5FUIA

Crystal structure of the c-terminal cbm6 of lamc a marine laminarianse from zobellia galactanivorans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'NTLKIEAESYLYSNDVQKEPCSEGGENVGYINNGSWMSYPGINFPSSGNYLIEYRVASAVDGGRFSSDLEAGETVLGELSVPNTGGWQNWTTVSQTVNVSAGTYQFGLYSISGGWNINWIRITK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
publication title Unraveling the Multivalent Binding of a Marine Family 6 Carbohydrate-Binding Module with its Native Laminarin Ligand.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5fuiA00
3AC0A 3E1F1 4CU8A 2E32A 2W1SA 3I2GA 2VZSA 3ACFA 4A41A 4L0PA 3UETA 4BK4A 4YPJA 3WEZA 3CZUA 1JYNA 1NX9A 2PQSA 2L9LA 4KI5M 5DQ0A 1KEXA 2J1EA 3OGRA 3T2OA 4LQRA 3MV01 1UXXX 1GQPA 1JZ2A 3LEIA 1GNYA 2VL4A 4XUQA 2QBXA 3T0DA 4W4ZA 1H6XA 4OMDA 4P02B 4KWUA 4MGQA 4OUEA 2VMDA 1OF3A 2YFUA 1UY3A 2EIDA 3LEGA 1D7PM 4D0QA 4OMCA 1YQ2A 2W9XA 3OG2A 2VZTA 3HN3A 4CUBA 1MPXA 3WSOA 2WYSA 4GWJA 2Y6HA 1W9WA 5LCWL 3IDAA 1JU4A 3VD7A 3OGVA 1UMHA 1GOGA 2RJ2A 2ZEXA 3T0BA 4D8MA 3ACGA 3EYPA 2CDOA 5LA0A 4MOAA 2CDPA 2W5FA 1PMJX 4P5YA 3IIIA 4A42A 1EUUA 4QB6A 3ZM8A 3C8XA 1OF4A 2BBAA 2QQIA 1W0NA 3T0AA 3ECQA 4A6OA 3K4ZA 1SG3A 4E8DA 2W3JA 3EB7A 3JXSA 5B4NA 4P08A 5JMOA 3VDBA 1JYWA 1CX1A 2ZEWA 3ABZA 1UY0A 4GWIA 3THCA 3A7QA 1W8OA 3MUY1 2ID4A 3OBAA 3LPFA 2J1SA 2HYXA 4QPWA 4XVHA 3WF0A 4QX0A 1K45A 2WAAA 3WQBA 2BZDA 1UY1A 4LHSA 3THDA 2E31A 2VMEA 4XUTA 5LA2A 4QX3A 1F4HA 2V72A 1TVGA 3W5NA 2Y8KA 2VZQA 2VCAA 4CUAA 3GM8A 1W8NA 2OKXA 1CZVA 1I5PA 4OYUA 1JZ8A 3GXUA 4ET7A 1K12A 3VDCA 4XUNA 3UESA 2HLEA 3W5MA 3BGAA 4DXTA 1W9SA 2DCKA 2VJXA 2ORZA 4QAWA 3ACIA 2C9KA 4A3ZA 4AAXA 1O59A 1H6YA 1LNSA 2EIEA 2X09A 1J83A 5EJ1B 1JZ3A 2VC9A 1CIYA 2VCCA 1K42A 2VMFA 4JKKA 2WDBA 4TTGA 2ORXA 4MADA 4ARYA 2VZVA 1UMIA 3WNMA 2QQOA 5C7GA 4QX2A 4QB2A 1CZTA 1BHGA 3NJVA 5EJZB 2V4VA 1PX3A 1US2A 2W1QA 3SKJE 2YG0A 1UXZA 5C70A 2VQTA 4BXSV 3P1IA 5IFPA 3DYMA 2Z4FA 4QB1A 2B9VA 3IAPA 3C7GA 1OT5A 4JKMA 1J84A 3I2FA 4QDQA 2C4XA 3IAQA 4P00B 2Y6LA 4Z2AA 4DEVA 2V5DA 1JZ6A 2VZUA 5DMYA 3DYOA 3HPNA 3NRUA 1UY2A 2WZ8A 2W87A 4M4RA 5IHRA 2JE8A 4XUPA 2E26A 2X10A 5JXHA 1UYYA 1HN1A 3HJRA 2ZEZA 1EUTA 4M4PA 4QDSA 4BJ0A 2WUHA 2YC2A 4DUWA 3WF3A 5JR2A 1GOHA 4GZ9A 3NQHA 3FL7A 1UX7A 4OZOA 2JD9A 5HXMA 2J1UA 3DECA 1US3A 3WNLA 4CVUA 4HG6B 3I3DA 1SDDB 1DP0A 2VOTA 5C71A 2QQJA 4ZY9A 4TXWA 3I2KA 4RYDA 4PT6A 1GMMA 2W1UA 5B4XA 3HNYM 2R7EB 2J1RA 2LS6A 3WNKA 3WNPA 2W91A 2VTFA 3HEIA 1TG7A 4PQQA 3WNNA 3C7OA 3VDAA 1JHJA 2VQUA 5F7UA 3I97A 3K75B 3CIHA 3IB3A 3GGLA 2VZPA 1DLCA 1SHWB 2VM9A 4PF1A 3LE0A 5EIYB 1NUKA 2J22A 4MO3M 4CUCA 1ULPA 5A1AA 3GDBA 4DEQA 3K4AA 2VZOA 2QQKA 4A45A 3ETPA 3HNMA 4DUVA 1PX4A 3CZJA 3K77A 5HPOA 1CZSA 5CZKA 2Y6JA 4UOJA 2VO5A 3ACHA 3HNBM 1GU3A 4QDRA 4DXSA 2W92A 3OEAA 3WF4A 4BK5A 1O8SA 1JI6A 1R64A 1KGYA 3LEKA 1UYXA 2WO2A 3U37A 5J1XA 2W1WA 3D3AA 3FHQA 1L7RA 3I3BA 2YB7A 2RV9A 2X05A 3T08A 3VD4A 3VD5A 2BERA 1JZ5A 2VR4A 3UNPA 3J7HA 1P8JA 3CDZB 1RYYA 3NJXA 3I2IA 2WBKA 4E8CA 4AG4A 1XPWA 2EICA 4FI9A 3WF2A 3LPGA 5IJRA 2J1TA 5FUIA 5G05L 4W50A 2YFZA 1K3IA 2XHNA 1XC6A 2VMCA 4UAPA 2B4KA 3F2ZA 4CU7A 3T2QA 3OB8A 1UWWA 2KD7A 5JUVA 3C7FA 5G04L 2RVAA 1IQDC 1F4AA 2Y64A 4CU9A 3CKHA 2W94A 1W99A 3NNGA 3SKVA 4DXRA 5JXJA 4UI9L 4XZUG 2J1AA 2VZRA 4RN5A 1L7QA 4W8JA 3CQOA 4A4AA 1JU3A 2WZEA 3I3EA 3PUHA 5JXIA 3OEBA 4JKLA 4BDVB 3K46A 2LW8A 2QQNA 3T2PA 1JYXA 3I2JA 4ZZ5A 1GUIA 3A23A 4LKSA 3OGSA 4CU6A 4XUOA 2DCJA 1T2XA 3MBWA 4ZZ8A 1XNTA 3I2HA 3T09A 4QX1A 3CMGA 2QQMA 5IYYA 4IUGA 4JX0A 3MV11 2ZXQA 2W46A 1W9TA 1JZ7A 2JDAA 2QQLA 3PUIA 3C7HA 2VZ3A 2XONA 2Y6GA 1WKYA 1DYOA 3WNOA 4XURA 1O8PA 2W95A 3VD3A 3A21A 3MUZ1 4A44A 5CYYA 3FHAA 3SEPA 1OD3A 2DDUA 4DUXA 3C7EA 1WCQA 2J7MA 3DYPA 3SEEA 1PMHX 2WN3A 2WN2A 1ULOA 5DN2A 2BGPA 1NAEA 1UY4A 2WQ8A 2J1VA 1NKGA 2WABA 2WO3A 2XQXA 1UZ0A 2E33A 5JXGA 3WF1A 2ZEYA 2WAOA 3VD9A 1XNAA 3BN6A 4MGSA 4KMQA 3LQCA 3FN9A 1JZ4A 2W47A 1OH4A 2C26A 4ARXA 1JYVA 2EIBA 5IFTA 3MO4A 3P6BA 4LPLA 2VCBA 5LA1A 2WO1A 5DPNA 4ZXEA 2YC4A 3HOBA 4JHZA 5I0DA 3A22A 2VZ1A 2JKXA 2BGOA 1GOFA 1UYZA 2XOMA 2Y6KA 3K4DA
chains in the Genus database with same CATH superfamily
1HB4A 2VMGA 4J25A 1L3JA 5FPXA 1I6XA 3LAGA 4LBQB 5FP7A 3BCWA 1H2LA 4GB33 1VIWB 2C5DA 2I2SA 4YPJA 2V4AA 1RMU2 2VNGA 3WEZA 5KWRA 2PQSA 3ENRA 3AMNA 3NV3A 5L7OC 4NR1A 1KEXA 1NE6A 1RUJ3 5GZGA 3OGRA 2R6QA 4A7KA 3B69A 4R9DA 2XGXA 1GQPA 3OTFA 3HMYA 1W6NB 4Q0VA 2PLV2 1A8MA 4K3UA 4XUQA 4AI3A 1W8TA 4LBKA 2QBXA 5FUNA 4URAA 3PUSA 4XDQA 1FNZA 3JB8A 4FTBA 3E6CC 2NN8A 4SBVA 4OUEA 1ZBA2 1K5MC 2JKBA 2B9UA 4CCDA 2CSGA 4IEWA 4BQYA 3JD73 4WM7C 1AYM2 3WDYA 1D7PM 3AZXA 5KXCA 1VBA1 5EV7A 5L7OB 3CU7A 4IE5A 3VZJA 3OOXA 2AEZA 2DWRA 1ZYBA 3HN3A 4FPKA 4D6RA 5T5OA 1OKQA 3POEA 1XNCA 4HN0A 2W2IA 4GWJA 3NVCA 2R063 4QQHA 3O1PA 2JG8A 1W2TA 1CAXB 5LCWL 3UKNA 1FPN2 2GAUA 5CBLA 3KQ4B 3Q8FA 1YFWA 4YYOA 1K5MB 1XB9A 2RJ2A 2ZEXA 4BQ5A 3N4MA 4XF1A 3MF6A 4NWWA 1H8TA 1LENA 1RUE2 2RM21 4FTSA 2O14A 3EYPA 3KLSA 3SHRA 1Z7S2 2JD4A 4RHV1 3IIIA 3BI3A 5H9RA 3GYDA 2B5HA 5DUXA 4XBLA 5T55A 1VBB3 5M0TA 2O8QA 3BIWE 3DPRA 4R9AA 3ITQA 1EUUA 1OA2A 2XJTA 1A34A 5I0UA 1IKQA 1QXRA 2R072 2VOKA 3AKTA 2XJPA 4BQ1A 2XVLA 1CJDA 5KBFA 4XAEA 1VBE1 2A70A 2VQ0A 4Q0UA 3K4ZA 4NIHA 2ZAAA 2W3JA 3H1MA 4L9BA 1LODA 3JXSA 1VP6A 5B4NA 4O7XA 1IG3A 2OZ6A 3ON7A 2Q8EA 5KXBA 4UFHA 1N3QA 1UY0A 4UW6A 5T5JA 2GH2A 3THCA 3A7QA 2AYHA 4OQ9A 3GZTB 3MUY1 4CDUC 4D3WA 4UBGA 5GZCA 1JN2P 3V0BA 1VE0A 1DGWX 1YFUA 2J1SA 2YROA 2O0OA 1AHSA 4LKEA 1C57A 5JSOA 2BTVC 1ND3A 4P9LA 1LEMA 1TQ5A 4COUA 4FBFA 4N9IA 1BBT3 2G4IA 2PHLA 3KWVA 2H0VA 3TEYA 4YRDA 4QX3A 2G19A 3ZPOA 2BWAA 5CIRA 1SCSA 2VZQA 2W39A 1UPSA 4CCNA 5A3LA 2D40A 4QM9A 3J8F3 2AH2A 4J1WA 3LDKA 5FXVA 1UIKA 1WD4A 4GALA 3GM8A 1LOFA 1W8NA 4TLFA 2OKXA 2PELA 4AQ6A 1HRV1 4L99A 4J6GA 4RR3C 2ZOEB 1TMF1 4WVMA 5CKMA 1DU3D 2ILMA 5LBCA 3GXUA 3ZXLA 5BNNC 1JZ8A 5C8CB 3M3QA 5CU1A 1DQ2A 1JYTA 4IEXA 4LORA 1RXGA 1SLLA 2P34A 3FMGA 3WCRA 2JDKA 3HBZA 1AR92 3INAA 1YC61 2PHTA 1DQ6A 3WDUA 2A7AA 1BEV1 1PVC2 4XHXA 3BGAA 5JZGB 2VJXA 5T3NA 1HQWA 1BCXA 2YPJA 1CPMA 2P2KA 5FYYA 4QGNA 3H7YA 3R6SA 1ASJ1 3D5OA 4LKDA 1NYWA 1H6YA 3MIGA 4C90A 1LNSA 5A3TA 1J83A 3FLTA 1GLHA 5HV4A 5EJ1B 1Y9MA 2C6SA 5FYBA 4WVWA 1GKBA 1DG6A 1UZVA 2RS32 1QDCA 4P9IA 1Y43B 2ZMNA 3RRDA 4XFFA 3NNFA 1J1LA 3W59A 1S2BA 4GWMA 4Z8BA 2WZPP 2F4PA 4QX2A 4GMP0 1CWPA 2GDFA 3NJVA 3DKQA 4IETA 1LHUA 3I8TA 5FRAA 1CIWA 3ZSEA 1SFYA 2RMU1 4YW7A 5A32B 5JOXA 1W06A 4AEDC 3IIAA 2V4VA 2R30A 1LB2A 5ACA3 4OFGA 5GZEA 3H3UA 2W1QA 5FPAA 1HJGA 3H50A 4AEJA 3SITA 4BIOA 5BV6A 1UXZA 2D5FA 2LM3A 1PZ9A 4BHPA 3JZVA 3P1IA 3LOBA 5FAXA 1QMJA 4QXKA 1TME3 2PFWA 3DYMA 4JRLA 3IAPA 4YZ1A 4TYSA 2XR4A 1J84A 4QDQA 1QU0A 2AZ5A 3POJA 5CNAA 1NLSA 1SEFA 2YYOA 5J7MA 3B5LB 3NL1A 3NAPC 4LO7A 4IL7A 2ZGTA 2P3KA 3SH4A 4AEDB 5LBEA 4Y1UA 5LEJA 5FZ7A 5BPXA 4N7IA 3CJIC 1JH5A 3KM5A 2JIJA 5FMDA 3D0JA 3RZHA 4PBPA 1W2OA 5JWPA 3VHRA 5F2SA 2X5IA 4NRPA 5FYTA 5ISLA 3OUIA 1N1VA 1OA3A 1SLTA 3AKQA 2YHJA 4LBLA 4CDXA 4LO6B 1GP5A 2WZ8A 4NE9A 2W87A 3ES4A 3TN93 3TRSB 1R082 2NLRA 2JE8A 1QJU3 4C1WA 1DFQA 2MEV2 1VAKA 5FJHA 1XU2A 5L9RA 4HOOA 4WZCA 4AFDA 4KWLA 5FZKA 3QD6A 1GP4A 1IGOA 1ODNA 4RFT0 1MR5A 1ZBE3 4AZZA 1B09A 1GWLA 1ZZ9A 4MZUA 2HYKA 4YVWA 4BMBA 4GB32 4Y1VA 1W04A 2LROA 3AJZA 1XE7A 1OPOA 2FMDA 2BU9A 2DFBA 1CN1A 5CKQA 2XHKA 1RUJ2 4YGCA 2J1UA 3J7LA 5D1IA 1G86A 3DECA 3VBOB 5C3PA 2WLPA 3RZGA 1UU4A 1WWYA 3V0AB 4HKWA 2HWD3 3H0OA 4DRRA 3I3DA 1FMD2 3UV9A 3R05A 4IE7A 3OCPA 1SACA 3WXPA 2VOVA 4KGGA 4O9GA 1NY71 3JBG1 4TXWA 5A7QA 4N53C 3S30A 3OD0A 1HB3A 4CEWB 3M70A 4NPMA 5B4XA 2PYTA 4BQ4A 3HQXA 5LRRA 4RQPA 2VCMA 4IGQA 2R7EB 2ZJCA 3H9AA 4MHUA 1NLQA 2J1RA 4XDOA 1BQPA 1F35A 2D5HA 2IXIA 3B9IA 1NZCA 3LIHA 2W91A 4QU1A 3WNPA 1W03A 4UF0B 1CPNA 1TG7A 2ZBJA 5FZFA 4NROA 2DYCA 4D69A 2K46A 4IESA 1ZRFA 1UOGA 1PIV1 5FTTC 1CAWA 3K75B 5I0RA 1GSLA 5K4LA 4MGKE 5FO9B 1ONAA 3CIHA 3P5BA 1MEC1 3CL1A 3KF3A 4Y22B 5FZMA 3BTYA 1E5SA 1Y7BA 4F8AA 1SHWB 2DU0A 3O5SA 1S55A 1UIJA 3N7LA 4RFRB 3VKOA 4COYA 4EE2A 5EIYB 5A6YA 4LLFA 1NXMA 2H6BA 3AMPA 1NUKA 5J09A 5AC91 1CX4A 5F39A 5IVVA 1NCQA 1QDOA 4CUCA 4FSJA 1VBB2 1D2QA 2UWCA 1LOCA 2WT1A 2G1MA 1FOD3 1OLQA 1JS9A 4BZ4A 1QJX3 3KV6A 2IXLA 4UFLA 1GWMA 4ZS3A 1LRHA 4A45A 3K48A 3HNMA 4CXXA 1XNDA 1PX4A 1UPIA 1MS3A 2XXZA 1CAVA 4HMZA 1DZRA 3K77A 1VJ2A 3VBSB 4FTEA 4YM0A 1BLZA 1N1YA 4LKFA 4LOSA 5LZ6A 4PIXA 3ACHA 2A6ZA 1PGSA 1VAVA 4QDRA 4DXSA 1GNZA 3OEAA 3WF4A 2A5ZA 3AB0A 1URXA 4Y1XA 2YXSA 2ZX0A 3EQEA 4G3YC 3OF1A 5SV5A 3N7MA 5HV0A 2WO2A 1UD1A 1W0PA 1MS1A 2QZ3A 2A3WA 2ZMLA 4G4FA 2BVBA 1F5FA 4JZRA 4XILA 1V0AA 2JDMA 2VBBA 3OY8B 1Y9GA 3D3AA 4JTOA 4LIVA 2E9QA 3LFMA 4MXWB 4MGTA 2Q8DA 1ZZBA 2R0FA 2NPIA 2CWSA 3N9LA 4EWAA 1N3PA 1X8MA 3RDIA 2XKOA 3ZFGB 4Q1RA 1XSQA 1IKPA 4IEUA 3VD5A 2WFF1 4C8DA 2DVBA 4MUVA 3CDZB 5FOBB 3OJBA 3B3QE 1PGW1 1W39A 1XPWA 2ERFA 5C5UA 4IV1A 3OD4A 4DO0A 2DBIA 5FUIA 3TNPB 3T1MA 4MGZE 4W50A 2WT2A 4O9EA 4QQ2A 5L19A 2VMCA 3GJAA 3W58A 1CR7A 1GQGA 2WZR2 4K7JA 2JECA 3AJYA 4O61A 3SCFA 4D7YA 2CGPA 4FFHA 1LOBA 3TNQA 2K0GA 3C7FA 3PNAA 4DRVA 2HWB2 1RUC1 2D44A 2BV4A 4XACA 2RE9A 3AP5A 3GBGA 1WW6A 1W6PA 1IS4A 4PQ9A 5FYIA 2XKPA 4QM8A 3VBFC 4NHLA 2VZRA 2ES3A 4QPIC 4GXLA 4RN5A 4W8JA 5DZGA 1YJKA 1WW4A 2W68A 4XZPA 3NWKA 1VBC1 2B46X 3PUHA 4JHTA 2WS91 5JXIA 4LO4B 1AYN1 3AKRA 2BGCA 1OUSA 2DUOA 1W8FA 4M01A 4Z07A 3VB9A 4E2GA 1JYXA 3I2JA 4BLIA 3PUAA 4LBMA 1GUIA 2HWF1 1EP0A 4YFZA 3IBMA 1OKOA 5C3OA 2XB6C 3WLUA 5FXWA 1F5JA 3MHZA 1T2XA 3MBWA 3NV2A 4CDQA 1VMJA 1D0GA 2OXBA 4NVPA 4QPIB 1C8M1 1R1A3 3T09A 1W28A 2X8KA 3ZFFC 4PDWC 3USUB 5IYYA 4KGQA 1MVEA 3HT2A 3MI8A 3AP9A 4YVSC 5C8WA 4LNVA 2UYBA 2ZXQA 1JOPA 1NCRC 2W46A 2ZS6B 1F31A 3DXTA 5BY5A 2OYZA 2JDAA 1V9U3 1BMV1 5C5TA 3PUIA 3S7EA 4HONA 2XONA 2Y6GA 5D8AA 3PHMA 2GNTA 1C1FA 4TSVA 1DYOA 3BU7A 3LSEA 3WNOA 2A6VA 1WMXA 4QQPA 1O8PA 4XEZA 5C9AB 3ZLIA 1W90A 3ZFFB 4R4ZA 3J7NA 3FHAA 1W6QB 1QH6A 1D0HA 2XMLA 4ITCA 4RGAA 4CP9B 2PLV3 2DDUA 4IDZA 3C7EA 4YVSB 5A7WA 2ZHMA 4RS5C 1Z0HA 2XVGA 4JGZB 4Y24A 1RUF3 1ZBA3 4PLOA 2BGPA 1QXJA 4AOCA 1QJU2 2RM22 5FBJA 1NAEA 4LHKA 1WMDA 3NSTA 3GBFA 1VBD1 2WLQA 5H9QA 1AYM3 2WQ8A 2J1VA 4CEYC 2DTYA 4R52A 5C4WB 2EIGA 2WO3A 3UGHA 1ZVFA 2R49A 4NO4A 4Q27A 5FO8B 4DS0A 1DYPA 3E5QA 1SPPA 3WF1A 2PHDA 1W6MB 1REEA 2WAOA 4NIDA 1MQTC 1FPN3 4LHNA 4MGSA 4LUKA 1SBDA 2CV6A 2W47A 1S2EA 1TE1B 4XXPA 3S57A 1UU6A 4ARXA 2EIBA 1JYVA 2FDKA 5FPBA 2CGOA 5IFTA 4OI2A 2HWD2 3P6BA 5FY4A 1RUE3 3U4XA 4N43C 3RQ0A 4Q0SA 4Q4V1 5DPNA 5KC5A 1PM7A 3I49A 2FD8A 1GZCA 2ET7A 1Z7S3 1S0JA 5IK7A 5I0DA 4JC1A 4Y20B 3ZPYA 4LTAA 1ACCA 1UYPA 3B02A 5K0UB 2XJRA 3CNAA 5F37A 1GOFA 2JIGA 3KGZA 4XOGA 1GZWB 5DUWA 2R073 2XOMA 4XTMA 2BNOA 2JG9A 3AL6A 3JU9A 4IV3A 2TBVA 5LRSA 2OQ7A 3VBRB 1ULGA 2VZSA 3ACFA 3VHPA 2FCTA 2Q5TA 4BPZA 4KQ7A 2SBAA 2GMPA 5A3WA 5IK4A 1RHI3 1CJPA 1REFA 3NMBA 5BNPC 1NX9A 2YPDA 2LUWA 2J1EA 2EXIA 1HRV2 3T2OA 3WDXA 1RUI3 5CKNA 4HFSA 3NO8A 1JZ2A 2GMEA 1SFNA 2EF6A 2VL4A 2CHHA 1BXHA 4AQ2A 1OA4A 4W4ZA 4M00A 1SBEA 1RUH3 4Q4X3 1H6XA 4C0HA 4OMDA 4P02B 4EN8B 2N7GA 2RJLA 4KWUA 1MZ5A 5A33A 5FZ8A 3W9AA 4CDWB 1C3HA 3ZFEB 3ZMOA 2VMDA 4XJ9A 2FZ2A 3C3VA 3MIHA 4XAAA 2YFUA 3U1XA 1GZ9A 2A73B 1UY3A 5HXVA 1G7YA 1FOD2 2C24A 1OFSA 2VXRA 4NPRA 2D93A 2ADDA 2XWBB 3MW2A 3N9PA 4QHOA 3VHNA 5HI0A 1LU2A 4OHVA 4OMCA 3V64A 1YIPA 2VNOA 2W9XA 1LHNA 3OG2A 2VZTA 5DDJ3 3NNLA 3PL0A 1YFYA 3WSOA 1ASJ2 3WHUA 5F5CA 2YBPA 4BISA 2BP6A 4A7ZA 1W9WA 2I07B 2QQWA 1H8VA 1HW5A 3JD71 5A6XA 4NIIA 5DXDA 3LZZA 2XJUA 3OGVA 3VD7A 2KR2A 5C33A 2E7AA 4HN1A 5EYYA 1AR93 4B29A 1KDMA 2YGLA 2BDRA 4N90A 4QX8A 3ZXJA 4A7YA 4D8MA 3ACGA 3ZM8A 3QLQA 1PVC3 2PHXA 2IXJA 2W5FA 1PMJX 4P5YA 2R0HA 2VQAA 5KXDA 1XE0A 2D98A 1XYPA 2H6CA 5BXXA 5FYUA 2I74A 2RS11 2XBO1 3ALQA 1ENQA 4QB6A 2GSYA 3C8XA 4RA0A 1JODA 3RZZA 2CAVA 1UO9A 1Q8PA 5ABJC 4I0BA 2VBPA 2VG9A 3AXDA 1PO11 2DVGA 4X6QB 4CE8A 5K8SA 3UGFA 1SDWA 2RS33 3EB7A 4ZU7A 3PIJA 4MXVA 3I4IA 3ZKUA 2ZEWA 3H7JA 4MHRA 3WD5A 1KFXL 5FQ0B 1W6OA 2O1QA 1COV1 2OZJA 3AXEA 1SCRA 4E4DX 2ID4A 2OUJA 3ZR6A 4YZ5A 1DQ4A 3G7DA 3O14A 2RDQA 3GZAA 2OIIA 3P3NA 2CAUA 4LULA 4U36A 3WUCA 4XVHA 3IWZA 4IXLA 5FJKA 4BH9A 4QX0A 3PLQA 1HV1A 1SBFA 5LATA 1OVPA 2FHRA 2WNVC 3THDA 2V5YA 4LLOA 5H9PA 4NMIA 3PU8A 2E31A 4IEOA 4XUTA 5LA2A 5IVEA 3JQWA 4JRAA 4XJAA 5J96B 5J98B 2V72A 4KG8A 2Y8KA 1DQ0A 1VPHA 2VCAA 5CVRA 5EP9A 4CUAA 3OYWA 2JB8A 5FDBA 1YRZA 1CZVA 1W6NA 5FZGA 1AZDA 1ND2A 4QHBA 1O91A 4OYUA 4EN6B 3MFAA 4K1ZA 1PGL2 1ZNPA 2AGSA 1QKQA 2RJKA 4DY5A 4H7LA 1PNGA 2HWE1 4JGYB 1QQP3 3AKPA 4XETA 4CP2A 1ZREA 3UESA 3RZKA 4XXAA 2RR11 5J48A 4GMP3 3M2MA 1YFXA 5I0SA 3RZJA 2GNMA 4ISRA 4YG6A 3VBUB 2ZACA 1EPWA 4LBJA 1AJOA 5FZ6A 3WG2A 5LY2A 4KU8A 1R1A2 2WNUA 1CAXA 2C9KA 4C91A 2ZZQA 1WCSA 4A3ZA 2P6HA 5FKBA 2RS53 4OUSA 2X09A 3ORJA 1W9YA 4KWJA 1V6MA 3E97A 2VUCA 4PCRA 2D6LX 2VC9A 1Z78A 2UYAA 2MEV3 3HR9A 3KT4A 4P9WA 3ILRA 1NY72 3JBG2 1JMUB 2VMFA 4FPYA 2V73A 3B01A 2P17A 4S2DA 5FLJA 5BNOB 2H0BA 3O1VA 2A6WA 4QPGC 1NA1C 3LA7A 4ARYA 1V9U2 3KS7A 1MS0A 5CG9A 4QT6A 4D7TA 1XE8A 2RDSA 3WNMA 1WBFA 4PJYA 1QEXA 1CX1A 1CZTA 1HRI3 2HWC1 3EJKA 3H1WA 2Q1ZB 4CUGA 3QH6A 3AYDA 3BALA 1HQLA 1I3HA 4PIYA 4K8RB 2OT7A 2XJSA 3WW2A 3WT3A 1PIV2 1AJKA 1FMD3 2D7FA 3BPZA 2YG0A 3VBHB 5C70A 3LWCA 2VQTA 1VRH1 3THPA 2BBVA 3OSDA 4YSFA 4BXSV 1GR3A 1MEC2 3K3OA 4QPGB 1NA1B 3ATGA 1RUF2 1OFNA 3B7MA 4QB1A 2B9VA 1OT5A 5CFCC 4W6YA 1VB2A 1QJY3 3FJSA 4GQ7A 5T54A 5ACA1 3IAQA 4S2FA 5GM0A 5AC92 2Y6LA 1O4YA 1LESA 2XLFA 5A6ZA 2ZGRA 3TYJA 4Z2AA 5JSRA 1F15A 1RIRA 2YUEA 3ST7A 5JI7A 1JZ6A 4K21A 4GH4C 2VZUA 3LIGA 1FV3A 4CPBA 1G9BA 1VMFA 1YWKA 5FP4A 4E4SA 5JI9A 4N7UA 2G9GA 2IXHA 1UY2A 4B8EA 3I59B 5CFCB 1RUG3 3POBA 5FXZA 2HBTA 1YQ8A 3MZHA 3R4DB 4FP2A 4WM7B 5C8CA 4M4RA 4ATEA 4AVBA 2B7YA 1PZ7A 2OPKA 4ZPIA 5FKCA 1S0CA 2E26A 4F7ZA 5FR3A 1FATA 1GYKA 4UW5A 4Z92B 5LBBA 3RSJA 5JXHA 3U0ZA 1VB4A 1H2KA 3W20A 1A8DA 1V6OA 5A7PA 1AXKA 1EUTA 5JZGA 3VUOA 2P4EA 4YM3A 4M4PA 5FWEA 3FE5A 2WUHA 2ZHNA 4DUWA 4QX7A 2KA3A 1RHI2 4GZ9A 2VTXA 3ZVXA 1NT0A 3FL7A 1AL23 2G9ZA 1DGRA 1OQ1A 1ULFA 1V70A 2JD9A 3VZKA 3ZXGA 1MS8A 1H1MA 2I45A 2WNEA 5FYZA 3WW4A 1RUI2 3CJXA 3J4UH 1V6NA 3WNLA 1PGW2 2BJSA 2ETEA 1ULEA 5FZ4A 5T5PA 1SDDB 5C3SA 2Q0AA 3DXUA 4K1YA 4AVVA 5C71A 5APAA 5J3UA 2QQJA 1RUH2 4MGYE 1EV13 2R16A 4Q4X2 4EZHA 5F6LB 4RYDA 5DAWA 1GMMA 1LOEA 3HT1A 5C3RA 4AFBA 2W1UA 3CHXA 2ZGKA 3MW3A 4MX3A 3B9CA 3H42B 4YGEA 5A32A 1ST8A 2E7TA 3KT7A 1Q56A 2JG8C 3AZYA 4FAHA 4CDUB 3FWEA 3RFRA 1JXNA 2B39A 1Q43A 1RUC2 1YQ6A 2VTFA 4PQQA 1ZM1A 5FP3A 5DDJ2 4UFIA 1SZBA 3NNJA 1ZZ7A 3C7OA 1PO23 4Y5SA 3ZOIA 1H8TC 1KRIA 4CXWA 2CWMA 2VQUA 5F7UA 2FMYA 1HV0A 5FZ0A 2DCTA 1OHFA 3ZR5A 1U12A 1XNKA 1YIFA 2QDNA 1H4HA 1POV3 4LE4A 3IB3A 3OUHA 3DPRC 3GGLA 5F32A 2NZ9A 4GJZA 1AYN2 1W2UA 1A78A 2UWBA 2WZR3 4YZ4A 3LE0A 2WR9A 5IVCA 1FX5A 4HSJA 3KVAA 2HWB3 3A0KA 5D21A 1ZZ8A 2MHFA 2VMHA 1NOVA 3K4AA 4DEQA 5IK8A 1I5ZA 2UURA 4RR3B 4UFKA 4B7KA 1H8TB 3WHTA 5BNNB 3ETPA 1EAH1 2D3SA 4H55A 4TN7A 1RUD1 4W6WA 4Q4Y1 2VULA 5CZKA 2Y6JA 2VVEA 3AM2A 1ND3C 1S0BA 3VDBA 2A6XA 4EJRA 3WW3A 4Q26A 5FY7A 3BIEA 4ZHNA 5ANQA 4BK5A 2QKDA 1YJLA 1O8SA 1QJX1 4L8QA 4PLNA 4WM8A 2D97A 3LEKA 1VLNA 4Q0QA 1UYXA 3U37A 3O7OA 4V2WA 3N36A 2RDRA 1BZWA 5LBFA 1LOFC 1N3OA 2ZGPA 4JDMA 4AHWA 1IS3A 1TNFA 3FHQA 4M3CB 3O1OA 3AMQA 2DURA 2DTWA 3U4SA 2X05A 2RV9A 4QPYA 4UYBA 2G9FA 4QX5A 3VD4A 2P1BA 1GZTA 3VBOA 2BERA 2FDJA 1OXCA 3MPPG 3U07A 3UNPA 3J7HA 3RNSA 3V0AA 2GU9A 1DGLA 1HIXA 1Q8SA 3LEMA 4TZDA 1ENRA 2WBKA 3VKFC 2AEYA 2VXJA 2Z79A 2ZGSA 4CEWA 4LT5A 1OOPA 3I3MA 1H0BA 2RHPA 4OI4A 1VBD2 5H9SA 5IUQA 5FK8A 1VBA3 4QKNA 5A80A 2FDIA 1WZXA 2WYFA 1XC6A 3T4VA 1RITA 4UAPA 1QQP2 2XVKA 3TEXA 4HKOA 2R32A 1D4VB 1AF9A 1BYHA 4LJHA 3M7AA 1WMFA 2ARAA 4P9XA 4RGGA 4UF0A 5F5AA 1UWWA 1X7NA 2KD7A 1NQDA 2X53S 1DF0A 3URFA 5G04L 3ZIXA 2VMIA 4DMIA 1F4AA 4R4XA 4XCAA 4CU9A 2P3YA 3NKGA 4XW3A 1SQ4A 2BWCA 2W94A 4AAPA 3SKVA 5LEKA 1AR61 2BFUS 2RS52 4Y22A 3MDPA 4UI9L 3NAPB 3MLLA 2RM23 2IFWA 1S0IA 4XF4A 4Q4V2 2PQQA 4FOVA 4QXCA 3SH5A 1S4CA 4RHV3 5IATA 4S2GA 3CJIB 3CQOA 1A3KA 1JU3A 3GNEA 4CCCA 3FC0A 3I3EA 1SLBA 5JPNB 3FX3A 4EWEA 5CB7A 1DZTA 3AYCA 4XFAA 1QF3A 4BQWA 4BDVB 3K46A 1HRI2 3T2PA 1VBE3 4ZZ5A 2XPJA 3A23A 4LKSA 4EN0A 1DGRN 3IKWA 3OGSA 4AL9A 3IDBB 4CU6A 4XUOA 2ZABA 4B1MA 2DCJA 3VBSA 3RWNA 2VOWA 4QKDA 1RUOA 5BUVA 2WRAA 3I2HA 4AFMA 2GNDA 4IGOA 4BQ3A 2IFRA 4QX1A 5FZOB 3CMGA 4O65A 3KMHA 4YM1A 3ZO0B 1YCIA 4KH9A 1AR71 2R041 2HKXA 5FPUA 5DZEA 1QJY2 1W9TA 4FAGA 4R9BA 3LDBA 4I09A 2X5IC 2YU1A 4MXWA 3OY8A 3DKWA 3ROUA 3SXWA 1M4WA 4CDXC 3MIFA 4CYDA 1ZX5A 5JOWA 4B4PA 2F17A 4AVCA 2W95A 3ZFGA 3HWJA 2XG3A 4FFGA 5AVAA 5FV3A 1HRV3 5DUUA 3U11A 2D43A 4AQTA 1K5JA 4N53B 5CYYA 3SEPA 1T6GC 1TMF3 4YG3A 3APBA 1TZOA 1WCQA 4HBNA 1RUG2 2C9AA 1D2SA 2J7MA 1JYIA 5GALA 2QTWB 3SEEA 3W21A 4ISQA 2WN3A 2WN2A 1ULOA 1RMU1 2X5IB 4EN7B 5DN2A 1IQAA 5JPMB 2VW0A 3PUQA 3IMMA 3ZYGA 2CY6A 3MIDA 1BEV3 3T30A 3CO2A 3R0RA 4YVWC 5FZDA 2ZGNA 3A0NA 3OBRA 4META 4Q4W1 2A75A 1WD3A 3KHBA 1UZ0A 1A6CA 1POV0 1W0OA 2ADEA 5DG2A 1ASJ3 3ZSMA 4CCOA 2YC0A 5A6QA 1ZRDA 1S0DA 2ZEYA 3N9NA 3SH3A 1Q3EA 1BK1A 1AL22 3VD9A 1YXWA 2PA7A 2Y0IA 3ZXKA 2WNOA 2BUKA 3PTYA 5F3GA 4NRMA 5EXOA 1JZ4A 4FPFA 4LA2A 3POSA 2NYYA 3POIA 4Z1VA 4XMAA 4I0AA 3DL3A 3TOJA 2JENA 4RQPC 5LA1A 2WO1A 3VLBB 2P37A 2YC4A 1EV12 1X33A 3A22A 2VZ1A 2JKXA 1WLWA 2ZHLA 1LTEA 2RMU3 2ZKLA 4L92A 5DZFA 1LGCA 1CONA 1FPN1 1UYZA 3VDDA 1AXYA 3K4DA 1XOYA 1RC6A 3E1F1 2IZWA 2E32A 4IE0A 4CU8A 2W1SA 3I2GA 3Q8BA 1GV9A 1O4ZA 1EY2A 4A41A 1G9AA 2DU1A 3NV4A 2ZX1A 4L0PA 1DDLA 3UETA 2XDVA 4FOQA 4BK4A 3VL8A 1PO22 5FCCA 4AXOA 1PMIA 2DUQA 3WOGA 2L9LA 1WCDJ 1XRUA 5J37A 1QHDA 3NW4A 2R071 1NCQC 3WG3A 3LA3A 3FHIB 2BVVA 5E16A 1ALYA 1D4M1 1GNYA 1DHKB 2XL9A 4AI1A 3FUOA 3P3PA 3PVBB 2Q8OA 3Q9OA 1VAMA 1O6UA 4MGQA 2HWE2 1TEIA 3POWA 3LA2A 4BE3A 3I2OA 1OF3A 2VU9A 1CD3G 2EIDA 2RR12 3ILNA 4DINB 5C9AA 3LEGA 3LF7A 3H1YA 1SLCA 4YW2A 1FI2A 4AF9A 3WG4A 1W6QA 4YLZA 2QJVA 3N7JA 2WSVA 2AUYA 4CUBA 1HJFA 1MPXA 2VW2A 4JCKA 3O1RA 5CFDA 2IXCA 1J3RA 2WYSA 4ZU4A 3KCYA 2XJVA 2Y6HA 4JGZA 2VOXA 2GNBA 2Y60A 3IDAA 5IVBA 2AC1A 2YGMA 5I8YA 1H1AA 1UMHA 5DAPA 2QUOA 1GOGA 3J26N 2X29A 3R4UA 2VAUA 2A1XA 5DAQA 1H4GA 3KT1A 3SC7X 1RVF1 1O3TA 1SFPA 1PK6C 4EN9B 5LA0A 1LAJA 5C4WA 4B4RA 3MW4A 2WL1A 4A42A 5IT6A 4ES9A 1MS5A 3M3CA 1U5IA 3VBFB 4OHXA 1X9PA 2HEVF 4QU2A 1OF4A 5FK7A 1KXGA 1Q8OA 2QQIA 3ME2A 3ECQA 3TEZA 1B35A 1OLME 2ZGUA 2PHUA 1S0FA 4XE9A 4IV1C 2Y6FA 3U14A 5E6HA 1LU1A 3AP4A 1VRH2 3MYXA 3WNXA 3D6EA 3JQXA 3A4UA 4P08A 3WP6A 3JBG3 4UFMA 3DF0A 1QNWA 3Q8EA 4AHXA 5JMOA 3ABZA 1R1ZA 1JYWA 2ZA9A 2ZCWA 1DYKA 4GWIA 2WINB 1UOJA 1W8OA 2GC3A 2ZZJA 3WX5A 1DQ5A 4Y20A 1PK6B 5K0UA 4BB3A 5GLZA 1U0AA 4QPWA 3WF0A 4YZ3A 1VBA2 4HANA 4X8NA 4LA3A 4I30A 4RL7A 3ZXDA 3N9OA 2BZDA 4TLGA 3S6PA 3VBRA 4PDWB 5KXEA 4LHSA 5FPVA 2JDYA 1PIV3 3ZYHA 3TBDA 1HXS1 4IEZA 1AR81 1QXPA 3W5NA 4JV4A 1NCRB 1R091 4N8MA 1MEC3 5FIXA 4S2HA 4MLOA 5JVVA 3FBYA 4CZSA 4QQOA 5JMCA 1GFF2 4RD7A 4AWDA 4UW4A 2P3IA 4RHV2 1LOGA 1I5PA 1J3QA 2VECA 2WWSA 5FREA 3UT0A 5FZHA 5AC93 4XYXA 1W6PB 2OPWA 4CDWA 4AGVA 3ZFEA 1JBCA 3KZ4C 5FZAA 5LK7B 3RGBA 2D6KA 4CDQC 2Y38A 3H3ZA 5FZIA 1YYNA 3O1MA 4V1PA 1VBE2 4AK3A 1K12A 3NNMA 3VDCA 4RS5B 4Y26A 2TNFA 2HLEA 1X9TA 1SMVA 3W5MA 3KVBA 3MGUA 4PBOA 4K9SA 2A71A 5GLVA 4HT1T 3FLPA 5FY1A 1YEWA 4I02A 2D6MA 3AZVA 4I3GA 4BYYA 3PJYA 4QAWA 3KHCA 4KBZA 4CP0A 3ACIA 3K2OA 1X8EA 1BKZA 3RYKA 4AAXA 4CEYB 3O0VA 5EYXA 2GN3A 1OD5A 2TEPA 4GWNA 4XF3A 5D8AC 2D3PA 1JZ3A 3K3NA 3AP7A 2VCCA 1K42A 2CGNA 4L2NA 1E5RA 4JKKA 2WDBA 1O3QA 5HCAA 4LBOA 1MQTB 4FPJA 2QQOA 3ES1A 2PXJA 3RI8A 1IPJA 1BHGA 2KM2A 1U5YA 4FVVA 2D3RA 1N1SA 2V09A 1R081 3O0WA 2WWJA 4OZXA 3H8OA 5CG8A 4N43B 1YNAA 3IMNA 3ZN6A 1S2KA 1US2A 2B45X 3TEWA 5C6CA 1TMF2 4BOWA 1RUNA 4KBBA 1Y3TA 2JE9A 4FO9A 1WW5A 3MPBA 3H3LA 4H2AA 4LOTA 3IM0A 5ERLA 5FQ0A 5IFPA 2BQPA 3RI9A 1WMEA 4GB31 3WZ1A 3IN9A 1VR3A 5CADA 3C7GA 4JKMA 1GWKA 4QGMA 4AI0A 2PHFA 2BW8A 1BEV2 1RUJ1 2ZGLA 4HPKB 1YI7A 5BNPB 4P00B 4M0HA 4GJYA 1RUC3 4FPHA 3OGGA 2GH8A 3E6BA 4DEVA 4I2OA 1OLMA 4LK6A 2WIIB 2V5DA 3QH7A 4J1XA 3UK9A 4GKYA 1C8NA 1O5LA 1OMIA 1VRBA 1XYNA 4WBBA 4WVZA 1XSRA 3VZLA 1XNBA 5BNQA 3V65A 3DYOA 4Q4Y2 3VKLA 3HPNA 5SV8A 1LGBA 3RYRA 3WV6A 1VBC3 4XFCA 2AR6A 3H8UA 3WQ1A 2WS93 1CGPA 5EFUA 5L9BA 1AYN3 1AL0G 1F9KA 1RJ8A 4OULA 1X82A 2JG9C 4XPVA 3H8RA 1QOTA 4MG2A 4IV3C 3DGTA 1O4TA 4CSWA 2HWF3 4FOWA 2R061 2RMU2 4AFAA 2XWJB 4XUPA 1XXNA 3ZYPA 5LA9A 4JGYA 1C1LA 1CAUA 1GICA 1NZIA 1UYYA 4WV8A 4BLJA 3CBNA 4AVSA 1HN1A 1NLRA 2ZEZA 3N7KA 4QDSA 1C8M3 1CESA 5LY1A 3M3EA 4KWKA 4EZ4A 3VBUA 2YC2A 2PHRA 1W8WA 3WF3A 5JR2A 2JEMA 4JVAA 3ZXFA 3NQHA 1NG0A 2OS2A 4AGRA 1VBB1 1NQJA 5F8PA 3PDQA 2W0XA 3WDTA 5HXMA 1LEDA 2F6BA 2Z5WA 4IV3B 3WVJA 4ZKTB 3GZUC 4CVUA 4EWDA 2YMZA 5FOJB 5BNOA 1DP0A 3HQRA 2XH6A 5B2GB 3DCQA 5FWJA 4COVA 2JDZA 4ZY9A 5ABJB 4BU2A 4LBQA 3WINE 1VMHA 4PT6A 1RXFA 4RSUA 3HNYM 4YW5A 4QKFA 4URTA 5FYMA 2JB4A 2HEWF 1Y4WA 5KC6A 2ARBA 2EXHA 1AVBA 1V6IA 2Q30A 1QGLA 1IPSA 2LS6A 2IWGB 3WNKA 3BOPA 5A1FA 2DCZA 3HEIA 3QACA 4E9KA 5KHIA 5FMOS 5FMCA 2PAMA 3VBHA 3WNNA 4CCKA 1HN0A 3BTZA 5FPLA 4JQTA 1QJEA 3VDAA 1UU5A 1BJQA 1BBT1 1YQ5A 3ZN4A 5A3PA 4I01A 4K40A 1W2AX 1VBD3 2NQYA 2WNVB 1ZA7A 5F3IA 3EXUA 4MGIE 2J42A 2Y34A 3J8F1 1DLCA 1AX1A 1OQEA 3KD4A 2ZMKA 2VM9A 4PF1A 1I9RA 1QWRA 5L7OA 2JDPA 4Y4YA 2J22A 4MO3M 2W08A 2ENRA 3SNMA 1L7LA 4LO5B 3VZMA 5JAXA 1ULPA 3D8CA 3GDBA 5LB6A 1UL9A 2Q1FA 4YARA 3NJZA 2QQKA 5DAVA 3MFCA 3GCXA 2Q4SA 3POGA 4M3CE 2K2SA 4DUVA 4U2AA 1K5MA 4Q4V3 1FXZA 2QNKA 3I59A 3ZXAC 1W2NA 1UW8A 4YFWA 3CZJA 4B4QA 3GHMA 1CZSA 2WA3A 2BNNA 2PAEA 3WR0A 2R042 3JCIA 4QMAA 2VO5A 4WM7A 1JYCA 3D0SA 2HWB1 3HNBM 3N9QA 3RG0A 4OI1A 1O3RA 5LWBA 2W92A 3HBKA 1ZRIA 3LDRA 3ILFA 4XFGA 3LKJA 3OBTA 3POYA 2PN5A 1JI6A 2IC1A 5L9VA 1KGYA 3VV1A 1O3SA 1RJ7A 3SCHA 2E53A 2JDHA 4HVRA 3SISA 3WP4A 4D6QA 5C3QA 1Q8QA 5J1XA 3NJYA 5DABA 1FAYA 1ND2C 3I3BA 3KSCA 2GN7A 2XLAA 2YB7A 3AX4A 2GALA 3VHOA 1QH7A 3AP6A 3IPVB 4UXAA 2JX9A 3J7MA 4X8PA 1UQXA 3AZZA 4GAZA 1Q5OA 5DG1A 3EHKA 1YLLA 4XTPA 2MPFA 2UY8A 2VNVA 5FYHA 1DIWA 3PIGA 4MSVA 4P5HA 2B42B 4LO8A 3NJXA 5T5LA 2WT0A 4LMFA 4HETA 4CCLA 4AG4A 4E8CA 2QDRA 4XQWA 5EWSA 3HVDA 2EICA 4FI9A 3WF2A 3LPGA 5IJRA 3T3YA 2J1TA 3AYEA 3OYWB 1TME1 4Q4W2 4YZ2A 5HBAA 1ND2B 2WNUC 4BIFA 4CDUA 4NOTA 3OB8A 1AUYA 1W9FA 1W8HA 2OUHA 3E5XA 5A7OA 4DXZA 5KHGA 2R1DA 2RVAA 1OC1A 3ZYIB 4AHYA 4E4HA 5CA6A 4Y4RA 3U10A 3NNGA 3L9JT 1AX0A 1EYBA 4DXRA 5JXJA 4L11A 3O0XA 2KXLA 4XZUG 4QQLA 3BKZA 1L7QA 3HQUA 2RG4A 4Y33A 5E1RA 4A4AA 3ZN5A 3WDVA 4GH4B 2WZEA 4BA6A 2WNUB 3OPTA 1UMZA 1GANA 5ANNA 2RS13 2XBO3 1QY4A 3OEBA 2EAKA 2VD7A 2MNGA 5IVFA 3O12A 2GP3A 3TN91 2NM1A 4YGDA 1PO13 2QQNA 4RR3A 2YY1A 2WFF2 1QJU1 1BVVA 2D6NA 3KV4A 5BNNA 4P14A 1C28A 4OCTA 1C5HA 4X6RB 3R4SA 1WCUA 4XJ8A 1WLTA 3N35A 4XCBA 1COV3 1WW7A 3AL5A 1LULA 1QOSA 1FV2A 3N3HA 5FFOC 3WG1A 1N1TA 1ZBE1 3KCXA 3AVRA 4CRQA 4LR4A 4QXBA 2LALA 4OHWA 4XABA 2QQMA 4IUGA 3OGJA 1D4M2 1G6NA 2AACA 4XF0A 3DN7A 4JX0A 1O7FA 2EALA 3MV11 2JDUA 1U5XA 4NHYA 2QQUA 2ZHKA 1KDKA 4AYUA 2HWD1 1KITA 5EHDA 3AFKA 2DUPA 2VZ3A 4M3CA 1XU1A 5I93A 1WKYA 3UJOA 3B94A 3GCWA 4DFSA 3RPQA 2CNAA 4H7MA 3S5AA 2JICA 4XURA 3IT8A 2CYFA 4QD2A 3WQ0A 5C8CC 3A21A 3CLPA 2EVXA 4Q0PA 5EZWA 4AI9A 1IS6A 4ORFA 5F6KA 5F1RA 2DBNA 1OD3A 4FPEA 2EA7A 1VBC2 4UWDA 5JDBA 4V2VA 1G9CA 1O5UA 2WS92 4HK8A 2VVDA 1XJAA 4K6BA 4UW3A 4JDOA 3DEMA 5GZDA 1UNBA 3BYWA 2JG8B 4AEDA 4XIOA 5JZGC 1UOBA 2GMMA 2HWE3 3AMHA 2HWF2 3PVNA 1RVF2 2EAAA 1LECA 1UY4A 1QOOA 2RR13 3KV9A 3ZX7A 5JCTA 4Q2FA 1APNA 2BPA2 1NKGA 1YI9A 2CL2A 2XQXA 1C8M2 1J58A 5HCFA 3WCSA 5JXGA 1HQNA 3DPRB 5D2AA 2Q8CA 3LFIA 2F4LA 3PVEA 4NHXA 5CISA 3MIEA 4KMQA 5A7NA 4Y5TA 4AR2A 1FOD1 1YO8A 3FN9A 3LQCA 3NAPA 2DV9A 1LR5A 5FLHA 3ELNA 3I54A 5AFBA 4IEQA 1PZ8A 3OPZA 3CJIA 3MO4A 4LPLA 3RJ2X 2VCBA 3UGGA 3THTA 1BMV2 3M1HA 4NAOA 1QNYA 3EBRA 3MIBA 3E5UA 3HOBA 3PURA 4ZXEA 4NPLA 4JHZA 4YW1A 4AHZA 4HSLA 2HWC3 2BFUL 5A3UA 1YUDA 3V0BB 3M3IA 2OA2A 4FXKB 4NRQA 3ZYRA 4AVAA 4CXYA 1TNRA 2Y6KA 1DZQA 3AC0A 2IVIB 1ND3B 4LBQD 5IWFA 1HXS2 1AR82 5F5QA 1XBFA 1VRH3 4CCMA 1GBGA 1R092 4FXGB 3LB9A 1IOAA 1UX6A 4BWOA 1LHVA 2PTMA 3CEWA 5FZOA 4N9HA 3CZUA 4NHKA 2QE3A 4Y5Z0 1JYNA 4KI5M 5DQ0A 1HB1A 3NV1A 4R8HA 3U75A 1LCLA 4LQRA 3MV01 4PI0A 2FDFA 1UXXX 4E2QA 3LEIA 4R9CA 2UU8A 2YU2A 2PHWA 3T0DA 1QIQA 5KHKA 4WVMB 1AXZA 3ZXEA 5FUPA 2ZAHA 5K7PA 1W8ZA 3G6JB 4LXLA 4HZFA 5JSPA 2NMOA 4FT8A 3UYJA 4FP3A 2JDNA 1W05A 4D0QA 1MZ6A 2DVDA 4YG0A 2QQPA 3KV5A 3KGLA 4HXCA 4N53A 1J1TA 1LJ7A 1YQ2A 4AI2A 2ZPXA 2VBDA 2ZGOA 3HN1A 1IZ3A 4XHBA 1E5HA 3D82A 4IEYA 3S0MA 4RGKA 4WM8C 2HBUA 3ETQA 1V00A 1JU4A 4MH0E 2PMWB 3FFQA 4Y1YA 3T0BA 2FDHA 1WBLA 4LUMA 1H2MA 1OSGA 2OW4A 2CDOA 2WJSA 4MOAA 2CDPA 1UZWA 4Q8LA 1MVQA 3VBOC 5FY0A 5IVJA 4ZXKA 2Y33A 5IK5A 4NJ4A 1MS9A 2GC2A 1PGL1 2VW1A 2IXKA 1KJRA 4HK9A 1SLAA 3RMXA 3WP5A 3CF6E 1WA4A 2BBAA 1W0NA 4WM8B 3T0AA 4BM8A 3HIFA 4K8FA 4CEWC 1OOPC 4A6OA 1SG3A 4E8DA 2C0ZA 1EPZA 4ES8A 1OURA 3O1UA 2NP0A 1IPKA 2FDGA 5FXXA 4MV2A 3ZKYA 4C0BA 2E63A 3PVOA 1UKGA 2VPVA 1R1A1 3OBAA 3LPFA 2HYXA 3AZWA 1H30A 2WKKA 1DBNA 5J36A 1K45A 2ET1A 2WAAA 2BEOA 1W3XA 3FUQA 4GIQA 2QVSB 4Y1ZA 1UY1A 4FFFA 4DNYA 4OVEA 2XL7A 1OOPB 1OH3A 2DCYA 2VMEA 3WQBA 1V9U1 1JOJA 4JTNA 4NAMA 1RB8G 1ENSA 1PVXA 1F4HA 4CA9A 1TVGA 3JD72 4CCEA 4CPBD 4KL1A 2FCUA 1WGPA 1BVP1 3FBMA 4Y3OA 3WY6A 1H9WA 5IW0A 4DY3A 4DB5A 3C2UA 2D6PA 4PI2A 1GP6A 4QXHA 5E8AA 4CDXB 4P9YA 5KR7A 3QBQA 1XYOA 3OPWA 1G8WA 4HL0A 5F5IA 1V6JA 2R062 5GLTA 5FZ3A 2PLV1 3HAGA 1CQ9A 2ZX3A 3FZ3A 4FPLA 2RS12 2XBO2 5FY8A 5IAVA 3ZYFA 3VBSC 3TAYA 4OQ8A 1PO12 1RUF1 1ZBA1 2IVJA 1EAH3 2VH9A 4COZA 4DOUA 3RYPA 4ET7A 2QCSB 4XC9A 4XUNA 2Z42A 4DIQA 3T4HB 1RUD3 5I0TA 4Q4Y3 4XBQA 2BOJA 4DXTA 1W9SA 2DCKA 1AYM1 3KB5A 2YBSA 2LTNA 1FNYA 2ORZA 2YV8A 4GULA 3VL9A 1COV2 2A3XA 2Y26A 4YVWB 5FZ1A 5FY5A 1WLDA 3KF5A 4XJZA 4EROA 1O59A 5FPZA 2EIEA 3S5QA 3PU3A 3RZMA 3RS6A 5A3OA 3BU0A 1CIYA 2HJIA 5A7SA 5LW9A 4TTGA 2SLIA 2ORXA 3ZFGC 1ZRCA 2GC0A 4MADA 4MYEA 2OX0A 4UT5A 5JIAA 4DPNA 2VZVA 3RJRA 1RUE1 1SLIA 1UMIA 4JDNA 4F83A 3VBFA 4ZONA 5C7GA 3ZMNA 4QB2A 4QPIA 3EMRA 1Z7S1 1ULCA 3E6DA 3RVHA 4QWNA 1JW6A 2XJQA 5EJZB 1NE4A 1UZZA 2QZ2A 4RQPB 3USUA 5GLWA 5LK5A 1LGNA 4LBNA 3J9SA 4AI8A 3USSA 1PX3A 2GC1A 5FZEA 3VGIA 1OQDA 4L97A 5CAZA 2Q1MA 1BBT2 1F2NA 1ULDA 3SKJE 4LITA 1WCKA 3D4KA 2XUMA 5TSWA 1UOFA 4IQPA 1PK6A 3NKTA 1CAWB 1JUHA 1RHI1 5JR7B 3PJQA 3J8F2 2Z4FA 3BUCA 4YW3A 3DUIA 3OBZA 1HDKA 3I2FA 4JAAA 5A3MA 3POFA 5K9YA 2C4XA 4XJWA 1RUI1 3ZFFA 1JUIA 4PDWA 3BTXA 4YWAA 1UF2C 2ZGQA 5IVYA 5IAXA 4CP9A 5GJ6A 4FFIA 4YVSA 1NCQB 1RUH1 2CTVA 4Q4X1 3JB4C 1AR63 1NCRA 1OPMA 2UY9A 3UJQA 3B93A 3KQRA 3ZIWA 5DMYA 5DAXA 3GZEA 2ARCA 5FZLA 3NRUA 1POQA 3PTRB 1H9PA 3BPSA 4BCUA 3VDDC 3L2YA 1CAVB 2JXAA 5F9TA 2P6CA 1ZRRA 1FYUA 2BYVE 5DDJ1 5IHRA 5FZBA 2A6YA 2HWC2 2WC2A 5FLIA 2CU5A 1W6MA 1OBNA 2VTXJ 2X10A 2DF7A 3MLKA 4RS5A 2VUJA 4XFHA 4ZU5A 1IS5A 3HJRA 4XQ4A 1AR91 3FLRA 2QFEA 2HEYF 1C4RA 2C1FA 4IERA 4BJ0A 4F3JA 1PVC1 2WO7A 2DVFA 4YW4A 2B8MA 3O1SA 1GOHA 4FPOB 1AR73 2R043 3VDDB 4XJUA 1UX7A 3LD8A 4OZOA 4CU7A 1DLLA 4EQVA 4CEYA 5BYNA 1VALA 4QHZA 2YZ4A 2VUAA 2K9ZA 3BB6A 3ZYJB 1US3A 4B7EA 5ACA2 3AYAA 4YGBA 5FYSA 3FFZA 1JHNA 1GZWA 4HG6B 5AVPA 5FYVA 5I91A 4OI0A 4D6SA 2OVUA 2VOTA 4E2SA 5C9AC 2RS31 1OUXA 3QOPA 3B00A 1MQTA 4WVVA 3I2KA 5JLVA 2GP5A 1MZEA 4ASKA 1TME2 2WQZC 4IV1B 4BMEA 3WDWA 3WP3A 2R1BA 2VUDA 4P9GA 4IEVA 4OHZA 1STMA 1NXD1 5CFDC 4N43A 2Y0OA 4JGZC 1AX2A 5FO7B 1YQCA 2E6VA 2FQPA 2DVAA 4IGPA 4P9JA 3IDEA 1V6KA 4NHMA 2BNMA 1F8VA 2VGDA 3TWIA 1HLCA 3U78A 3M4FA 1CVNA 3SMHA 3S7IA 1C5IA 1PNFA 1RMU3 5DUVA 1JHJA 4ATFA 4ASMB 1X36A 2XUEA 3I97A 1PM4A 5C4WC 4HLTA 4KG0A 1E57A 3GF6A 1OLRA 5F3EA 2VZPA 5GKAC 4Q4W3 3N9MA 3KCCA 4HPKA 2ZGMA 5BNPA 2Z69A 5CFDB 4UBHA 3MF9A 4QGLA 5E88A 4BQ2A 4W6XA 3TN92 5JOYA 3BODA 1B35C 1UKRA 1HKDA 1RINA 2GZWA 3ZSJA 3QCWA 3I2DA 5A1AA 3AFGA 2VZOA 3OUJA 4I3PA 4FQ4A 1MS4A 2JWPA 4NN0A 3LGRA 4AGGA 3RZLA 4OUMA 1QJZA 4ASLA 5K0UC 4KNCA 1QQP1 1ZBE2 2LRPA 1WUVA 4CDQB 5HPOA 4GMP1 2BRTA 4UOJA 3V56A 4PF5A 2Z2SB 4AE2A 2XLGA 3X29B 1GU3A 1OI6A 3VBRC 4GD4A 2ZTNA 1LHWA 1QJFA 4QKBA 1B35B 5I8SA 4YW6A 2RS51 1R64A 4XF9A 2WFF3 2ZX4A 4YNIA 4B3NA 3O1TA 2JJ6A 4XIKA 4AEKA 1I1EA 2MEV1 5GZFA 5JIUA 3PMEA 1V6LA 2W1WA 2YBKA 3AKSA 4AEMA 4G9SB 5D8AB 2OQ6A 3UKVA 3VKNA 3AK0A 1HX6A 5A1LA 1L7RA 1J3PA 4XMIA 1KJLA 4Q5OA 3T08A 3VKMA 3T1LA 3WW1A 4EYUA 1HRI1 4XFBA 4CDWC 1D4M3 2WQ4A 1H1IA 4Q29A 4XFIA 2FZ1A 3ZFEC 1JZ5A 2VR4A 2AREA 1IHMA 4LIUA 1P8JA 1UN1A 3HD8B 4UFJA 4NWVA 5FBZA 5T52A 1RYYA 3ACLA 4PHZA 5A7WB 1IG0A 3ZDSA 3I3QA 3WUDA 3BOWA 1ZZCA 3I2IA 4FPGA 5ABJA 1KQRA 4BXFA 1FMD1 1S0GA 4XBNA 4YM2A 3GBWA 4OLLA 5KHJA 5G05L 4C1XA 1H2NA 2YFZA 4AVTA 5HCHA 1K3IA 1UAIA 2XHNA 1EAH2 1REDA 1MZFA 2B4KA 5F2WA 1RL3A 2ARXA 3F2ZA 1QJY1 3SCGA 1RUD2 3T2QA 4D7SA 2E51A 1RTVA 1RGSA 3ASIA 3BTAA 2ZX2A 5JUVA 4JQRA 1S0EA 1U5ZA 1X50A 1IQDC 1J59A 1SPPB 4H14A 2Y64A 3LSDA 3CKHA 3VN4A 4H3WA 1W99A 1ZA4A 2AENA 3DV8A 1QJX2 3JUUA 5EJ3A 2WNVA 5EQUA 1RVF3 2J1AA 1DCSA 2TUNA 4EV0A 5FMOL 1UCXA 2FBEA 4A6SA 3ZSKA 1LHOA 4AQSA 5LASA 3WQ7A 4Q8KA 4I0WB 2RDNA 5FY9A 1RUG1 3AVSA 4HVQA 4JKLA 1Q8VA 5CEHA 4CP1A 2LW8A 4OHYA 5L73A 4IE6A 5A70A 4XQDA 3VZNA 4W65A 3GJBA 4XDPA 3AMMA 2ATFA 5KHHA 1FT9A 3H8XA 2JG9B 4LE3A 3RMYA 2VVFA 2P3JA 4AFCA 1JTZX 5FP8A 1XQNA 3GALA 1W8UA 4ZS2A 5I8TA 4FOYA 3I7DA 5T50A 4ZZ8A 1XNTA 4INDA 4NUBA 5L36A 4COWA 3MICA 1HB2A 5GLUA 1S1AA 4A3XA 3K51A 1OVSA 1KS5A 4DQAA 3GHNA 1AL21 3ZN6B 4K20A 1UZYA 1GQHA 3MEPA 3F95A 4CCJA 4B1LA 1JZ7A 4E27A 4LHLA 1HXS3 4FCAA 4GKXA 1AR83 2QQLA 2WA4A 3C7HA 4D94A 1R093 4WZFA 5A33B 4NIGA 1KD7A 1EV11 1DQ1A 1GNHA 2XQRA 1AR62 3TB0A 3M3OA 3Q8CA 2EXKA 2VY0A 2W52A 3IPVA 5F3CA 3VD3A 4QPGA 1NA1A 4LK7A 3MUZ1 4HKLA 5FZ9A 4HVOA 3M8LA 5E89A 4A44A 3MLJA 5JOZA 4TWTA 2D6OX 5EPAA 1G9DA 2P5BA 3BVCA 1DGWA 4DUXA 4JGYC 2BOIA 2NMNA 1ODMA 2WFPA 3DYPA 3Q8AA 4M0NA 5AFEA 3PMSA 1ZZ6A 1PMHX 5FMBA 1T6BX 1PO21 2A3YA 1WLCA 4IE4A 4LEJA 5A3NA 3RWKX 3UKTA 3SLIA 3VBUC 2E7QA 2VE1A 4SLIA 1JOBA 1BK0A 3LOIA 3LCPA 4AW7A 4DZGA 1POV1 4IEPA 1LKNA 2IUWA 2WSUA 4CTEA 2WABA 5FP9A 2EXJA 4E4ZA 2PAKA 1KS4A 2HH9A 3IDCB 5FYCA 3SQOA 2WZR1 1LOAA 4BQXA 5CFCA 2E33A 4ONUA 4NIAA 1E5IA 2YDEA 5BNOC 1AR72 1MACA 5FZCA 1CAUB 1KFUL 4Q1PA 1XNAA 3BN6A 4Z2WA 3VZOA 4A2UA 5HCBA 1OH4A 2C26A 3ZYBA 3EO6A 2JE7A 4Z82A 1G9FA 2UWAA 1WA6X 2DFCA 4GH4A 4M3CF 2ZKNA 1YHFA 1M06G 4GA9A 3ZSLA 1PHMA 2O8OA 1W6OB 2FCVA 2VNRA 1N47A 3IZOA 4PIZA 1ENXA 1R083 2QQVA 2WWUA 4KU7A 4MVTA 4FPCA 4PLMA 3T2TA 1W3VA 1Y9QA 2BGOA 3UL2A 3VBHC 3ZDVA 4IW3A 3L2HA 4FQZA
chains in the Genus database with same CATH topology
3AC0A 3E1F1 4CU8A 2E32A 2W1SA 3I2GA 2VZSA 3ACFA 4A41A 4L0PA 3UETA 4BK4A 4YPJA 3WEZA 3CZUA 1JYNA 1NX9A 2PQSA 2L9LA 4KI5M 5DQ0A 1KEXA 2J1EA 3OGRA 3T2OA 4LQRA 3MV01 1UXXX 1GQPA 1JZ2A 3LEIA 1GNYA 2VL4A 4XUQA 2QBXA 3T0DA 4W4ZA 1H6XA 4OMDA 4P02B 4KWUA 4MGQA 4OUEA 2VMDA 1OF3A 2YFUA 1UY3A 2EIDA 3LEGA 1D7PM 4D0QA 4OMCA 1YQ2A 2W9XA 3OG2A 2VZTA 3HN3A 4CUBA 1MPXA 3WSOA 2WYSA 4GWJA 2Y6HA 1W9WA 5LCWL 3IDAA 1JU4A 3VD7A 3OGVA 1UMHA 1GOGA 2RJ2A 2ZEXA 3T0BA 4D8MA 3ACGA 3EYPA 2CDOA 5LA0A 4MOAA 2CDPA 2W5FA 1PMJX 4P5YA 3IIIA 4A42A 1EUUA 4QB6A 3ZM8A 3C8XA 1OF4A 2BBAA 2QQIA 1W0NA 3T0AA 3ECQA 4A6OA 3K4ZA 1SG3A 4E8DA 2W3JA 3EB7A 3JXSA 5B4NA 4P08A 5JMOA 3VDBA 1JYWA 1CX1A 2ZEWA 3ABZA 1UY0A 4GWIA 3THCA 3A7QA 1W8OA 3MUY1 2ID4A 3OBAA 3LPFA 2J1SA 2HYXA 4QPWA 4XVHA 3WF0A 4QX0A 1K45A 2WAAA 3WQBA 2BZDA 1UY1A 4LHSA 3THDA 2E31A 2VMEA 4XUTA 5LA2A 4QX3A 1F4HA 2V72A 1TVGA 3W5NA 2Y8KA 2VZQA 2VCAA 4CUAA 3GM8A 1W8NA 2OKXA 1CZVA 1I5PA 4OYUA 1JZ8A 3GXUA 4ET7A 1K12A 3VDCA 4XUNA 3UESA 2HLEA 3W5MA 3BGAA 4DXTA 1W9SA 2DCKA 2VJXA 2ORZA 4QAWA 3ACIA 2C9KA 4A3ZA 4AAXA 1O59A 1H6YA 1LNSA 2EIEA 2X09A 1J83A 5EJ1B 1JZ3A 2VC9A 1CIYA 2VCCA 1K42A 2VMFA 4JKKA 2WDBA 4TTGA 2ORXA 4MADA 4ARYA 2VZVA 1UMIA 3WNMA 2QQOA 5C7GA 4QX2A 4QB2A 1CZTA 1BHGA 3NJVA 5EJZB 2V4VA 1PX3A 1US2A 2W1QA 3SKJE 2YG0A 1UXZA 5C70A 2VQTA 4BXSV 3P1IA 5IFPA 3DYMA 2Z4FA 4QB1A 2B9VA 3IAPA 3C7GA 1OT5A 4JKMA 1J84A 3I2FA 4QDQA 2C4XA 3IAQA 4P00B 2Y6LA 4Z2AA 4DEVA 2V5DA 1JZ6A 2VZUA 5DMYA 3DYOA 3HPNA 3NRUA 1UY2A 2WZ8A 2W87A 4M4RA 5IHRA 2JE8A 4XUPA 2E26A 2X10A 5JXHA 1UYYA 1HN1A 3HJRA 2ZEZA 1EUTA 4M4PA 4QDSA 4BJ0A 2WUHA 2YC2A 4DUWA 3WF3A 5JR2A 1GOHA 4GZ9A 3NQHA 3FL7A 1UX7A 4OZOA 2JD9A 5HXMA 2J1UA 3DECA 1US3A 3WNLA 4CVUA 4HG6B 3I3DA 1SDDB 1DP0A 2VOTA 5C71A 2QQJA 4ZY9A 4TXWA 3I2KA 4RYDA 4PT6A 1GMMA 2W1UA 5B4XA 3HNYM 2R7EB 2J1RA 2LS6A 3WNKA 3WNPA 2W91A 2VTFA 3HEIA 1TG7A 4PQQA 3WNNA 3C7OA 3VDAA 1JHJA 2VQUA 5F7UA 3I97A 3K75B 3CIHA 3IB3A 3GGLA 2VZPA 1DLCA 1SHWB 2VM9A 4PF1A 3LE0A 5EIYB 1NUKA 2J22A 4MO3M 4CUCA 1ULPA 5A1AA 3GDBA 4DEQA 3K4AA 2VZOA 2QQKA 4A45A 3ETPA 3HNMA 4DUVA 1PX4A 3CZJA 3K77A 5HPOA 1CZSA 5CZKA 2Y6JA 4UOJA 2VO5A 3ACHA 3HNBM 1GU3A 4QDRA 4DXSA 2W92A 3OEAA 3WF4A 4BK5A 1O8SA 1JI6A 1R64A 1KGYA 3LEKA 1UYXA 2WO2A 3U37A 5J1XA 2W1WA 3D3AA 3FHQA 1L7RA 3I3BA 2YB7A 2RV9A 2X05A 3T08A 3VD4A 3VD5A 2BERA 1JZ5A 2VR4A 3UNPA 3J7HA 1P8JA 3CDZB 1RYYA 3NJXA 3I2IA 2WBKA 4E8CA 4AG4A 1XPWA 2EICA 4FI9A 3WF2A 3LPGA 5IJRA 2J1TA 5FUIA 5G05L 4W50A 2YFZA 1K3IA 2XHNA 1XC6A 2VMCA 4UAPA 2B4KA 3F2ZA 4CU7A 3T2QA 3OB8A 1UWWA 2KD7A 5JUVA 3C7FA 5G04L 2RVAA 1IQDC 1F4AA 2Y64A 4CU9A 3CKHA 2W94A 1W99A 3NNGA 3SKVA 4DXRA 5JXJA 4UI9L 4XZUG 2J1AA 2VZRA 4RN5A 1L7QA 4W8JA 3CQOA 4A4AA 1JU3A 2WZEA 3I3EA 3PUHA 5JXIA 3OEBA 4JKLA 4BDVB 3K46A 2LW8A 2QQNA 3T2PA 1JYXA 3I2JA 4ZZ5A 1GUIA 3A23A 4LKSA 3OGSA 4CU6A 4XUOA 2DCJA 1T2XA 3MBWA 4ZZ8A 1XNTA 3I2HA 3T09A 4QX1A 3CMGA 2QQMA 5IYYA 4IUGA 4JX0A 3MV11 2ZXQA 2W46A 1W9TA 1JZ7A 2JDAA 2QQLA 3PUIA 3C7HA 2VZ3A 2XONA 2Y6GA 1WKYA 1DYOA 3WNOA 4XURA 1O8PA 2W95A 3VD3A 3A21A 3MUZ1 4A44A 5CYYA 3FHAA 3SEPA 1OD3A 2DDUA 4DUXA 3C7EA 1WCQA 2J7MA 3DYPA 3SEEA 1PMHX 2WN3A 2WN2A 1ULOA 5DN2A 2BGPA 1NAEA 1UY4A 2WQ8A 2J1VA 1NKGA 2WABA 2WO3A 2XQXA 1UZ0A 2E33A 5JXGA 3WF1A 2ZEYA 2WAOA 3VD9A 1XNAA 3BN6A 4MGSA 4KMQA 3LQCA 3FN9A 1JZ4A 2W47A 1OH4A 2C26A 4ARXA 1JYVA 2EIBA 5IFTA 3MO4A 3P6BA 4LPLA 2VCBA 5LA1A 2WO1A 5DPNA 4ZXEA 2YC4A 3HOBA 4JHZA 5I0DA 3A22A 2VZ1A 2JKXA 2BGOA 1GOFA 1UYZA 2XOMA 2Y6KA 3K4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AC0 A;  3E1F 1;  4CU8 A;  2E32 A;  2W1S A;  3I2G A;  2VZS A;  3ACF A;  4A41 A;  4L0P A;  3UET A;  4BK4 A;  4YPJ A;  3WEZ A;  3CZU A;  1JYN A;  1NX9 A;  2PQS A;  2L9L A;  4KI5 M;  5DQ0 A;  1KEX A;  2J1E A;  3OGR A;  3T2O A;  4LQR A;  3MV0 1;  1UXX X;  1GQP A;  1JZ2 A;  3LEI A;  1GNY A;  2VL4 A;  4XUQ A;  2QBX A;  3T0D A;  4W4Z A;  1H6X A;  4OMD A;  4P02 B;  4KWU A;  4MGQ A;  4OUE A;  2VMD A;  1OF3 A;  2YFU A;  1UY3 A;  2EID A;  3LEG A;  1D7P M;  4D0Q A;  4OMC A;  1YQ2 A;  2W9X A;  3OG2 A;  2VZT A;  3HN3 A;  4CUB A;  1MPX A;  3WSO A;  2WYS A;  4GWJ A;  2Y6H A;  1W9W A;  5LCW L;  3IDA A;  1JU4 A;  3VD7 A;  3OGV A;  1UMH A;  1GOG A;  2RJ2 A;  2ZEX A;  3T0B A;  4D8M A;  3ACG A;  3EYP A;  2CDO A;  5LA0 A;  4MOA A;  2CDP A;  2W5F A;  1PMJ X;  4P5Y A;  3III A;  4A42 A;  1EUU A;  4QB6 A;  3ZM8 A;  3C8X A;  1OF4 A;  2BBA A;  2QQI A;  1W0N A;  3T0A A;  3ECQ A;  4A6O A;  3K4Z A;  1SG3 A;  4E8D A;  2W3J A;  3EB7 A;  3JXS A;  5B4N A;  4P08 A;  5JMO A;  3VDB A;  1JYW A;  1CX1 A;  2ZEW A;  3ABZ A;  1UY0 A;  4GWI A;  3THC A;  3A7Q A;  1W8O A;  3MUY 1;  2ID4 A;  3OBA A;  3LPF A;  2J1S A;  2HYX A;  4QPW A;  4XVH A;  3WF0 A;  4QX0 A;  1K45 A;  2WAA A;  3WQB A;  2BZD A;  1UY1 A;  4LHS A;  3THD A;  2E31 A;  2VME A;  4XUT A;  5LA2 A;  4QX3 A;  1F4H A;  2V72 A;  1TVG A;  3W5N A;  2Y8K A;  2VZQ A;  2VCA A;  4CUA A;  3GM8 A;  1W8N A;  2OKX A;  1CZV A;  1I5P A;  4OYU A;  1JZ8 A;  3GXU A;  4ET7 A;  1K12 A;  3VDC A;  4XUN A;  3UES A;  2HLE A;  3W5M A;  3BGA A;  4DXT A;  1W9S A;  2DCK A;  2VJX A;  2ORZ A;  4QAW A;  3ACI A;  2C9K A;  4A3Z A;  4AAX A;  1O59 A;  1H6Y A;  1LNS A;  2EIE A;  2X09 A;  1J83 A;  5EJ1 B;  1JZ3 A;  2VC9 A;  1CIY A;  2VCC A;  1K42 A;  2VMF A;  4JKK A;  2WDB A;  4TTG A;  2ORX A;  4MAD A;  4ARY A;  2VZV A;  1UMI A;  3WNM A;  2QQO A;  5C7G A;  4QX2 A;  4QB2 A;  1CZT A;  1BHG A;  3NJV A;  5EJZ B;  2V4V A;  1PX3 A;  1US2 A;  2W1Q A;  3SKJ E;  2YG0 A;  1UXZ A;  5C70 A;  2VQT A;  4BXS V;  3P1I A;  5IFP A;  3DYM A;  2Z4F A;  4QB1 A;  2B9V A;  3IAP A;  3C7G A;  1OT5 A;  4JKM A;  1J84 A;  3I2F A;  4QDQ A;  2C4X A;  3IAQ A;  4P00 B;  2Y6L A;  4Z2A A;  4DEV A;  2V5D A;  1JZ6 A;  2VZU A;  5DMY A;  3DYO A;  3HPN A;  3NRU A;  1UY2 A;  2WZ8 A;  2W87 A;  4M4R A;  5IHR A;  2JE8 A;  4XUP A;  2E26 A;  2X10 A;  5JXH A;  1UYY A;  1HN1 A;  3HJR A;  2ZEZ A;  1EUT A;  4M4P A;  4QDS A;  4BJ0 A;  2WUH A;  2YC2 A;  4DUW A;  3WF3 A;  5JR2 A;  1GOH A;  4GZ9 A;  3NQH A;  3FL7 A;  1UX7 A;  4OZO A;  2JD9 A;  5HXM A;  2J1U A;  3DEC A;  1US3 A;  3WNL A;  4CVU A;  4HG6 B;  3I3D A;  1SDD B;  1DP0 A;  2VOT A;  5C71 A;  2QQJ A;  4ZY9 A;  4TXW A;  3I2K A;  4RYD A;  4PT6 A;  1GMM A;  2W1U A;  5B4X A;  3HNY M;  2R7E B;  2J1R A;  2LS6 A;  3WNK A;  3WNP A;  2W91 A;  2VTF A;  3HEI A;  1TG7 A;  4PQQ A;  3WNN A;  3C7O A;  3VDA A;  1JHJ A;  2VQU A;  5F7U A;  3I97 A;  3K75 B;  3CIH A;  3IB3 A;  3GGL A;  2VZP A;  1DLC A;  1SHW B;  2VM9 A;  4PF1 A;  3LE0 A;  5EIY B;  1NUK A;  2J22 A;  4MO3 M;  4CUC A;  1ULP A;  5A1A A;  3GDB A;  4DEQ A;  3K4A A;  2VZO A;  2QQK A;  4A45 A;  3ETP A;  3HNM A;  4DUV A;  1PX4 A;  3CZJ A;  3K77 A;  5HPO A;  1CZS A;  5CZK A;  2Y6J A;  4UOJ A;  2VO5 A;  3ACH A;  3HNB M;  1GU3 A;  4QDR A;  4DXS A;  2W92 A;  3OEA A;  3WF4 A;  4BK5 A;  1O8S A;  1JI6 A;  1R64 A;  1KGY A;  3LEK A;  1UYX A;  2WO2 A;  3U37 A;  5J1X A;  2W1W A;  3D3A A;  3FHQ A;  1L7R A;  3I3B A;  2YB7 A;  2RV9 A;  2X05 A;  3T08 A;  3VD4 A;  3VD5 A;  2BER A;  1JZ5 A;  2VR4 A;  3UNP A;  3J7H A;  1P8J A;  3CDZ B;  1RYY A;  3NJX A;  3I2I A;  2WBK A;  4E8C A;  4AG4 A;  1XPW A;  2EIC A;  4FI9 A;  3WF2 A;  3LPG A;  5IJR A;  2J1T A;  5FUI A;  5G05 L;  4W50 A;  2YFZ A;  1K3I A;  2XHN A;  1XC6 A;  2VMC A;  4UAP A;  2B4K A;  3F2Z A;  4CU7 A;  3T2Q A;  3OB8 A;  1UWW A;  2KD7 A;  5JUV A;  3C7F A;  5G04 L;  2RVA A;  1IQD C;  1F4A A;  2Y64 A;  4CU9 A;  3CKH A;  2W94 A;  1W99 A;  3NNG A;  3SKV A;  4DXR A;  5JXJ A;  4UI9 L;  4XZU G;  2J1A A;  2VZR A;  4RN5 A;  1L7Q A;  4W8J A;  3CQO A;  4A4A A;  1JU3 A;  2WZE A;  3I3E A;  3PUH A;  5JXI A;  3OEB A;  4JKL A;  4BDV B;  3K46 A;  2LW8 A;  2QQN A;  3T2P A;  1JYX A;  3I2J A;  4ZZ5 A;  1GUI A;  3A23 A;  4LKS A;  3OGS A;  4CU6 A;  4XUO A;  2DCJ A;  1T2X A;  3MBW A;  4ZZ8 A;  1XNT A;  3I2H A;  3T09 A;  4QX1 A;  3CMG A;  2QQM A;  5IYY A;  4IUG A;  4JX0 A;  3MV1 1;  2ZXQ A;  2W46 A;  1W9T A;  1JZ7 A;  2JDA A;  2QQL A;  3PUI A;  3C7H A;  2VZ3 A;  2XON A;  2Y6G A;  1WKY A;  1DYO A;  3WNO A;  4XUR A;  1O8P A;  2W95 A;  3VD3 A;  3A21 A;  3MUZ 1;  4A44 A;  5CYY A;  3FHA A;  3SEP A;  1OD3 A;  2DDU A;  4DUX A;  3C7E A;  1WCQ A;  2J7M A;  3DYP A;  3SEE A;  1PMH X;  2WN3 A;  2WN2 A;  1ULO A;  5DN2 A;  2BGP A;  1NAE A;  1UY4 A;  2WQ8 A;  2J1V A;  1NKG A;  2WAB A;  2WO3 A;  2XQX A;  1UZ0 A;  2E33 A;  5JXG A;  3WF1 A;  2ZEY A;  2WAO A;  3VD9 A;  1XNA A;  3BN6 A;  4MGS A;  4KMQ A;  3LQC A;  3FN9 A;  1JZ4 A;  2W47 A;  1OH4 A;  2C26 A;  4ARX A;  1JYV A;  2EIB A;  5IFT A;  3MO4 A;  3P6B A;  4LPL A;  2VCB A;  5LA1 A;  2WO1 A;  5DPN A;  4ZXE A;  2YC4 A;  3HOB A;  4JHZ A;  5I0D A;  3A22 A;  2VZ1 A;  2JKX A;  2BGO A;  1GOF A;  1UYZ A;  2XOM A;  2Y6K A;  3K4D A; 
#chains in the Genus database with same CATH topology
 1HB4 A;  2VMG A;  4J25 A;  1L3J A;  5FPX A;  1I6X A;  3LAG A;  4LBQ B;  5FP7 A;  3BCW A;  1H2L A;  4GB3 3;  1VIW B;  2C5D A;  2I2S A;  4YPJ A;  2V4A A;  1RMU 2;  2VNG A;  3WEZ A;  5KWR A;  2PQS A;  3ENR A;  3AMN A;  3NV3 A;  5L7O C;  4NR1 A;  1KEX A;  1NE6 A;  1RUJ 3;  5GZG A;  3OGR A;  2R6Q A;  4A7K A;  3B69 A;  4R9D A;  2XGX A;  1GQP A;  3OTF A;  3HMY A;  1W6N B;  4Q0V A;  2PLV 2;  1A8M A;  4K3U A;  4XUQ A;  4AI3 A;  1W8T A;  4LBK A;  2QBX A;  5FUN A;  4URA A;  3PUS A;  4XDQ A;  1FNZ A;  3JB8 A;  4FTB A;  3E6C C;  2NN8 A;  4SBV A;  4OUE A;  1ZBA 2;  1K5M C;  2JKB A;  2B9U A;  4CCD A;  2CSG A;  4IEW A;  4BQY A;  3JD7 3;  4WM7 C;  1AYM 2;  3WDY A;  1D7P M;  3AZX A;  5KXC A;  1VBA 1;  5EV7 A;  5L7O B;  3CU7 A;  4IE5 A;  3VZJ A;  3OOX A;  2AEZ A;  2DWR A;  1ZYB A;  3HN3 A;  4FPK A;  4D6R A;  5T5O A;  1OKQ A;  3POE A;  1XNC A;  4HN0 A;  2W2I A;  4GWJ A;  3NVC A;  2R06 3;  4QQH A;  3O1P A;  2JG8 A;  1W2T A;  1CAX B;  5LCW L;  3UKN A;  1FPN 2;  2GAU A;  5CBL A;  3KQ4 B;  3Q8F A;  1YFW A;  4YYO A;  1K5M B;  1XB9 A;  2RJ2 A;  2ZEX A;  4BQ5 A;  3N4M A;  4XF1 A;  3MF6 A;  4NWW A;  1H8T A;  1LEN A;  1RUE 2;  2RM2 1;  4FTS A;  2O14 A;  3EYP A;  3KLS A;  3SHR A;  1Z7S 2;  2JD4 A;  4RHV 1;  3III A;  3BI3 A;  5H9R A;  3GYD A;  2B5H A;  5DUX A;  4XBL A;  5T55 A;  1VBB 3;  5M0T A;  2O8Q A;  3BIW E;  3DPR A;  4R9A A;  3ITQ A;  1EUU A;  1OA2 A;  2XJT A;  1A34 A;  5I0U A;  1IKQ A;  1QXR A;  2R07 2;  2VOK A;  3AKT A;  2XJP A;  4BQ1 A;  2XVL A;  1CJD A;  5KBF A;  4XAE A;  1VBE 1;  2A70 A;  2VQ0 A;  4Q0U A;  3K4Z A;  4NIH A;  2ZAA A;  2W3J A;  3H1M A;  4L9B A;  1LOD A;  3JXS A;  1VP6 A;  5B4N A;  4O7X A;  1IG3 A;  2OZ6 A;  3ON7 A;  2Q8E A;  5KXB A;  4UFH A;  1N3Q A;  1UY0 A;  4UW6 A;  5T5J A;  2GH2 A;  3THC A;  3A7Q A;  2AYH A;  4OQ9 A;  3GZT B;  3MUY 1;  4CDU C;  4D3W A;  4UBG A;  5GZC A;  1JN2 P;  3V0B A;  1VE0 A;  1DGW X;  1YFU A;  2J1S A;  2YRO A;  2O0O A;  1AHS A;  4LKE A;  1C57 A;  5JSO A;  2BTV C;  1ND3 A;  4P9L A;  1LEM A;  1TQ5 A;  4COU A;  4FBF A;  4N9I A;  1BBT 3;  2G4I A;  2PHL A;  3KWV A;  2H0V A;  3TEY A;  4YRD A;  4QX3 A;  2G19 A;  3ZPO A;  2BWA A;  5CIR A;  1SCS A;  2VZQ A;  2W39 A;  1UPS A;  4CCN A;  5A3L A;  2D40 A;  4QM9 A;  3J8F 3;  2AH2 A;  4J1W A;  3LDK A;  5FXV A;  1UIK A;  1WD4 A;  4GAL A;  3GM8 A;  1LOF A;  1W8N A;  4TLF A;  2OKX A;  2PEL A;  4AQ6 A;  1HRV 1;  4L99 A;  4J6G A;  4RR3 C;  2ZOE B;  1TMF 1;  4WVM A;  5CKM A;  1DU3 D;  2ILM A;  5LBC A;  3GXU A;  3ZXL A;  5BNN C;  1JZ8 A;  5C8C B;  3M3Q A;  5CU1 A;  1DQ2 A;  1JYT A;  4IEX A;  4LOR A;  1RXG A;  1SLL A;  2P34 A;  3FMG A;  3WCR A;  2JDK A;  3HBZ A;  1AR9 2;  3INA A;  1YC6 1;  2PHT A;  1DQ6 A;  3WDU A;  2A7A A;  1BEV 1;  1PVC 2;  4XHX A;  3BGA A;  5JZG B;  2VJX A;  5T3N A;  1HQW A;  1BCX A;  2YPJ A;  1CPM A;  2P2K A;  5FYY A;  4QGN A;  3H7Y A;  3R6S A;  1ASJ 1;  3D5O A;  4LKD A;  1NYW A;  1H6Y A;  3MIG A;  4C90 A;  1LNS A;  5A3T A;  1J83 A;  3FLT A;  1GLH A;  5HV4 A;  5EJ1 B;  1Y9M A;  2C6S A;  5FYB A;  4WVW A;  1GKB A;  1DG6 A;  1UZV A;  2RS3 2;  1QDC A;  4P9I A;  1Y43 B;  2ZMN A;  3RRD A;  4XFF A;  3NNF A;  1J1L A;  3W59 A;  1S2B A;  4GWM A;  4Z8B A;  2WZP P;  2F4P A;  4QX2 A;  4GMP 0;  1CWP A;  2GDF A;  3NJV A;  3DKQ A;  4IET A;  1LHU A;  3I8T A;  5FRA A;  1CIW A;  3ZSE A;  1SFY A;  2RMU 1;  4YW7 A;  5A32 B;  5JOX A;  1W06 A;  4AED C;  3IIA A;  2V4V A;  2R30 A;  1LB2 A;  5ACA 3;  4OFG A;  5GZE A;  3H3U A;  2W1Q A;  5FPA A;  1HJG A;  3H50 A;  4AEJ A;  3SIT A;  4BIO A;  5BV6 A;  1UXZ A;  2D5F A;  2LM3 A;  1PZ9 A;  4BHP A;  3JZV A;  3P1I A;  3LOB A;  5FAX A;  1QMJ A;  4QXK A;  1TME 3;  2PFW A;  3DYM A;  4JRL A;  3IAP A;  4YZ1 A;  4TYS A;  2XR4 A;  1J84 A;  4QDQ A;  1QU0 A;  2AZ5 A;  3POJ A;  5CNA A;  1NLS A;  1SEF A;  2YYO A;  5J7M A;  3B5L B;  3NL1 A;  3NAP C;  4LO7 A;  4IL7 A;  2ZGT A;  2P3K A;  3SH4 A;  4AED B;  5LBE A;  4Y1U A;  5LEJ A;  5FZ7 A;  5BPX A;  4N7I A;  3CJI C;  1JH5 A;  3KM5 A;  2JIJ A;  5FMD A;  3D0J A;  3RZH A;  4PBP A;  1W2O A;  5JWP A;  3VHR A;  5F2S A;  2X5I A;  4NRP A;  5FYT A;  5ISL A;  3OUI A;  1N1V A;  1OA3 A;  1SLT A;  3AKQ A;  2YHJ A;  4LBL A;  4CDX A;  4LO6 B;  1GP5 A;  2WZ8 A;  4NE9 A;  2W87 A;  3ES4 A;  3TN9 3;  3TRS B;  1R08 2;  2NLR A;  2JE8 A;  1QJU 3;  4C1W A;  1DFQ A;  2MEV 2;  1VAK A;  5FJH A;  1XU2 A;  5L9R A;  4HOO A;  4WZC A;  4AFD A;  4KWL A;  5FZK A;  3QD6 A;  1GP4 A;  1IGO A;  1ODN A;  4RFT 0;  1MR5 A;  1ZBE 3;  4AZZ A;  1B09 A;  1GWL A;  1ZZ9 A;  4MZU A;  2HYK A;  4YVW A;  4BMB A;  4GB3 2;  4Y1V A;  1W04 A;  2LRO A;  3AJZ A;  1XE7 A;  1OPO A;  2FMD A;  2BU9 A;  2DFB A;  1CN1 A;  5CKQ A;  2XHK A;  1RUJ 2;  4YGC A;  2J1U A;  3J7L A;  5D1I A;  1G86 A;  3DEC A;  3VBO B;  5C3P A;  2WLP A;  3RZG A;  1UU4 A;  1WWY A;  3V0A B;  4HKW A;  2HWD 3;  3H0O A;  4DRR A;  3I3D A;  1FMD 2;  3UV9 A;  3R05 A;  4IE7 A;  3OCP A;  1SAC A;  3WXP A;  2VOV A;  4KGG A;  4O9G A;  1NY7 1;  3JBG 1;  4TXW A;  5A7Q A;  4N53 C;  3S30 A;  3OD0 A;  1HB3 A;  4CEW B;  3M70 A;  4NPM A;  5B4X A;  2PYT A;  4BQ4 A;  3HQX A;  5LRR A;  4RQP A;  2VCM A;  4IGQ A;  2R7E B;  2ZJC A;  3H9A A;  4MHU A;  1NLQ A;  2J1R A;  4XDO A;  1BQP A;  1F35 A;  2D5H A;  2IXI A;  3B9I A;  1NZC A;  3LIH A;  2W91 A;  4QU1 A;  3WNP A;  1W03 A;  4UF0 B;  1CPN A;  1TG7 A;  2ZBJ A;  5FZF A;  4NRO A;  2DYC A;  4D69 A;  2K46 A;  4IES A;  1ZRF A;  1UOG A;  1PIV 1;  5FTT C;  1CAW A;  3K75 B;  5I0R A;  1GSL A;  5K4L A;  4MGK E;  5FO9 B;  1ONA A;  3CIH A;  3P5B A;  1MEC 1;  3CL1 A;  3KF3 A;  4Y22 B;  5FZM A;  3BTY A;  1E5S A;  1Y7B A;  4F8A A;  1SHW B;  2DU0 A;  3O5S A;  1S55 A;  1UIJ A;  3N7L A;  4RFR B;  3VKO A;  4COY A;  4EE2 A;  5EIY B;  5A6Y A;  4LLF A;  1NXM A;  2H6B A;  3AMP A;  1NUK A;  5J09 A;  5AC9 1;  1CX4 A;  5F39 A;  5IVV A;  1NCQ A;  1QDO A;  4CUC A;  4FSJ A;  1VBB 2;  1D2Q A;  2UWC A;  1LOC A;  2WT1 A;  2G1M A;  1FOD 3;  1OLQ A;  1JS9 A;  4BZ4 A;  1QJX 3;  3KV6 A;  2IXL A;  4UFL A;  1GWM A;  4ZS3 A;  1LRH A;  4A45 A;  3K48 A;  3HNM A;  4CXX A;  1XND A;  1PX4 A;  1UPI A;  1MS3 A;  2XXZ A;  1CAV A;  4HMZ A;  1DZR A;  3K77 A;  1VJ2 A;  3VBS B;  4FTE A;  4YM0 A;  1BLZ A;  1N1Y A;  4LKF A;  4LOS A;  5LZ6 A;  4PIX A;  3ACH A;  2A6Z A;  1PGS A;  1VAV A;  4QDR A;  4DXS A;  1GNZ A;  3OEA A;  3WF4 A;  2A5Z A;  3AB0 A;  1URX A;  4Y1X A;  2YXS A;  2ZX0 A;  3EQE A;  4G3Y C;  3OF1 A;  5SV5 A;  3N7M A;  5HV0 A;  2WO2 A;  1UD1 A;  1W0P A;  1MS1 A;  2QZ3 A;  2A3W A;  2ZML A;  4G4F A;  2BVB A;  1F5F A;  4JZR A;  4XIL A;  1V0A A;  2JDM A;  2VBB A;  3OY8 B;  1Y9G A;  3D3A A;  4JTO A;  4LIV A;  2E9Q A;  3LFM A;  4MXW B;  4MGT A;  2Q8D A;  1ZZB A;  2R0F A;  2NPI A;  2CWS A;  3N9L A;  4EWA A;  1N3P A;  1X8M A;  3RDI A;  2XKO A;  3ZFG B;  4Q1R A;  1XSQ A;  1IKP A;  4IEU A;  3VD5 A;  2WFF 1;  4C8D A;  2DVB A;  4MUV A;  3CDZ B;  5FOB B;  3OJB A;  3B3Q E;  1PGW 1;  1W39 A;  1XPW A;  2ERF A;  5C5U A;  4IV1 A;  3OD4 A;  4DO0 A;  2DBI A;  5FUI A;  3TNP B;  3T1M A;  4MGZ E;  4W50 A;  2WT2 A;  4O9E A;  4QQ2 A;  5L19 A;  2VMC A;  3GJA A;  3W58 A;  1CR7 A;  1GQG A;  2WZR 2;  4K7J A;  2JEC A;  3AJY A;  4O61 A;  3SCF A;  4D7Y A;  2CGP A;  4FFH A;  1LOB A;  3TNQ A;  2K0G A;  3C7F A;  3PNA A;  4DRV A;  2HWB 2;  1RUC 1;  2D44 A;  2BV4 A;  4XAC A;  2RE9 A;  3AP5 A;  3GBG A;  1WW6 A;  1W6P A;  1IS4 A;  4PQ9 A;  5FYI A;  2XKP A;  4QM8 A;  3VBF C;  4NHL A;  2VZR A;  2ES3 A;  4QPI C;  4GXL A;  4RN5 A;  4W8J A;  5DZG A;  1YJK A;  1WW4 A;  2W68 A;  4XZP A;  3NWK A;  1VBC 1;  2B46 X;  3PUH A;  4JHT A;  2WS9 1;  5JXI A;  4LO4 B;  1AYN 1;  3AKR A;  2BGC A;  1OUS A;  2DUO A;  1W8F A;  4M01 A;  4Z07 A;  3VB9 A;  4E2G A;  1JYX A;  3I2J A;  4BLI A;  3PUA A;  4LBM A;  1GUI A;  2HWF 1;  1EP0 A;  4YFZ A;  3IBM A;  1OKO A;  5C3O A;  2XB6 C;  3WLU A;  5FXW A;  1F5J A;  3MHZ A;  1T2X A;  3MBW A;  3NV2 A;  4CDQ A;  1VMJ A;  1D0G A;  2OXB A;  4NVP A;  4QPI B;  1C8M 1;  1R1A 3;  3T09 A;  1W28 A;  2X8K A;  3ZFF C;  4PDW C;  3USU B;  5IYY A;  4KGQ A;  1MVE A;  3HT2 A;  3MI8 A;  3AP9 A;  4YVS C;  5C8W A;  4LNV A;  2UYB A;  2ZXQ A;  1JOP A;  1NCR C;  2W46 A;  2ZS6 B;  1F31 A;  3DXT A;  5BY5 A;  2OYZ A;  2JDA A;  1V9U 3;  1BMV 1;  5C5T A;  3PUI A;  3S7E A;  4HON A;  2XON A;  2Y6G A;  5D8A A;  3PHM A;  2GNT A;  1C1F A;  4TSV A;  1DYO A;  3BU7 A;  3LSE A;  3WNO A;  2A6V A;  1WMX A;  4QQP A;  1O8P A;  4XEZ A;  5C9A B;  3ZLI A;  1W90 A;  3ZFF B;  4R4Z A;  3J7N A;  3FHA A;  1W6Q B;  1QH6 A;  1D0H A;  2XML A;  4ITC A;  4RGA A;  4CP9 B;  2PLV 3;  2DDU A;  4IDZ A;  3C7E A;  4YVS B;  5A7W A;  2ZHM A;  4RS5 C;  1Z0H A;  2XVG A;  4JGZ B;  4Y24 A;  1RUF 3;  1ZBA 3;  4PLO A;  2BGP A;  1QXJ A;  4AOC A;  1QJU 2;  2RM2 2;  5FBJ A;  1NAE A;  4LHK A;  1WMD A;  3NST A;  3GBF A;  1VBD 1;  2WLQ A;  5H9Q A;  1AYM 3;  2WQ8 A;  2J1V A;  4CEY C;  2DTY A;  4R52 A;  5C4W B;  2EIG A;  2WO3 A;  3UGH A;  1ZVF A;  2R49 A;  4NO4 A;  4Q27 A;  5FO8 B;  4DS0 A;  1DYP A;  3E5Q A;  1SPP A;  3WF1 A;  2PHD A;  1W6M B;  1REE A;  2WAO A;  4NID A;  1MQT C;  1FPN 3;  4LHN A;  4MGS A;  4LUK A;  1SBD A;  2CV6 A;  2W47 A;  1S2E A;  1TE1 B;  4XXP A;  3S57 A;  1UU6 A;  4ARX A;  2EIB A;  1JYV A;  2FDK A;  5FPB A;  2CGO A;  5IFT A;  4OI2 A;  2HWD 2;  3P6B A;  5FY4 A;  1RUE 3;  3U4X A;  4N43 C;  3RQ0 A;  4Q0S A;  4Q4V 1;  5DPN A;  5KC5 A;  1PM7 A;  3I49 A;  2FD8 A;  1GZC A;  2ET7 A;  1Z7S 3;  1S0J A;  5IK7 A;  5I0D A;  4JC1 A;  4Y20 B;  3ZPY A;  4LTA A;  1ACC A;  1UYP A;  3B02 A;  5K0U B;  2XJR A;  3CNA A;  5F37 A;  1GOF A;  2JIG A;  3KGZ A;  4XOG A;  1GZW B;  5DUW A;  2R07 3;  2XOM A;  4XTM A;  2BNO A;  2JG9 A;  3AL6 A;  3JU9 A;  4IV3 A;  2TBV A;  5LRS A;  2OQ7 A;  3VBR B;  1ULG A;  2VZS A;  3ACF A;  3VHP A;  2FCT A;  2Q5T A;  4BPZ A;  4KQ7 A;  2SBA A;  2GMP A;  5A3W A;  5IK4 A;  1RHI 3;  1CJP A;  1REF A;  3NMB A;  5BNP C;  1NX9 A;  2YPD A;  2LUW A;  2J1E A;  2EXI A;  1HRV 2;  3T2O A;  3WDX A;  1RUI 3;  5CKN A;  4HFS A;  3NO8 A;  1JZ2 A;  2GME A;  1SFN A;  2EF6 A;  2VL4 A;  2CHH A;  1BXH A;  4AQ2 A;  1OA4 A;  4W4Z A;  4M00 A;  1SBE A;  1RUH 3;  4Q4X 3;  1H6X A;  4C0H A;  4OMD A;  4P02 B;  4EN8 B;  2N7G A;  2RJL A;  4KWU A;  1MZ5 A;  5A33 A;  5FZ8 A;  3W9A A;  4CDW B;  1C3H A;  3ZFE B;  3ZMO A;  2VMD A;  4XJ9 A;  2FZ2 A;  3C3V A;  3MIH A;  4XAA A;  2YFU A;  3U1X A;  1GZ9 A;  2A73 B;  1UY3 A;  5HXV A;  1G7Y A;  1FOD 2;  2C24 A;  1OFS A;  2VXR A;  4NPR A;  2D93 A;  2ADD A;  2XWB B;  3MW2 A;  3N9P A;  4QHO A;  3VHN A;  5HI0 A;  1LU2 A;  4OHV A;  4OMC A;  3V64 A;  1YIP A;  2VNO A;  2W9X A;  1LHN A;  3OG2 A;  2VZT A;  5DDJ 3;  3NNL A;  3PL0 A;  1YFY A;  3WSO A;  1ASJ 2;  3WHU A;  5F5C A;  2YBP A;  4BIS A;  2BP6 A;  4A7Z A;  1W9W A;  2I07 B;  2QQW A;  1H8V A;  1HW5 A;  3JD7 1;  5A6X A;  4NII A;  5DXD A;  3LZZ A;  2XJU A;  3OGV A;  3VD7 A;  2KR2 A;  5C33 A;  2E7A A;  4HN1 A;  5EYY A;  1AR9 3;  4B29 A;  1KDM A;  2YGL A;  2BDR A;  4N90 A;  4QX8 A;  3ZXJ A;  4A7Y A;  4D8M A;  3ACG A;  3ZM8 A;  3QLQ A;  1PVC 3;  2PHX A;  2IXJ A;  2W5F A;  1PMJ X;  4P5Y A;  2R0H A;  2VQA A;  5KXD A;  1XE0 A;  2D98 A;  1XYP A;  2H6C A;  5BXX A;  5FYU A;  2I74 A;  2RS1 1;  2XBO 1;  3ALQ A;  1ENQ A;  4QB6 A;  2GSY A;  3C8X A;  4RA0 A;  1JOD A;  3RZZ A;  2CAV A;  1UO9 A;  1Q8P A;  5ABJ C;  4I0B A;  2VBP A;  2VG9 A;  3AXD A;  1PO1 1;  2DVG A;  4X6Q B;  4CE8 A;  5K8S A;  3UGF A;  1SDW A;  2RS3 3;  3EB7 A;  4ZU7 A;  3PIJ A;  4MXV A;  3I4I A;  3ZKU A;  2ZEW A;  3H7J A;  4MHR A;  3WD5 A;  1KFX L;  5FQ0 B;  1W6O A;  2O1Q A;  1COV 1;  2OZJ A;  3AXE A;  1SCR A;  4E4D X;  2ID4 A;  2OUJ A;  3ZR6 A;  4YZ5 A;  1DQ4 A;  3G7D A;  3O14 A;  2RDQ A;  3GZA A;  2OII A;  3P3N A;  2CAU A;  4LUL A;  4U36 A;  3WUC A;  4XVH A;  3IWZ A;  4IXL A;  5FJK A;  4BH9 A;  4QX0 A;  3PLQ A;  1HV1 A;  1SBF A;  5LAT A;  1OVP A;  2FHR A;  2WNV C;  3THD A;  2V5Y A;  4LLO A;  5H9P A;  4NMI A;  3PU8 A;  2E31 A;  4IEO A;  4XUT A;  5LA2 A;  5IVE A;  3JQW A;  4JRA A;  4XJA A;  5J96 B;  5J98 B;  2V72 A;  4KG8 A;  2Y8K A;  1DQ0 A;  1VPH A;  2VCA A;  5CVR A;  5EP9 A;  4CUA A;  3OYW A;  2JB8 A;  5FDB A;  1YRZ A;  1CZV A;  1W6N A;  5FZG A;  1AZD A;  1ND2 A;  4QHB A;  1O91 A;  4OYU A;  4EN6 B;  3MFA A;  4K1Z A;  1PGL 2;  1ZNP A;  2AGS A;  1QKQ A;  2RJK A;  4DY5 A;  4H7L A;  1PNG A;  2HWE 1;  4JGY B;  1QQP 3;  3AKP A;  4XET A;  4CP2 A;  1ZRE A;  3UES A;  3RZK A;  4XXA A;  2RR1 1;  5J48 A;  4GMP 3;  3M2M A;  1YFX A;  5I0S A;  3RZJ A;  2GNM A;  4ISR A;  4YG6 A;  3VBU B;  2ZAC A;  1EPW A;  4LBJ A;  1AJO A;  5FZ6 A;  3WG2 A;  5LY2 A;  4KU8 A;  1R1A 2;  2WNU A;  1CAX A;  2C9K A;  4C91 A;  2ZZQ A;  1WCS A;  4A3Z A;  2P6H A;  5FKB A;  2RS5 3;  4OUS A;  2X09 A;  3ORJ A;  1W9Y A;  4KWJ A;  1V6M A;  3E97 A;  2VUC A;  4PCR A;  2D6L X;  2VC9 A;  1Z78 A;  2UYA A;  2MEV 3;  3HR9 A;  3KT4 A;  4P9W A;  3ILR A;  1NY7 2;  3JBG 2;  1JMU B;  2VMF A;  4FPY A;  2V73 A;  3B01 A;  2P17 A;  4S2D A;  5FLJ A;  5BNO B;  2H0B A;  3O1V A;  2A6W A;  4QPG C;  1NA1 C;  3LA7 A;  4ARY A;  1V9U 2;  3KS7 A;  1MS0 A;  5CG9 A;  4QT6 A;  4D7T A;  1XE8 A;  2RDS A;  3WNM A;  1WBF A;  4PJY A;  1QEX A;  1CX1 A;  1CZT A;  1HRI 3;  2HWC 1;  3EJK A;  3H1W A;  2Q1Z B;  4CUG A;  3QH6 A;  3AYD A;  3BAL A;  1HQL A;  1I3H A;  4PIY A;  4K8R B;  2OT7 A;  2XJS A;  3WW2 A;  3WT3 A;  1PIV 2;  1AJK A;  1FMD 3;  2D7F A;  3BPZ A;  2YG0 A;  3VBH B;  5C70 A;  3LWC A;  2VQT A;  1VRH 1;  3THP A;  2BBV A;  3OSD A;  4YSF A;  4BXS V;  1GR3 A;  1MEC 2;  3K3O A;  4QPG B;  1NA1 B;  3ATG A;  1RUF 2;  1OFN A;  3B7M A;  4QB1 A;  2B9V A;  1OT5 A;  5CFC C;  4W6Y A;  1VB2 A;  1QJY 3;  3FJS A;  4GQ7 A;  5T54 A;  5ACA 1;  3IAQ A;  4S2F A;  5GM0 A;  5AC9 2;  2Y6L A;  1O4Y A;  1LES A;  2XLF A;  5A6Z A;  2ZGR A;  3TYJ A;  4Z2A A;  5JSR A;  1F15 A;  1RIR A;  2YUE A;  3ST7 A;  5JI7 A;  1JZ6 A;  4K21 A;  4GH4 C;  2VZU A;  3LIG A;  1FV3 A;  4CPB A;  1G9B A;  1VMF A;  1YWK A;  5FP4 A;  4E4S A;  5JI9 A;  4N7U A;  2G9G A;  2IXH A;  1UY2 A;  4B8E A;  3I59 B;  5CFC B;  1RUG 3;  3POB A;  5FXZ A;  2HBT A;  1YQ8 A;  3MZH A;  3R4D B;  4FP2 A;  4WM7 B;  5C8C A;  4M4R A;  4ATE A;  4AVB A;  2B7Y A;  1PZ7 A;  2OPK A;  4ZPI A;  5FKC A;  1S0C A;  2E26 A;  4F7Z A;  5FR3 A;  1FAT A;  1GYK A;  4UW5 A;  4Z92 B;  5LBB A;  3RSJ A;  5JXH A;  3U0Z A;  1VB4 A;  1H2K A;  3W20 A;  1A8D A;  1V6O A;  5A7P A;  1AXK A;  1EUT A;  5JZG A;  3VUO A;  2P4E A;  4YM3 A;  4M4P A;  5FWE A;  3FE5 A;  2WUH A;  2ZHN A;  4DUW A;  4QX7 A;  2KA3 A;  1RHI 2;  4GZ9 A;  2VTX A;  3ZVX A;  1NT0 A;  3FL7 A;  1AL2 3;  2G9Z A;  1DGR A;  1OQ1 A;  1ULF A;  1V70 A;  2JD9 A;  3VZK A;  3ZXG A;  1MS8 A;  1H1M A;  2I45 A;  2WNE A;  5FYZ A;  3WW4 A;  1RUI 2;  3CJX A;  3J4U H;  1V6N A;  3WNL A;  1PGW 2;  2BJS A;  2ETE A;  1ULE A;  5FZ4 A;  5T5P A;  1SDD B;  5C3S A;  2Q0A A;  3DXU A;  4K1Y A;  4AVV A;  5C71 A;  5APA A;  5J3U A;  2QQJ A;  1RUH 2;  4MGY E;  1EV1 3;  2R16 A;  4Q4X 2;  4EZH A;  5F6L B;  4RYD A;  5DAW A;  1GMM A;  1LOE A;  3HT1 A;  5C3R A;  4AFB A;  2W1U A;  3CHX A;  2ZGK A;  3MW3 A;  4MX3 A;  3B9C A;  3H42 B;  4YGE A;  5A32 A;  1ST8 A;  2E7T A;  3KT7 A;  1Q56 A;  2JG8 C;  3AZY A;  4FAH A;  4CDU B;  3FWE A;  3RFR A;  1JXN A;  2B39 A;  1Q43 A;  1RUC 2;  1YQ6 A;  2VTF A;  4PQQ A;  1ZM1 A;  5FP3 A;  5DDJ 2;  4UFI A;  1SZB A;  3NNJ A;  1ZZ7 A;  3C7O A;  1PO2 3;  4Y5S A;  3ZOI A;  1H8T C;  1KRI A;  4CXW A;  2CWM A;  2VQU A;  5F7U A;  2FMY A;  1HV0 A;  5FZ0 A;  2DCT A;  1OHF A;  3ZR5 A;  1U12 A;  1XNK A;  1YIF A;  2QDN A;  1H4H A;  1POV 3;  4LE4 A;  3IB3 A;  3OUH A;  3DPR C;  3GGL A;  5F32 A;  2NZ9 A;  4GJZ A;  1AYN 2;  1W2U A;  1A78 A;  2UWB A;  2WZR 3;  4YZ4 A;  3LE0 A;  2WR9 A;  5IVC A;  1FX5 A;  4HSJ A;  3KVA A;  2HWB 3;  3A0K A;  5D21 A;  1ZZ8 A;  2MHF A;  2VMH A;  1NOV A;  3K4A A;  4DEQ A;  5IK8 A;  1I5Z A;  2UUR A;  4RR3 B;  4UFK A;  4B7K A;  1H8T B;  3WHT A;  5BNN B;  3ETP A;  1EAH 1;  2D3S A;  4H55 A;  4TN7 A;  1RUD 1;  4W6W A;  4Q4Y 1;  2VUL A;  5CZK A;  2Y6J A;  2VVE A;  3AM2 A;  1ND3 C;  1S0B A;  3VDB A;  2A6X A;  4EJR A;  3WW3 A;  4Q26 A;  5FY7 A;  3BIE A;  4ZHN A;  5ANQ A;  4BK5 A;  2QKD A;  1YJL A;  1O8S A;  1QJX 1;  4L8Q A;  4PLN A;  4WM8 A;  2D97 A;  3LEK A;  1VLN A;  4Q0Q A;  1UYX A;  3U37 A;  3O7O A;  4V2W A;  3N36 A;  2RDR A;  1BZW A;  5LBF A;  1LOF C;  1N3O A;  2ZGP A;  4JDM A;  4AHW A;  1IS3 A;  1TNF A;  3FHQ A;  4M3C B;  3O1O A;  3AMQ A;  2DUR A;  2DTW A;  3U4S A;  2X05 A;  2RV9 A;  4QPY A;  4UYB A;  2G9F A;  4QX5 A;  3VD4 A;  2P1B A;  1GZT A;  3VBO A;  2BER A;  2FDJ A;  1OXC A;  3MPP G;  3U07 A;  3UNP A;  3J7H A;  3RNS A;  3V0A A;  2GU9 A;  1DGL A;  1HIX A;  1Q8S A;  3LEM A;  4TZD A;  1ENR A;  2WBK A;  3VKF C;  2AEY A;  2VXJ A;  2Z79 A;  2ZGS A;  4CEW A;  4LT5 A;  1OOP A;  3I3M A;  1H0B A;  2RHP A;  4OI4 A;  1VBD 2;  5H9S A;  5IUQ A;  5FK8 A;  1VBA 3;  4QKN A;  5A80 A;  2FDI A;  1WZX A;  2WYF A;  1XC6 A;  3T4V A;  1RIT A;  4UAP A;  1QQP 2;  2XVK A;  3TEX A;  4HKO A;  2R32 A;  1D4V B;  1AF9 A;  1BYH A;  4LJH A;  3M7A A;  1WMF A;  2ARA A;  4P9X A;  4RGG A;  4UF0 A;  5F5A A;  1UWW A;  1X7N A;  2KD7 A;  1NQD A;  2X53 S;  1DF0 A;  3URF A;  5G04 L;  3ZIX A;  2VMI A;  4DMI A;  1F4A A;  4R4X A;  4XCA A;  4CU9 A;  2P3Y A;  3NKG A;  4XW3 A;  1SQ4 A;  2BWC A;  2W94 A;  4AAP A;  3SKV A;  5LEK A;  1AR6 1;  2BFU S;  2RS5 2;  4Y22 A;  3MDP A;  4UI9 L;  3NAP B;  3MLL A;  2RM2 3;  2IFW A;  1S0I A;  4XF4 A;  4Q4V 2;  2PQQ A;  4FOV A;  4QXC A;  3SH5 A;  1S4C A;  4RHV 3;  5IAT A;  4S2G A;  3CJI B;  3CQO A;  1A3K A;  1JU3 A;  3GNE A;  4CCC A;  3FC0 A;  3I3E A;  1SLB A;  5JPN B;  3FX3 A;  4EWE A;  5CB7 A;  1DZT A;  3AYC A;  4XFA A;  1QF3 A;  4BQW A;  4BDV B;  3K46 A;  1HRI 2;  3T2P A;  1VBE 3;  4ZZ5 A;  2XPJ A;  3A23 A;  4LKS A;  4EN0 A;  1DGR N;  3IKW A;  3OGS A;  4AL9 A;  3IDB B;  4CU6 A;  4XUO A;  2ZAB A;  4B1M A;  2DCJ A;  3VBS A;  3RWN A;  2VOW A;  4QKD A;  1RUO A;  5BUV A;  2WRA A;  3I2H A;  4AFM A;  2GND A;  4IGO A;  4BQ3 A;  2IFR A;  4QX1 A;  5FZO B;  3CMG A;  4O65 A;  3KMH A;  4YM1 A;  3ZO0 B;  1YCI A;  4KH9 A;  1AR7 1;  2R04 1;  2HKX A;  5FPU A;  5DZE A;  1QJY 2;  1W9T A;  4FAG A;  4R9B A;  3LDB A;  4I09 A;  2X5I C;  2YU1 A;  4MXW A;  3OY8 A;  3DKW A;  3ROU A;  3SXW A;  1M4W A;  4CDX C;  3MIF A;  4CYD A;  1ZX5 A;  5JOW A;  4B4P A;  2F17 A;  4AVC A;  2W95 A;  3ZFG A;  3HWJ A;  2XG3 A;  4FFG A;  5AVA A;  5FV3 A;  1HRV 3;  5DUU A;  3U11 A;  2D43 A;  4AQT A;  1K5J A;  4N53 B;  5CYY A;  3SEP A;  1T6G C;  1TMF 3;  4YG3 A;  3APB A;  1TZO A;  1WCQ A;  4HBN A;  1RUG 2;  2C9A A;  1D2S A;  2J7M A;  1JYI A;  5GAL A;  2QTW B;  3SEE A;  3W21 A;  4ISQ A;  2WN3 A;  2WN2 A;  1ULO A;  1RMU 1;  2X5I B;  4EN7 B;  5DN2 A;  1IQA A;  5JPM B;  2VW0 A;  3PUQ A;  3IMM A;  3ZYG A;  2CY6 A;  3MID A;  1BEV 3;  3T30 A;  3CO2 A;  3R0R A;  4YVW C;  5FZD A;  2ZGN A;  3A0N A;  3OBR A;  4MET A;  4Q4W 1;  2A75 A;  1WD3 A;  3KHB A;  1UZ0 A;  1A6C A;  1POV 0;  1W0O A;  2ADE A;  5DG2 A;  1ASJ 3;  3ZSM A;  4CCO A;  2YC0 A;  5A6Q A;  1ZRD A;  1S0D A;  2ZEY A;  3N9N A;  3SH3 A;  1Q3E A;  1BK1 A;  1AL2 2;  3VD9 A;  1YXW A;  2PA7 A;  2Y0I A;  3ZXK A;  2WNO A;  2BUK A;  3PTY A;  5F3G A;  4NRM A;  5EXO A;  1JZ4 A;  4FPF A;  4LA2 A;  3POS A;  2NYY A;  3POI A;  4Z1V A;  4XMA A;  4I0A A;  3DL3 A;  3TOJ A;  2JEN A;  4RQP C;  5LA1 A;  2WO1 A;  3VLB B;  2P37 A;  2YC4 A;  1EV1 2;  1X33 A;  3A22 A;  2VZ1 A;  2JKX A;  1WLW A;  2ZHL A;  1LTE A;  2RMU 3;  2ZKL A;  4L92 A;  5DZF A;  1LGC A;  1CON A;  1FPN 1;  1UYZ A;  3VDD A;  1AXY A;  3K4D A;  1XOY A;  1RC6 A;  3E1F 1;  2IZW A;  2E32 A;  4IE0 A;  4CU8 A;  2W1S A;  3I2G A;  3Q8B A;  1GV9 A;  1O4Z A;  1EY2 A;  4A41 A;  1G9A A;  2DU1 A;  3NV4 A;  2ZX1 A;  4L0P A;  1DDL A;  3UET A;  2XDV A;  4FOQ A;  4BK4 A;  3VL8 A;  1PO2 2;  5FCC A;  4AXO A;  1PMI A;  2DUQ A;  3WOG A;  2L9L A;  1WCD J;  1XRU A;  5J37 A;  1QHD A;  3NW4 A;  2R07 1;  1NCQ C;  3WG3 A;  3LA3 A;  3FHI B;  2BVV A;  5E16 A;  1ALY A;  1D4M 1;  1GNY A;  1DHK B;  2XL9 A;  4AI1 A;  3FUO A;  3P3P A;  3PVB B;  2Q8O A;  3Q9O A;  1VAM A;  1O6U A;  4MGQ A;  2HWE 2;  1TEI A;  3POW A;  3LA2 A;  4BE3 A;  3I2O A;  1OF3 A;  2VU9 A;  1CD3 G;  2EID A;  2RR1 2;  3ILN A;  4DIN B;  5C9A A;  3LEG A;  3LF7 A;  3H1Y A;  1SLC A;  4YW2 A;  1FI2 A;  4AF9 A;  3WG4 A;  1W6Q A;  4YLZ A;  2QJV A;  3N7J A;  2WSV A;  2AUY A;  4CUB A;  1HJF A;  1MPX A;  2VW2 A;  4JCK A;  3O1R A;  5CFD A;  2IXC A;  1J3R A;  2WYS A;  4ZU4 A;  3KCY A;  2XJV A;  2Y6H A;  4JGZ A;  2VOX A;  2GNB A;  2Y60 A;  3IDA A;  5IVB A;  2AC1 A;  2YGM A;  5I8Y A;  1H1A A;  1UMH A;  5DAP A;  2QUO A;  1GOG A;  3J26 N;  2X29 A;  3R4U A;  2VAU A;  2A1X A;  5DAQ A;  1H4G A;  3KT1 A;  3SC7 X;  1RVF 1;  1O3T A;  1SFP A;  1PK6 C;  4EN9 B;  5LA0 A;  1LAJ A;  5C4W A;  4B4R A;  3MW4 A;  2WL1 A;  4A42 A;  5IT6 A;  4ES9 A;  1MS5 A;  3M3C A;  1U5I A;  3VBF B;  4OHX A;  1X9P A;  2HEV F;  4QU2 A;  1OF4 A;  5FK7 A;  1KXG A;  1Q8O A;  2QQI A;  3ME2 A;  3ECQ A;  3TEZ A;  1B35 A;  1OLM E;  2ZGU A;  2PHU A;  1S0F A;  4XE9 A;  4IV1 C;  2Y6F A;  3U14 A;  5E6H A;  1LU1 A;  3AP4 A;  1VRH 2;  3MYX A;  3WNX A;  3D6E A;  3JQX A;  3A4U A;  4P08 A;  3WP6 A;  3JBG 3;  4UFM A;  3DF0 A;  1QNW A;  3Q8E A;  4AHX A;  5JMO A;  3ABZ A;  1R1Z A;  1JYW A;  2ZA9 A;  2ZCW A;  1DYK A;  4GWI A;  2WIN B;  1UOJ A;  1W8O A;  2GC3 A;  2ZZJ A;  3WX5 A;  1DQ5 A;  4Y20 A;  1PK6 B;  5K0U A;  4BB3 A;  5GLZ A;  1U0A A;  4QPW A;  3WF0 A;  4YZ3 A;  1VBA 2;  4HAN A;  4X8N A;  4LA3 A;  4I30 A;  4RL7 A;  3ZXD A;  3N9O A;  2BZD A;  4TLG A;  3S6P A;  3VBR A;  4PDW B;  5KXE A;  4LHS A;  5FPV A;  2JDY A;  1PIV 3;  3ZYH A;  3TBD A;  1HXS 1;  4IEZ A;  1AR8 1;  1QXP A;  3W5N A;  4JV4 A;  1NCR B;  1R09 1;  4N8M A;  1MEC 3;  5FIX A;  4S2H A;  4MLO A;  5JVV A;  3FBY A;  4CZS A;  4QQO A;  5JMC A;  1GFF 2;  4RD7 A;  4AWD A;  4UW4 A;  2P3I A;  4RHV 2;  1LOG A;  1I5P A;  1J3Q A;  2VEC A;  2WWS A;  5FRE A;  3UT0 A;  5FZH A;  5AC9 3;  4XYX A;  1W6P B;  2OPW A;  4CDW A;  4AGV A;  3ZFE A;  1JBC A;  3KZ4 C;  5FZA A;  5LK7 B;  3RGB A;  2D6K A;  4CDQ C;  2Y38 A;  3H3Z A;  5FZI A;  1YYN A;  3O1M A;  4V1P A;  1VBE 2;  4AK3 A;  1K12 A;  3NNM A;  3VDC A;  4RS5 B;  4Y26 A;  2TNF A;  2HLE A;  1X9T A;  1SMV A;  3W5M A;  3KVB A;  3MGU A;  4PBO A;  4K9S A;  2A71 A;  5GLV A;  4HT1 T;  3FLP A;  5FY1 A;  1YEW A;  4I02 A;  2D6M A;  3AZV A;  4I3G A;  4BYY A;  3PJY A;  4QAW A;  3KHC A;  4KBZ A;  4CP0 A;  3ACI A;  3K2O A;  1X8E A;  1BKZ A;  3RYK A;  4AAX A;  4CEY B;  3O0V A;  5EYX A;  2GN3 A;  1OD5 A;  2TEP A;  4GWN A;  4XF3 A;  5D8A C;  2D3P A;  1JZ3 A;  3K3N A;  3AP7 A;  2VCC A;  1K42 A;  2CGN A;  4L2N A;  1E5R A;  4JKK A;  2WDB A;  1O3Q A;  5HCA A;  4LBO A;  1MQT B;  4FPJ A;  2QQO A;  3ES1 A;  2PXJ A;  3RI8 A;  1IPJ A;  1BHG A;  2KM2 A;  1U5Y A;  4FVV A;  2D3R A;  1N1S A;  2V09 A;  1R08 1;  3O0W A;  2WWJ A;  4OZX A;  3H8O A;  5CG8 A;  4N43 B;  1YNA A;  3IMN A;  3ZN6 A;  1S2K A;  1US2 A;  2B45 X;  3TEW A;  5C6C A;  1TMF 2;  4BOW A;  1RUN A;  4KBB A;  1Y3T A;  2JE9 A;  4FO9 A;  1WW5 A;  3MPB A;  3H3L A;  4H2A A;  4LOT A;  3IM0 A;  5ERL A;  5FQ0 A;  5IFP A;  2BQP A;  3RI9 A;  1WME A;  4GB3 1;  3WZ1 A;  3IN9 A;  1VR3 A;  5CAD A;  3C7G A;  4JKM A;  1GWK A;  4QGM A;  4AI0 A;  2PHF A;  2BW8 A;  1BEV 2;  1RUJ 1;  2ZGL A;  4HPK B;  1YI7 A;  5BNP B;  4P00 B;  4M0H A;  4GJY A;  1RUC 3;  4FPH A;  3OGG A;  2GH8 A;  3E6B A;  4DEV A;  4I2O A;  1OLM A;  4LK6 A;  2WII B;  2V5D A;  3QH7 A;  4J1X A;  3UK9 A;  4GKY A;  1C8N A;  1O5L A;  1OMI A;  1VRB A;  1XYN A;  4WBB A;  4WVZ A;  1XSR A;  3VZL A;  1XNB A;  5BNQ A;  3V65 A;  3DYO A;  4Q4Y 2;  3VKL A;  3HPN A;  5SV8 A;  1LGB A;  3RYR A;  3WV6 A;  1VBC 3;  4XFC A;  2AR6 A;  3H8U A;  3WQ1 A;  2WS9 3;  1CGP A;  5EFU A;  5L9B A;  1AYN 3;  1AL0 G;  1F9K A;  1RJ8 A;  4OUL A;  1X82 A;  2JG9 C;  4XPV A;  3H8R A;  1QOT A;  4MG2 A;  4IV3 C;  3DGT A;  1O4T A;  4CSW A;  2HWF 3;  4FOW A;  2R06 1;  2RMU 2;  4AFA A;  2XWJ B;  4XUP A;  1XXN A;  3ZYP A;  5LA9 A;  4JGY A;  1C1L A;  1CAU A;  1GIC A;  1NZI A;  1UYY A;  4WV8 A;  4BLJ A;  3CBN A;  4AVS A;  1HN1 A;  1NLR A;  2ZEZ A;  3N7K A;  4QDS A;  1C8M 3;  1CES A;  5LY1 A;  3M3E A;  4KWK A;  4EZ4 A;  3VBU A;  2YC2 A;  2PHR A;  1W8W A;  3WF3 A;  5JR2 A;  2JEM A;  4JVA A;  3ZXF A;  3NQH A;  1NG0 A;  2OS2 A;  4AGR A;  1VBB 1;  1NQJ A;  5F8P A;  3PDQ A;  2W0X A;  3WDT A;  5HXM A;  1LED A;  2F6B A;  2Z5W A;  4IV3 B;  3WVJ A;  4ZKT B;  3GZU C;  4CVU A;  4EWD A;  2YMZ A;  5FOJ B;  5BNO A;  1DP0 A;  3HQR A;  2XH6 A;  5B2G B;  3DCQ A;  5FWJ A;  4COV A;  2JDZ A;  4ZY9 A;  5ABJ B;  4BU2 A;  4LBQ A;  3WIN E;  1VMH A;  4PT6 A;  1RXF A;  4RSU A;  3HNY M;  4YW5 A;  4QKF A;  4URT A;  5FYM A;  2JB4 A;  2HEW F;  1Y4W A;  5KC6 A;  2ARB A;  2EXH A;  1AVB A;  1V6I A;  2Q30 A;  1QGL A;  1IPS A;  2LS6 A;  2IWG B;  3WNK A;  3BOP A;  5A1F A;  2DCZ A;  3HEI A;  3QAC A;  4E9K A;  5KHI A;  5FMO S;  5FMC A;  2PAM A;  3VBH A;  3WNN A;  4CCK A;  1HN0 A;  3BTZ A;  5FPL A;  4JQT A;  1QJE A;  3VDA A;  1UU5 A;  1BJQ A;  1BBT 1;  1YQ5 A;  3ZN4 A;  5A3P A;  4I01 A;  4K40 A;  1W2A X;  1VBD 3;  2NQY A;  2WNV B;  1ZA7 A;  5F3I A;  3EXU A;  4MGI E;  2J42 A;  2Y34 A;  3J8F 1;  1DLC A;  1AX1 A;  1OQE A;  3KD4 A;  2ZMK A;  2VM9 A;  4PF1 A;  1I9R A;  1QWR A;  5L7O A;  2JDP A;  4Y4Y A;  2J22 A;  4MO3 M;  2W08 A;  2ENR A;  3SNM A;  1L7L A;  4LO5 B;  3VZM A;  5JAX A;  1ULP A;  3D8C A;  3GDB A;  5LB6 A;  1UL9 A;  2Q1F A;  4YAR A;  3NJZ A;  2QQK A;  5DAV A;  3MFC A;  3GCX A;  2Q4S A;  3POG A;  4M3C E;  2K2S A;  4DUV A;  4U2A A;  1K5M A;  4Q4V 3;  1FXZ A;  2QNK A;  3I59 A;  3ZXA C;  1W2N A;  1UW8 A;  4YFW A;  3CZJ A;  4B4Q A;  3GHM A;  1CZS A;  2WA3 A;  2BNN A;  2PAE A;  3WR0 A;  2R04 2;  3JCI A;  4QMA A;  2VO5 A;  4WM7 A;  1JYC A;  3D0S A;  2HWB 1;  3HNB M;  3N9Q A;  3RG0 A;  4OI1 A;  1O3R A;  5LWB A;  2W92 A;  3HBK A;  1ZRI A;  3LDR A;  3ILF A;  4XFG A;  3LKJ A;  3OBT A;  3POY A;  2PN5 A;  1JI6 A;  2IC1 A;  5L9V A;  1KGY A;  3VV1 A;  1O3S A;  1RJ7 A;  3SCH A;  2E53 A;  2JDH A;  4HVR A;  3SIS A;  3WP4 A;  4D6Q A;  5C3Q A;  1Q8Q A;  5J1X A;  3NJY A;  5DAB A;  1FAY A;  1ND2 C;  3I3B A;  3KSC A;  2GN7 A;  2XLA A;  2YB7 A;  3AX4 A;  2GAL A;  3VHO A;  1QH7 A;  3AP6 A;  3IPV B;  4UXA A;  2JX9 A;  3J7M A;  4X8P A;  1UQX A;  3AZZ A;  4GAZ A;  1Q5O A;  5DG1 A;  3EHK A;  1YLL A;  4XTP A;  2MPF A;  2UY8 A;  2VNV A;  5FYH A;  1DIW A;  3PIG A;  4MSV A;  4P5H A;  2B42 B;  4LO8 A;  3NJX A;  5T5L A;  2WT0 A;  4LMF A;  4HET A;  4CCL A;  4AG4 A;  4E8C A;  2QDR A;  4XQW A;  5EWS A;  3HVD A;  2EIC A;  4FI9 A;  3WF2 A;  3LPG A;  5IJR A;  3T3Y A;  2J1T A;  3AYE A;  3OYW B;  1TME 1;  4Q4W 2;  4YZ2 A;  5HBA A;  1ND2 B;  2WNU C;  4BIF A;  4CDU A;  4NOT A;  3OB8 A;  1AUY A;  1W9F A;  1W8H A;  2OUH A;  3E5X A;  5A7O A;  4DXZ A;  5KHG A;  2R1D A;  2RVA A;  1OC1 A;  3ZYI B;  4AHY A;  4E4H A;  5CA6 A;  4Y4R A;  3U10 A;  3NNG A;  3L9J T;  1AX0 A;  1EYB A;  4DXR A;  5JXJ A;  4L11 A;  3O0X A;  2KXL A;  4XZU G;  4QQL A;  3BKZ A;  1L7Q A;  3HQU A;  2RG4 A;  4Y33 A;  5E1R A;  4A4A A;  3ZN5 A;  3WDV A;  4GH4 B;  2WZE A;  4BA6 A;  2WNU B;  3OPT A;  1UMZ A;  1GAN A;  5ANN A;  2RS1 3;  2XBO 3;  1QY4 A;  3OEB A;  2EAK A;  2VD7 A;  2MNG A;  5IVF A;  3O12 A;  2GP3 A;  3TN9 1;  2NM1 A;  4YGD A;  1PO1 3;  2QQN A;  4RR3 A;  2YY1 A;  2WFF 2;  1QJU 1;  1BVV A;  2D6N A;  3KV4 A;  5BNN A;  4P14 A;  1C28 A;  4OCT A;  1C5H A;  4X6R B;  3R4S A;  1WCU A;  4XJ8 A;  1WLT A;  3N35 A;  4XCB A;  1COV 3;  1WW7 A;  3AL5 A;  1LUL A;  1QOS A;  1FV2 A;  3N3H A;  5FFO C;  3WG1 A;  1N1T A;  1ZBE 1;  3KCX A;  3AVR A;  4CRQ A;  4LR4 A;  4QXB A;  2LAL A;  4OHW A;  4XAB A;  2QQM A;  4IUG A;  3OGJ A;  1D4M 2;  1G6N A;  2AAC A;  4XF0 A;  3DN7 A;  4JX0 A;  1O7F A;  2EAL A;  3MV1 1;  2JDU A;  1U5X A;  4NHY A;  2QQU A;  2ZHK A;  1KDK A;  4AYU A;  2HWD 1;  1KIT A;  5EHD A;  3AFK A;  2DUP A;  2VZ3 A;  4M3C A;  1XU1 A;  5I93 A;  1WKY A;  3UJO A;  3B94 A;  3GCW A;  4DFS A;  3RPQ A;  2CNA A;  4H7M A;  3S5A A;  2JIC A;  4XUR A;  3IT8 A;  2CYF A;  4QD2 A;  3WQ0 A;  5C8C C;  3A21 A;  3CLP A;  2EVX A;  4Q0P A;  5EZW A;  4AI9 A;  1IS6 A;  4ORF A;  5F6K A;  5F1R A;  2DBN A;  1OD3 A;  4FPE A;  2EA7 A;  1VBC 2;  4UWD A;  5JDB A;  4V2V A;  1G9C A;  1O5U A;  2WS9 2;  4HK8 A;  2VVD A;  1XJA A;  4K6B A;  4UW3 A;  4JDO A;  3DEM A;  5GZD A;  1UNB A;  3BYW A;  2JG8 B;  4AED A;  4XIO A;  5JZG C;  1UOB A;  2GMM A;  2HWE 3;  3AMH A;  2HWF 2;  3PVN A;  1RVF 2;  2EAA A;  1LEC A;  1UY4 A;  1QOO A;  2RR1 3;  3KV9 A;  3ZX7 A;  5JCT A;  4Q2F A;  1APN A;  2BPA 2;  1NKG A;  1YI9 A;  2CL2 A;  2XQX A;  1C8M 2;  1J58 A;  5HCF A;  3WCS A;  5JXG A;  1HQN A;  3DPR B;  5D2A A;  2Q8C A;  3LFI A;  2F4L A;  3PVE A;  4NHX A;  5CIS A;  3MIE A;  4KMQ A;  5A7N A;  4Y5T A;  4AR2 A;  1FOD 1;  1YO8 A;  3FN9 A;  3LQC A;  3NAP A;  2DV9 A;  1LR5 A;  5FLH A;  3ELN A;  3I54 A;  5AFB A;  4IEQ A;  1PZ8 A;  3OPZ A;  3CJI A;  3MO4 A;  4LPL A;  3RJ2 X;  2VCB A;  3UGG A;  3THT A;  1BMV 2;  3M1H A;  4NAO A;  1QNY A;  3EBR A;  3MIB A;  3E5U A;  3HOB A;  3PUR A;  4ZXE A;  4NPL A;  4JHZ A;  4YW1 A;  4AHZ A;  4HSL A;  2HWC 3;  2BFU L;  5A3U A;  1YUD A;  3V0B B;  3M3I A;  2OA2 A;  4FXK B;  4NRQ A;  3ZYR A;  4AVA A;  4CXY A;  1TNR A;  2Y6K A;  1DZQ A;  3AC0 A;  2IVI B;  1ND3 B;  4LBQ D;  5IWF A;  1HXS 2;  1AR8 2;  5F5Q A;  1XBF A;  1VRH 3;  4CCM A;  1GBG A;  1R09 2;  4FXG B;  3LB9 A;  1IOA A;  1UX6 A;  4BWO A;  1LHV A;  2PTM A;  3CEW A;  5FZO A;  4N9H A;  3CZU A;  4NHK A;  2QE3 A;  4Y5Z 0;  1JYN A;  4KI5 M;  5DQ0 A;  1HB1 A;  3NV1 A;  4R8H A;  3U75 A;  1LCL A;  4LQR A;  3MV0 1;  4PI0 A;  2FDF A;  1UXX X;  4E2Q A;  3LEI A;  4R9C A;  2UU8 A;  2YU2 A;  2PHW A;  3T0D A;  1QIQ A;  5KHK A;  4WVM B;  1AXZ A;  3ZXE A;  5FUP A;  2ZAH A;  5K7P A;  1W8Z A;  3G6J B;  4LXL A;  4HZF A;  5JSP A;  2NMO A;  4FT8 A;  3UYJ A;  4FP3 A;  2JDN A;  1W05 A;  4D0Q A;  1MZ6 A;  2DVD A;  4YG0 A;  2QQP A;  3KV5 A;  3KGL A;  4HXC A;  4N53 A;  1J1T A;  1LJ7 A;  1YQ2 A;  4AI2 A;  2ZPX A;  2VBD A;  2ZGO A;  3HN1 A;  1IZ3 A;  4XHB A;  1E5H A;  3D82 A;  4IEY A;  3S0M A;  4RGK A;  4WM8 C;  2HBU A;  3ETQ A;  1V00 A;  1JU4 A;  4MH0 E;  2PMW B;  3FFQ A;  4Y1Y A;  3T0B A;  2FDH A;  1WBL A;  4LUM A;  1H2M A;  1OSG A;  2OW4 A;  2CDO A;  2WJS A;  4MOA A;  2CDP A;  1UZW A;  4Q8L A;  1MVQ A;  3VBO C;  5FY0 A;  5IVJ A;  4ZXK A;  2Y33 A;  5IK5 A;  4NJ4 A;  1MS9 A;  2GC2 A;  1PGL 1;  2VW1 A;  2IXK A;  1KJR A;  4HK9 A;  1SLA A;  3RMX A;  3WP5 A;  3CF6 E;  1WA4 A;  2BBA A;  1W0N A;  4WM8 B;  3T0A A;  4BM8 A;  3HIF A;  4K8F A;  4CEW C;  1OOP C;  4A6O A;  1SG3 A;  4E8D A;  2C0Z A;  1EPZ A;  4ES8 A;  1OUR A;  3O1U A;  2NP0 A;  1IPK A;  2FDG A;  5FXX A;  4MV2 A;  3ZKY A;  4C0B A;  2E63 A;  3PVO A;  1UKG A;  2VPV A;  1R1A 1;  3OBA A;  3LPF A;  2HYX A;  3AZW A;  1H30 A;  2WKK A;  1DBN A;  5J36 A;  1K45 A;  2ET1 A;  2WAA A;  2BEO A;  1W3X A;  3FUQ A;  4GIQ A;  2QVS B;  4Y1Z A;  1UY1 A;  4FFF A;  4DNY A;  4OVE A;  2XL7 A;  1OOP B;  1OH3 A;  2DCY A;  2VME A;  3WQB A;  1V9U 1;  1JOJ A;  4JTN A;  4NAM A;  1RB8 G;  1ENS A;  1PVX A;  1F4H A;  4CA9 A;  1TVG A;  3JD7 2;  4CCE A;  4CPB D;  4KL1 A;  2FCU A;  1WGP A;  1BVP 1;  3FBM A;  4Y3O A;  3WY6 A;  1H9W A;  5IW0 A;  4DY3 A;  4DB5 A;  3C2U A;  2D6P A;  4PI2 A;  1GP6 A;  4QXH A;  5E8A A;  4CDX B;  4P9Y A;  5KR7 A;  3QBQ A;  1XYO A;  3OPW A;  1G8W A;  4HL0 A;  5F5I A;  1V6J A;  2R06 2;  5GLT A;  5FZ3 A;  2PLV 1;  3HAG A;  1CQ9 A;  2ZX3 A;  3FZ3 A;  4FPL A;  2RS1 2;  2XBO 2;  5FY8 A;  5IAV A;  3ZYF A;  3VBS C;  3TAY A;  4OQ8 A;  1PO1 2;  1RUF 1;  1ZBA 1;  2IVJ A;  1EAH 3;  2VH9 A;  4COZ A;  4DOU A;  3RYP A;  4ET7 A;  2QCS B;  4XC9 A;  4XUN A;  2Z42 A;  4DIQ A;  3T4H B;  1RUD 3;  5I0T A;  4Q4Y 3;  4XBQ A;  2BOJ A;  4DXT A;  1W9S A;  2DCK A;  1AYM 1;  3KB5 A;  2YBS A;  2LTN A;  1FNY A;  2ORZ A;  2YV8 A;  4GUL A;  3VL9 A;  1COV 2;  2A3X A;  2Y26 A;  4YVW B;  5FZ1 A;  5FY5 A;  1WLD A;  3KF5 A;  4XJZ A;  4ERO A;  1O59 A;  5FPZ A;  2EIE A;  3S5Q A;  3PU3 A;  3RZM A;  3RS6 A;  5A3O A;  3BU0 A;  1CIY A;  2HJI A;  5A7S A;  5LW9 A;  4TTG A;  2SLI A;  2ORX A;  3ZFG C;  1ZRC A;  2GC0 A;  4MAD A;  4MYE A;  2OX0 A;  4UT5 A;  5JIA A;  4DPN A;  2VZV A;  3RJR A;  1RUE 1;  1SLI A;  1UMI A;  4JDN A;  4F83 A;  3VBF A;  4ZON A;  5C7G A;  3ZMN A;  4QB2 A;  4QPI A;  3EMR A;  1Z7S 1;  1ULC A;  3E6D A;  3RVH A;  4QWN A;  1JW6 A;  2XJQ A;  5EJZ B;  1NE4 A;  1UZZ A;  2QZ2 A;  4RQP B;  3USU A;  5GLW A;  5LK5 A;  1LGN A;  4LBN A;  3J9S A;  4AI8 A;  3USS A;  1PX3 A;  2GC1 A;  5FZE A;  3VGI A;  1OQD A;  4L97 A;  5CAZ A;  2Q1M A;  1BBT 2;  1F2N A;  1ULD A;  3SKJ E;  4LIT A;  1WCK A;  3D4K A;  2XUM A;  5TSW A;  1UOF A;  4IQP A;  1PK6 A;  3NKT A;  1CAW B;  1JUH A;  1RHI 1;  5JR7 B;  3PJQ A;  3J8F 2;  2Z4F A;  3BUC A;  4YW3 A;  3DUI A;  3OBZ A;  1HDK A;  3I2F A;  4JAA A;  5A3M A;  3POF A;  5K9Y A;  2C4X A;  4XJW A;  1RUI 1;  3ZFF A;  1JUI A;  4PDW A;  3BTX A;  4YWA A;  1UF2 C;  2ZGQ A;  5IVY A;  5IAX A;  4CP9 A;  5GJ6 A;  4FFI A;  4YVS A;  1NCQ B;  1RUH 1;  2CTV A;  4Q4X 1;  3JB4 C;  1AR6 3;  1NCR A;  1OPM A;  2UY9 A;  3UJQ A;  3B93 A;  3KQR A;  3ZIW A;  5DMY A;  5DAX A;  3GZE A;  2ARC A;  5FZL A;  3NRU A;  1POQ A;  3PTR B;  1H9P A;  3BPS A;  4BCU A;  3VDD C;  3L2Y A;  1CAV B;  2JXA A;  5F9T A;  2P6C A;  1ZRR A;  1FYU A;  2BYV E;  5DDJ 1;  5IHR A;  5FZB A;  2A6Y A;  2HWC 2;  2WC2 A;  5FLI A;  2CU5 A;  1W6M A;  1OBN A;  2VTX J;  2X10 A;  2DF7 A;  3MLK A;  4RS5 A;  2VUJ A;  4XFH A;  4ZU5 A;  1IS5 A;  3HJR A;  4XQ4 A;  1AR9 1;  3FLR A;  2QFE A;  2HEY F;  1C4R A;  2C1F A;  4IER A;  4BJ0 A;  4F3J A;  1PVC 1;  2WO7 A;  2DVF A;  4YW4 A;  2B8M A;  3O1S A;  1GOH A;  4FPO B;  1AR7 3;  2R04 3;  3VDD B;  4XJU A;  1UX7 A;  3LD8 A;  4OZO A;  4CU7 A;  1DLL A;  4EQV A;  4CEY A;  5BYN A;  1VAL A;  4QHZ A;  2YZ4 A;  2VUA A;  2K9Z A;  3BB6 A;  3ZYJ B;  1US3 A;  4B7E A;  5ACA 2;  3AYA A;  4YGB A;  5FYS A;  3FFZ A;  1JHN A;  1GZW A;  4HG6 B;  5AVP A;  5FYV A;  5I91 A;  4OI0 A;  4D6S A;  2OVU A;  2VOT A;  4E2S A;  5C9A C;  2RS3 1;  1OUX A;  3QOP A;  3B00 A;  1MQT A;  4WVV A;  3I2K A;  5JLV A;  2GP5 A;  1MZE A;  4ASK A;  1TME 2;  2WQZ C;  4IV1 B;  4BME A;  3WDW A;  3WP3 A;  2R1B A;  2VUD A;  4P9G A;  4IEV A;  4OHZ A;  1STM A;  1NXD 1;  5CFD C;  4N43 A;  2Y0O A;  4JGZ C;  1AX2 A;  5FO7 B;  1YQC A;  2E6V A;  2FQP A;  2DVA A;  4IGP A;  4P9J A;  3IDE A;  1V6K A;  4NHM A;  2BNM A;  1F8V A;  2VGD A;  3TWI A;  1HLC A;  3U78 A;  3M4F A;  1CVN A;  3SMH A;  3S7I A;  1C5I A;  1PNF A;  1RMU 3;  5DUV A;  1JHJ A;  4ATF A;  4ASM B;  1X36 A;  2XUE A;  3I97 A;  1PM4 A;  5C4W C;  4HLT A;  4KG0 A;  1E57 A;  3GF6 A;  1OLR A;  5F3E A;  2VZP A;  5GKA C;  4Q4W 3;  3N9M A;  3KCC A;  4HPK A;  2ZGM A;  5BNP A;  2Z69 A;  5CFD B;  4UBH A;  3MF9 A;  4QGL A;  5E88 A;  4BQ2 A;  4W6X A;  3TN9 2;  5JOY A;  3BOD A;  1B35 C;  1UKR A;  1HKD A;  1RIN A;  2GZW A;  3ZSJ A;  3QCW A;  3I2D A;  5A1A A;  3AFG A;  2VZO A;  3OUJ A;  4I3P A;  4FQ4 A;  1MS4 A;  2JWP A;  4NN0 A;  3LGR A;  4AGG A;  3RZL A;  4OUM A;  1QJZ A;  4ASL A;  5K0U C;  4KNC A;  1QQP 1;  1ZBE 2;  2LRP A;  1WUV A;  4CDQ B;  5HPO A;  4GMP 1;  2BRT A;  4UOJ A;  3V56 A;  4PF5 A;  2Z2S B;  4AE2 A;  2XLG A;  3X29 B;  1GU3 A;  1OI6 A;  3VBR C;  4GD4 A;  2ZTN A;  1LHW A;  1QJF A;  4QKB A;  1B35 B;  5I8S A;  4YW6 A;  2RS5 1;  1R64 A;  4XF9 A;  2WFF 3;  2ZX4 A;  4YNI A;  4B3N A;  3O1T A;  2JJ6 A;  4XIK A;  4AEK A;  1I1E A;  2MEV 1;  5GZF A;  5JIU A;  3PME A;  1V6L A;  2W1W A;  2YBK A;  3AKS A;  4AEM A;  4G9S B;  5D8A B;  2OQ6 A;  3UKV A;  3VKN A;  3AK0 A;  1HX6 A;  5A1L A;  1L7R A;  1J3P A;  4XMI A;  1KJL A;  4Q5O A;  3T08 A;  3VKM A;  3T1L A;  3WW1 A;  4EYU A;  1HRI 1;  4XFB A;  4CDW C;  1D4M 3;  2WQ4 A;  1H1I A;  4Q29 A;  4XFI A;  2FZ1 A;  3ZFE C;  1JZ5 A;  2VR4 A;  2ARE A;  1IHM A;  4LIU A;  1P8J A;  1UN1 A;  3HD8 B;  4UFJ A;  4NWV A;  5FBZ A;  5T52 A;  1RYY A;  3ACL A;  4PHZ A;  5A7W B;  1IG0 A;  3ZDS A;  3I3Q A;  3WUD A;  3BOW A;  1ZZC A;  3I2I A;  4FPG A;  5ABJ A;  1KQR A;  4BXF A;  1FMD 1;  1S0G A;  4XBN A;  4YM2 A;  3GBW A;  4OLL A;  5KHJ A;  5G05 L;  4C1X A;  1H2N A;  2YFZ A;  4AVT A;  5HCH A;  1K3I A;  1UAI A;  2XHN A;  1EAH 2;  1RED A;  1MZF A;  2B4K A;  5F2W A;  1RL3 A;  2ARX A;  3F2Z A;  1QJY 1;  3SCG A;  1RUD 2;  3T2Q A;  4D7S A;  2E51 A;  1RTV A;  1RGS A;  3ASI A;  3BTA A;  2ZX2 A;  5JUV A;  4JQR A;  1S0E A;  1U5Z A;  1X50 A;  1IQD C;  1J59 A;  1SPP B;  4H14 A;  2Y64 A;  3LSD A;  3CKH A;  3VN4 A;  4H3W A;  1W99 A;  1ZA4 A;  2AEN A;  3DV8 A;  1QJX 2;  3JUU A;  5EJ3 A;  2WNV A;  5EQU A;  1RVF 3;  2J1A A;  1DCS A;  2TUN A;  4EV0 A;  5FMO L;  1UCX A;  2FBE A;  4A6S A;  3ZSK A;  1LHO A;  4AQS A;  5LAS A;  3WQ7 A;  4Q8K A;  4I0W B;  2RDN A;  5FY9 A;  1RUG 1;  3AVS A;  4HVQ A;  4JKL A;  1Q8V A;  5CEH A;  4CP1 A;  2LW8 A;  4OHY A;  5L73 A;  4IE6 A;  5A70 A;  4XQD A;  3VZN A;  4W65 A;  3GJB A;  4XDP A;  3AMM A;  2ATF A;  5KHH A;  1FT9 A;  3H8X A;  2JG9 B;  4LE3 A;  3RMY A;  2VVF A;  2P3J A;  4AFC A;  1JTZ X;  5FP8 A;  1XQN A;  3GAL A;  1W8U A;  4ZS2 A;  5I8T A;  4FOY A;  3I7D A;  5T50 A;  4ZZ8 A;  1XNT A;  4IND A;  4NUB A;  5L36 A;  4COW A;  3MIC A;  1HB2 A;  5GLU A;  1S1A A;  4A3X A;  3K51 A;  1OVS A;  1KS5 A;  4DQA A;  3GHN A;  1AL2 1;  3ZN6 B;  4K20 A;  1UZY A;  1GQH A;  3MEP A;  3F95 A;  4CCJ A;  4B1L A;  1JZ7 A;  4E27 A;  4LHL A;  1HXS 3;  4FCA A;  4GKX A;  1AR8 3;  2QQL A;  2WA4 A;  3C7H A;  4D94 A;  1R09 3;  4WZF A;  5A33 B;  4NIG A;  1KD7 A;  1EV1 1;  1DQ1 A;  1GNH A;  2XQR A;  1AR6 2;  3TB0 A;  3M3O A;  3Q8C A;  2EXK A;  2VY0 A;  2W52 A;  3IPV A;  5F3C A;  3VD3 A;  4QPG A;  1NA1 A;  4LK7 A;  3MUZ 1;  4HKL A;  5FZ9 A;  4HVO A;  3M8L A;  5E89 A;  4A44 A;  3MLJ A;  5JOZ A;  4TWT A;  2D6O X;  5EPA A;  1G9D A;  2P5B A;  3BVC A;  1DGW A;  4DUX A;  4JGY C;  2BOI A;  2NMN A;  1ODM A;  2WFP A;  3DYP A;  3Q8A A;  4M0N A;  5AFE A;  3PMS A;  1ZZ6 A;  1PMH X;  5FMB A;  1T6B X;  1PO2 1;  2A3Y A;  1WLC A;  4IE4 A;  4LEJ A;  5A3N A;  3RWK X;  3UKT A;  3SLI A;  3VBU C;  2E7Q A;  2VE1 A;  4SLI A;  1JOB A;  1BK0 A;  3LOI A;  3LCP A;  4AW7 A;  4DZG A;  1POV 1;  4IEP A;  1LKN A;  2IUW A;  2WSU A;  4CTE A;  2WAB A;  5FP9 A;  2EXJ A;  4E4Z A;  2PAK A;  1KS4 A;  2HH9 A;  3IDC B;  5FYC A;  3SQO A;  2WZR 1;  1LOA A;  4BQX A;  5CFC A;  2E33 A;  4ONU A;  4NIA A;  1E5I A;  2YDE A;  5BNO C;  1AR7 2;  1MAC A;  5FZC A;  1CAU B;  1KFU L;  4Q1P A;  1XNA A;  3BN6 A;  4Z2W A;  3VZO A;  4A2U A;  5HCB A;  1OH4 A;  2C26 A;  3ZYB A;  3EO6 A;  2JE7 A;  4Z82 A;  1G9F A;  2UWA A;  1WA6 X;  2DFC A;  4GH4 A;  4M3C F;  2ZKN A;  1YHF A;  1M06 G;  4GA9 A;  3ZSL A;  1PHM A;  2O8O A;  1W6O B;  2FCV A;  2VNR A;  1N47 A;  3IZO A;  4PIZ A;  1ENX A;  1R08 3;  2QQV A;  2WWU A;  4KU7 A;  4MVT A;  4FPC A;  4PLM A;  3T2T A;  1W3V A;  1Y9Q A;  2BGO A;  3UL2 A;  3VBH C;  3ZDV A;  4IW3 A;  3L2H A;  4FQZ A; 
#chains in the Genus database with same CATH homology
 3AC0 A;  3E1F 1;  4CU8 A;  2E32 A;  2W1S A;  3I2G A;  2VZS A;  3ACF A;  4A41 A;  4L0P A;  3UET A;  4BK4 A;  4YPJ A;  3WEZ A;  3CZU A;  1JYN A;  1NX9 A;  2PQS A;  2L9L A;  4KI5 M;  5DQ0 A;  1KEX A;  2J1E A;  3OGR A;  3T2O A;  4LQR A;  3MV0 1;  1UXX X;  1GQP A;  1JZ2 A;  3LEI A;  1GNY A;  2VL4 A;  4XUQ A;  2QBX A;  3T0D A;  4W4Z A;  1H6X A;  4OMD A;  4P02 B;  4KWU A;  4MGQ A;  4OUE A;  2VMD A;  1OF3 A;  2YFU A;  1UY3 A;  2EID A;  3LEG A;  1D7P M;  4D0Q A;  4OMC A;  1YQ2 A;  2W9X A;  3OG2 A;  2VZT A;  3HN3 A;  4CUB A;  1MPX A;  3WSO A;  2WYS A;  4GWJ A;  2Y6H A;  1W9W A;  5LCW L;  3IDA A;  1JU4 A;  3VD7 A;  3OGV A;  1UMH A;  1GOG A;  2RJ2 A;  2ZEX A;  3T0B A;  4D8M A;  3ACG A;  3EYP A;  2CDO A;  5LA0 A;  4MOA A;  2CDP A;  2W5F A;  1PMJ X;  4P5Y A;  3III A;  4A42 A;  1EUU A;  4QB6 A;  3ZM8 A;  3C8X A;  1OF4 A;  2BBA A;  2QQI A;  1W0N A;  3T0A A;  3ECQ A;  4A6O A;  3K4Z A;  1SG3 A;  4E8D A;  2W3J A;  3EB7 A;  3JXS A;  5B4N A;  4P08 A;  5JMO A;  3VDB A;  1JYW A;  1CX1 A;  2ZEW A;  3ABZ A;  1UY0 A;  4GWI A;  3THC A;  3A7Q A;  1W8O A;  3MUY 1;  2ID4 A;  3OBA A;  3LPF A;  2J1S A;  2HYX A;  4QPW A;  4XVH A;  3WF0 A;  4QX0 A;  1K45 A;  2WAA A;  3WQB A;  2BZD A;  1UY1 A;  4LHS A;  3THD A;  2E31 A;  2VME A;  4XUT A;  5LA2 A;  4QX3 A;  1F4H A;  2V72 A;  1TVG A;  3W5N A;  2Y8K A;  2VZQ A;  2VCA A;  4CUA A;  3GM8 A;  1W8N A;  2OKX A;  1CZV A;  1I5P A;  4OYU A;  1JZ8 A;  3GXU A;  4ET7 A;  1K12 A;  3VDC A;  4XUN A;  3UES A;  2HLE A;  3W5M A;  3BGA A;  4DXT A;  1W9S A;  2DCK A;  2VJX A;  2ORZ A;  4QAW A;  3ACI A;  2C9K A;  4A3Z A;  4AAX A;  1O59 A;  1H6Y A;  1LNS A;  2EIE A;  2X09 A;  1J83 A;  5EJ1 B;  1JZ3 A;  2VC9 A;  1CIY A;  2VCC A;  1K42 A;  2VMF A;  4JKK A;  2WDB A;  4TTG A;  2ORX A;  4MAD A;  4ARY A;  2VZV A;  1UMI A;  3WNM A;  2QQO A;  5C7G A;  4QX2 A;  4QB2 A;  1CZT A;  1BHG A;  3NJV A;  5EJZ B;  2V4V A;  1PX3 A;  1US2 A;  2W1Q A;  3SKJ E;  2YG0 A;  1UXZ A;  5C70 A;  2VQT A;  4BXS V;  3P1I A;  5IFP A;  3DYM A;  2Z4F A;  4QB1 A;  2B9V A;  3IAP A;  3C7G A;  1OT5 A;  4JKM A;  1J84 A;  3I2F A;  4QDQ A;  2C4X A;  3IAQ A;  4P00 B;  2Y6L A;  4Z2A A;  4DEV A;  2V5D A;  1JZ6 A;  2VZU A;  5DMY A;  3DYO A;  3HPN A;  3NRU A;  1UY2 A;  2WZ8 A;  2W87 A;  4M4R A;  5IHR A;  2JE8 A;  4XUP A;  2E26 A;  2X10 A;  5JXH A;  1UYY A;  1HN1 A;  3HJR A;  2ZEZ A;  1EUT A;  4M4P A;  4QDS A;  4BJ0 A;  2WUH A;  2YC2 A;  4DUW A;  3WF3 A;  5JR2 A;  1GOH A;  4GZ9 A;  3NQH A;  3FL7 A;  1UX7 A;  4OZO A;  2JD9 A;  5HXM A;  2J1U A;  3DEC A;  1US3 A;  3WNL A;  4CVU A;  4HG6 B;  3I3D A;  1SDD B;  1DP0 A;  2VOT A;  5C71 A;  2QQJ A;  4ZY9 A;  4TXW A;  3I2K A;  4RYD A;  4PT6 A;  1GMM A;  2W1U A;  5B4X A;  3HNY M;  2R7E B;  2J1R A;  2LS6 A;  3WNK A;  3WNP A;  2W91 A;  2VTF A;  3HEI A;  1TG7 A;  4PQQ A;  3WNN A;  3C7O A;  3VDA A;  1JHJ A;  2VQU A;  5F7U A;  3I97 A;  3K75 B;  3CIH A;  3IB3 A;  3GGL A;  2VZP A;  1DLC A;  1SHW B;  2VM9 A;  4PF1 A;  3LE0 A;  5EIY B;  1NUK A;  2J22 A;  4MO3 M;  4CUC A;  1ULP A;  5A1A A;  3GDB A;  4DEQ A;  3K4A A;  2VZO A;  2QQK A;  4A45 A;  3ETP A;  3HNM A;  4DUV A;  1PX4 A;  3CZJ A;  3K77 A;  5HPO A;  1CZS A;  5CZK A;  2Y6J A;  4UOJ A;  2VO5 A;  3ACH A;  3HNB M;  1GU3 A;  4QDR A;  4DXS A;  2W92 A;  3OEA A;  3WF4 A;  4BK5 A;  1O8S A;  1JI6 A;  1R64 A;  1KGY A;  3LEK A;  1UYX A;  2WO2 A;  3U37 A;  5J1X A;  2W1W A;  3D3A A;  3FHQ A;  1L7R A;  3I3B A;  2YB7 A;  2RV9 A;  2X05 A;  3T08 A;  3VD4 A;  3VD5 A;  2BER A;  1JZ5 A;  2VR4 A;  3UNP A;  3J7H A;  1P8J A;  3CDZ B;  1RYY A;  3NJX A;  3I2I A;  2WBK A;  4E8C A;  4AG4 A;  1XPW A;  2EIC A;  4FI9 A;  3WF2 A;  3LPG A;  5IJR A;  2J1T A;  5FUI A;  5G05 L;  4W50 A;  2YFZ A;  1K3I A;  2XHN A;  1XC6 A;  2VMC A;  4UAP A;  2B4K A;  3F2Z A;  4CU7 A;  3T2Q A;  3OB8 A;  1UWW A;  2KD7 A;  5JUV A;  3C7F A;  5G04 L;  2RVA A;  1IQD C;  1F4A A;  2Y64 A;  4CU9 A;  3CKH A;  2W94 A;  1W99 A;  3NNG A;  3SKV A;  4DXR A;  5JXJ A;  4UI9 L;  4XZU G;  2J1A A;  2VZR A;  4RN5 A;  1L7Q A;  4W8J A;  3CQO A;  4A4A A;  1JU3 A;  2WZE A;  3I3E A;  3PUH A;  5JXI A;  3OEB A;  4JKL A;  4BDV B;  3K46 A;  2LW8 A;  2QQN A;  3T2P A;  1JYX A;  3I2J A;  4ZZ5 A;  1GUI A;  3A23 A;  4LKS A;  3OGS A;  4CU6 A;  4XUO A;  2DCJ A;  1T2X A;  3MBW A;  4ZZ8 A;  1XNT A;  3I2H A;  3T09 A;  4QX1 A;  3CMG A;  2QQM A;  5IYY A;  4IUG A;  4JX0 A;  3MV1 1;  2ZXQ A;  2W46 A;  1W9T A;  1JZ7 A;  2JDA A;  2QQL A;  3PUI A;  3C7H A;  2VZ3 A;  2XON A;  2Y6G A;  1WKY A;  1DYO A;  3WNO A;  4XUR A;  1O8P A;  2W95 A;  3VD3 A;  3A21 A;  3MUZ 1;  4A44 A;  5CYY A;  3FHA A;  3SEP A;  1OD3 A;  2DDU A;  4DUX A;  3C7E A;  1WCQ A;  2J7M A;  3DYP A;  3SEE A;  1PMH X;  2WN3 A;  2WN2 A;  1ULO A;  5DN2 A;  2BGP A;  1NAE A;  1UY4 A;  2WQ8 A;  2J1V A;  1NKG A;  2WAB A;  2WO3 A;  2XQX A;  1UZ0 A;  2E33 A;  5JXG A;  3WF1 A;  2ZEY A;  2WAO A;  3VD9 A;  1XNA A;  3BN6 A;  4MGS A;  4KMQ A;  3LQC A;  3FN9 A;  1JZ4 A;  2W47 A;  1OH4 A;  2C26 A;  4ARX A;  1JYV A;  2EIB A;  5IFT A;  3MO4 A;  3P6B A;  4LPL A;  2VCB A;  5LA1 A;  2WO1 A;  5DPN A;  4ZXE A;  2YC4 A;  3HOB A;  4JHZ A;  5I0D A;  3A22 A;  2VZ1 A;  2JKX A;  2BGO A;  1GOF A;  1UYZ A;  2XOM A;  2Y6K A;  3K4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...