1RB8 G;  1RUD 2;  2E32 A;  4KWU A;  3AYE A;  3SHR A;  2ZX1 A;  4XIK A;  4CUA A;  1UOB A;  2TUN A;  2VY0 A;  3ZN6 B;  1K5M B;  1MVE A;  4XF3 A;  2A6W A;  2Y60 A;  1GQG A;  1IGO A;  1R09 2;  3GM8 A;  3NNG A;  5FOJ B;  3IAP A;  5KR7 A;  4A4A A;  1DGL A;  5ACA 1;  3IAQ A;  1GR3 A;  1LOC A;  2XJV A;  4JGY B;  1MQT C;  1JXN A;  1UMH A;  4LNV A;  4MAD A;  3AP5 A;  1E57 A;  5IVC A;  4CP9 A;  4TZD A;  1RUF 3;  3AL5 A;  4U2A A;  4CZS A;  3V0A A;  2BBA A;  3IDA A;  3M3O A;  1AR6 1;  4EV0 A;  2Y0O A;  4HK9 A;  4UXA A;  5A7P A;  3EHK A;  2AZ5 A;  3A4U A;  1FV2 A;  3I59 B;  4IL7 A;  5FY4 A;  2W52 A;  4A44 A;  5A3L A;  5IK8 A;  2HJI A;  5J1X A;  4ES8 A;  4B8E A;  1RJ8 A;  1IS5 A;  3QOP A;  5E16 A;  5K0U A;  2QE3 A;  4C1X A;  1CZS A;  2WQ8 A;  3A7Q A;  1LHN A;  4Q1P A;  2B5H A;  1PO2 2;  5DG1 A;  1UX6 A;  3IBM A;  3O1U A;  1SPP B;  3FBY A;  4L11 A;  3AFK A;  2W2I A;  3NJZ A;  4XF4 A;  2VBP A;  3QH6 A;  3J7M A;  1HRV 3;  5F6K A;  2YXS A;  4ATF A;  4O9E A;  3DYO A;  2WNV B;  1AR7 3;  4UF0 B;  1YIF A;  2W91 A;  2X53 S;  2XJP A;  4P9W A;  2VBD A;  5FXW A;  3WUD A;  2PYT A;  1VMH A;  2VNO A;  5IAX A;  3O1T A;  4ZXE A;  5BXX A;  4QPW A;  2VMD A;  3BTZ A;  1RUO A;  3DXU A;  5BNN B;  5JXG A;  1TME 3;  4FQZ A;  2PA7 A;  1FXZ A;  1R64 A;  4PDW A;  1UNB A;  5I0R A;  1OH3 A;  2WWJ A;  5LW9 A;  1W6P B;  1PM4 A;  3JBG 3;  1JOD A;  4GB3 3;  1C8M 1;  4OQ9 A;  5ACA 2;  2XL9 A;  3TNP B;  2VZR A;  3I3D A;  1DHK B;  3KCY A;  4FO9 A;  4BIO A;  4Z8B A;  3PLQ A;  3EXU A;  3S7I A;  1X8M A;  5E1R A;  4CCK A;  4YVS B;  1NKG A;  1XXN A;  2WZR 3;  1WME A;  3ETQ A;  1N47 A;  3AYA A;  3GGL A;  2C9A A;  2Q1M A;  4JGZ C;  4NRQ A;  3WG4 A;  1DU3 D;  3ZSK A;  3MDP A;  3TBD A;  2XR4 A;  2UYB A;  1ZVF A;  1LGC A;  1HRI 1;  5A32 A;  2MHF A;  3NVC A;  4YW4 A;  1C5I A;  1ZRE A;  2DCZ A;  4YG6 A;  1W8T A;  4HSJ A;  4M01 A;  3WZ1 A;  5EIY B;  2HKX A;  3GZU C;  2JB8 A;  5CAZ A;  1UX7 A;  1NCQ B;  1WLC A;  4BXS V;  1QMJ A;  2R04 1;  4UW3 A;  2FDH A;  4Z07 A;  1EAH 2;  5KXD A;  2YMZ A;  3GDB A;  5JVV A;  5JR2 A;  3VB9 A;  1WBL A;  1UYP A;  4R4X A;  1BZW A;  2HEW F;  4CUG A;  1I1E A;  3WP6 A;  4DRR A;  2B8M A;  4XQW A;  1R1Z A;  1R1A 2;  3NNF A;  4W6W A;  2DCY A;  3H8X A;  1JOJ A;  1LEM A;  1UZV A;  2ZKN A;  3H8R A;  3BB6 A;  5FOB B;  5CYY A;  2EA7 A;  4XF1 A;  3E97 A;  2D3R A;  3GJB A;  4DOU A;  1ND3 B;  5EV7 A;  5F2S A;  1TE1 B;  1VBD 1;  1O5L A;  1LOF C;  2A3W A;  4NRM A;  4CDQ A;  3VD7 A;  3DV8 A;  5FXZ A;  2E6V A;  2RM2 3;  4OFG A;  1AXY A;  2IWG B;  3CZJ A;  2UU8 A;  3SCF A;  1JHN A;  2PHT A;  3DGT A;  1C8M 2;  1IQA A;  2E63 A;  4COY A;  3F95 A;  4D7Y A;  5FWJ A;  3K4Z A;  4FSJ A;  2GNM A;  1QY4 A;  1S2B A;  2DCT A;  2VME A;  1LRH A;  2WAB A;  3I2I A;  1XU1 A;  4JCK A;  4FOQ A;  4WVM B;  1SBE A;  1GWL A;  5DDJ 2;  4XTP A;  3OY8 B;  3MYX A;  4FQ4 A;  2P34 A;  4CDQ C;  3JD7 3;  3O1P A;  1HRI 2;  1GIC A;  3U78 A;  1CQ9 A;  5DAP A;  1HB1 A;  2D3P A;  4FXG B;  4AR2 A;  3VL8 A;  4YW5 A;  4RA0 A;  5A7S A;  4JZR A;  4Q0P A;  4DEQ A;  1ZZB A;  3P6B A;  2UWA A;  1H8T B;  1JU4 A;  4QB2 A;  4DPN A;  3MIC A;  4MGI E;  5FYM A;  4BQ2 A;  3WEZ A;  4LBM A;  4PHZ A;  2RG4 A;  2R04 2;  4R4Z A;  4XFG A;  3ZXJ A;  3OOX A;  3LDB A;  4OCT A;  1GWM A;  4GAL A;  2E33 A;  2W5F A;  4AGG A;  5FQ0 A;  4NWW A;  2Q8O A;  3DN7 A;  1RUE 3;  1VBB 1;  1H2M A;  1GZC A;  2XL7 A;  4QDQ A;  1XSQ A;  4MXW B;  3E6B A;  4JC1 A;  5D2A A;  5FZO B;  3FUQ A;  1LR5 A;  3M3C A;  3N4M A;  2BER A;  2OS2 A;  3VHO A;  1WCD J;  1HQW A;  2WA3 A;  4YVW A;  5B4X A;  4PBP A;  3VBU A;  2IFR A;  2YPD A;  4LR4 A;  3DXT A;  3VD3 A;  4AXO A;  1W03 A;  3HNB M;  4E2Q A;  5DAX A;  2Y6H A;  4IES A;  5GZG A;  1F4H A;  2V4V A;  2ZGN A;  1UZZ A;  4ASL A;  2DTW A;  3Q8C A;  1UY3 A;  3BAL A;  3LPF A;  5L7O B;  4A42 A;  2G19 A;  1XNA A;  2WT2 A;  1YQ8 A;  4JHT A;  5E89 A;  1ZRR A;  5EZW A;  1BK0 A;  2TEP A;  1XYP A;  1IQD C;  1LEC A;  5DUU A;  2YRO A;  3RZJ A;  4BDV B;  3AZY A;  4QX7 A;  1WD3 A;  4XFH A;  3FHQ A;  4WBB A;  3VBU C;  2Z5W A;  2PFW A;  3X29 B;  3USU A;  4M0N A;  5E88 A;  2A71 A;  3RI8 A;  1WA6 X;  2WNU C;  4Q4Y 3;  2PHL A;  2FCT A;  2PAE A;  3J7H A;  3PTR B;  1SFY A;  2MEV 1;  2RDR A;  4K20 A;  1NA1 B;  1PK6 B;  4B29 A;  1SLL A;  2HWB 3;  1WD4 A;  2GN7 A;  5FPV A;  4IUG A;  1OUX A;  3GNE A;  3GAL A;  1J59 A;  3KGL A;  3W21 A;  1YFX A;  2OII A;  3OEA A;  1VBB 2;  5I0U A;  3BUC A;  4OVE A;  1GZW A;  5C7G A;  1ENS A;  3BIE A;  4L8Q A;  1WW6 A;  1HJF A;  2DUR A;  1NZI A;  4MZU A;  2WZE A;  5FTT C;  5BNO A;  1VRH 3;  5GLW A;  2XJU A;  2WT1 A;  5CIS A;  2VG9 A;  4LHK A;  4EYU A;  5IAT A;  4C90 A;  4K3U A;  1SFP A;  2WNE A;  5F39 A;  2ZX3 A;  4UBH A;  5AC9 1;  2BOI A;  3ZYH A;  2OYZ A;  1NXM A;  4CDX A;  4N53 A;  4CUC A;  3VBF C;  4QX1 A;  3WDY A;  2XUM A;  1PM7 A;  4F7Z A;  2O0O A;  3TN9 1;  5IFP A;  4Y1Y A;  3LE0 A;  3AZW A;  3FL7 A;  5F9T A;  3UK9 A;  1AX0 A;  1DGR N;  5AVA A;  3ZFF C;  3OD0 A;  3WDW A;  1JYC A;  4XBN A;  2EXK A;  1V9U 3;  3VD5 A;  4ZU7 A;  2WLQ A;  2WAA A;  2QKD A;  4I02 A;  4MHU A;  5DAB A;  5FZ7 A;  1I9R A;  3WF2 A;  3WUC A;  3MFA A;  4UFJ A;  3ZYB A;  5C71 A;  1QJY 3;  1W2T A;  5FZA A;  4N53 C;  1UZY A;  1RUD 3;  1YCI A;  5FP8 A;  1RXF A;  4XDQ A;  1I3H A;  1ZRF A;  2MEV 2;  4ZZ8 A;  4EZH A;  1W39 A;  4CCM A;  3VBR A;  1TZO A;  4GH4 B;  2RS1 3;  4A6S A;  1CAU B;  5EWS A;  5LZ6 A;  4RS5 B;  4AQT A;  3ME2 A;  1AR8 1;  4FOY A;  5FCC A;  1XJA A;  2BP6 A;  4IQP A;  3BOW A;  3MV0 1;  4IV3 C;  4ZY9 A;  4WZC A;  2VPV A;  3GZT B;  3VZM A;  2W08 A;  2Y6K A;  3AMP A;  2Y33 A;  4LO6 B;  1H4G A;  3ZDS A;  2F4P A;  3VDB A;  4JKL A;  3FX3 A;  3ZIW A;  3S5A A;  5C9A A;  2XG3 A;  2Y6F A;  2NLR A;  1EPW A;  2ARC A;  4NPM A;  2Y6L A;  2Z42 A;  5FXX A;  1POV 0;  2I74 A;  4JVA A;  4FTS A;  4Q0Q A;  2ZGO A;  2JDA A;  4BIF A;  4QPY A;  4XQD A;  1RUF 1;  4Y5S A;  4BK5 A;  3WQ1 A;  3KCX A;  1JH5 A;  2RJ2 A;  4HN0 A;  5KHI A;  5A1A A;  1U5Z A;  5CVR A;  1H6X A;  2J1E A;  4ORF A;  4FPF A;  3TN9 2;  3ACL A;  2YY1 A;  3HNY M;  4TYS A;  5FFO C;  3LB9 A;  4UOJ A;  5F8P A;  1O91 A;  3POF A;  1OOP C;  3V56 A;  3VDC A;  1XSR A;  1ULC A;  4CDW C;  1O8S A;  1C57 A;  1M4W A;  2A70 A;  3SLI A;  3I2J A;  5FZH A;  1GFF 2;  3CJI A;  1H1A A;  3M70 A;  5C3O A;  1CVN A;  2CGO A;  3AM2 A;  1C1F A;  2YGM A;  4Q8L A;  5EYX A;  5H9S A;  1VJ2 A;  2QZ2 A;  1DIW A;  5JPN B;  3IMM A;  1L7L A;  3AJY A;  5C4W A;  2D6O X;  1HRV 1;  4L9B A;  2J1S A;  3WW2 A;  1I5P A;  1AR7 1;  3I4I A;  3H42 B;  4AI0 A;  4QQL A;  1AR8 2;  1QKQ A;  2A5Z A;  5B4N A;  1Q8V A;  4QGL A;  1RVF 3;  3U75 A;  1DQ4 A;  2LS6 A;  1VAV A;  3POB A;  1Z0H A;  2Y8K A;  1YXW A;  2QQI A;  1TME 1;  1UW8 A;  2VH9 A;  2PN5 A;  3B7M A;  3A21 A;  1BEV 3;  5FKC A;  1W6M B;  3WF4 A;  2OPK A;  3W59 A;  1VR3 A;  2P3K A;  3ILR A;  4QD2 A;  1RUN A;  3JBG 1;  4GB3 1;  5FO7 B;  3ELN A;  2JWP A;  1EP0 A;  1MS1 A;  1W6O B;  4XE9 A;  4WM7 C;  3ZSL A;  1QF3 A;  5IWF A;  2WZR 1;  2YFU A;  4TN7 A;  5CB7 A;  1H9P A;  3VGI A;  4EN9 B;  1GNZ A;  3LCP A;  1RUF 2;  1W8O A;  2GSY A;  3IT8 A;  4WM8 A;  2GZW A;  1EAH 3;  3PUR A;  1KJR A;  3WVJ A;  4H2A A;  4WZF A;  4CEW A;  4PIZ A;  4YFZ A;  1NLQ A;  3ACI A;  3J4U H;  2Q1F A;  1R1A 3;  1Y43 B;  3I2H A;  4AED A;  1W0O A;  3ZYI B;  3WCS A;  4CCN A;  2WAO A;  1LJ7 A;  4QQ2 A;  2E31 A;  5IUQ A;  3C7H A;  4HVQ A;  1UF2 C;  2JDK A;  3THP A;  5C3Q A;  3T2Q A;  4PT6 A;  4YPJ A;  1EUT A;  3FLT A;  3OGJ A;  3S30 A;  2DCJ A;  3VBO A;  5IVV A;  1BMV 1;  2A6X A;  4FPJ A;  1SQ4 A;  3DCQ A;  4KWL A;  1YRZ A;  3RZZ A;  4CPB D;  3LWC A;  3MIH A;  5IK5 A;  4GUL A;  3K3N A;  2PAK A;  4N7I A;  3N35 A;  4XHX A;  1AR7 2;  4BLJ A;  4F8A A;  3IZO A;  5LA1 A;  2QQP A;  5C3S A;  4IEW A;  2Y34 A;  4A3Z A;  4PF5 A;  3ZFG B;  3IIA A;  3O7O A;  4AFD A;  3KD4 A;  3BTA A;  3RNS A;  3IDE A;  2LW8 A;  3T30 A;  1LU1 A;  4E2G A;  2YYO A;  2QQL A;  5DDJ 3;  3VBO C;  2RM2 1;  1ENR A;  5HCA A;  2JB4 A;  1OQE A;  3CDZ B;  4DIN B;  1D2Q A;  3JBG 2;  1SBF A;  4GB3 2;  1CX1 A;  1HRI 3;  3B3Q E;  1CZV A;  2ATF A;  2VZO A;  2J1A A;  2ENR A;  4CP1 A;  3MHZ A;  4Q29 A;  2A7A A;  1SAC A;  5FYI A;  1CJP A;  1W6Q B;  3KQ4 B;  4CPB A;  3WY6 A;  1YFU A;  1FV3 A;  4PQQ A;  3IDC B;  5LK5 A;  4LBO A;  4OUE A;  2P1B A;  3G6J B;  3ZR5 A;  2XQR A;  3CJI C;  4GJY A;  4P5Y A;  5EP9 A;  5J98 B;  4XFC A;  3SEE A;  4QGM A;  1B09 A;  2ZGR A;  1QOT A;  4AYU A;  1Y9M A;  1OI6 A;  3NST A;  3OGV A;  1K5J A;  2ZGU A;  1VAK A;  1XNK A;  2QUO A;  3LA2 A;  4QPG A;  1GSL A;  2R7E B;  5A7N A;  4L2N A;  5D8A C;  5EJZ B;  1EV1 2;  1JI6 A;  1TMF 3;  1F2N A;  2G9F A;  1X9T A;  1BMV 2;  4OHY A;  4QKD A;  5FJK A;  5IVY A;  3LEK A;  1JYT A;  1RUE 1;  3PME A;  2PTM A;  2W68 A;  2D93 A;  1Q43 A;  2XLG A;  1NAE A;  4COW A;  1O3S A;  2VZP A;  3I3B A;  2ZGQ A;  5HPO A;  5JUV A;  1SHW B;  4FPO B;  3DPR B;  1AUY A;  1MZ5 A;  2RJK A;  4EWE A;  3C7E A;  4FXK B;  4LO8 A;  1XND A;  5A7W B;  2HWE 2;  1W8U A;  4LOR A;  3HN3 A;  4BQX A;  4MGZ E;  3CO2 A;  4LLF A;  2RM2 2;  3OPZ A;  3PVB B;  1LOB A;  3OB8 A;  4MGQ A;  1K5M A;  1Q8Q A;  2QDN A;  2OQ7 A;  2AUY A;  3GBW A;  1W2U A;  3ZN6 A;  4RHV 3;  2ZHK A;  2YC4 A;  1ND2 B;  3EYP A;  4CP0 A;  3P3P A;  5A1F A;  4PJY A;  5JOZ A;  2FDI A;  4NJ4 A;  2RDQ A;  1NQJ A;  2H0V A;  1WLW A;  1ULG A;  1QNW A;  4JGY A;  4Z82 A;  3UL2 A;  4NAM A;  1ZZ8 A;  4Q26 A;  5FRA A;  1T2X A;  5JZG B;  1RJ7 A;  2ZEX A;  4UBG A;  2WR9 A;  4XJW A;  3UES A;  2R06 3;  2ZHL A;  2P37 A;  1OA3 A;  1WLD A;  1UYY A;  2DFB A;  4QKF A;  2XJS A;  3KZ4 C;  3ZDV A;  4Q4Y 1;  2W47 A;  4RFT 0;  4QKB A;  1UCX A;  1OFS A;  3I59 A;  2W95 A;  2JX9 A;  2NMO A;  3OBR A;  1W99 A;  2IXH A;  4XAA A;  4Y4R A;  3U14 A;  2VCB A;  2Q0A A;  2HWB 1;  3KCC A;  2OX0 A;  4LLO A;  4HPK B;  4CDU C;  2NQY A;  4LA3 A;  5DZE A;  1HQN A;  2ZTN A;  2VUJ A;  4NO4 A;  3VKL A;  3KQR A;  1RUE 2;  2IZW A;  4CU8 A;  1SPP A;  2D40 A;  3B01 A;  2LAL A;  2R1B A;  2ZS6 B;  4JTN A;  4JKK A;  2F6B A;  1VRH 1;  4N8M A;  2ARB A;  1WMX A;  1YI9 A;  2RS5 3;  3ZSE A;  2OZJ A;  4XC9 A;  2C4X A;  5JWP A;  5C8C C;  5FPB A;  2V72 A;  5SV8 A;  3HBK A;  2CTV A;  3HD8 B;  4QXB A;  4AFM A;  1Y7B A;  4S2G A;  5GZC A;  4IV1 B;  3I8T A;  2RJL A;  3T4V A;  5BNN A;  5I93 A;  3PHM A;  3CMG A;  2BU9 A;  1GOH A;  2D5H A;  4X8N A;  2PHF A;  2EAA A;  3K77 A;  1L7R A;  1W6P A;  3ZN4 A;  1VLN A;  4KU8 A;  4CEY B;  5JDB A;  1WKY A;  2QFE A;  4FFF A;  3UV9 A;  1C28 A;  3ES1 A;  2MEV 3;  4YVS A;  1DLL A;  1E5H A;  1KFU L;  2K2S A;  1V9U 1;  1ODN A;  1CIY A;  2BV4 A;  5FBJ A;  2VCA A;  2EXI A;  4PLN A;  3SCG A;  4A3X A;  3NJX A;  1N3O A;  4CA9 A;  4EQV A;  4AAP A;  5J96 B;  2OUH A;  1Q5O A;  2JE9 A;  4N90 A;  4Q4Y 2;  1WUV A;  3I2G A;  4KG0 A;  2EIC A;  2WSV A;  2VUL A;  2KD7 A;  1YQ2 A;  1QHD A;  2DU0 A;  1IG3 A;  3KV9 A;  4XVH A;  3NAP B;  2RS1 1;  2JG8 B;  2GN3 A;  2ZXQ A;  1IHM A;  3I7D A;  1ULP A;  5F2W A;  4J6G A;  2WLP A;  1UOG A;  1YC6 1;  4IE7 A;  4JDO A;  5E8A A;  4ARY A;  4Q4W 3;  4JAA A;  5FMC A;  3S6P A;  2XWB B;  5KHG A;  4PQ9 A;  3UNP A;  5FZD A;  4HZF A;  4FP3 A;  1HV1 A;  1JOP A;  2CL2 A;  4YAR A;  4CCD A;  1VRH 2;  1X36 A;  3SCH A;  1J83 A;  2W9X A;  4CUB A;  5CFC B;  4LHL A;  3O0V A;  1LOA A;  2PAM A;  2O8Q A;  1W9W A;  1ND3 A;  2WIN B;  3I2F A;  1Q8P A;  4D8M A;  4J25 A;  5GKA C;  3W9A A;  3LFI A;  4CXX A;  3N9M A;  4UFH A;  2SLI A;  3RRD A;  3BI3 A;  3RMX A;  2ORX A;  4GIQ A;  1PX3 A;  2WUH A;  2GC0 A;  2CGN A;  4YRD A;  2CWS A;  5FZF A;  1HJG A;  1OVP A;  2WT0 A;  2E7A A;  1RUI 3;  5FZK A;  4FFI A;  4HET A;  2D6L X;  4B4P A;  3AXD A;  5DUX A;  3KT1 A;  3FLR A;  4XPV A;  5GM0 A;  1NCR B;  4N43 A;  3MO4 A;  4LO4 B;  1VBA 3;  2I07 B;  1OT5 A;  3LDK A;  4K1Z A;  4QHZ A;  3WF1 A;  3ZR6 A;  1ZX5 A;  1BK1 A;  2PXJ A;  3EO6 A;  1V9U 2;  1V6M A;  4NHM A;  3AXE A;  1O3Q A;  3OY8 A;  4QDS A;  1W8H A;  4NIG A;  2VCM A;  2IVI B;  3B93 A;  1CPM A;  3HPN A;  4JHZ A;  5GZF A;  1ULO A;  4D6R A;  1UYZ A;  2DUQ A;  2R0H A;  3HT1 A;  3POI A;  1AXZ A;  4O7X A;  3ZFE B;  4C8D A;  1DLC A;  3GYD A;  3SH4 A;  1H8T A;  3PVE A;  3WG1 A;  2RS1 2;  2PMW B;  3L2H A;  4R52 A;  1S0I A;  2BJS A;  3RZK A;  3FFZ A;  2BW8 A;  4N43 C;  1IG0 A;  1RVF 1;  2D3S A;  3KF5 A;  3Q8A A;  4ARX A;  1UY4 A;  4AEK A;  5FZ6 A;  4ZXK A;  4DS0 A;  4Y1V A;  4OI4 A;  3VDA A;  1O6U A;  2ZAH A;  2W1S A;  1BEV 1;  3NNL A;  1F31 A;  1OKQ A;  1GBG A;  1NE6 A;  2ADD A;  3FBM A;  4MXW A;  4GAZ A;  4I09 A;  4M3C E;  2JDU A;  5FZO A;  1MEC 3;  2HH9 A;  4SLI A;  3VLB B;  3B9I A;  3VBH B;  4KBZ A;  1G9F A;  2O8O A;  1L3J A;  4IND A;  4NHX A;  4PIY A;  4D6S A;  3VBS A;  1OC1 A;  3H8O A;  2FZ2 A;  1GP6 A;  3LD8 A;  3BTY A;  3MW2 A;  3TRS B;  1HQL A;  1S0E A;  1GP5 A;  1LOD A;  4L0P A;  2XB6 C;  2ZGT A;  1KS4 A;  2V09 A;  3BCW A;  4RGK A;  1LHV A;  2X05 A;  1EAH 1;  4ATE A;  3HEI A;  5FXV A;  1RXG A;  2EVX A;  4NIH A;  5IT6 A;  3VDD B;  3J26 N;  3C7O A;  5L7O A;  1U5I A;  4HMZ A;  4QT6 A;  2C0Z A;  4LJH A;  1HN1 A;  3H7J A;  3A0K A;  4Q8K A;  1R1A 1;  3MUY 1;  3ZSM A;  4BHP A;  1CAW B;  4DZG A;  1YLL A;  2D6M A;  4XFF A;  2FHR A;  2DDU A;  3VBS C;  4XJZ A;  1B35 A;  2A3Y A;  1RHI 3;  2JG9 B;  3H50 A;  3K48 A;  1AL0 G;  1PIV 3;  5K8S A;  5K0U C;  2P3J A;  4AI3 A;  3QD6 A;  3WQB A;  2XVL A;  4GMP 3;  5FPL A;  2J1V A;  2WO1 A;  3U11 A;  3K46 A;  2CV6 A;  1Z7S 3;  3BGA A;  3LF7 A;  5APA A;  1DQ2 A;  1KGY A;  5A80 A;  3ES4 A;  1PGW 1;  4IER A;  1NA1 A;  3AJZ A;  1PK6 A;  3HBZ A;  1FMD 2;  5LRS A;  1N1T A;  5JMO A;  4QU2 A;  1RVF 2;  3LEM A;  4B4R A;  5EYY A;  3RZM A;  5FPX A;  4ONU A;  2ERF A;  4Q4V 3;  1B35 C;  4Y1X A;  4E27 A;  5DDJ 1;  3MPB A;  2AYH A;  2XON A;  4WVV A;  1BEV 2;  3VZL A;  3CL1 A;  3MIF A;  2YHJ A;  2A6V A;  2VXJ A;  4OUM A;  4XUN A;  3WX5 A;  4FFG A;  5FPA A;  4HON A;  1QNY A;  4Q4X 2;  2RDS A;  2DVA A;  1OF4 A;  3RYR A;  4PDW C;  1DQ1 A;  1ZYB A;  3AVR A;  1ONA A;  1APN A;  3E5Q A;  4URA A;  3OYW B;  3D6E A;  3M2M A;  2RHP A;  1UY1 A;  2BNN A;  4Y33 A;  4AVT A;  2VOX A;  2P3Y A;  1UXZ A;  2BEO A;  5GZD A;  1AYM 3;  1EV1 3;  3ITQ A;  1PVC 3;  2BFU S;  4CU7 A;  5BNP B;  2VNV A;  3PNA A;  2DBI A;  1V6I A;  1XYN A;  4QHB A;  2NPI A;  4LO7 A;  2VZT A;  4A7K A;  3FWE A;  2VUD A;  3UT0 A;  1J3P A;  3BU7 A;  5ABJ B;  3KMH A;  1GLH A;  4FT8 A;  2FDG A;  1KS5 A;  4QPI A;  1TMF 1;  5JXI A;  5KWR A;  4UT5 A;  2CDO A;  4LPL A;  4EN7 B;  4N7U A;  2CHH A;  1NUK A;  5C5U A;  1PGS A;  4BQ3 A;  4XDP A;  3POS A;  1ZBE 3;  2HWE 3;  2VUC A;  1YO8 A;  3III A;  1OHF A;  2ZCW A;  1IOA A;  3MGU A;  1OA4 A;  1PGW 2;  4LBL A;  3T0A A;  4A2U A;  3AX4 A;  2VTF A;  2WO2 A;  5LBE A;  2DV9 A;  1JYX A;  2ZX2 A;  2UUR A;  1UU6 A;  4GH4 A;  5F5I A;  5FUP A;  1N1S A;  4OHV A;  4RS5 A;  3U1X A;  1ZRD A;  3UYJ A;  3ETP A;  1PZ8 A;  5AVP A;  1SLA A;  1C5H A;  4M00 A;  4PF1 A;  1JZ8 A;  4GD4 A;  4RR3 B;  2ZOE B;  2YC0 A;  3KSC A;  2EXJ A;  2WS9 3;  1Q8S A;  3ROU A;  2P6C A;  1XNC A;  4OUL A;  4P9J A;  3D3A A;  1QXR A;  4RHV 1;  2WN3 A;  4YZ2 A;  1DGR A;  2VZ3 A;  4Y5Z 0;  1W8F A;  2HEY F;  4YM0 A;  5EHD A;  3U10 A;  1ZA7 A;  5FBZ A;  5CA6 A;  3B69 A;  2DUP A;  2VEC A;  2WFP A;  4F83 A;  2IUW A;  4GWJ A;  3Q8F A;  4K9S A;  1W0P A;  4OQ8 A;  2R06 1;  1ZZ9 A;  4BOW A;  1MQT B;  2DVF A;  2JDN A;  2GMP A;  2VMC A;  3AYD A;  4EE2 A;  1WA4 A;  4YWA A;  5JSR A;  3IDB B;  4HBN A;  2VCC A;  4AW7 A;  4QQO A;  5JXH A;  1X8E A;  3EB7 A;  5HBA A;  2QVS B;  4DO0 A;  2ZGK A;  5T52 A;  5CZK A;  5DUV A;  4UAP A;  2QQO A;  4AK3 A;  1W04 A;  4FTE A;  1TMF 2;  4QM9 A;  4QQH A;  3HJR A;  2WC2 A;  4IW3 A;  5I8Y A;  2C1F A;  2XQX A;  3U07 A;  5A3U A;  3OJB A;  2GP5 A;  4AGV A;  1A3K A;  1UAI A;  2OT7 A;  4JV4 A;  1YHF A;  3TB0 A;  4P02 B;  2RS5 1;  2WSU A;  4RQP A;  3H0O A;  4Y5T A;  3JUU A;  4AZZ A;  3V0A B;  4D94 A;  2XKO A;  1CN1 A;  3O1S A;  4Q0U A;  1QOS A;  3E6C C;  2RMU 2;  4L97 A;  2DU1 A;  1QQP 1;  5JR7 B;  1PO1 3;  2ID4 A;  3GHN A;  4YVW C;  1D4V B;  3ZPY A;  2J22 A;  4EN0 A;  1XE7 A;  3SKJ E;  2W0X A;  3HWJ A;  1W6M A;  3ATG A;  4RHV 2;  5SV5 A;  3NV4 A;  4XUQ A;  2VOW A;  4OZO A;  5HV0 A;  5F37 A;  2QTW B;  2H6C A;  1VPH A;  1M06 G;  5F5A A;  2SBA A;  2ZMN A;  4RQP C;  3QH7 A;  2B9V A;  1IS3 A;  3ZIX A;  4I01 A;  2P2K A;  4IDZ A;  5CKQ A;  3UGG A;  5FRE A;  4Y20 B;  4CCC A;  2R06 2;  4PLM A;  1NLS A;  2B7Y A;  4HLT A;  1V6N A;  4FPY A;  3ZOI A;  3N7M A;  3AZV A;  1QOO A;  1MZ6 A;  2VU9 A;  2QQN A;  1WW5 A;  3JCI A;  3THC A;  4QHO A;  4DEV A;  4M3C B;  3T2P A;  3WNK A;  4AHW A;  5FK8 A;  1JN2 P;  4JGZ B;  4LBN A;  4XCB A;  4ZS3 A;  1HW5 A;  3I54 A;  5FY0 A;  3VKM A;  3LSD A;  4NR1 A;  2CGP A;  5FIX A;  5CFD A;  1QJU 2;  4OHZ A;  4DUW A;  1W28 A;  2V4A A;  1KQR A;  1VP6 A;  2XH6 A;  4Q4W 1;  2WJS A;  2X5I A;  5I0S A;  1X50 A;  4M4P A;  2YGL A;  1TVG A;  4COZ A;  3POG A;  4NRP A;  2W92 A;  3I97 A;  4QM8 A;  4AFA A;  4EN6 B;  3WNP A;  1QJX 3;  2VO5 A;  1JZ6 A;  2B45 X;  2BGC A;  1CIW A;  4XXP A;  2RS5 2;  4Z2W A;  3NWK A;  3O0W A;  2BYV E;  2XKP A;  1YEW A;  2HEV F;  1G8W A;  2XML A;  5DUW A;  3AB0 A;  5T50 A;  3ZFG A;  4EJR A;  1F9K A;  5BNO C;  1JMU B;  1UIJ A;  3OBZ A;  5FMO S;  1QQP 2;  1RUG 3;  5CFD C;  3JQW A;  5EQU A;  5F3I A;  4DRV A;  2VOK A;  2FD8 A;  1LUL A;  3K4D A;  2X5I C;  5F1R A;  3E5U A;  1CON A;  1W05 A;  2WL1 A;  1G6N A;  1RUI 1;  3D4K A;  4DXZ A;  2TBV A;  2XHN A;  2IXL A;  4CDX C;  4V2V A;  1XOY A;  2Y64 A;  3IWZ A;  4S2H A;  3GXU A;  1VBA 1;  2GC1 A;  3CQO A;  1WWY A;  3INA A;  3NQH A;  2VVD A;  4QQP A;  3RYP A;  1RUJ 2;  4AAX A;  1W6Q A;  3VZJ A;  3KGZ A;  4ET7 A;  1JZ3 A;  1W9T A;  2GAL A;  1JTZ X;  4AQS A;  4RSU A;  1US3 A;  2QNK A;  4FI9 A;  3OGG A;  1UU5 A;  3EMR A;  1RTV A;  1DP0 A;  4MOA A;  4M0H A;  4KMQ A;  1KEX A;  2ARX A;  4RN5 A;  5FYV A;  3N9Q A;  2FZ1 A;  4XFI A;  5T55 A;  5DAQ A;  2VAU A;  2DYC A;  3T09 A;  4CDQ B;  1HX6 A;  4XJ9 A;  5J37 A;  1U0A A;  5FPU A;  1UQX A;  4Q0V A;  5HXM A;  3VBR C;  4XJU A;  4BB3 A;  5KBF A;  5FZB A;  1STM A;  4Q4W 2;  5G05 L;  1GMM A;  2JEC A;  3SIT A;  4OUS A;  3C7F A;  4I3G A;  5DN2 A;  3LZZ A;  1WCK A;  2GND A;  4IXL A;  4MVT A;  4R9A A;  4XMI A;  5AFB A;  2O14 A;  2BFU L;  2D43 A;  4AG4 A;  1BVV A;  1LHU A;  2YC2 A;  3U0Z A;  1MEC 1;  4RFR B;  1YJL A;  3MID A;  4CYD A;  3DPR A;  1S0J A;  3POJ A;  4IGP A;  1FOD 3;  4LMF A;  5C9A C;  3MV1 1;  5JIA A;  4FVV A;  4CU9 A;  1BCX A;  1QDC A;  4XYX A;  3PUH A;  5A7W A;  2BDR A;  4AHX A;  4B7E A;  3WQ0 A;  3VKN A;  5IVE A;  3W58 A;  3WW1 A;  1BXH A;  1OA2 A;  3ZXD A;  1RUI 2;  1W9Y A;  1YWK A;  3BIW E;  4KG8 A;  4XAE A;  5LAT A;  1DDL A;  3VKF C;  4RYD A;  4FOV A;  1ND2 A;  1A6C A;  1AJK A;  2NM1 A;  3J7L A;  2Y38 A;  2Z4F A;  3J8F 3;  2QZ3 A;  4ITC A;  1COV 3;  1VBA 2;  5CBL A;  1HN0 A;  4QXC A;  1GKB A;  5FQ0 B;  2JE7 A;  3QBQ A;  1VB4 A;  5TSW A;  5JZG A;  4BMB A;  2IXK A;  1FMD 3;  1J3Q A;  1AJO A;  4HK8 A;  3RGB A;  1RHI 1;  4ES9 A;  3R0R A;  1PVX A;  5JPM B;  1PIV 1;  5F7U A;  1OFN A;  4NPL A;  5F32 A;  2GNT A;  1K12 A;  3BOD A;  4GMP 1;  1SDW A;  5I0T A;  1Z7S 1;  1GP4 A;  4H3W A;  1GU3 A; 
#chains in the Genus database with same CATH homology
 2VCB A;  5J1X A;  1GQP A;  4BK4 A;  3LPG A;  1CZS A;  2WQ8 A;  3T08 A;  3U37 A;  3A7Q A;  4XUP A;  2J1R A;  3HOB A;  2BGP A;  1XNT A;  4CU8 A;  2RVA A;  4JKK A;  3DYO A;  2WYS A;  4GZ9 A;  2C4X A;  4W8J A;  2W91 A;  2V72 A;  2VQT A;  4XUO A;  4ZXE A;  4QAW A;  4QPW A;  2VMD A;  3CKH A;  5FUI A;  5JXG A;  4XUR A;  3CMG A;  1R64 A;  1GOH A;  2J1U A;  4A45 A;  2X10 A;  3K77 A;  1L7R A;  1WCQ A;  3I3E A;  2C9K A;  1P8J A;  1WKY A;  1JU3 A;  2VZR A;  2BZD A;  3I3D A;  2WO3 A;  1W8N A;  1NKG A;  3GGL A;  4QDR A;  1CIY A;  2QBX A;  2VCA A;  4XUT A;  2W1W A;  3NJX A;  3BN6 A;  4OMC A;  2VC9 A;  2Y6G A;  3ECQ A;  3MUZ 1;  4D0Q A;  3I2G A;  2EIC A;  5EIY B;  2KD7 A;  1YQ2 A;  5EJ1 B;  2L9L A;  1UX7 A;  3ACF A;  4XVH A;  3THD A;  1MPX A;  4BXS V;  2ZXQ A;  1ULP A;  1GNY A;  3GDB A;  5JR2 A;  1K3I A;  4ARY A;  3UNP A;  2BGO A;  2OKX A;  2W87 A;  3IB3 A;  1J83 A;  1GUI A;  2W9X A;  5CYY A;  4CUB A;  3NRU A;  1W9W A;  3I2F A;  2HLE A;  4D8M A;  1PMH X;  5LCW L;  2ORX A;  1PX3 A;  2WUH A;  3VD7 A;  3WSO A;  3WF3 A;  2W1U A;  3CZJ A;  2VZ1 A;  3K4Z A;  3MO4 A;  1OT5 A;  2VME A;  2WAB A;  3WF1 A;  1UY2 A;  2W46 A;  1K42 A;  3I2I A;  2ZEY A;  4QDS A;  4MGS A;  3T2O A;  3HPN A;  4JHZ A;  1ULO A;  1UYZ A;  3MBW A;  1PMJ X;  1DLC A;  3P6B A;  4DEQ A;  1JU4 A;  4QB2 A;  3WEZ A;  1JYW A;  3A22 A;  3ABZ A;  2CDP A;  4ARX A;  4M4R A;  1UY4 A;  2E33 A;  2W5F A;  3VDA A;  4JX0 A;  2VJX A;  2W1S A;  2VL4 A;  3W5N A;  4QDQ A;  1L7Q A;  4DXS A;  2DCK A;  2BER A;  1US2 A;  5B4X A;  5JXJ A;  2WZ8 A;  2X09 A;  4L0P A;  3AC0 A;  3VD3 A;  3HNB M;  2X05 A;  2Y6H A;  1F4H A;  2V4V A;  3HEI A;  3ZM8 A;  1UY3 A;  3LPF A;  3DYM A;  3C7O A;  4A42 A;  1XNA A;  4CVU A;  1HN1 A;  3MUY 1;  4LQR A;  1IQD C;  5DPN A;  1PX4 A;  4BDV B;  2DDU A;  3I2K A;  3FHQ A;  1UMI A;  5G04 L;  3WQB A;  2J1V A;  2WO1 A;  3K46 A;  3BGA A;  3OGR A;  3J7H A;  1KGY A;  3OGS A;  3JXS A;  2B4K A;  4IUG A;  2Y6J A;  5JMO A;  2XOM A;  3WNO A;  4DUV A;  1GOG A;  2W1Q A;  1F4A A;  3OEA A;  2XON A;  4W50 A;  5C7G A;  2J7M A;  4XUN A;  2ZEW A;  4W4Z A;  2WZE A;  1OF4 A;  2PQS A;  2JE8 A;  1CZT A;  2YG0 A;  1UY1 A;  4CUC A;  1UXZ A;  4QX1 A;  4CU7 A;  1SDD B;  2VMF A;  5IFP A;  2YB7 A;  3LE0 A;  3FL7 A;  3SKV A;  2VZT A;  1UZ0 A;  3A23 A;  5DMY A;  3VD5 A;  2WAA A;  2VR4 A;  5JXI A;  3WF2 A;  2CDO A;  4LPL A;  3WNN A;  2ZEZ A;  5C71 A;  1NUK A;  1GOF A;  3III A;  3T0A A;  4ZZ8 A;  2JD9 A;  2VTF A;  2WO2 A;  1OF3 A;  1JYX A;  2V5D A;  3ETP A;  3E1F 1;  3MV0 1;  4ZY9 A;  1XC6 A;  1TG7 A;  4PF1 A;  1JZ8 A;  1JYV A;  2Y6K A;  3T0D A;  2EIB A;  3D3A A;  3VDB A;  4JKL A;  3OG2 A;  2WN3 A;  2VZ3 A;  2Y6L A;  1JYN A;  1UWW A;  3LEI A;  4DXT A;  4QB1 A;  4GWJ A;  2JDA A;  4BK5 A;  2RJ2 A;  4QX0 A;  4HG6 B;  3LQC A;  5A1A A;  1H6X A;  2J1E A;  2VMC A;  3HNY M;  4UOJ A;  2VCC A;  3WNL A;  2VZQ A;  3CZU A;  3ACG A;  3VDC A;  5JXH A;  3EB7 A;  1K45 A;  4QX3 A;  1JZ7 A;  5CZK A;  1O8S A;  1RYY A;  2QQO A;  4UAP A;  5C70 A;  3I2J A;  3HJR A;  2XQX A;  1UY0 A;  3PUI A;  4XZU G;  4GWI A;  4TTG A;  2J1S A;  4P02 B;  1I5P A;  2WN2 A;  5B4N A;  5LA2 A;  3WNM A;  2LS6 A;  3C8X A;  4QB6 A;  1JZ2 A;  2E26 A;  2Y8K A;  2QQI A;  3W5M A;  2ID4 A;  2ORZ A;  4DUX A;  2J22 A;  3A21 A;  3SKJ E;  3WF4 A;  4XUQ A;  4OZO A;  3VD9 A;  3ACH A;  2B9V A;  3FHA A;  1W9S A;  2YFU A;  4OYU A;  1W8O A;  2HYX A;  5LA0 A;  2VZU A;  3K75 B;  3THC A;  3FN9 A;  2WBK A;  2QQN A;  2QQK A;  4DEV A;  3WNK A;  3T2P A;  4LKS A;  3ACI A;  2J1T A;  3I2H A;  1J84 A;  4QX2 A;  2WAO A;  2C26 A;  2E31 A;  3C7H A;  4DUW A;  2YFZ A;  2W94 A;  1SG3 A;  3T2Q A;  4PT6 A;  2VQU A;  4YPJ A;  1EUT A;  2DCJ A;  3UET A;  1OH4 A;  4M4P A;  1TVG A;  2W92 A;  3I97 A;  1JZ5 A;  1JZ6 A;  3VD4 A;  3WNP A;  2VO5 A;  2W3J A;  4ZZ5 A;  1D7P M;  4A6O A;  1JZ4 A;  4E8C A;  5LA1 A;  4A3Z A;  3OEB A;  5IFT A;  3OBA A;  3SEP A;  2LW8 A;  1UXX X;  4JKM A;  2QQL A;  2QQJ A;  3K4D A;  2XHN A;  3CDZ B;  4Z2A A;  1CX1 A;  5DQ0 A;  3DYP A;  5IYY A;  1CZV A;  4MO3 M;  4P00 B;  2VZO A;  2Y64 A;  2J1A A;  3GXU A;  5I0D A;  1H6Y A;  3F2Z A;  3CQO A;  3NQH A;  2WDB A;  1XPW A;  4AAX A;  1O59 A;  4ET7 A;  1JZ3 A;  4PQQ A;  1W9T A;  3NJV A;  1US3 A;  1JHJ A;  4FI9 A;  4OUE A;  2VOT A;  4P5Y A;  3SEE A;  1DP0 A;  3DEC A;  1NX9 A;  4MOA A;  4KMQ A;  5IHR A;  1KEX A;  3T0B A;  4RN5 A;  1EUU A;  1W0N A;  3OGV A;  1UYX A;  4CU6 A;  4KI5 M;  3K4A A;  1BHG A;  3HNM A;  3T09 A;  2R7E B;  5IJR A;  4UI9 L;  5EJZ B;  5HXM A;  1JI6 A;  5G05 L;  1GMM A;  3LEK A;  2QQM A;  3C7F A;  3C7G A;  4A41 A;  2VM9 A;  1NAE A;  5DN2 A;  4E8D A;  2VZP A;  3I3B A;  4BJ0 A;  5HPO A;  5JUV A;  4AG4 A;  2EIE A;  1O8P A;  1SHW B;  2YC2 A;  3LEG A;  1LNS A;  3WF0 A;  2JKX A;  2VZS A;  3MV1 1;  4CU9 A;  1DYO A;  2EID A;  3C7E A;  1OD3 A;  3PUH A;  4KWU A;  2E32 A;  2VZV A;  3HN3 A;  4CUA A;  4LHS A;  3OB8 A;  4MGQ A;  3CIH A;  4DXR A;  3GM8 A;  4RYD A;  2YC4 A;  3NNG A;  3IAP A;  3EYP A;  2RV9 A;  4A4A A;  3IAQ A;  2Z4F A;  1UMH A;  1T2X A;  4OMD A;  2ZEX A;  4MAD A;  4TXW A;  3UES A;  2BBA A;  3IDA A;  5F7U A;  1UYY A;  1K12 A;  2W47 A;  4P08 A;  4A44 A;  3P1I A;  2W95 A;  1W99 A;  1GU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...