5FUIA

Crystal structure of the c-terminal cbm6 of lamc a marine laminarianse from zobellia galactanivorans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
NTLKIEAESYLYSNDVQKEPCSEGGENVGYINNGSWMSYPGINFPSSGNYLIEYRVASAVDGGRFSSDLEAGETVLGELSVPNTGGWQNWTTVSQTVNVSAGTYQFGLYSISGGWNINWIRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unraveling the Multivalent Binding of a Marine Family 6 Carbohydrate-Binding Module with its Native Laminarin Ligand.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
molecule keywords ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5fuiA00
3BGAA 3C7FA 2WDBA 3T2QA 1PX3A 3OGVA 5A1AA 3WEZA 2VC9A 1JU3A 1XNTA 3CZJA 4IUGA 4UAPA 3IAQA 3I3BA 1W0NA 3WNKA 2QQJA 3MUY1 2JE8A 4CU6A 4BJ0A 2VTFA 4DUXA 2X05A 1UZ0A 3WF2A 5HPOA 3C7GA 2L9LA 4HG6B 3K4ZA 1MPXA 2J1SA 1W9WA 1OH4A 1W9SA 2BZDA 1P8JA 3OBAA 3ACHA 3GM8A 1JHJA 2XONA 4DXRA 3PUHA 3I2JA 2B4KA 2WO2A 2W1SA 1XPWA 2Y6KA 1K42A 2C4XA 4MADA 3WF3A 2CDPA 3I2IA 1UXXX 3A23A 4QB2A 2LS6A 1KGYA 1OD3A 1UMIA 2VZTA 4P08A 3HNMA 3EB7A 3OB8A 1W8OA 3F2ZA 2DCKA 3K77A 4UI9L 3A7QA 3DYMA 3HNBM 4XUTA 3C7HA 3SEPA 1UYYA 1ULPA 2QQMA 2OKXA 2RJ2A 2V4VA 2WAOA 3LEGA 2W91A 5J1XA 4L0PA 5JR2A 1NAEA 1JYWA 3FHQA 2ORZA 4W8JA 1J83A 1DYOA 5LA0A 3K4AA 1UYXA 2WABA 3GXUA 5JUVA 3WF4A 1GOGA 5IJRA 3WF0A 3LQCA 4JKLA 2EIBA 1UY1A 4BXSV 2XHNA 3EYPA 2XQXA 4OYUA 3WNPA 4KI5M 3NQHA 1TVGA 1PMJX 4E8DA 4TTGA 1WCQA 2VL4A 1F4AA 2VJXA 2WQ8A 2R7EB 2E26A 4QDSA 4P00B 1RYYA 1H6YA 3IIIA 2QQIA 2QQOA 4TXWA 4AAXA 4BK5A 2VCBA 2ORXA 5FUIA 2Y6JA 1OT5A 2W46A 5DMYA 3T0DA 4A45A 2J1AA 2ID4A 2BERA 2W92A 5LA2A 4CVUA 3CIHA 4A3ZA 1UMHA 5EJ1B 5IFTA 4XUOA 5LCWL 3VD4A 3PUIA 3IAPA 3VD5A 4ARYA 2YFUA 4XUQA 3CQOA 3WNNA 1GMMA 3HJRA 5B4XA 2ZEWA 4DEQA 3AC0A 1LNSA 3W5NA 3CMGA 1JYVA 1GUIA 2DCJA 1K45A 5CYYA 4JKKA 3GDBA 5C70A 1F4HA 3ABZA 1JZ8A 4A41A 3CKHA 1WKYA 3I3DA 4DXTA 3FN9A 1O8PA 3SEEA 3WNMA 4A44A 5DQ0A 1SHWB 4AG4A 4W50A 2VQTA 4XZUG 3D3AA 4RN5A 2VQUA 3T0AA 1EUTA 2W9XA 1UY4A 1UY2A 2W1QA 3E1F1 3T09A 3J7HA 3THDA 2VOTA 2C9KA 2J1TA 4FI9A 5DN2A 3T0BA 4ZZ5A 4XUNA 1DLCA 2ZEXA 1JZ6A 1PX4A 1DP0A 3IB3A 3GGLA 3SKJE 5G05L 2KD7A 3WNOA 4KWUA 5EJZB 2WBKA 2YB7A 5C7GA 3HEIA 4PQQA 3OEAA 2JDAA 5IYYA 1OF3A 3FHAA 1CX1A 1J84A 2EIDA 2RV9A 3A22A 2W1UA 4QB1A 2WO3A 2VZSA 2HYXA 3ACFA 4D8MA 4CU9A 1US3A 4CUAA 4GWJA 4OMCA 2WO1A 4E8CA 2HLEA 2W5FA 4P5YA 3VDCA 1BHGA 1UY0A 4QB6A 4M4PA 3UESA 4ET7A 3NJVA 3WQBA 2VZOA 2PQSA 2BGOA 4OMDA 2WAAA 4OZOA 3DECA 2W95A 2Z4FA 1UXZA 1NKGA 3LEKA 4BK4A 4DUVA 1KEXA 2E31A 1JZ5A 5G04L 1GNYA 4QX2A 5JXJA 2WUHA 2B9VA 3HNYM 1D7PM 4MOAA 4P02B 3CZUA 5F7UA 3K46A 3HPNA 5CZKA 5DPNA 2C26A 3A21A 3BN6A 2V72A 2JKXA 1CZVA 4QDRA 1W9TA 2ZXQA 5I0DA 2EICA 3P1IA 2VMFA 3C7OA 3OEBA 2VZ3A 1US2A 1XC6A 2X09A 5IHRA 2YC4A 4PF1A 2QQKA 4MO3M 2W94A 2LW8A 3P6BA 3OG2A 3T2PA 1ULOA 1NX9A 1GOHA 1CZSA 2YC2A 2QBXA 1O8SA 4JKMA 4QX3A 1GOFA 5JXIA 4CU7A 2VZVA 2J1EA 3WSOA 3NNGA 1R64A 4PT6A 2W3JA 4ZY9A 4DXSA 4XVHA 1UYZA 1K12A 3LPFA 4RYDA 3MO4A 2VCAA 1CIYA 5C71A 1OF4A 1L7QA 4QX0A 2VZPA 4JX0A 4ZXEA 2E33A 4YPJA 4CUBA 4QAWA 2VMCA 1EUUA 1GQPA 4Z2AA 2VMDA 4UOJA 3T08A 2VO5A 2VZ1A 1GU3A 3DYPA 1W99A 2VM9A 2WN3A 4LQRA 2J1RA 4CUCA 3UNPA 2VMEA 3FL7A 4QX1A 3W5MA 1NUKA 2VR4A 1YQ2A 1H6XA 2Y64A 4DEVA 2BBAA 4KMQA 3C7EA 3I2HA 3MUZ1 2ZEYA 2Y8KA 2CDOA 4D0QA 4LHSA 3K4DA 2E32A 2WN2A 3VD9A 2RVAA 2J22A 3I3EA 3THCA 2JD9A 1JZ2A 3K75B 4MGQA 1K3IA 2Y6LA 1JZ4A 2J1UA 4CU8A 1SG3A 3VD3A 3NJXA 1IQDC 1JU4A 2VZUA 2WYSA 2WZ8A 3MBWA 2QQNA 3LEIA 4DUWA 1JYNA 2WZEA 3LPGA 1HN1A 1PMHX 3DYOA 3LE0A 2YG0A 4LKSA 2VZRA 1I5PA 3T2OA 4M4RA 3ACGA 1UY3A 3I2FA 4ARXA 2XOMA 4W4ZA 4BDVB 5HXMA 1UWWA 2Y6GA 3HOBA 5B4NA 1TG7A 3ECQA 1CZTA 4QPWA 2J7MA 3JXSA 3I97A 3SKVA 1JZ7A 3NRUA 3WF1A 5JXHA 2V5DA 3ETPA 2J1VA 1JI6A 2ZEZA 2W47A 4XURA 1L7RA 2W1WA 4ZZ8A 3U37A 3I2KA 1O59A 1JZ3A 2EIEA 3VDAA 4LPLA 3ZM8A 1T2XA 3OGRA 3HN3A 2Y6HA 3MV11 2X10A 3CDZB 3C8XA 1SDDB 1W8NA 1XNAA 3VDBA 4MGSA 4JHZA 3WNLA 5IFPA 1JYXA 2YFZA 4A4AA 2VCCA 4GZ9A 3OGSA 3IDAA 3UETA 4A6OA 4QDQA 2VZQA 2W87A 2DDUA 2QQLA 4A42A 3MV01 3ACIA 4XUPA 5JXGA 4OUEA 5JMOA 5LA1A 5EIYB 1UX7A 2BGPA 3VD7A 3I2GA 4GWIA
chains in the Genus database with same CATH superfamily
3AZWA 4ORFA 1DQ4A 4NIAA 3RZLA 1OVSA 4LR4A 5DXDA 1LHWA 1TZOA 4FPKA 1G86A 3BODA 1PX3A 2LM3A 3OGVA 5IK8A 2Q0AA 1DBNA 5KWRA 1RMU3 5FYZA 4XQDA 1XU2A 3KCCA 3M2MA 2VH9A 4X6RB 4JV4A 3CZJA 3IAQA 2C24A 4AWDA 4NN0A 4FTBA 2ZZJA 2IUWA 5DDJ3 5J98B 1VBB3 4D6SA 2B45X 3ZYFA 2XXZA 2ZJCA 3ZYBA 2D6NA 5LBFA 3V64A 1O4ZA 3D0JA 1Y9MA 2L9LA 2OXBA 3USUA 4LEJA 2BNMA 4YLZA 4Y33A 4IETA 2ADDA 4H2AA 2R32A 5FY5A 3K4ZA 5C3QA 2DU0A 1YQCA 4NHXA 4NOTA 1N3PA 1UW8A 2ES3A 2IXIA 1WD3A 3AKRA 4YVWC 4Y5SA 3GM8A 3MYXA 1JHJA 2ZGKA 2FDIA 5CKMA 2JDPA 2FCTA 2GU9A 3GCXA 2HWB1 3I2JA 3PUHA 2W1SA 2DCYA 3AYEA 3EHKA 4AI0A 4XABA 4YFWA 4AEMA 5TSWA 5J37A 1XSQA 2GDFA 3INAA 1S0EA 2XWBB 1FATA 2JECA 2YV8A 3NAPA 3OY8A 3WCSA 4CDXC 4FP2A 4QB2A 1PHMA 2LS6A 3IPVA 2D6LX 2GC1A 3PU8A 1GWKA 3BKZA 3SXWA 3ZLIA 3MW3A 1O5LA 3FE5A 1G9FA 1NOVA 2NN8A 2OVUA 2R072 3GYDA 2KM2A 3RI8A 4RGAA 3KCXA 5F8PA 3V0AA 2OUHA 3J26N 4Q8LA 2R1BA 2XBO3 4NRMA 5FZ8A 2DU1A 2JDUA 5EV7A 1DQ6A 3IIAA 1VBD1 5FWJA 3O1SA 5FLJA 4AAPA 3H3ZA 5FPAA 3D5OA 1QH6A 1ULPA 3EXUA 4OI1A 3KGLA 4BYYA 3QH6A 3UGGA 2OKXA 4P9GA 2BTVC 2XBO1 4BQWA 5A6QA 2JDHA 1CN1A 5FOJB 4BQ2A 1RUI1 2QE3A 1X33A 1Y9GA 4LUMA 2LROA 5JAXA 4RQPB 4XFFA 1RUF3 2JDMA 1OI6A 5JR2A 1ENSA 3ZMNA 5KBFA 3OCPA 1QH7A 1FMD1 4XMIA 5IVVA 3U14A 1V0AA 1JYWA 2IWGB 2PAKA 1ENRA 3PIJA 4WBBA 2ORZA 3AYAA 3KMHA 4IGQA 4CP9B 1QKQA 4LLFA 2R043 1LU1A 3VDDC 4GH4A 2Q1MA 3GXUA 4IE6A 2IFRA 1H8VA 4DNYA 2EAAA 1ZBE3 5L36A 3O1UA 4S2GA 5FJHA 3RYRA 1UY1A 2UWCA 3EYPA 1HJFA 2IC1A 1VMHA 2XQXA 4PF5A 3BU0A 3PHMA 1Z7S2 3VUOA 1WCKA 1RB8G 4QKDA 5BNNB 1RVF2 1YLLA 3O5SA 4Q4X2 2WWUA 2WZR2 1XJAA 3LFMA 1HB3A 4TTGA 3N9OA 3MIGA 4XFBA 4CCNA 1YI7A 3RZHA 3TOJA 3QBQA 2JWPA 4XILA 2R7EB 2E26A 2XL9A 4CDXB 4CPBA 3RDIA 1RUJ1 2MHFA 1QNYA 1RINA 3A4UA 2ZHNA 2VNVA 4IE0A 1H6YA 4XYXA 4TXWA 1QJX1 3B5LB 1GZCA 1REDA 2ORXA 1EYBA 5ACA2 1XYOA 3CJIB 5K4LA 3VKFC 2ZABA 2P1BA 4NHMA 3T0DA 4MXWB 3JBG3 3P3NA 5A32A 3NKGA 1X7NA 2GNMA 1RUE3 2ZS6B 5GLWA 1LCLA 1NCQC 5C5TA 3VGIA 2MPFA 2LUWA 4ZXKA 1CQ9A 3HIFA 4Q0VA 1GNZA 2B7YA 2K46A 2X8KA 4IEXA 4LBKA 3RSJA 3ZIWA 3CJXA 3KWVA 5A7NA 5C8CC 1DIWA 3HBKA 3I7DA 4IGOA 4CXXA 4XW3A 5BNOB 4FOQA 2Y33A 4RFRB 5A33A 5FXVA 5FCCA 2MNGA 2VUDA 3TAYA 5ACA1 4CEYA 4YM0A 2WA3A 1G9CA 1W2TA 1JYVA 3PDQA 1FX5A 1PIV1 2P3YA 4P9YA 2DCJA 3VDDA 1GV9A 4QHBA 1RUE2 4XFHA 1FOD3 3GDBA 4GAZA 4QU1A 5A7OA 1XNDA 3J8F3 3ABZA 1WKYA 2BFUL 3NL1A 1MS3A 3B3QE 4AI3A 1W6QB 3SEEA 1N1SA 5LRSA 1UAIA 5EWSA 2OS2A 3JB8A 3ZPYA 3Q8BA 4NHYA 4WZCA 1DZTA 2QQVA 3TBDA 2CY6A 2O8OA 1OURA 2ARCA 3N7KA 5K0UA 1CGPA 1W6QA 2ET7A 2XLAA 2A3XA 1LHNA 3NAPB 1FOD2 4PIXA 2W1QA 3ZVXA 5HBAA 3Q8FA 1W6OA 3ELNA 1OA3A 3PVOA 1LECA 3V56A 3ZXDA 4DZGA 4UYBA 1VIWB 3B69A 3ZX7A 3DKQA 2VOTA 5KXBA 2DTWA 5DUVA 4ES8A 2WSVA 4OUSA 3T0BA 4N53A 4XACA 5HCBA 1F31A 5AVAA 1DLCA 2PELA 2XUEA 2ZEXA 2D5HA 3ILNA 4MG2A 3E5QA 4FQ4A 2RDRA 4ASMB 3OSDA 4JCKA 1DP0A 3O7OA 3MLLA 4RR3A 3VBSA 2XBO2 2FD8A 2KD7A 1BVP1 2DVBA 2R062 5EJZB 4JDNA 2WBKA 2YB7A 3WT3A 3WV6A 5C7GA 5IVFA 1JS9A 5DAPA 4CP1A 4IV3A 2JD4A 2JDAA 1WW6A 1UIJA 5GZEA 1L3JA 5FZGA 2FCVA 3VBRA 3UK9A 1J84A 3WG3A 4L2NA 1ZZ6A 4AI2A 1Q56A 3C2UA 5FTTC 3ALQA 3KT7A 2WWJA 4FOYA 4QB1A 1FPN2 5A32B 3VB9A 2JDNA 1HRI1 3ACFA 2UY8A 5JZGB 1H9WA 1W9FA 1ZNPA 1T6GC 4FPLA 2DBNA 1C8M1 5FXXA 4BM8A 2NMOA 4I0AA 5C33A 5FR3A 4OMCA 3O1RA 4E8CA 1PVXA 2WNOA 1GBGA 2QTWB 2RR11 4I0WB 4J1WA 2I45A 3S5QA 3AP4A 4RD7A 5LK7B 4UW3A 4GXLA 3OPTA 1L7LA 1SLCA 1NQDA 2WL1A 2VMIA 1XXNA 1XB9A 2YPJA 4ET7A 2I07B 2QZ2A 3H8UA 4ZKTB 5LASA 2PQSA 4O7XA 1W06A 3CU7A 4AVBA 1DQ2A 4IDZA 1AR81 3O1VA 4LK7A 4YSFA 1C8M2 1UXZA 3LEKA 4UF0A 1SBFA 4BK4A 5CFCC 2LRPA 4FPOB 2E31A 4PIYA 1JZ5A 4MHRA 1IKPA 2VW1A 1VRBA 2DVAA 1OUXA 5FZBA 4QU2A 1UQXA 4PDWA 3HNYM 3WY6A 1UOBA 3GALA 3ZSKA 4P02B 4IEYA 3TRSB 1KITA 2ZGOA 1CVNA 3LKJA 4CCCA 5FK7A 2IXJA 3K2OA 4XETA 3UGHA 3WDYA 5DPNA 2BWAA 2I74A 3HQRA 2JKXA 1VRH2 3DF0A 2EICA 1I5ZA 1Q5OA 2JENA 4KBZA 5E8AA 3EJKA 3SC7X 3OEBA 1XC6A 5IHRA 4UFLA 4RQPA 3LZZA 1F8VA 4Q4V3 2XVLA 1PGSA 5ANNA 3JCIA 1OC1A 2B9UA 4OQ9A 4IQPA 4M00A 4YM3A 1ULFA 4QQLA 1CZSA 3VZMA 4ASKA 4B8EA 2QBXA 3ZIXA 1JW6A 3RGBA 4IV1B 4JKMA 2DUQA 2B46X 1HRI2 4R9DA 5HI0A 3OPZA 5FJKA 1ULEA 2RS32 2XMLA 5EP9A 1YYNA 2EF6A 2VTXA 3WSOA 4XXPA 3MIBA 3KD4A 1HXS1 2ERFA 1V00A 2W3JA 1WBFA 2ZGNA 4YGDA 2Z42A 1UYZA 1NQJA 1D4VB 1TEIA 1Z7S3 4HXCA 4I3GA 5LK5A 4A2UA 3KV6A 4CCLA 4QX0A 1RVF3 5C8CB 4NRPA 1W8ZA 1V9U1 1PK6A 4JGYA 4QAWA 2ARXA 1RUG3 1JTZX 1EUUA 1F35A 1UCXA 5FYCA 1GQPA 4O65A 4FPHA 4UOJA 2HH9A 4YZ3A 1PZ9A 1HRI3 3I4IA 1GU3A 3DYPA 4TSVA 1J1LA 4OHVA 4LQRA 1Q8QA 2MEV1 5L7OC 4TZDA 3W5MA 3R4SA 1NUKA 4GWNA 1UPSA 1KDKA 1YQ2A 2C6SA 3JB4C 1S2KA 1SPPA 3SITA 4CXYA 1CIWA 1MS8A 1FXZA 4AVAA 4FOVA 5GKAC 3RYKA 4KMQA 1VBC3 2WR9A 5T5LA 3B00A 3FFQA 5CU1A 3TEZA 2AENA 2ZEYA 3S7IA 4GA9A 5M0TA 1UZVA 1E57A 2AH2A 3IM0A 1CWPA 1RUJ3 2OQ7A 1MQTB 2EVXA 4QHZA 4CPBD 3VBUA 3WDUA 1W2OA 2J22A 3I3EA 1MEC1 2JEMA 2FZ1A 1R1ZA 2W39A 2YYOA 4F3JA 1YJKA 2AUYA 2J42A 3AK0A 5KHJA 4R4XA 4EN6B 1RXGA 3M70A 4RQPC 1SDWA 1ZX5A 1SG3A 1VAKA 4RHV1 3VD3A 3NJXA 4XZPA 1IQDC 1KXGA 1XRUA 1N1YA 2WZ8A 1TME3 3NW4A 2QQNA 1RTVA 2W08A 4ES9A 3G6JB 3JUUA 5HCAA 4W6XA 1JYNA 1EY2A 1QJU2 2OW4A 1PK6C 4V2WA 3ZKYA 1OFNA 2B42B 1Y7BA 3R05A 4IEQA 1HN1A 1S4CA 1Y9QA 2BOIA 1UL9A 1RGSA 2P6HA 2ZAHA 5EHDA 4JTOA 1IG3A 5DAWA 1LOFC 1I5PA 1F5FA 1OXCA 2TBVA 4HPKB 3WW1A 3X29B 2R073 2ZGRA 1RUG1 3ACGA 5FYHA 1O3RA 1UIKA 2ZTNA 1YWKA 1VJ2A 5FZ3A 4I01A 4BDVB 4CCEA 5JIUA 3HT2A 1V6OA 2WA4A 4QHOA 3ZFFA 2VG9A 2YY1A 3NSTA 4FPGA 3THTA 4WM8B 1X8EA 1HXS3 1O4YA 3I97A 2GMPA 2BRTA 3AL6A 3WF1A 2A3WA 2WNUC 1KJLA 3AYCA 4XURA 4N53C 4AHYA 3ZDSA 2W1WA 1WLDA 4IV1A 4V2VA 4QPIA 3L2HA 4E4SA 1O59A 1W9YA 3VDAA 2KA3A 2FDFA 5FPZA 1GZ9A 2DF7A 1LESA 5T5JA 2R042 2IZWA 2XVKA 5IVCA 2ADEA 4G3YC 5ABJC 2BU9A 3O12A 1MS1A 4FPCA 3RI9A 4LE4A 3U4SA 4CDUC 4COVA 2HEWF 2QFEA 3WCRA 2GAUA 2Y38A 4XTPA 3FUQA 1V6IA 4LOTA 1R092 2EXKA 3IMMA 3I49A 4BOWA 3A0NA 1BEV3 3B94A 3DN7A 4W6YA 1PGW1 3IDAA 4BH9A 3UETA 1MEC3 4XAEA 4RFT0 1Q8PA 1R082 1UMZA 3AKSA 1LU2A 1R091 1XNCA 5BUVA 1ND2C 4A42A 1QJZA 3N7LA 2RJKA 3LAGA 3LA2A 4JGZC 2PHFA 4N8MA 4B1LA 3FHIB 4OUEA 4LUKA 1CX4A 5JMOA 5LA1A 3PVNA 1UX7A 1CJDA 5A6XA 5FP9A 5FDBA 1V70A 4MGZE 3TN91 4LKFA 3WG2A 5A33B 1EPZA 1KFUL 3VBRC 3VD7A 5K0UC 4GWIA 5FMCA 1VMFA 3AZYA 5I8SA 5L9VA 5A3PA 2CV6A 4NE9A 1OSGA 1BLZA 1FNZA 3ZFFC 1AR72 1Q8OA 5AFBA 4H7LA 1Q8SA 5JZGA 4ZU4A 4WVZA 1TMF1 1V9U3 3V0BA 1YHFA 3ZSEA 4FSJA 2OPKA 5AC92 2WNVA 1E5RA 2VC9A 2VY0A 3OGJA 4D94A 1D0GA 1CD3G 1XYNA 2A6VA 4LA3A 1ZBA1 4FPJA 5FY7A 4AGRA 2WS92 3KF5A 4JRLA 2AR6A 4Q8KA 2PFWA 4R9AA 3I3BA 3NNLA 3K3OA 1OLRA 2QQJA 3MUY1 4ZS2A 1QQP1 1LTEA 1UU4A 5IATA 4BQ1A 1H8TB 4RR3B 1ODMA 5HPOA 5AVPA 3WDTA 2F17A 4UW5A 4YM2A 3AVRA 2B39A 4Y1ZA 4KU7A 4HG6B 5I0RA 1AX0A 2E6VA 3J7MA 1GYKA 4PLNA 1NE4A 2ZGTA 1MPXA 2J1SA 4S2HA 5ABJB 1A8DA 5CISA 3ACHA 3T4VA 2VBPA 1MVQA 3H1MA 3OGGA 2XONA 4KG8A 1QDOA 3U78A 3WQ1A 5BNNA 4IEUA 4FXKB 3R6SA 5IUQA 2PHLA 2WO2A 1AL21 1XE7A 4HANA 5H9QA 4DFSA 1K42A 3ZOIA 2C1FA 2C4XA 2EXHA 2WS91 4MADA 4GJZA 2IXKA 2JG9A 1N3QA 1PO13 2XJRA 3IBMA 1XE8A 1PNFA 2BW8A 2W2IA 2ZHLA 2XKPA 4IEOA 4NR1A 1KGYA 3E5UA 4QPIB 4NWWA 2P3IA 4LO5B 3ZYHA 1WMEA 4LHLA 4KWJA 1GZWB 3K51A 5CKQA 4KQ7A 4CEYC 2VZTA 3HNMA 1T6BX 3ZXAC 4HSLA 4XAAA 3EB7A 1DLLA 3OB8A 4I02A 1W8OA 4BQ5A 1A34A 3P3PA 1Q3EA 1W90A 1BCXA 2OA2A 4BCUA 4FFFA 4UFKA 3O1TA 3MDPA 3WVJA 5A3UA 4NHLA 1AL0G 5FZCA 1WLCA 1PO12 1X36A 3JZVA 3SEPA 4J6GA 4C90A 5KHHA 4YVWB 1QNWA 2VOVA 4CCDA 4BQXA 3BUCA 4EQVA 2A1XA 1AR71 3LEGA 3LDBA 3VBUC 3BIEA 4OZXA 5BV6A 1XNBA 5J1XA 1IKQA 2EIGA 1WCSA 1FAYA 3OBZA 1YEWA 2DVFA 4BMEA 3MFCA 2JDKA 4D6RA 2H6CA 3WHTA 1TNRA 1DZRA 1RUE1 3NV3A 3ZSLA 4W8JA 4YG3A 2D7FA 3ZXFA 2WNVC 1J83A 1DYOA 3HQXA 1PM7A 5DUUA 3K4AA 1H2KA 2GALA 5JUVA 2XL7A 4GB31 3WF4A 1J3QA 2QCSB 5GLVA 4BE3A 5IJRA 3W9AA 4JKLA 3C3VA 1QJU3 2XHNA 2FMYA 1K5MA 5FZMA 1BKZA 4Q0SA 3R4DB 3VKMA 1QJX3 3CJIC 4IESA 1MS0A 3VBSC 2BBVA 3HAGA 3I3QA 2ZMLA 4KI5M 3I59A 1QJEA 2ZOEB 4LO8A 5GLZA 2PYTA 3NQHA 4AVSA 4A7KA 3FLTA 3PTYA 2UURA 5C4WA 1YNAA 4LBOA 4BU2A 1B35C 4CRQA 3TWIA 1WCQA 2WIIB 3KGZA 5KC5A 4YW3A 1QDCA 3B9CA 1FOD1 2VVDA 2XWJB 1UPIA 2CSGA 2VJXA 5CEHA 1W0PA 4XJ9A 1SFNA 1H9PA 4CDQC 4CDWA 4CCJA 1OLQA 3D4KA 4P00B 4K8FA 3IIIA 1F9KA 1JOJA 2JDYA 2QQIA 3VZNA 1ZRCA 4BK5A 1ZRDA 1ND3C 1BMV2 2QDNA 1F15A 2D3SA 5FUIA 2ENRA 2Y6JA 1R1A1 1QJX2 1ZZ7A 3H50A 4A45A 1OHFA 2BERA 3AJZA 5L9RA 1GLHA 2NMNA 2W92A 5LA2A 1WCUA 3CLPA 3HBZA 2B8MA 1ULDA 3JQWA 1LOAA 4XEZA 3M3OA 3W20A 5F39A 1G6NA 4BLJA 4D7YA 5IK7A 3OBTA 1FMD3 2QJVA 1DG6A 1H2MA 1UMHA 2PTMA 1W04A 4QXHA 4RGGA 3VBRB 2YU1A 4HOOA 1WD4A 1KS5A 1RUF1 2YHJA 4XE9A 4XMAA 4Y4YA 4YYOA 2IXLA 1QXRA 3OD4A 3ETQA 3SISA 3ZFFB 3QLQA 4KU8A 1OH3A 4HKOA 4XQ4A 5AC93 4XHBA 4ARYA 4A6SA 3RZKA 4Q0UA 3CQOA 5FREA 3CNAA 5LRRA 3V65A 3W5NA 1XNKA 2YGLA 5CFDA 2D40A 4YW4A 1R093 2RR12 4IW3A 4N53B 1K45A 4D7TA 2EXIA 4JKKA 2XH6A 4OFGA 3ZDVA 2GNBA 5C70A 3J7LA 4CXWA 1FMD2 3KT4A 3WR0A 5EXOA 3VKOA 1JZ8A 4DXTA 2PHXA 1BEV1 2YBPA 3V0AB 3AXDA 4FAGA 3ROUA 2YU2A 2QVSB 3N9LA 2P2KA 3WNMA 4CCKA 5FFOC 4D7SA 1J1TA 1RUH3 1SHWB 3POSA 4AG4A 2VQTA 4XZUG 3K3NA 4R9BA 3AZZA 3PJQA 4BHPA 1J59A 1SLAA 1ENQA 2VQUA 4HPKA 1W39A 3JBG2 3HVDA 1EUTA 1WLWA 5IVYA 5EPAA 1ND2A 1WBLA 1OFSA 1VBC2 1AR93 2LTNA 1C57A 2VQAA 4LBQD 2WZR1 2ZGMA 4Q1PA 1JOPA 3O0WA 1OOPC 2IVIB 2VOXA 4R4ZA 5GZCA 1ND3B 3FUOA 4HONA 4JQTA 2Q8CA 3LFIA 2J1TA 4FI9A 5L7OA 3J8F1 4Y3OA 3WQ0A 5I8YA 3GNEA 3GHNA 3N7JA 4GKYA 4QX5A 4JVAA 3PL0A 3DKWA 1LGBA 2YPDA 3LGRA 5F3GA 1S2BA 4WM8C 2XJPA 1JZ6A 5KC6A 3DGTA 3IB3A 4MHUA 3GGLA 4QM8A 4XBNA 4LITA 3SKJE 1ZZ9A 3WNOA 1MS4A 3ZFGB 1WGPA 2HBUA 5FP7A 3FBMA 4PQQA 3OEAA 3EO6A 5FXZA 1NY72 1X9PA 1SZBA 3FHAA 4L11A 2NP0A 1CX1A 3M3QA 1LKNA 4Y20B 2EIDA 3AXEA 3J8F2 4UFMA 2RV9A 2GN7A 2W1UA 2VBDA 3A22A 2ZA9A 4UW4A 4NIDA 3P5BA 2WO3A 1XQNA 2XUMA 2VZSA 3ASIA 2HYXA 4PBPA 4D8MA 4UBGA 1LB2A 4X8PA 4OI2A 1UD1A 4CUAA 3V0BB 4TN7A 4GWJA 4HFSA 5DG2A 3JBG1 2WO1A 1VB4A 5H9PA 4BMBA 1RUI3 5FMOL 1NY71 4RS5C 3VDCA 1GP6A 5GJ6A 2EALA 3UESA 4RR3C 4QQHA 5BY5A 3NJVA 3SH4A 2VPVA 3WP6A 2CAVA 4PI0A 2BJSA 2VZOA 1D4M3 1NCQB 2BGOA 1AHSA 2HWD3 3NKTA 2WAAA 4OMDA 5FZ6A 1DQ1A 5A6ZA 2DV9A 3BIWE 1RC6A 2W95A 2Z4FA 1NKGA 1NYWA 3LEMA 1IS3A 4X6QB 2ZMKA 1LOEA 2RM21 3B7MA 5DAVA 4DO0A 1IS5A 4KBBA 3KS7A 1I1EA 4WM7C 1JOBA 3KHCA 4QWNA 4WM8A 1QXJA 3DEMA 2WUHA 1AXZA 5H9RA 3VHOA 3N3HA 4PLOA 2B9VA 1NZIA 1D7PM 2D6PA 5A3LA 4DRVA 3AMQA 4KH9A 3CZUA 5F7UA 2VTXJ 2FHRA 2VQ0A 5FZ9A 2C5DA 2RMU1 1W8FA 2V72A 4QDRA 4YG0A 4D6QA 1VE0A 1GZTA 3P1IA 5IT6A 3ON7A 3N35A 1US2A 4JAAA 1FPN3 2X09A 4A3XA 4PF1A 2QQKA 4MO3M 3NV1A 2K2SA 4N7UA 2W94A 4COZA 3E97A 3OG2A 3T2PA 4PI2A 4JRAA 3LOBA 3I8TA 4UF0B 2RS51 3I2OA 1GOHA 1CPMA 3S0MA 1O8SA 2P37A 4EROA 3PVEA 1ZZBA 3LSEA 1GFF2 4YARA 3VBHC 4RS5A 4ISRA 1LGCA 2VUCA 4MH0E 4MZUA 4CU7A 1CAXA 3AZVA 5IK4A 1DYKA 1VRH1 4PT6A 1R64A 5FWEA 5CFCB 2IXHA 1Q8VA 2IXCA 4KNCA 4ZY9A 4DXSA 4AVCA 1IPSA 1HRV2 1K12A 4AE2A 4RYDA 3MO4A 1SEFA 2DCZA 4XF1A 2BYVE 4GKXA 4HVQA 4DRRA 5CFCA 5ISLA 1JBCA 1LRHA 1RMU1 1YFWA 4JX0A 4XF3A 1RHI1 4YPJA 1G9DA 1UZWA 2VMCA 1C28A 4RS5B 1CR7A 4MVTA 1COV3 3PJYA 3MPBA 2QKDA 2VW2A 2VNGA 2XDVA 2D6OX 5FZDA 3T08A 5FIXA 1G8WA 3SCGA 5FZ7A 4IEVA 1NA1A 4LO4B 1S1AA 3UV9A 3B9IA 2Q30A 1W99A 3NO8A 1KRIA 4LBNA 2UWAA 5FYUA 4XIOA 2ZMNA 4IEPA 1EV12 4MGKE 1ZRRA 1H6XA 2Y64A 4D69A 3OF1A 3O1MA 3RZJA 3VBSB 2RS12 2VVEA 3AP5A 1GKBA 2R6QA 2XB6C 3L2YA 4IV1C 2OIIA 5KHGA 2XR4A 1HV1A 1F2NA 2XLGA 1VBE3 4IEWA 4YGEA 5JZGC 4MLOA 2CDOA 1J58A 2YDEA 3OD0A 4D0QA 1Y4WA 4JTNA 2VNOA 2WN2A 5F37A 4ZHNA 4ATFA 4NPLA 1ZREA 2JE7A 4PHZA 2RVAA 4HL0A 1AR83 2UU8A 4Q4W1 3THCA 2PA7A 1VBA3 3POYA 1JZ2A 3RJ2X 3AKPA 3K75B 4MGQA 1K3IA 1PIV3 2ZACA 4BPZA 3LWCA 4CDUA 5FOBB 1VBB1 2JICA 3POBA 5DDJ1 2J1UA 2E51A 2ZPXA 4LBQA 5DG1A 5LY2A 1O6UA 1W05A 5LBBA 4COYA 2GNTA 1AR91 3POGA 3SMHA 5ACA3 1MQTA 3LDKA 1JU4A 2K9ZA 4XF9A 3LEIA 2RR13 1ACCA 3BTYA 5GZDA 1BJQA 1RUD2 2QUOA 3AP6A 4Q2FA 5B2GB 3RZGA 2E7TA 2WZEA 4XDPA 2SLIA 2H0BA 3VBFA 5JMCA 4AFDA 2A6XA 3LPGA 4HVOA 2RS52 5BXXA 3URFA 3G7DA 4C91A 1PMHX 4K1YA 3DYOA 4LKSA 1SLBA 3U75A 5CFDC 2G19A 3RWKX 5CBLA 4GALA 1RUH2 3O0VA 4B3NA 3AMPA 2O14A 4UT5A 1KFXL 3BVCA 4YG6A 3JD71 5FV3A 5FKCA 1X82A 1LEDA 1URXA 1UY3A 3BOWA 3BTAA 1GICA 4E4DX 4ARXA 1S0GA 3M3IA 1YFYA 2ZKNA 4KWKA 1CAVB 3HOBA 5B4NA 1RUI2 3KV4A 2IFWA 1TG7A 1LR5A 1DQ0A 2EA7A 2W0XA 1S0JA 4UFHA 1JZ7A 1OMIA 3UKNA 2ZZQA 4OQ8A 1H1AA 4QPGB 2WZPP 4BXFA 3D0SA 5E88A 1JXNA 2ZEZA 5LB6A 3IDCB 4Q27A 1L7RA 4I0BA 4QT6A 5FBZA 4CEWA 2PHTA 2G9ZA 4XFIA 2HEYF 3U37A 1OA4A 4CYDA 5JWPA 4OI0A 5FPVA 3TEXA 1FYUA 4EWEA 2PHRA 3OY8B 5F2SA 5JI9A 4QD2A 2P6CA 2ZX1A 4XFAA 4Z1VA 3WLUA 1PM4A 2SBAA 3FBYA 1IHMA 1VBD2 2QQUA 1T2XA 4Q4Y2 3OGRA 4COUA 1TME2 5IK5A 2RS31 1GR3A 3AB0A 1ND2B 1AVBA 3MV11 1VBB2 2X10A 2FQPA 5I0SA 1WW5A 4MGTA 1PO21 4S2FA 2DTYA 5A7PA 4JHZA 1NT0A 4JGYB 4XIKA 3HQUA 5T55A 1AZDA 1JYXA 2YFZA 3JD72 4A4AA 4CTEA 1DDLA 4GZ9A 3OGSA 4XF0A 4P9IA 1VBA1 5HV4A 4AEJA 4HMZA 1MZ6A 3USSA 4DIQA 4BZ4A 1A78A 4Y1YA 2DYCA 5CG8A 3WW3A 4TLGA 5FZ0A 2ZKLA 1RUC1 5GLUA 1HB2A 3WOGA 2VOWA 5FZ1A 2ETEA 2XJVA 1YFXA 2JG8B 3DPRB 2DDUA 3H1WA 2QQLA 3KQRA 4QMAA 2E7AA 1D2QA 1GZWA 1ZYBA 1Q43A 1OQEA 3QH7A 4AFCA 5JXGA 5GLTA 1UU6A 1WMFA 4Y22B 1QJU1 1CAUB 5EIYB 2V5YA 1FT9A 3RPQA 5F9TA 3T4HB 1V6JA 2BEOA 4O9EA 1AX1A 1LEMA 2Y60A 2HBTA 2PAMA 1W8WA 5HV0A 4K8RB 1ASJ3 1W6MA 1YFUA 3VBOB 1G7YA 1W2UA 3C7FA 4AFMA 4XJAA 4HVRA 2WDBA 3OUHA 4XOGA 3H8RA 1SQ4A 1KS4A 5JOXA 1FPN1 3WD5A 3ZXEA 3BPZA 5A1LA 5CNAA 4YZ4A 4L92A 4RL7A 3WEZA 3H7YA 3ZXJA 1OOPB 1JU3A 3VLBB 3PUSA 1E5SA 5F6LB 3TN93 1XNTA 2X5IB 2PAEA 3FX3A 5T52A 4PQ9A 1W0NA 1ALYA 4PJYA 2Q1FA 1C3HA 1U12A 3ITQA 2JE8A 2Q4SA 2VW0A 2HWE2 2WRAA 4BJ0A 4N43B 2VTFA 2XJTA 1IGOA 2HWF1 1UZ0A 2X05A 1MEC2 2IVJA 3C7GA 2YMZA 5F2WA 3ZPOA 4H55A 2PHDA 4NVPA 2ZAAA 5T5PA 2Q8OA 2RM23 1C8NA 3POFA 4PCRA 3KLSA 4QPIC 1HJGA 2AEYA 3N9QA 5FYBA 4CUGA 2QDRA 5EYXA 3OBAA 1UX6A 1IZ3A 1VBA2 3NNJA 5JSOA 5C8WA 2YROA 3AMHA 3H3UA 4U36A 5IW0A 3TN92 1EPWA 2B4KA 4Z92B 1FNYA 3SCFA 1Z0HA 2Y6KA 5FLHA 1GQHA 5DABA 4AI9A 1G9BA 1PGL2 1GNHA 3WF3A 2WWSA 4N90A 5IWFA 2CDPA 3I2IA 3POWA 4B4PA 1UXXX 3WW4A 1EAH1 3ORJA 1ZA4A 4NPMA 2P34A 4Q4X3 1RUH1 4CEWB 1R081 1DGWA 1PMIA 4ZU7A 1V6MA 4YFZA 3DXTA 4LLOA 1OD3A 4P08A 4OHYA 4LKDA 2Y6FA 3MI8A 2H0VA 1QJFA 5BYNA 3F2ZA 4WVVA 2DCKA 3M7AA 4P9WA 1O5UA 2ATFA 1W3XA 4YNIA 1D4M1 4UI9L 5FP3A 5JIAA 1U5ZA 1I6XA 2FDJA 3DYMA 1AXKA 4FFIA 4NO4A 3HNBM 3H42B 4XUTA 1ULGA 1WMDA 1SMVA 2QQMA 4P9JA 1GQGA 1AR62 5FZOA 3BCWA 3A0KA 4K6BA 1VALA 2V09A 4QGNA 2V4VA 5APAA 3RQ0A 3U11A 2WFF3 3D82A 4B29A 5JPNB 2GC0A 3MZHA 4R9CA 5I93A 2AC1A 4F7ZA 2VVFA 5DAQA 1NAEA 5E1RA 1AXYA 3GF6A 3FHQA 3N7MA 5FPLA 5K0UB 3MHZA 2Q5TA 4LMFA 2YBKA 3MGUA 5FUPA 2GSYA 5LA0A 1W28A 2JKBA 3H8OA 5C6CA 1UYXA 2WABA 1NCRA 2WNUB 2OZJA 1PZ7A 3MLJA 3RZMA 3LQCA 2PN5A 4BXSV 2CNAA 3VHRA 5LATA 3KVBA 2FZ2A 4NUBA 3WNPA 4GD4A 1O3TA 1XOYA 3U10A 3ZFGA 1JHNA 1DF0A 4LK6A 4LTAA 4YGCA 3POEA 3GZTB 1APNA 3CBNA 4AEDB 4B4QA 1TVGA 3VN4A 1NZCA 1REEA 4NPRA 5D21A 3S6PA 1V6NA 5D2AA 1UO9A 1LENA 1F4AA 2E63A 3BYWA 5ABJA 1H8TC 4Y24A 2XPJA 4V1PA 2WQ8A 2A75A 3O1PA 3M8LA 3ST7A 4K3UA 5J3UA 2BNOA 3JQXA 4Q29A 4NHKA 1E5HA 2BGCA 2VNRA 2EAKA 5FZAA 2F4PA 2QQOA 1LOFA 4XJZA 5F5QA 2VCBA 1LGNA 4A7ZA 2WFPA 1OQ1A 5DDJ2 1OT5A 3RYPA 4GMP3 1W6OB 3GZEA 4XBQA 4NAOA 5DMYA 2XLFA 3NNMA 1BBT3 2ID4A 5A3MA 1W0OA 3FZ3A 5CIRA 1XU1A 4E27A 3R0RA 4GB32 5LBEA 2R061 1C1LA 3IMNA 4PLMA 4C1WA 3CIHA 4MGYE 4A3ZA 2RG4A 4AGVA 1YIFA 4AXOA 1HQLA 5IFTA 2RDSA 2V4AA 3OUJA 5L73A 3PUIA 2Q1ZB 3ZXKA 4DS0A 3FC0A 5FZ4A 5J09A 3SNMA 1R1A3 4YZ5A 1QQP2 3VD5A 2R30A 3TYJA 3ZYGA 4XUQA 3WNNA 2ZGUA 1GMMA 4XBLA 2CGOA 5B4XA 1Y3TA 2ZEWA 4DEQA 3AC0A 3BI3A 1ZBE2 5LEKA 1XSRA 3CMGA 2D98A 1BK0A 3J4UH 2N7GA 1GUIA 4QQPA 3ZXGA 4CEYB 5CYYA 2DUPA 5K9YA 1UYPA 3RZZA 1GWMA 4R8HA 2HYKA 4QPGA 5C9AB 1F4HA 3SLIA 3BTXA 4QX8A 3CKHA 3I3DA 5J7MA 4FPEA 1AYM2 3ZYRA 1IOAA 4S2DA 1O8PA 2QQPA 2WZR3 1VP6A 4AVTA 5C3RA 4OCTA 1OD5A 1CAWB 4A44A 1R1A2 3N36A 5BNNC 4W50A 2P3KA 1UKRA 5FZEA 2D6KA 3AX4A 3POIA 2GC3A 5LY1A 2RS33 3D3AA 5EFUA 2VULA 1TNFA 4JGYC 5C8CA 4EN0A 3LDRA 4XFGA 4Q4Y1 4Q1RA 1ODNA 2HWB2 3LA7A 3HWJA 3GZAA 2AYHA 1S0IA 1QHDA 3ILFA 1BEV2 3E1F1 2OT7A 4GIQA 1AYM3 3J7HA 1MZ5A 3UJOA 1COV1 5I91A 2C9KA 5DAXA 2JG9C 4QX7A 2WT1A 3R4UA 4YVSC 4LOSA 5T5OA 3D6EA 3LF7A 5BNOA 2OYZA 1PX4A 1ONAA 4GULA 3E6DA 2FDKA 1W8TA 1BZWA 5FYSA 4JQRA 3USUB 1N47A 5LZ6A 4NIHA 1VRH3 3W59A 4E2GA 3HEIA 4P9LA 4UXAA 5HCFA 5CB7A 3AFKA 2HWE3 4A7YA 4NJ4A 4CZSA 2D3PA 3AZXA 1OF3A 1J3RA 1HIXA 1SFYA 1B35B 3U1XA 3GBFA 4J1XA 3KSCA 2MEV3 1U0AA 3RWNA 2VMHA 2RM22 3BALA 1HDKA 1YJLA 4LKEA 5F3IA 5BNOC 3VV1A 3OJBA 2RS53 4YZ1A 4LT5A 3VZJA 3L9JT 1H0BA 1RUJ2 4GH4B 1DCSA 5DZFA 3UL2A 2R16A 1W3VA 1RJ7A 1YQ8A 1YQ5A 3AKTA 1SACA 4RSUA 3RVHA 3SHRA 4BIFA 2QZ3A 3FFZA 2C9AA 3H9AA 5A3NA 3TEWA 2WS93 4K20A 4P5YA 5DUXA 2GMMA 4YZ2A 1BHGA 1UY0A 4M4PA 4AHZA 3M1HA 4DMIA 1AR92 5BPXA 1HLCA 4IERA 5A3TA 2VXJA 1VLNA 1OPOA 2PHUA 4JC1A 2B5HA 2ZX3A 4IV3C 5K7PA 1JYCA 3IT8A 4YGBA 3H1YA 3WP3A 3ZR6A 4AEDA 3NV4A 4N43A 2JG8C 4DUVA 4Z2WA 1HN0A 3NJZA 3MF9A 2WT0A 4L8QA 1KEXA 4FXGB 2UWBA 4LIUA 2A3YA 5G04L 1QEXA 3RMYA 5BNPB 3BU7A 4QX2A 5JXJA 4FTSA 3WXPA 1DU3D 5SV8A 3ZN6A 4CDQA 1U5IA 2X29A 5A3OA 1X50A 3UGFA 3QD6A 4MOAA 4YRDA 1POV3 4AI1A 2VBBA 3HMYA 4QKNA 1W03A 3LD8A 4Q4Y3 3CL1A 1W8UA 2BVBA 5D8AA 4FOWA 5FZKA 1ZZCA 1AR63 4E2SA 3IN9A 3NJYA 4SLIA 1CZVA 2OZ6A 5I0DA 1S0FA 2ZXQA 1QJY1 1ZVFA 3VKLA 1SCSA 3GZUC 1CPNA 2VZ3A 1POV1 3VHPA 4TYSA 5FZFA 3KB5A 1YCIA 2ZBJA 2ET1A 3CJIA 2LW8A 4IE7A 4WVMB 1HB4A 1ULOA 2VUAA 3CHXA 3AYDA 3M3CA 1QOTA 2WT2A 2XKOA 3KZ4C 2RDQA 4J25A 4DB5A 4FPFA 4QX3A 4NIIA 1GOFA 3VL9A 3U0ZA 5JXIA 3U4XA 5HCHA 2BPA2 3PIGA 2J1EA 5FBJA 3ZN4A 1GANA 1TE1B 3NNGA 3VL8A 1MS5A 1OKQA 2E9QA 1QU0A 4XVHA 5F3CA 3TEYA 2PLV1 4MX3A 1D4M2 3LIGA 3M3EA 1WZXA 2VCAA 2JE9A 1CIYA 4HSJA 4U2AA 5FAXA 1OF4A 4LBMA 5F5AA 4ZXEA 2RHPA 3B01A 4C8DA 2E33A 1NG0A 1VB2A 2JIGA 2DFCA 4CUBA 3ILRA 4DQAA 2DWRA 2D6MA 3WP5A 3B93A 1C8M3 1WA6X 2OPWA 1ASJ2 3N9NA 3WNXA 5AFEA 2ILMA 4GMP0 1AJKA 1A8MA 2VO5A 2Y0IA 2CTVA 5FUNA 2EXJA 2VM9A 5T50A 2R063 3UNPA 2GN3A 3KVAA 1H4HA 1DYPA 2HKXA 4FT8A 3OOXA 2VR4A 3VBOA 4GWMA 3SH5A 1BBT2 5F32A 1IS4A 1WA4A 2G4IA 4CDWB 1OA2A 4PBOA 1J3PA 1RJ8A 3MUZ1 4RHV3 4JGZA 3ES1A 4K9SA 4ATEA 4FAHA 1CAUA 1BQPA 4YW5A 4AF9A 2GP3A 2HEVF 3K4DA 1AYN3 5L7OB 4EYUA 4G4FA 2WQ4A 3OYWB 4Q4V2 4QQOA 3I59B 4LBQB 3S57A 5E16A 1H8TA 2D3RA 2YGMA 2JD9A 1IS6A 1QOOA 5BNPA 4XCBA 3CO2A 2PLV2 1AYM1 1H1IA 2Y6LA 1VMJA 1QQP3 1JZ4A 2BP6A 4YW2A 2Z2SB 3KQ4B 4XTMA 1U5XA 3ZO0B 5C5UA 5KXEA 4Y5Z0 2VECA 3GBGA 1HQWA 2VZUA 4QKFA 1PZ8A 1OUSA 2WYSA 3MBWA 4YVSB 5FXWA 5AC91 4RHV2 5FPXA 4AHWA 2F4LA 2UYAA 3T1LA 4JHTA 1AF9A 1TMF3 2UYBA 1SFPA 4WVWA 4AYUA 2R071 4Z8BA 4WM7B 2JJ6A 2CGNA 1OVPA 5FP8A 2W68A 3MICA 4P14A 2YG0A 2CWSA 2VZRA 5JVVA 2ZHKA 2WO7A 2A70A 3AP9A 3T2OA 3J9SA 1W6PB 4ISQA 3PVBB 2TNFA 4M4RA 2Z69A 4OULA 3I2FA 2WFF1 1HW5A 3QCWA 4OHWA 2X53S 2XOMA 1JH5A 1RUD1 1LOBA 2A7AA 4Y1VA 1UWWA 5EJ3A 4AGGA 4BIOA 5FMOS 2D5FA 2NYYA 3ZFEB 1CZTA 4FFGA 3JXSA 2OQ6A 3SKVA 4HKLA 3NRUA 4M3CE 2CL2A 4H14A 4META 3T30A 4QXBA 4AZZA 5JOYA 2V5DA 5ANQA 5JI7A 4BQ4A 5FY8A 2P5BA 3ZKUA 4HKWA 3I54A 4DINB 4NWVA 2X5IA 1JI6A 2W47A 3Q9OA 4AFBA 4RA0A 2XJSA 4ZZ8A 1UF2C 2A6WA 3PUAA 4PIZA 4E2QA 4CDWC 5FY0A 1V9U2 2YXSA 4K7JA 1LULA 3S5AA 2EIEA 3MIHA 4Q4V1 2AEZA 4FPYA 3SCHA 5FK8A 4YW7A 2FBEA 4K21A 4KG0A 5FMBA 5J36A 3DPRC 3RS6A 1LHVA 1WWYA 4CP0A 1TME1 4O61A 5CG9A 4XJWA 3CDZB 4AK3A 1W8NA 1XNAA 4EN7B 3ZSMA 3GBWA 5IAVA 2AGSA 3WNLA 3FLRA 4Y22A 4N9IA 4XF4A 2VCCA 4XC9A 4EN8B 1UU5A 3UT0A 1A6CA 3LOIA 4A6OA 1VR3A 3WUDA 4QDQA 2AREA 3DPRA 2DURA 5ERLA 1NXD1 4CDUB 1CESA 5CAZA 1O3SA 2AACA 1UOFA 5E6HA 3MV01 3ACIA 1CAXB 2E7QA 4YM1A 4XUPA 4PDWC 5LA9A 1FV3A 2ZGLA 2QNKA 4HETA 1C4RA 4MGIE 4IEZA 3PNAA 3POJA 4OHXA 4AEKA 3M4FA 2CHHA 4ZPIA 3T1MA 4F83A 2BGPA 1SPPB 2W52A 2NM1A 2X5IC 3B02A 4CSWA 1RUOA 3I2GA 5C4WB 2GC2A 2R041 2CU5A 2O1QA 1U5YA 3VZOA 1H4GA 1JODA 3BGAA 1YO8A 5FO7B 3T2QA 5CA6A 3CEWA 1NA1B 4NMIA 3KV5A 4FO9A 1QWRA 5A1AA 4YVSA 4B4RA 3DUIA 5FYTA 2O8QA 3KM5A 1MS9A 2ARBA 3LIHA 1Z7S1 4IUGA 2V73A 4UAPA 4EN9B 1QMJA 3WNKA 4P9XA 3TNPB 5A7WA 4CU6A 1VPHA 1HX6A 2BNNA 3QOPA 1ENXA 3WF2A 4DUXA 5GZGA 2DVDA 3AJYA 3AM2A 2TEPA 3H7JA 3NAPC 3UKTA 4CDXA 3H8XA 3THPA 1W9WA 4H7MA 1OH4A 4UFJA 1W9SA 2BZDA 1P8JA 5FZIA 1R083 1W2AX 3OTFA 3AFGA 4FQZA 1N3OA 2P3JA 2ARAA 1EAH3 4DXRA 5JOWA 2XHKA 1GP5A 4L99A 4NROA 4WV8A 1XPWA 3ZM8A 1TQ5A 1HB1A 1QF3A 3WW2A 5DUWA 4QPGC 1A3KA 1AR61 2XJUA 1S55A 1REFA 1YC61 2VU9A 1SCRA 3VBFB 2ZGSA 5A3WA 5F5CA 3A23A 3MEPA 4M3CF 3WDXA 5A6YA 4PDWB 3H0OA 1CAWA 2GH2A 1UMIA 1SLLA 1NXMA 1RL3A 1AR73 1OKOA 2HWF2 3KV9A 3WZ1A 3W58A 4DPNA 5GM0A 3IDEA 3N4MA 2GP5A 5JLVA 2NPIA 3K77A 3A7QA 4ZONA 4BA6A 4IXLA 1XE0A 3C7HA 4K1ZA 5CVRA 5A80A 3O1OA 1UYYA 4Z07A 5FQ0B 2VD7A 3RFRA 2RJ2A 5CFDB 4XDOA 4M0HA 3MFAA 1E5IA 2WAOA 2W91A 1IPJA 4B7EA 5EQUA 4URAA 1IQAA 4B7KA 5SV5A 4L0PA 2R0FA 3AL5A 1BVVA 1OBNA 1M4WA 3VHNA 5L19A 4IE5A 5E89A 4ZU5A 4OUMA 1AUYA 1QJY3 2F6BA 1OQDA 3J7NA 5FZLA 3FJSA 1MZFA 5FY4A 3VBOC 3ES4A 4CEWC 1STMA 1AL23 3ZR5A 1GOGA 1S0DA 2HWE1 5F6KA 2EIBA 3WF0A 4LXLA 2CGPA 4LORA 4OYUA 3UKVA 1YI9A 4AQTA 5FPUA 1ZRIA 3GJAA 5F3EA 1YQ6A 3RRDA 3JU9A 1BK1A 3MIFA 1PMJX 5H9SA 4FVVA 2XVGA 4E8DA 5D8AC 2VL4A 4I3PA 4E4ZA 4XQWA 2Q8EA 5IVEA 4INDA 3VBFC 1YIPA 2VXRA 1V6KA 4F8AA 4QDSA 1H2LA 4TWTA 3TNQA 2NLRA 5CADA 4C0BA 2BV4A 1G9AA 3MIEA 4BQ3A 4LJHA 3NMBA 1RYYA 3O0XA 4LIVA 1N1TA 4AAXA 2PXJA 1DZQA 5IVBA 2GNDA 2PHWA 2Y26A 1RUD3 3NVCA 4JZRA 4N43C 4BISA 1ZBA2 2W46A 2J1AA 2JIJA 3D8CA 2BDRA 4M3CB 4N7IA 2CAUA 4I2OA 1RXFA 4KGQA 5FKBA 1XYPA 2WLQA 1VAMA 4MYEA 2HWC3 4XCAA 1YXWA 4D3WA 4AFAA 1UZYA 1POQA 3GCWA 2JB8A 2XQRA 1MZEA 4DY5A 1WCDJ 4CVUA 5A70A 2OX0A 3RMXA 1BYHA 4HZFA 3TB0A 5EJ1B 4Q5OA 1B35A 4XUOA 2LALA 1GSLA 3AMMA 5FY1A 5LCWL 3VD4A 4Y1XA 2NQYA 3OUIA 1O7FA 2CWMA 1BBT1 1RHI3 3IKWA 5FY9A 3KCYA 2WQZC 5JSRA 4GMP1 4EWDA 1D0HA 3IAPA 4DY3A 3MLKA 3MW2A 3VBHB 2YFUA 5KR7A 3HJRA 4KWLA 4L9BA 3WX5A 1V6LA 4HK8A 1LNSA 3BPSA 4CA9A 4AW7A 5IVJA 3IWZA 3PMEA 3AP7A 5JPMB 3GJBA 1H30A 1HXS2 2BVVA 2RDNA 5F5IA 1OLME 1UKGA 4MSVA 1JYIA 4A41A 3FN9A 2KR2A 5T54A 5FPBA 5DZGA 1B09A 1NLQA 1W6NA 1DQ5A 3S7EA 2DUOA 4QGLA 4QM9A 3CF6E 5DQ0A 1MQTC 4Q4X1 3FLPA 5FYYA 2NZ9A 2YBSA 4L97A 3Q8CA 4KGGA 1NCRB 1ZBE1 2WNUA 4QXCA 3ZYJB 1IG0A 1F5JA 1O91A 1POV0 4RN5A 2RMU3 1W6PA 1NLSA 5JOZA 5FZHA 3T0AA 5JSPA 2WINB 4CP9A 4CDQB 4AQ2A 2W9XA 3ZYPA 1UY4A 1UY2A 2ZGPA 4ASLA 5JR7B 2XGXA 2ZHMA 3T09A 2DCTA 3DXUA 3OBRA 3THDA 2OUJA 3OPWA 1KQRA 1N1VA 1HV0A 2JDZA 5C9AA 3LSDA 4LE3A 5DN2A 3MIDA 5F1RA 4LHNA 1COV2 1JUIA 1DGWX 2KXLA 4ZZ5A 4SBVA 4XUNA 3N9MA 5KHKA 1K5MC 2ZX4A 1UOJA 4GJYA 2HWF3 3ZFEC 3HN1A 2DBIA 5EYYA 2PLV3 1VBE1 5G05L 5HXVA 4AQ6A 5FP4A 4KWUA 2GH8A 2VMGA 4AR2A 2Z79A 1NA1C 1FV2A 5C4WC 4ONUA 1EP0A 5BNQA 4NIGA 4Y4RA 3GHMA 5IYYA 5FYVA 4BLIA 3OYWA 2VUJA 4BB3A 4Y1UA 4HBNA 1RUF2 4R52A 1LHUA 4HN1A 4K40A 2HJIA 4O9GA 4MXVA 4CP2A 2BQPA 3QACA 2A71A 2FCUA 4ZS3A 3RNSA 3ZMOA 4CU9A 1UZZA 1US3A 2WNVB 4EJRA 1C1FA 3VKNA 3T3YA 2RJLA 4CE8A 3PMSA 2YC0A 2D44A 3RG0A 3WDWA 2HLEA 5L9BA 1PIV2 2W5FA 3BOPA 5C3SA 1OLMA 4Q26A 1DFQA 1WW4A 4QB6A 3T2TA 1I9RA 2HWB3 1BMV1 2PQQA 1LOGA 2K0GA 3EMRA 4M01A 3WG1A 1NCQA 1ZRFA 3WUCA 3O14A 3AMNA 3WQBA 3E6BA 1PVC1 3IDBB 1S0CA 4OZOA 1EV11 5CKNA 3DECA 4LHKA 3WP4A 1NCRC 3K48A 3NNFA 1W2NA 5A7WB 1C5IA 2GZWA 4HK9A 1AYN1 1SLIA 2JXAA 3APBA 4XFCA 1GNYA 3ZFEA 3ACLA 4ITCA 3UJQA 4BQYA 2P17A 2ZX0A 3ME2A 4AL9A 2ZCWA 4NRQA 4OLLA 4EZ4A 5J96B 2WC2A 3LA3A 1VBC1 1I3HA 2QQWA 4QQ2A 5D8AB 4OHZA 5C3PA 3EBRA 5C9AC 5FO8B 1XBFA 1GWLA 1RMU2 1JN2P 3K46A 3S30A 2D93A 4AEDC 1PVC2 3HPNA 5GALA 3AVSA 4JDOA 2C26A 3A21A 4Y20A 3BN6A 5CZKA 5EZWA 5KXCA 1W9TA 2MEV2 3ZN6B 4LULA 1RIRA 2VMFA 4AQSA 3C7OA 1CJPA 1DGRN 3LB9A 4WVMA 4YWAA 2YC4A 4QXKA 1JYTA 2R49A 3Q8AA 1ZM1A 4N9HA 3ZFGC 3P6BA 5LW9A 5A7QA 4EWAA 1AR82 2RE9A 1QIQA 1NX9A 1OPMA 5FRAA 2H6BA 2YC2A 1O4TA 1GP4A 1S2EA 1RVF1 2A5ZA 2O0OA 1M06G 5FZOB 3HD8B 2A73B 4XDQA 3AKQA 4FTEA 4UFIA 1NLRA 2BUKA 2VZVA 1KDMA 1C5HA 3PTRB 2HWD1 5LBCA 1CONA 1Z78A 1PVC3 2WYFA 2VAUA 3WG4A 1VBD3 2VGDA 4LBJA 3DL3A 3KHBA 4G9SB 3LPFA 3W21A 1QY4A 4QGMA 5C71A 2FDHA 4I09A 1LODA 1L7QA 2C0ZA 2VZPA 3BTZA 3H3LA 3ZSJA 5JDBA 3WINE 4LNVA 4IGPA 4AI8A 4UW6A 1RUC2 4OVEA 2VMDA 4B1MA 4Z2AA 4XJ8A 1LJ7A 3HT1A 2VZ1A 1KJRA 1ASJ1 2VOKA 4MXWA 4HN0A 4W6WA 1W6MB 2WN3A 2HWC1 2ZX2A 2J1RA 3MW4A 4AVVA 4GH4C 2WKKA 4CUCA 1HQNA 2VMEA 3FL7A 4QPYA 4QX1A 1HKDA 5I0UA 4EE2A 4DEVA 3VZLA 2WLPA 1X9TA 2BBAA 5KXDA 3C7EA 3EQEA 5D1IA 1FI2A 5IAXA 2HWC2 3I2HA 4M0NA 4GQ7A 2DVGA 5FYMA 2VE1A 2JB4A 2Y8KA 4HLTA 1AJOA 4HT1T 5I0TA 4EV0A 4LHSA 5FO9B 2E32A 2JG8A 1RUC3 3ENRA 4LO6B 4UBHA 3WHUA 2WJSA 3KT1A 5GZFA 3NV2A 1LAJA 4AHXA 3VD9A 2D43A 4IV3B 4QKBA 4XJUA 1RHI2 1PNGA 3KF3A 1YRZA 4Q0PA 1MR5A 4LO7A 1WW7A 4CU8A 2XG3A 1UOGA 1CAVA 3Q8EA 1EAH2 2Z5WA 1UNBA 4CCOA 1AX2A 1SLTA 3DCQA 2G9GA 3FMGA 4WZFA 2Q8DA 3RJRA 3ZYIB 2HWD2 4DUWA 4GB33 1HRV3 1IPKA 1WUVA 2JG9B 3JD73 4M3CA 2FMDA 4UWDA 3I2DA 1BXHA 4IE4A 2D97A 1H2NA 2R0HA 2WNEA 3LE0A 4Y26A 1LOCA 3I3MA 2G1MA 4X8NA 2GMEA 3E5XA 1LHOA 2TUNA 1PGW2 3N9PA 1NE6A 1QXPA 4MV2A 5J48A 1PO22 4YW6A 2AZ5A 1UN1A 2RMU2 1QGLA 4URTA 2BOJA 4W4ZA 5I8TA 3U07A 5HXMA 2Y6GA 1PGL1 1PK6B 1SBEA 3ECQA 1W8HA 4YW1A 3SQOA 4DOUA 5LEJA 5K8SA 4QPWA 2J7MA 2RS13 4C1XA 1O3QA 5JCTA 1JMUB 1KD7A 5JXHA 1X8MA 1AYN2 2ZGQA 3ETPA 3PURA 4Q4W3 2J1VA 4Z82A 4OI4A 2P4EA 3VDDB 3WDVA 4JGZB 1QOSA 2BWCA 4FP3A 4FBFA 3BB6A 5FMDA 3IPVB 5DZEA 4LBLA 2XJQA 1WMXA 3PLQA 3I2KA 3HR9A 2FDGA 4C0HA 3F95A 4E4HA 1JZ3A 4FCAA 5C3OA 2A6YA 1PO23 4NAMA 3MPPG 1ND3A 1MVEA 4LPLA 4XPVA 3WQ7A 2R1DA 2E53A 5LWBA 1RUNA 1HRV1 1QJY2 1PO11 1ZZ8A 3HN3A 2Y6HA 1ST8A 2UY9A 4IL7A 5KHIA 1K5MB 1TMF2 3LCPA 4I30A 4WM7A 1AL22 4CCMA 5A1FA 3ATGA 3C8XA 3PU3A 1SDDB 5BNPC 1MACA 2DFBA 3DV8A 2I2SA 4Q4W2 4MGSA 4XHXA 1ULCA 4YVWA 2CYFA 5IFPA 3VDBA 5FQ0A 1JUHA 3NWKA 4Q0QA 4P5HA 4XXAA 4E9KA 3SH3A 4Y5TA 5FLIA 1DGRA 2VCMA 2WFF2 4H3WA 5A7SA 3ZN5A 1W6NB 1ZA7A 2A6ZA 4BWOA 1H1MA 2VZQA 4FFHA 5T3NA 2YUEA 4KL1A 5FYIA 4RGKA 2W87A 1S0BA 1YUDA 4JDMA 2RS11 1EV13 3MF6A 4W65A 3UYJA 3ZXLA 3PUQA 3VBUB 4LA2A 2BFUS 1SBDA 4COWA 2WSUA 1Y43B 1OOPA 2Y0OA 1RITA 4TLFA 3E6CC 1D2SA 4MUVA 4EZHA 4AOCA 1VBE2 1VAVA 1K5JA 2Y34A 1ZBA3 2G9FA 3VBHA 1DHKB 2YZ4A 2JX9A 3VZKA 4DXZA 1RUG2 3FWEA 3IZOA 1DGLA 1WLTA 2PMWB
chains in the Genus database with same CATH topology
3BGAA 3C7FA 2WDBA 3T2QA 1PX3A 3OGVA 5A1AA 3WEZA 2VC9A 1JU3A 1XNTA 3CZJA 4IUGA 4UAPA 3IAQA 3I3BA 1W0NA 3WNKA 2QQJA 3MUY1 2JE8A 4CU6A 4BJ0A 2VTFA 4DUXA 2X05A 1UZ0A 3WF2A 5HPOA 3C7GA 2L9LA 4HG6B 3K4ZA 1MPXA 2J1SA 1W9WA 1OH4A 1W9SA 2BZDA 1P8JA 3OBAA 3ACHA 3GM8A 1JHJA 2XONA 4DXRA 3PUHA 3I2JA 2B4KA 2WO2A 2W1SA 1XPWA 2Y6KA 1K42A 2C4XA 4MADA 3WF3A 2CDPA 3I2IA 1UXXX 3A23A 4QB2A 2LS6A 1KGYA 1OD3A 1UMIA 2VZTA 4P08A 3HNMA 3EB7A 3OB8A 1W8OA 3F2ZA 2DCKA 3K77A 4UI9L 3A7QA 3DYMA 3HNBM 4XUTA 3C7HA 3SEPA 1UYYA 1ULPA 2QQMA 2OKXA 2RJ2A 2V4VA 2WAOA 3LEGA 2W91A 5J1XA 4L0PA 5JR2A 1NAEA 1JYWA 3FHQA 2ORZA 4W8JA 1J83A 1DYOA 5LA0A 3K4AA 1UYXA 2WABA 3GXUA 5JUVA 3WF4A 1GOGA 5IJRA 3WF0A 3LQCA 4JKLA 2EIBA 1UY1A 4BXSV 2XHNA 3EYPA 2XQXA 4OYUA 3WNPA 4KI5M 3NQHA 1TVGA 1PMJX 4E8DA 4TTGA 1WCQA 2VL4A 1F4AA 2VJXA 2WQ8A 2R7EB 2E26A 4QDSA 4P00B 1RYYA 1H6YA 3IIIA 2QQIA 2QQOA 4TXWA 4AAXA 4BK5A 2VCBA 2ORXA 5FUIA 2Y6JA 1OT5A 2W46A 5DMYA 3T0DA 4A45A 2J1AA 2ID4A 2BERA 2W92A 5LA2A 4CVUA 3CIHA 4A3ZA 1UMHA 5EJ1B 5IFTA 4XUOA 5LCWL 3VD4A 3PUIA 3IAPA 3VD5A 4ARYA 2YFUA 4XUQA 3CQOA 3WNNA 1GMMA 3HJRA 5B4XA 2ZEWA 4DEQA 3AC0A 1LNSA 3W5NA 3CMGA 1JYVA 1GUIA 2DCJA 1K45A 5CYYA 4JKKA 3GDBA 5C70A 1F4HA 3ABZA 1JZ8A 4A41A 3CKHA 1WKYA 3I3DA 4DXTA 3FN9A 1O8PA 3SEEA 3WNMA 4A44A 5DQ0A 1SHWB 4AG4A 4W50A 2VQTA 4XZUG 3D3AA 4RN5A 2VQUA 3T0AA 1EUTA 2W9XA 1UY4A 1UY2A 2W1QA 3E1F1 3T09A 3J7HA 3THDA 2VOTA 2C9KA 2J1TA 4FI9A 5DN2A 3T0BA 4ZZ5A 4XUNA 1DLCA 2ZEXA 1JZ6A 1PX4A 1DP0A 3IB3A 3GGLA 3SKJE 5G05L 2KD7A 3WNOA 4KWUA 5EJZB 2WBKA 2YB7A 5C7GA 3HEIA 4PQQA 3OEAA 2JDAA 5IYYA 1OF3A 3FHAA 1CX1A 1J84A 2EIDA 2RV9A 3A22A 2W1UA 4QB1A 2WO3A 2VZSA 2HYXA 3ACFA 4D8MA 4CU9A 1US3A 4CUAA 4GWJA 4OMCA 2WO1A 4E8CA 2HLEA 2W5FA 4P5YA 3VDCA 1BHGA 1UY0A 4QB6A 4M4PA 3UESA 4ET7A 3NJVA 3WQBA 2VZOA 2PQSA 2BGOA 4OMDA 2WAAA 4OZOA 3DECA 2W95A 2Z4FA 1UXZA 1NKGA 3LEKA 4BK4A 4DUVA 1KEXA 2E31A 1JZ5A 5G04L 1GNYA 4QX2A 5JXJA 2WUHA 2B9VA 3HNYM 1D7PM 4MOAA 4P02B 3CZUA 5F7UA 3K46A 3HPNA 5CZKA 5DPNA 2C26A 3A21A 3BN6A 2V72A 2JKXA 1CZVA 4QDRA 1W9TA 2ZXQA 5I0DA 2EICA 3P1IA 2VMFA 3C7OA 3OEBA 2VZ3A 1US2A 1XC6A 2X09A 5IHRA 2YC4A 4PF1A 2QQKA 4MO3M 2W94A 2LW8A 3P6BA 3OG2A 3T2PA 1ULOA 1NX9A 1GOHA 1CZSA 2YC2A 2QBXA 1O8SA 4JKMA 4QX3A 1GOFA 5JXIA 4CU7A 2VZVA 2J1EA 3WSOA 3NNGA 1R64A 4PT6A 2W3JA 4ZY9A 4DXSA 4XVHA 1UYZA 1K12A 3LPFA 4RYDA 3MO4A 2VCAA 1CIYA 5C71A 1OF4A 1L7QA 4QX0A 2VZPA 4JX0A 4ZXEA 2E33A 4YPJA 4CUBA 4QAWA 2VMCA 1EUUA 1GQPA 4Z2AA 2VMDA 4UOJA 3T08A 2VO5A 2VZ1A 1GU3A 3DYPA 1W99A 2VM9A 2WN3A 4LQRA 2J1RA 4CUCA 3UNPA 2VMEA 3FL7A 4QX1A 3W5MA 1NUKA 2VR4A 1YQ2A 1H6XA 2Y64A 4DEVA 2BBAA 4KMQA 3C7EA 3I2HA 3MUZ1 2ZEYA 2Y8KA 2CDOA 4D0QA 4LHSA 3K4DA 2E32A 2WN2A 3VD9A 2RVAA 2J22A 3I3EA 3THCA 2JD9A 1JZ2A 3K75B 4MGQA 1K3IA 2Y6LA 1JZ4A 2J1UA 4CU8A 1SG3A 3VD3A 3NJXA 1IQDC 1JU4A 2VZUA 2WYSA 2WZ8A 3MBWA 2QQNA 3LEIA 4DUWA 1JYNA 2WZEA 3LPGA 1HN1A 1PMHX 3DYOA 3LE0A 2YG0A 4LKSA 2VZRA 1I5PA 3T2OA 4M4RA 3ACGA 1UY3A 3I2FA 4ARXA 2XOMA 4W4ZA 4BDVB 5HXMA 1UWWA 2Y6GA 3HOBA 5B4NA 1TG7A 3ECQA 1CZTA 4QPWA 2J7MA 3JXSA 3I97A 3SKVA 1JZ7A 3NRUA 3WF1A 5JXHA 2V5DA 3ETPA 2J1VA 1JI6A 2ZEZA 2W47A 4XURA 1L7RA 2W1WA 4ZZ8A 3U37A 3I2KA 1O59A 1JZ3A 2EIEA 3VDAA 4LPLA 3ZM8A 1T2XA 3OGRA 3HN3A 2Y6HA 3MV11 2X10A 3CDZB 3C8XA 1SDDB 1W8NA 1XNAA 3VDBA 4MGSA 4JHZA 3WNLA 5IFPA 1JYXA 2YFZA 4A4AA 2VCCA 4GZ9A 3OGSA 3IDAA 3UETA 4A6OA 4QDQA 2VZQA 2W87A 2DDUA 2QQLA 4A42A 3MV01 3ACIA 4XUPA 5JXGA 4OUEA 5JMOA 5LA1A 5EIYB 1UX7A 2BGPA 3VD7A 3I2GA 4GWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGA A;  3C7F A;  2WDB A;  3T2Q A;  1PX3 A;  3OGV A;  5A1A A;  3WEZ A;  2VC9 A;  1JU3 A;  1XNT A;  3CZJ A;  4IUG A;  4UAP A;  3IAQ A;  3I3B A;  1W0N A;  3WNK A;  2QQJ A;  3MUY 1;  2JE8 A;  4CU6 A;  4BJ0 A;  2VTF A;  4DUX A;  2X05 A;  1UZ0 A;  3WF2 A;  5HPO A;  3C7G A;  2L9L A;  4HG6 B;  3K4Z A;  1MPX A;  2J1S A;  1W9W A;  1OH4 A;  1W9S A;  2BZD A;  1P8J A;  3OBA A;  3ACH A;  3GM8 A;  1JHJ A;  2XON A;  4DXR A;  3PUH A;  3I2J A;  2B4K A;  2WO2 A;  2W1S A;  1XPW A;  2Y6K A;  1K42 A;  2C4X A;  4MAD A;  3WF3 A;  2CDP A;  3I2I A;  1UXX X;  3A23 A;  4QB2 A;  2LS6 A;  1KGY A;  1OD3 A;  1UMI A;  2VZT A;  4P08 A;  3HNM A;  3EB7 A;  3OB8 A;  1W8O A;  3F2Z A;  2DCK A;  3K77 A;  4UI9 L;  3A7Q A;  3DYM A;  3HNB M;  4XUT A;  3C7H A;  3SEP A;  1UYY A;  1ULP A;  2QQM A;  2OKX A;  2RJ2 A;  2V4V A;  2WAO A;  3LEG A;  2W91 A;  5J1X A;  4L0P A;  5JR2 A;  1NAE A;  1JYW A;  3FHQ A;  2ORZ A;  4W8J A;  1J83 A;  1DYO A;  5LA0 A;  3K4A A;  1UYX A;  2WAB A;  3GXU A;  5JUV A;  3WF4 A;  1GOG A;  5IJR A;  3WF0 A;  3LQC A;  4JKL A;  2EIB A;  1UY1 A;  4BXS V;  2XHN A;  3EYP A;  2XQX A;  4OYU A;  3WNP A;  4KI5 M;  3NQH A;  1TVG A;  1PMJ X;  4E8D A;  4TTG A;  1WCQ A;  2VL4 A;  1F4A A;  2VJX A;  2WQ8 A;  2R7E B;  2E26 A;  4QDS A;  4P00 B;  1RYY A;  1H6Y A;  3III A;  2QQI A;  2QQO A;  4TXW A;  4AAX A;  4BK5 A;  2VCB A;  2ORX A;  5FUI A;  2Y6J A;  1OT5 A;  2W46 A;  5DMY A;  3T0D A;  4A45 A;  2J1A A;  2ID4 A;  2BER A;  2W92 A;  5LA2 A;  4CVU A;  3CIH A;  4A3Z A;  1UMH A;  5EJ1 B;  5IFT A;  4XUO A;  5LCW L;  3VD4 A;  3PUI A;  3IAP A;  3VD5 A;  4ARY A;  2YFU A;  4XUQ A;  3CQO A;  3WNN A;  1GMM A;  3HJR A;  5B4X A;  2ZEW A;  4DEQ A;  3AC0 A;  1LNS A;  3W5N A;  3CMG A;  1JYV A;  1GUI A;  2DCJ A;  1K45 A;  5CYY A;  4JKK A;  3GDB A;  5C70 A;  1F4H A;  3ABZ A;  1JZ8 A;  4A41 A;  3CKH A;  1WKY A;  3I3D A;  4DXT A;  3FN9 A;  1O8P A;  3SEE A;  3WNM A;  4A44 A;  5DQ0 A;  1SHW B;  4AG4 A;  4W50 A;  2VQT A;  4XZU G;  3D3A A;  4RN5 A;  2VQU A;  3T0A A;  1EUT A;  2W9X A;  1UY4 A;  1UY2 A;  2W1Q A;  3E1F 1;  3T09 A;  3J7H A;  3THD A;  2VOT A;  2C9K A;  2J1T A;  4FI9 A;  5DN2 A;  3T0B A;  4ZZ5 A;  4XUN A;  1DLC A;  2ZEX A;  1JZ6 A;  1PX4 A;  1DP0 A;  3IB3 A;  3GGL A;  3SKJ E;  5G05 L;  2KD7 A;  3WNO A;  4KWU A;  5EJZ B;  2WBK A;  2YB7 A;  5C7G A;  3HEI A;  4PQQ A;  3OEA A;  2JDA A;  5IYY A;  1OF3 A;  3FHA A;  1CX1 A;  1J84 A;  2EID A;  2RV9 A;  3A22 A;  2W1U A;  4QB1 A;  2WO3 A;  2VZS A;  2HYX A;  3ACF A;  4D8M A;  4CU9 A;  1US3 A;  4CUA A;  4GWJ A;  4OMC A;  2WO1 A;  4E8C A;  2HLE A;  2W5F A;  4P5Y A;  3VDC A;  1BHG A;  1UY0 A;  4QB6 A;  4M4P A;  3UES A;  4ET7 A;  3NJV A;  3WQB A;  2VZO A;  2PQS A;  2BGO A;  4OMD A;  2WAA A;  4OZO A;  3DEC A;  2W95 A;  2Z4F A;  1UXZ A;  1NKG A;  3LEK A;  4BK4 A;  4DUV A;  1KEX A;  2E31 A;  1JZ5 A;  5G04 L;  1GNY A;  4QX2 A;  5JXJ A;  2WUH A;  2B9V A;  3HNY M;  1D7P M;  4MOA A;  4P02 B;  3CZU A;  5F7U A;  3K46 A;  3HPN A;  5CZK A;  5DPN A;  2C26 A;  3A21 A;  3BN6 A;  2V72 A;  2JKX A;  1CZV A;  4QDR A;  1W9T A;  2ZXQ A;  5I0D A;  2EIC A;  3P1I A;  2VMF A;  3C7O A;  3OEB A;  2VZ3 A;  1US2 A;  1XC6 A;  2X09 A;  5IHR A;  2YC4 A;  4PF1 A;  2QQK A;  4MO3 M;  2W94 A;  2LW8 A;  3P6B A;  3OG2 A;  3T2P A;  1ULO A;  1NX9 A;  1GOH A;  1CZS A;  2YC2 A;  2QBX A;  1O8S A;  4JKM A;  4QX3 A;  1GOF A;  5JXI A;  4CU7 A;  2VZV A;  2J1E A;  3WSO A;  3NNG A;  1R64 A;  4PT6 A;  2W3J A;  4ZY9 A;  4DXS A;  4XVH A;  1UYZ A;  1K12 A;  3LPF A;  4RYD A;  3MO4 A;  2VCA A;  1CIY A;  5C71 A;  1OF4 A;  1L7Q A;  4QX0 A;  2VZP A;  4JX0 A;  4ZXE A;  2E33 A;  4YPJ A;  4CUB A;  4QAW A;  2VMC A;  1EUU A;  1GQP A;  4Z2A A;  2VMD A;  4UOJ A;  3T08 A;  2VO5 A;  2VZ1 A;  1GU3 A;  3DYP A;  1W99 A;  2VM9 A;  2WN3 A;  4LQR A;  2J1R A;  4CUC A;  3UNP A;  2VME A;  3FL7 A;  4QX1 A;  3W5M A;  1NUK A;  2VR4 A;  1YQ2 A;  1H6X A;  2Y64 A;  4DEV A;  2BBA A;  4KMQ A;  3C7E A;  3I2H A;  3MUZ 1;  2ZEY A;  2Y8K A;  2CDO A;  4D0Q A;  4LHS A;  3K4D A;  2E32 A;  2WN2 A;  3VD9 A;  2RVA A;  2J22 A;  3I3E A;  3THC A;  2JD9 A;  1JZ2 A;  3K75 B;  4MGQ A;  1K3I A;  2Y6L A;  1JZ4 A;  2J1U A;  4CU8 A;  1SG3 A;  3VD3 A;  3NJX A;  1IQD C;  1JU4 A;  2VZU A;  2WYS A;  2WZ8 A;  3MBW A;  2QQN A;  3LEI A;  4DUW A;  1JYN A;  2WZE A;  3LPG A;  1HN1 A;  1PMH X;  3DYO A;  3LE0 A;  2YG0 A;  4LKS A;  2VZR A;  1I5P A;  3T2O A;  4M4R A;  3ACG A;  1UY3 A;  3I2F A;  4ARX A;  2XOM A;  4W4Z A;  4BDV B;  5HXM A;  1UWW A;  2Y6G A;  3HOB A;  5B4N A;  1TG7 A;  3ECQ A;  1CZT A;  4QPW A;  2J7M A;  3JXS A;  3I97 A;  3SKV A;  1JZ7 A;  3NRU A;  3WF1 A;  5JXH A;  2V5D A;  3ETP A;  2J1V A;  1JI6 A;  2ZEZ A;  2W47 A;  4XUR A;  1L7R A;  2W1W A;  4ZZ8 A;  3U37 A;  3I2K A;  1O59 A;  1JZ3 A;  2EIE A;  3VDA A;  4LPL A;  3ZM8 A;  1T2X A;  3OGR A;  3HN3 A;  2Y6H A;  3MV1 1;  2X10 A;  3CDZ B;  3C8X A;  1SDD B;  1W8N A;  1XNA A;  3VDB A;  4MGS A;  4JHZ A;  3WNL A;  5IFP A;  1JYX A;  2YFZ A;  4A4A A;  2VCC A;  4GZ9 A;  3OGS A;  3IDA A;  3UET A;  4A6O A;  4QDQ A;  2VZQ A;  2W87 A;  2DDU A;  2QQL A;  4A42 A;  3MV0 1;  3ACI A;  4XUP A;  5JXG A;  4OUE A;  5JMO A;  5LA1 A;  5EIY B;  1UX7 A;  2BGP A;  3VD7 A;  3I2G A;  4GWI A; 
#chains in the Genus database with same CATH topology
 3AZW A;  4ORF A;  1DQ4 A;  4NIA A;  3RZL A;  1OVS A;  4LR4 A;  5DXD A;  1LHW A;  1TZO A;  4FPK A;  1G86 A;  3BOD A;  1PX3 A;  2LM3 A;  3OGV A;  5IK8 A;  2Q0A A;  1DBN A;  5KWR A;  1RMU 3;  5FYZ A;  4XQD A;  1XU2 A;  3KCC A;  3M2M A;  2VH9 A;  4X6R B;  4JV4 A;  3CZJ A;  3IAQ A;  2C24 A;  4AWD A;  4NN0 A;  4FTB A;  2ZZJ A;  2IUW A;  5DDJ 3;  5J98 B;  1VBB 3;  4D6S A;  2B45 X;  3ZYF A;  2XXZ A;  2ZJC A;  3ZYB A;  2D6N A;  5LBF A;  3V64 A;  1O4Z A;  3D0J A;  1Y9M A;  2L9L A;  2OXB A;  3USU A;  4LEJ A;  2BNM A;  4YLZ A;  4Y33 A;  4IET A;  2ADD A;  4H2A A;  2R32 A;  5FY5 A;  3K4Z A;  5C3Q A;  2DU0 A;  1YQC A;  4NHX A;  4NOT A;  1N3P A;  1UW8 A;  2ES3 A;  2IXI A;  1WD3 A;  3AKR A;  4YVW C;  4Y5S A;  3GM8 A;  3MYX A;  1JHJ A;  2ZGK A;  2FDI A;  5CKM A;  2JDP A;  2FCT A;  2GU9 A;  3GCX A;  2HWB 1;  3I2J A;  3PUH A;  2W1S A;  2DCY A;  3AYE A;  3EHK A;  4AI0 A;  4XAB A;  4YFW A;  4AEM A;  5TSW A;  5J37 A;  1XSQ A;  2GDF A;  3INA A;  1S0E A;  2XWB B;  1FAT A;  2JEC A;  2YV8 A;  3NAP A;  3OY8 A;  3WCS A;  4CDX C;  4FP2 A;  4QB2 A;  1PHM A;  2LS6 A;  3IPV A;  2D6L X;  2GC1 A;  3PU8 A;  1GWK A;  3BKZ A;  3SXW A;  3ZLI A;  3MW3 A;  1O5L A;  3FE5 A;  1G9F A;  1NOV A;  2NN8 A;  2OVU A;  2R07 2;  3GYD A;  2KM2 A;  3RI8 A;  4RGA A;  3KCX A;  5F8P A;  3V0A A;  2OUH A;  3J26 N;  4Q8L A;  2R1B A;  2XBO 3;  4NRM A;  5FZ8 A;  2DU1 A;  2JDU A;  5EV7 A;  1DQ6 A;  3IIA A;  1VBD 1;  5FWJ A;  3O1S A;  5FLJ A;  4AAP A;  3H3Z A;  5FPA A;  3D5O A;  1QH6 A;  1ULP A;  3EXU A;  4OI1 A;  3KGL A;  4BYY A;  3QH6 A;  3UGG A;  2OKX A;  4P9G A;  2BTV C;  2XBO 1;  4BQW A;  5A6Q A;  2JDH A;  1CN1 A;  5FOJ B;  4BQ2 A;  1RUI 1;  2QE3 A;  1X33 A;  1Y9G A;  4LUM A;  2LRO A;  5JAX A;  4RQP B;  4XFF A;  1RUF 3;  2JDM A;  1OI6 A;  5JR2 A;  1ENS A;  3ZMN A;  5KBF A;  3OCP A;  1QH7 A;  1FMD 1;  4XMI A;  5IVV A;  3U14 A;  1V0A A;  1JYW A;  2IWG B;  2PAK A;  1ENR A;  3PIJ A;  4WBB A;  2ORZ A;  3AYA A;  3KMH A;  4IGQ A;  4CP9 B;  1QKQ A;  4LLF A;  2R04 3;  1LU1 A;  3VDD C;  4GH4 A;  2Q1M A;  3GXU A;  4IE6 A;  2IFR A;  1H8V A;  4DNY A;  2EAA A;  1ZBE 3;  5L36 A;  3O1U A;  4S2G A;  5FJH A;  3RYR A;  1UY1 A;  2UWC A;  3EYP A;  1HJF A;  2IC1 A;  1VMH A;  2XQX A;  4PF5 A;  3BU0 A;  3PHM A;  1Z7S 2;  3VUO A;  1WCK A;  1RB8 G;  4QKD A;  5BNN B;  1RVF 2;  1YLL A;  3O5S A;  4Q4X 2;  2WWU A;  2WZR 2;  1XJA A;  3LFM A;  1HB3 A;  4TTG A;  3N9O A;  3MIG A;  4XFB A;  4CCN A;  1YI7 A;  3RZH A;  3TOJ A;  3QBQ A;  2JWP A;  4XIL A;  2R7E B;  2E26 A;  2XL9 A;  4CDX B;  4CPB A;  3RDI A;  1RUJ 1;  2MHF A;  1QNY A;  1RIN A;  3A4U A;  2ZHN A;  2VNV A;  4IE0 A;  1H6Y A;  4XYX A;  4TXW A;  1QJX 1;  3B5L B;  1GZC A;  1RED A;  2ORX A;  1EYB A;  5ACA 2;  1XYO A;  3CJI B;  5K4L A;  3VKF C;  2ZAB A;  2P1B A;  4NHM A;  3T0D A;  4MXW B;  3JBG 3;  3P3N A;  5A32 A;  3NKG A;  1X7N A;  2GNM A;  1RUE 3;  2ZS6 B;  5GLW A;  1LCL A;  1NCQ C;  5C5T A;  3VGI A;  2MPF A;  2LUW A;  4ZXK A;  1CQ9 A;  3HIF A;  4Q0V A;  1GNZ A;  2B7Y A;  2K46 A;  2X8K A;  4IEX A;  4LBK A;  3RSJ A;  3ZIW A;  3CJX A;  3KWV A;  5A7N A;  5C8C C;  1DIW A;  3HBK A;  3I7D A;  4IGO A;  4CXX A;  4XW3 A;  5BNO B;  4FOQ A;  2Y33 A;  4RFR B;  5A33 A;  5FXV A;  5FCC A;  2MNG A;  2VUD A;  3TAY A;  5ACA 1;  4CEY A;  4YM0 A;  2WA3 A;  1G9C A;  1W2T A;  1JYV A;  3PDQ A;  1FX5 A;  1PIV 1;  2P3Y A;  4P9Y A;  2DCJ A;  3VDD A;  1GV9 A;  4QHB A;  1RUE 2;  4XFH A;  1FOD 3;  3GDB A;  4GAZ A;  4QU1 A;  5A7O A;  1XND A;  3J8F 3;  3ABZ A;  1WKY A;  2BFU L;  3NL1 A;  1MS3 A;  3B3Q E;  4AI3 A;  1W6Q B;  3SEE A;  1N1S A;  5LRS A;  1UAI A;  5EWS A;  2OS2 A;  3JB8 A;  3ZPY A;  3Q8B A;  4NHY A;  4WZC A;  1DZT A;  2QQV A;  3TBD A;  2CY6 A;  2O8O A;  1OUR A;  2ARC A;  3N7K A;  5K0U A;  1CGP A;  1W6Q A;  2ET7 A;  2XLA A;  2A3X A;  1LHN A;  3NAP B;  1FOD 2;  4PIX A;  2W1Q A;  3ZVX A;  5HBA A;  3Q8F A;  1W6O A;  3ELN A;  1OA3 A;  3PVO A;  1LEC A;  3V56 A;  3ZXD A;  4DZG A;  4UYB A;  1VIW B;  3B69 A;  3ZX7 A;  3DKQ A;  2VOT A;  5KXB A;  2DTW A;  5DUV A;  4ES8 A;  2WSV A;  4OUS A;  3T0B A;  4N53 A;  4XAC A;  5HCB A;  1F31 A;  5AVA A;  1DLC A;  2PEL A;  2XUE A;  2ZEX A;  2D5H A;  3ILN A;  4MG2 A;  3E5Q A;  4FQ4 A;  2RDR A;  4ASM B;  3OSD A;  4JCK A;  1DP0 A;  3O7O A;  3MLL A;  4RR3 A;  3VBS A;  2XBO 2;  2FD8 A;  2KD7 A;  1BVP 1;  2DVB A;  2R06 2;  5EJZ B;  4JDN A;  2WBK A;  2YB7 A;  3WT3 A;  3WV6 A;  5C7G A;  5IVF A;  1JS9 A;  5DAP A;  4CP1 A;  4IV3 A;  2JD4 A;  2JDA A;  1WW6 A;  1UIJ A;  5GZE A;  1L3J A;  5FZG A;  2FCV A;  3VBR A;  3UK9 A;  1J84 A;  3WG3 A;  4L2N A;  1ZZ6 A;  4AI2 A;  1Q56 A;  3C2U A;  5FTT C;  3ALQ A;  3KT7 A;  2WWJ A;  4FOY A;  4QB1 A;  1FPN 2;  5A32 B;  3VB9 A;  2JDN A;  1HRI 1;  3ACF A;  2UY8 A;  5JZG B;  1H9W A;  1W9F A;  1ZNP A;  1T6G C;  4FPL A;  2DBN A;  1C8M 1;  5FXX A;  4BM8 A;  2NMO A;  4I0A A;  5C33 A;  5FR3 A;  4OMC A;  3O1R A;  4E8C A;  1PVX A;  2WNO A;  1GBG A;  2QTW B;  2RR1 1;  4I0W B;  4J1W A;  2I45 A;  3S5Q A;  3AP4 A;  4RD7 A;  5LK7 B;  4UW3 A;  4GXL A;  3OPT A;  1L7L A;  1SLC A;  1NQD A;  2WL1 A;  2VMI A;  1XXN A;  1XB9 A;  2YPJ A;  4ET7 A;  2I07 B;  2QZ2 A;  3H8U A;  4ZKT B;  5LAS A;  2PQS A;  4O7X A;  1W06 A;  3CU7 A;  4AVB A;  1DQ2 A;  4IDZ A;  1AR8 1;  3O1V A;  4LK7 A;  4YSF A;  1C8M 2;  1UXZ A;  3LEK A;  4UF0 A;  1SBF A;  4BK4 A;  5CFC C;  2LRP A;  4FPO B;  2E31 A;  4PIY A;  1JZ5 A;  4MHR A;  1IKP A;  2VW1 A;  1VRB A;  2DVA A;  1OUX A;  5FZB A;  4QU2 A;  1UQX A;  4PDW A;  3HNY M;  3WY6 A;  1UOB A;  3GAL A;  3ZSK A;  4P02 B;  4IEY A;  3TRS B;  1KIT A;  2ZGO A;  1CVN A;  3LKJ A;  4CCC A;  5FK7 A;  2IXJ A;  3K2O A;  4XET A;  3UGH A;  3WDY A;  5DPN A;  2BWA A;  2I74 A;  3HQR A;  2JKX A;  1VRH 2;  3DF0 A;  2EIC A;  1I5Z A;  1Q5O A;  2JEN A;  4KBZ A;  5E8A A;  3EJK A;  3SC7 X;  3OEB A;  1XC6 A;  5IHR A;  4UFL A;  4RQP A;  3LZZ A;  1F8V A;  4Q4V 3;  2XVL A;  1PGS A;  5ANN A;  3JCI A;  1OC1 A;  2B9U A;  4OQ9 A;  4IQP A;  4M00 A;  4YM3 A;  1ULF A;  4QQL A;  1CZS A;  3VZM A;  4ASK A;  4B8E A;  2QBX A;  3ZIX A;  1JW6 A;  3RGB A;  4IV1 B;  4JKM A;  2DUQ A;  2B46 X;  1HRI 2;  4R9D A;  5HI0 A;  3OPZ A;  5FJK A;  1ULE A;  2RS3 2;  2XML A;  5EP9 A;  1YYN A;  2EF6 A;  2VTX A;  3WSO A;  4XXP A;  3MIB A;  3KD4 A;  1HXS 1;  2ERF A;  1V00 A;  2W3J A;  1WBF A;  2ZGN A;  4YGD A;  2Z42 A;  1UYZ A;  1NQJ A;  1D4V B;  1TEI A;  1Z7S 3;  4HXC A;  4I3G A;  5LK5 A;  4A2U A;  3KV6 A;  4CCL A;  4QX0 A;  1RVF 3;  5C8C B;  4NRP A;  1W8Z A;  1V9U 1;  1PK6 A;  4JGY A;  4QAW A;  2ARX A;  1RUG 3;  1JTZ X;  1EUU A;  1F35 A;  1UCX A;  5FYC A;  1GQP A;  4O65 A;  4FPH A;  4UOJ A;  2HH9 A;  4YZ3 A;  1PZ9 A;  1HRI 3;  3I4I A;  1GU3 A;  3DYP A;  4TSV A;  1J1L A;  4OHV A;  4LQR A;  1Q8Q A;  2MEV 1;  5L7O C;  4TZD A;  3W5M A;  3R4S A;  1NUK A;  4GWN A;  1UPS A;  1KDK A;  1YQ2 A;  2C6S A;  3JB4 C;  1S2K A;  1SPP A;  3SIT A;  4CXY A;  1CIW A;  1MS8 A;  1FXZ A;  4AVA A;  4FOV A;  5GKA C;  3RYK A;  4KMQ A;  1VBC 3;  2WR9 A;  5T5L A;  3B00 A;  3FFQ A;  5CU1 A;  3TEZ A;  2AEN A;  2ZEY A;  3S7I A;  4GA9 A;  5M0T A;  1UZV A;  1E57 A;  2AH2 A;  3IM0 A;  1CWP A;  1RUJ 3;  2OQ7 A;  1MQT B;  2EVX A;  4QHZ A;  4CPB D;  3VBU A;  3WDU A;  1W2O A;  2J22 A;  3I3E A;  1MEC 1;  2JEM A;  2FZ1 A;  1R1Z A;  2W39 A;  2YYO A;  4F3J A;  1YJK A;  2AUY A;  2J42 A;  3AK0 A;  5KHJ A;  4R4X A;  4EN6 B;  1RXG A;  3M70 A;  4RQP C;  1SDW A;  1ZX5 A;  1SG3 A;  1VAK A;  4RHV 1;  3VD3 A;  3NJX A;  4XZP A;  1IQD C;  1KXG A;  1XRU A;  1N1Y A;  2WZ8 A;  1TME 3;  3NW4 A;  2QQN A;  1RTV A;  2W08 A;  4ES9 A;  3G6J B;  3JUU A;  5HCA A;  4W6X A;  1JYN A;  1EY2 A;  1QJU 2;  2OW4 A;  1PK6 C;  4V2W A;  3ZKY A;  1OFN A;  2B42 B;  1Y7B A;  3R05 A;  4IEQ A;  1HN1 A;  1S4C A;  1Y9Q A;  2BOI A;  1UL9 A;  1RGS A;  2P6H A;  2ZAH A;  5EHD A;  4JTO A;  1IG3 A;  5DAW A;  1LOF C;  1I5P A;  1F5F A;  1OXC A;  2TBV A;  4HPK B;  3WW1 A;  3X29 B;  2R07 3;  2ZGR A;  1RUG 1;  3ACG A;  5FYH A;  1O3R A;  1UIK A;  2ZTN A;  1YWK A;  1VJ2 A;  5FZ3 A;  4I01 A;  4BDV B;  4CCE A;  5JIU A;  3HT2 A;  1V6O A;  2WA4 A;  4QHO A;  3ZFF A;  2VG9 A;  2YY1 A;  3NST A;  4FPG A;  3THT A;  4WM8 B;  1X8E A;  1HXS 3;  1O4Y A;  3I97 A;  2GMP A;  2BRT A;  3AL6 A;  3WF1 A;  2A3W A;  2WNU C;  1KJL A;  3AYC A;  4XUR A;  4N53 C;  4AHY A;  3ZDS A;  2W1W A;  1WLD A;  4IV1 A;  4V2V A;  4QPI A;  3L2H A;  4E4S A;  1O59 A;  1W9Y A;  3VDA A;  2KA3 A;  2FDF A;  5FPZ A;  1GZ9 A;  2DF7 A;  1LES A;  5T5J A;  2R04 2;  2IZW A;  2XVK A;  5IVC A;  2ADE A;  4G3Y C;  5ABJ C;  2BU9 A;  3O12 A;  1MS1 A;  4FPC A;  3RI9 A;  4LE4 A;  3U4S A;  4CDU C;  4COV A;  2HEW F;  2QFE A;  3WCR A;  2GAU A;  2Y38 A;  4XTP A;  3FUQ A;  1V6I A;  4LOT A;  1R09 2;  2EXK A;  3IMM A;  3I49 A;  4BOW A;  3A0N A;  1BEV 3;  3B94 A;  3DN7 A;  4W6Y A;  1PGW 1;  3IDA A;  4BH9 A;  3UET A;  1MEC 3;  4XAE A;  4RFT 0;  1Q8P A;  1R08 2;  1UMZ A;  3AKS A;  1LU2 A;  1R09 1;  1XNC A;  5BUV A;  1ND2 C;  4A42 A;  1QJZ A;  3N7L A;  2RJK A;  3LAG A;  3LA2 A;  4JGZ C;  2PHF A;  4N8M A;  4B1L A;  3FHI B;  4OUE A;  4LUK A;  1CX4 A;  5JMO A;  5LA1 A;  3PVN A;  1UX7 A;  1CJD A;  5A6X A;  5FP9 A;  5FDB A;  1V70 A;  4MGZ E;  3TN9 1;  4LKF A;  3WG2 A;  5A33 B;  1EPZ A;  1KFU L;  3VBR C;  3VD7 A;  5K0U C;  4GWI A;  5FMC A;  1VMF A;  3AZY A;  5I8S A;  5L9V A;  5A3P A;  2CV6 A;  4NE9 A;  1OSG A;  1BLZ A;  1FNZ A;  3ZFF C;  1AR7 2;  1Q8O A;  5AFB A;  4H7L A;  1Q8S A;  5JZG A;  4ZU4 A;  4WVZ A;  1TMF 1;  1V9U 3;  3V0B A;  1YHF A;  3ZSE A;  4FSJ A;  2OPK A;  5AC9 2;  2WNV A;  1E5R A;  2VC9 A;  2VY0 A;  3OGJ A;  4D94 A;  1D0G A;  1CD3 G;  1XYN A;  2A6V A;  4LA3 A;  1ZBA 1;  4FPJ A;  5FY7 A;  4AGR A;  2WS9 2;  3KF5 A;  4JRL A;  2AR6 A;  4Q8K A;  2PFW A;  4R9A A;  3I3B A;  3NNL A;  3K3O A;  1OLR A;  2QQJ A;  3MUY 1;  4ZS2 A;  1QQP 1;  1LTE A;  1UU4 A;  5IAT A;  4BQ1 A;  1H8T B;  4RR3 B;  1ODM A;  5HPO A;  5AVP A;  3WDT A;  2F17 A;  4UW5 A;  4YM2 A;  3AVR A;  2B39 A;  4Y1Z A;  4KU7 A;  4HG6 B;  5I0R A;  1AX0 A;  2E6V A;  3J7M A;  1GYK A;  4PLN A;  1NE4 A;  2ZGT A;  1MPX A;  2J1S A;  4S2H A;  5ABJ B;  1A8D A;  5CIS A;  3ACH A;  3T4V A;  2VBP A;  1MVQ A;  3H1M A;  3OGG A;  2XON A;  4KG8 A;  1QDO A;  3U78 A;  3WQ1 A;  5BNN A;  4IEU A;  4FXK B;  3R6S A;  5IUQ A;  2PHL A;  2WO2 A;  1AL2 1;  1XE7 A;  4HAN A;  5H9Q A;  4DFS A;  1K42 A;  3ZOI A;  2C1F A;  2C4X A;  2EXH A;  2WS9 1;  4MAD A;  4GJZ A;  2IXK A;  2JG9 A;  1N3Q A;  1PO1 3;  2XJR A;  3IBM A;  1XE8 A;  1PNF A;  2BW8 A;  2W2I A;  2ZHL A;  2XKP A;  4IEO A;  4NR1 A;  1KGY A;  3E5U A;  4QPI B;  4NWW A;  2P3I A;  4LO5 B;  3ZYH A;  1WME A;  4LHL A;  4KWJ A;  1GZW B;  3K51 A;  5CKQ A;  4KQ7 A;  4CEY C;  2VZT A;  3HNM A;  1T6B X;  3ZXA C;  4HSL A;  4XAA A;  3EB7 A;  1DLL A;  3OB8 A;  4I02 A;  1W8O A;  4BQ5 A;  1A34 A;  3P3P A;  1Q3E A;  1W90 A;  1BCX A;  2OA2 A;  4BCU A;  4FFF A;  4UFK A;  3O1T A;  3MDP A;  3WVJ A;  5A3U A;  4NHL A;  1AL0 G;  5FZC A;  1WLC A;  1PO1 2;  1X36 A;  3JZV A;  3SEP A;  4J6G A;  4C90 A;  5KHH A;  4YVW B;  1QNW A;  2VOV A;  4CCD A;  4BQX A;  3BUC A;  4EQV A;  2A1X A;  1AR7 1;  3LEG A;  3LDB A;  3VBU C;  3BIE A;  4OZX A;  5BV6 A;  1XNB A;  5J1X A;  1IKQ A;  2EIG A;  1WCS A;  1FAY A;  3OBZ A;  1YEW A;  2DVF A;  4BME A;  3MFC A;  2JDK A;  4D6R A;  2H6C A;  3WHT A;  1TNR A;  1DZR A;  1RUE 1;  3NV3 A;  3ZSL A;  4W8J A;  4YG3 A;  2D7F A;  3ZXF A;  2WNV C;  1J83 A;  1DYO A;  3HQX A;  1PM7 A;  5DUU A;  3K4A A;  1H2K A;  2GAL A;  5JUV A;  2XL7 A;  4GB3 1;  3WF4 A;  1J3Q A;  2QCS B;  5GLV A;  4BE3 A;  5IJR A;  3W9A A;  4JKL A;  3C3V A;  1QJU 3;  2XHN A;  2FMY A;  1K5M A;  5FZM A;  1BKZ A;  4Q0S A;  3R4D B;  3VKM A;  1QJX 3;  3CJI C;  4IES A;  1MS0 A;  3VBS C;  2BBV A;  3HAG A;  3I3Q A;  2ZML A;  4KI5 M;  3I59 A;  1QJE A;  2ZOE B;  4LO8 A;  5GLZ A;  2PYT A;  3NQH A;  4AVS A;  4A7K A;  3FLT A;  3PTY A;  2UUR A;  5C4W A;  1YNA A;  4LBO A;  4BU2 A;  1B35 C;  4CRQ A;  3TWI A;  1WCQ A;  2WII B;  3KGZ A;  5KC5 A;  4YW3 A;  1QDC A;  3B9C A;  1FOD 1;  2VVD A;  2XWJ B;  1UPI A;  2CSG A;  2VJX A;  5CEH A;  1W0P A;  4XJ9 A;  1SFN A;  1H9P A;  4CDQ C;  4CDW A;  4CCJ A;  1OLQ A;  3D4K A;  4P00 B;  4K8F A;  3III A;  1F9K A;  1JOJ A;  2JDY A;  2QQI A;  3VZN A;  1ZRC A;  4BK5 A;  1ZRD A;  1ND3 C;  1BMV 2;  2QDN A;  1F15 A;  2D3S A;  5FUI A;  2ENR A;  2Y6J A;  1R1A 1;  1QJX 2;  1ZZ7 A;  3H50 A;  4A45 A;  1OHF A;  2BER A;  3AJZ A;  5L9R A;  1GLH A;  2NMN A;  2W92 A;  5LA2 A;  1WCU A;  3CLP A;  3HBZ A;  2B8M A;  1ULD A;  3JQW A;  1LOA A;  4XEZ A;  3M3O A;  3W20 A;  5F39 A;  1G6N A;  4BLJ A;  4D7Y A;  5IK7 A;  3OBT A;  1FMD 3;  2QJV A;  1DG6 A;  1H2M A;  1UMH A;  2PTM A;  1W04 A;  4QXH A;  4RGG A;  3VBR B;  2YU1 A;  4HOO A;  1WD4 A;  1KS5 A;  1RUF 1;  2YHJ A;  4XE9 A;  4XMA A;  4Y4Y A;  4YYO A;  2IXL A;  1QXR A;  3OD4 A;  3ETQ A;  3SIS A;  3ZFF B;  3QLQ A;  4KU8 A;  1OH3 A;  4HKO A;  4XQ4 A;  5AC9 3;  4XHB A;  4ARY A;  4A6S A;  3RZK A;  4Q0U A;  3CQO A;  5FRE A;  3CNA A;  5LRR A;  3V65 A;  3W5N A;  1XNK A;  2YGL A;  5CFD A;  2D40 A;  4YW4 A;  1R09 3;  2RR1 2;  4IW3 A;  4N53 B;  1K45 A;  4D7T A;  2EXI A;  4JKK A;  2XH6 A;  4OFG A;  3ZDV A;  2GNB A;  5C70 A;  3J7L A;  4CXW A;  1FMD 2;  3KT4 A;  3WR0 A;  5EXO A;  3VKO A;  1JZ8 A;  4DXT A;  2PHX A;  1BEV 1;  2YBP A;  3V0A B;  3AXD A;  4FAG A;  3ROU A;  2YU2 A;  2QVS B;  3N9L A;  2P2K A;  3WNM A;  4CCK A;  5FFO C;  4D7S A;  1J1T A;  1RUH 3;  1SHW B;  3POS A;  4AG4 A;  2VQT A;  4XZU G;  3K3N A;  4R9B A;  3AZZ A;  3PJQ A;  4BHP A;  1J59 A;  1SLA A;  1ENQ A;  2VQU A;  4HPK A;  1W39 A;  3JBG 2;  3HVD A;  1EUT A;  1WLW A;  5IVY A;  5EPA A;  1ND2 A;  1WBL A;  1OFS A;  1VBC 2;  1AR9 3;  2LTN A;  1C57 A;  2VQA A;  4LBQ D;  2WZR 1;  2ZGM A;  4Q1P A;  1JOP A;  3O0W A;  1OOP C;  2IVI B;  2VOX A;  4R4Z A;  5GZC A;  1ND3 B;  3FUO A;  4HON A;  4JQT A;  2Q8C A;  3LFI A;  2J1T A;  4FI9 A;  5L7O A;  3J8F 1;  4Y3O A;  3WQ0 A;  5I8Y A;  3GNE A;  3GHN A;  3N7J A;  4GKY A;  4QX5 A;  4JVA A;  3PL0 A;  3DKW A;  1LGB A;  2YPD A;  3LGR A;  5F3G A;  1S2B A;  4WM8 C;  2XJP A;  1JZ6 A;  5KC6 A;  3DGT A;  3IB3 A;  4MHU A;  3GGL A;  4QM8 A;  4XBN A;  4LIT A;  3SKJ E;  1ZZ9 A;  3WNO A;  1MS4 A;  3ZFG B;  1WGP A;  2HBU A;  5FP7 A;  3FBM A;  4PQQ A;  3OEA A;  3EO6 A;  5FXZ A;  1NY7 2;  1X9P A;  1SZB A;  3FHA A;  4L11 A;  2NP0 A;  1CX1 A;  3M3Q A;  1LKN A;  4Y20 B;  2EID A;  3AXE A;  3J8F 2;  4UFM A;  2RV9 A;  2GN7 A;  2W1U A;  2VBD A;  3A22 A;  2ZA9 A;  4UW4 A;  4NID A;  3P5B A;  2WO3 A;  1XQN A;  2XUM A;  2VZS A;  3ASI A;  2HYX A;  4PBP A;  4D8M A;  4UBG A;  1LB2 A;  4X8P A;  4OI2 A;  1UD1 A;  4CUA A;  3V0B B;  4TN7 A;  4GWJ A;  4HFS A;  5DG2 A;  3JBG 1;  2WO1 A;  1VB4 A;  5H9P A;  4BMB A;  1RUI 3;  5FMO L;  1NY7 1;  4RS5 C;  3VDC A;  1GP6 A;  5GJ6 A;  2EAL A;  3UES A;  4RR3 C;  4QQH A;  5BY5 A;  3NJV A;  3SH4 A;  2VPV A;  3WP6 A;  2CAV A;  4PI0 A;  2BJS A;  2VZO A;  1D4M 3;  1NCQ B;  2BGO A;  1AHS A;  2HWD 3;  3NKT A;  2WAA A;  4OMD A;  5FZ6 A;  1DQ1 A;  5A6Z A;  2DV9 A;  3BIW E;  1RC6 A;  2W95 A;  2Z4F A;  1NKG A;  1NYW A;  3LEM A;  1IS3 A;  4X6Q B;  2ZMK A;  1LOE A;  2RM2 1;  3B7M A;  5DAV A;  4DO0 A;  1IS5 A;  4KBB A;  3KS7 A;  1I1E A;  4WM7 C;  1JOB A;  3KHC A;  4QWN A;  4WM8 A;  1QXJ A;  3DEM A;  2WUH A;  1AXZ A;  5H9R A;  3VHO A;  3N3H A;  4PLO A;  2B9V A;  1NZI A;  1D7P M;  2D6P A;  5A3L A;  4DRV A;  3AMQ A;  4KH9 A;  3CZU A;  5F7U A;  2VTX J;  2FHR A;  2VQ0 A;  5FZ9 A;  2C5D A;  2RMU 1;  1W8F A;  2V72 A;  4QDR A;  4YG0 A;  4D6Q A;  1VE0 A;  1GZT A;  3P1I A;  5IT6 A;  3ON7 A;  3N35 A;  1US2 A;  4JAA A;  1FPN 3;  2X09 A;  4A3X A;  4PF1 A;  2QQK A;  4MO3 M;  3NV1 A;  2K2S A;  4N7U A;  2W94 A;  4COZ A;  3E97 A;  3OG2 A;  3T2P A;  4PI2 A;  4JRA A;  3LOB A;  3I8T A;  4UF0 B;  2RS5 1;  3I2O A;  1GOH A;  1CPM A;  3S0M A;  1O8S A;  2P37 A;  4ERO A;  3PVE A;  1ZZB A;  3LSE A;  1GFF 2;  4YAR A;  3VBH C;  4RS5 A;  4ISR A;  1LGC A;  2VUC A;  4MH0 E;  4MZU A;  4CU7 A;  1CAX A;  3AZV A;  5IK4 A;  1DYK A;  1VRH 1;  4PT6 A;  1R64 A;  5FWE A;  5CFC B;  2IXH A;  1Q8V A;  2IXC A;  4KNC A;  4ZY9 A;  4DXS A;  4AVC A;  1IPS A;  1HRV 2;  1K12 A;  4AE2 A;  4RYD A;  3MO4 A;  1SEF A;  2DCZ A;  4XF1 A;  2BYV E;  4GKX A;  4HVQ A;  4DRR A;  5CFC A;  5ISL A;  1JBC A;  1LRH A;  1RMU 1;  1YFW A;  4JX0 A;  4XF3 A;  1RHI 1;  4YPJ A;  1G9D A;  1UZW A;  2VMC A;  1C28 A;  4RS5 B;  1CR7 A;  4MVT A;  1COV 3;  3PJY A;  3MPB A;  2QKD A;  2VW2 A;  2VNG A;  2XDV A;  2D6O X;  5FZD A;  3T08 A;  5FIX A;  1G8W A;  3SCG A;  5FZ7 A;  4IEV A;  1NA1 A;  4LO4 B;  1S1A A;  3UV9 A;  3B9I A;  2Q30 A;  1W99 A;  3NO8 A;  1KRI A;  4LBN A;  2UWA A;  5FYU A;  4XIO A;  2ZMN A;  4IEP A;  1EV1 2;  4MGK E;  1ZRR A;  1H6X A;  2Y64 A;  4D69 A;  3OF1 A;  3O1M A;  3RZJ A;  3VBS B;  2RS1 2;  2VVE A;  3AP5 A;  1GKB A;  2R6Q A;  2XB6 C;  3L2Y A;  4IV1 C;  2OII A;  5KHG A;  2XR4 A;  1HV1 A;  1F2N A;  2XLG A;  1VBE 3;  4IEW A;  4YGE A;  5JZG C;  4MLO A;  2CDO A;  1J58 A;  2YDE A;  3OD0 A;  4D0Q A;  1Y4W A;  4JTN A;  2VNO A;  2WN2 A;  5F37 A;  4ZHN A;  4ATF A;  4NPL A;  1ZRE A;  2JE7 A;  4PHZ A;  2RVA A;  4HL0 A;  1AR8 3;  2UU8 A;  4Q4W 1;  3THC A;  2PA7 A;  1VBA 3;  3POY A;  1JZ2 A;  3RJ2 X;  3AKP A;  3K75 B;  4MGQ A;  1K3I A;  1PIV 3;  2ZAC A;  4BPZ A;  3LWC A;  4CDU A;  5FOB B;  1VBB 1;  2JIC A;  3POB A;  5DDJ 1;  2J1U A;  2E51 A;  2ZPX A;  4LBQ A;  5DG1 A;  5LY2 A;  1O6U A;  1W05 A;  5LBB A;  4COY A;  2GNT A;  1AR9 1;  3POG A;  3SMH A;  5ACA 3;  1MQT A;  3LDK A;  1JU4 A;  2K9Z A;  4XF9 A;  3LEI A;  2RR1 3;  1ACC A;  3BTY A;  5GZD A;  1BJQ A;  1RUD 2;  2QUO A;  3AP6 A;  4Q2F A;  5B2G B;  3RZG A;  2E7T A;  2WZE A;  4XDP A;  2SLI A;  2H0B A;  3VBF A;  5JMC A;  4AFD A;  2A6X A;  3LPG A;  4HVO A;  2RS5 2;  5BXX A;  3URF A;  3G7D A;  4C91 A;  1PMH X;  4K1Y A;  3DYO A;  4LKS A;  1SLB A;  3U75 A;  5CFD C;  2G19 A;  3RWK X;  5CBL A;  4GAL A;  1RUH 2;  3O0V A;  4B3N A;  3AMP A;  2O14 A;  4UT5 A;  1KFX L;  3BVC A;  4YG6 A;  3JD7 1;  5FV3 A;  5FKC A;  1X82 A;  1LED A;  1URX A;  1UY3 A;  3BOW A;  3BTA A;  1GIC A;  4E4D X;  4ARX A;  1S0G A;  3M3I A;  1YFY A;  2ZKN A;  4KWK A;  1CAV B;  3HOB A;  5B4N A;  1RUI 2;  3KV4 A;  2IFW A;  1TG7 A;  1LR5 A;  1DQ0 A;  2EA7 A;  2W0X A;  1S0J A;  4UFH A;  1JZ7 A;  1OMI A;  3UKN A;  2ZZQ A;  4OQ8 A;  1H1A A;  4QPG B;  2WZP P;  4BXF A;  3D0S A;  5E88 A;  1JXN A;  2ZEZ A;  5LB6 A;  3IDC B;  4Q27 A;  1L7R A;  4I0B A;  4QT6 A;  5FBZ A;  4CEW A;  2PHT A;  2G9Z A;  4XFI A;  2HEY F;  3U37 A;  1OA4 A;  4CYD A;  5JWP A;  4OI0 A;  5FPV A;  3TEX A;  1FYU A;  4EWE A;  2PHR A;  3OY8 B;  5F2S A;  5JI9 A;  4QD2 A;  2P6C A;  2ZX1 A;  4XFA A;  4Z1V A;  3WLU A;  1PM4 A;  2SBA A;  3FBY A;  1IHM A;  1VBD 2;  2QQU A;  1T2X A;  4Q4Y 2;  3OGR A;  4COU A;  1TME 2;  5IK5 A;  2RS3 1;  1GR3 A;  3AB0 A;  1ND2 B;  1AVB A;  3MV1 1;  1VBB 2;  2X10 A;  2FQP A;  5I0S A;  1WW5 A;  4MGT A;  1PO2 1;  4S2F A;  2DTY A;  5A7P A;  4JHZ A;  1NT0 A;  4JGY B;  4XIK A;  3HQU A;  5T55 A;  1AZD A;  1JYX A;  2YFZ A;  3JD7 2;  4A4A A;  4CTE A;  1DDL A;  4GZ9 A;  3OGS A;  4XF0 A;  4P9I A;  1VBA 1;  5HV4 A;  4AEJ A;  4HMZ A;  1MZ6 A;  3USS A;  4DIQ A;  4BZ4 A;  1A78 A;  4Y1Y A;  2DYC A;  5CG8 A;  3WW3 A;  4TLG A;  5FZ0 A;  2ZKL A;  1RUC 1;  5GLU A;  1HB2 A;  3WOG A;  2VOW A;  5FZ1 A;  2ETE A;  2XJV A;  1YFX A;  2JG8 B;  3DPR B;  2DDU A;  3H1W A;  2QQL A;  3KQR A;  4QMA A;  2E7A A;  1D2Q A;  1GZW A;  1ZYB A;  1Q43 A;  1OQE A;  3QH7 A;  4AFC A;  5JXG A;  5GLT A;  1UU6 A;  1WMF A;  4Y22 B;  1QJU 1;  1CAU B;  5EIY B;  2V5Y A;  1FT9 A;  3RPQ A;  5F9T A;  3T4H B;  1V6J A;  2BEO A;  4O9E A;  1AX1 A;  1LEM A;  2Y60 A;  2HBT A;  2PAM A;  1W8W A;  5HV0 A;  4K8R B;  1ASJ 3;  1W6M A;  1YFU A;  3VBO B;  1G7Y A;  1W2U A;  3C7F A;  4AFM A;  4XJA A;  4HVR A;  2WDB A;  3OUH A;  4XOG A;  3H8R A;  1SQ4 A;  1KS4 A;  5JOX A;  1FPN 1;  3WD5 A;  3ZXE A;  3BPZ A;  5A1L A;  5CNA A;  4YZ4 A;  4L92 A;  4RL7 A;  3WEZ A;  3H7Y A;  3ZXJ A;  1OOP B;  1JU3 A;  3VLB B;  3PUS A;  1E5S A;  5F6L B;  3TN9 3;  1XNT A;  2X5I B;  2PAE A;  3FX3 A;  5T52 A;  4PQ9 A;  1W0N A;  1ALY A;  4PJY A;  2Q1F A;  1C3H A;  1U12 A;  3ITQ A;  2JE8 A;  2Q4S A;  2VW0 A;  2HWE 2;  2WRA A;  4BJ0 A;  4N43 B;  2VTF A;  2XJT A;  1IGO A;  2HWF 1;  1UZ0 A;  2X05 A;  1MEC 2;  2IVJ A;  3C7G A;  2YMZ A;  5F2W A;  3ZPO A;  4H55 A;  2PHD A;  4NVP A;  2ZAA A;  5T5P A;  2Q8O A;  2RM2 3;  1C8N A;  3POF A;  4PCR A;  3KLS A;  4QPI C;  1HJG A;  2AEY A;  3N9Q A;  5FYB A;  4CUG A;  2QDR A;  5EYX A;  3OBA A;  1UX6 A;  1IZ3 A;  1VBA 2;  3NNJ A;  5JSO A;  5C8W A;  2YRO A;  3AMH A;  3H3U A;  4U36 A;  5IW0 A;  3TN9 2;  1EPW A;  2B4K A;  4Z92 B;  1FNY A;  3SCF A;  1Z0H A;  2Y6K A;  5FLH A;  1GQH A;  5DAB A;  4AI9 A;  1G9B A;  1PGL 2;  1GNH A;  3WF3 A;  2WWS A;  4N90 A;  5IWF A;  2CDP A;  3I2I A;  3POW A;  4B4P A;  1UXX X;  3WW4 A;  1EAH 1;  3ORJ A;  1ZA4 A;  4NPM A;  2P34 A;  4Q4X 3;  1RUH 1;  4CEW B;  1R08 1;  1DGW A;  1PMI A;  4ZU7 A;  1V6M A;  4YFZ A;  3DXT A;  4LLO A;  1OD3 A;  4P08 A;  4OHY A;  4LKD A;  2Y6F A;  3MI8 A;  2H0V A;  1QJF A;  5BYN A;  3F2Z A;  4WVV A;  2DCK A;  3M7A A;  4P9W A;  1O5U A;  2ATF A;  1W3X A;  4YNI A;  1D4M 1;  4UI9 L;  5FP3 A;  5JIA A;  1U5Z A;  1I6X A;  2FDJ A;  3DYM A;  1AXK A;  4FFI A;  4NO4 A;  3HNB M;  3H42 B;  4XUT A;  1ULG A;  1WMD A;  1SMV A;  2QQM A;  4P9J A;  1GQG A;  1AR6 2;  5FZO A;  3BCW A;  3A0K A;  4K6B A;  1VAL A;  2V09 A;  4QGN A;  2V4V A;  5APA A;  3RQ0 A;  3U11 A;  2WFF 3;  3D82 A;  4B29 A;  5JPN B;  2GC0 A;  3MZH A;  4R9C A;  5I93 A;  2AC1 A;  4F7Z A;  2VVF A;  5DAQ A;  1NAE A;  5E1R A;  1AXY A;  3GF6 A;  3FHQ A;  3N7M A;  5FPL A;  5K0U B;  3MHZ A;  2Q5T A;  4LMF A;  2YBK A;  3MGU A;  5FUP A;  2GSY A;  5LA0 A;  1W28 A;  2JKB A;  3H8O A;  5C6C A;  1UYX A;  2WAB A;  1NCR A;  2WNU B;  2OZJ A;  1PZ7 A;  3MLJ A;  3RZM A;  3LQC A;  2PN5 A;  4BXS V;  2CNA A;  3VHR A;  5LAT A;  3KVB A;  2FZ2 A;  4NUB A;  3WNP A;  4GD4 A;  1O3T A;  1XOY A;  3U10 A;  3ZFG A;  1JHN A;  1DF0 A;  4LK6 A;  4LTA A;  4YGC A;  3POE A;  3GZT B;  1APN A;  3CBN A;  4AED B;  4B4Q A;  1TVG A;  3VN4 A;  1NZC A;  1REE A;  4NPR A;  5D21 A;  3S6P A;  1V6N A;  5D2A A;  1UO9 A;  1LEN A;  1F4A A;  2E63 A;  3BYW A;  5ABJ A;  1H8T C;  4Y24 A;  2XPJ A;  4V1P A;  2WQ8 A;  2A75 A;  3O1P A;  3M8L A;  3ST7 A;  4K3U A;  5J3U A;  2BNO A;  3JQX A;  4Q29 A;  4NHK A;  1E5H A;  2BGC A;  2VNR A;  2EAK A;  5FZA A;  2F4P A;  2QQO A;  1LOF A;  4XJZ A;  5F5Q A;  2VCB A;  1LGN A;  4A7Z A;  2WFP A;  1OQ1 A;  5DDJ 2;  1OT5 A;  3RYP A;  4GMP 3;  1W6O B;  3GZE A;  4XBQ A;  4NAO A;  5DMY A;  2XLF A;  3NNM A;  1BBT 3;  2ID4 A;  5A3M A;  1W0O A;  3FZ3 A;  5CIR A;  1XU1 A;  4E27 A;  3R0R A;  4GB3 2;  5LBE A;  2R06 1;  1C1L A;  3IMN A;  4PLM A;  4C1W A;  3CIH A;  4MGY E;  4A3Z A;  2RG4 A;  4AGV A;  1YIF A;  4AXO A;  1HQL A;  5IFT A;  2RDS A;  2V4A A;  3OUJ A;  5L73 A;  3PUI A;  2Q1Z B;  3ZXK A;  4DS0 A;  3FC0 A;  5FZ4 A;  5J09 A;  3SNM A;  1R1A 3;  4YZ5 A;  1QQP 2;  3VD5 A;  2R30 A;  3TYJ A;  3ZYG A;  4XUQ A;  3WNN A;  2ZGU A;  1GMM A;  4XBL A;  2CGO A;  5B4X A;  1Y3T A;  2ZEW A;  4DEQ A;  3AC0 A;  3BI3 A;  1ZBE 2;  5LEK A;  1XSR A;  3CMG A;  2D98 A;  1BK0 A;  3J4U H;  2N7G A;  1GUI A;  4QQP A;  3ZXG A;  4CEY B;  5CYY A;  2DUP A;  5K9Y A;  1UYP A;  3RZZ A;  1GWM A;  4R8H A;  2HYK A;  4QPG A;  5C9A B;  1F4H A;  3SLI A;  3BTX A;  4QX8 A;  3CKH A;  3I3D A;  5J7M A;  4FPE A;  1AYM 2;  3ZYR A;  1IOA A;  4S2D A;  1O8P A;  2QQP A;  2WZR 3;  1VP6 A;  4AVT A;  5C3R A;  4OCT A;  1OD5 A;  1CAW B;  4A44 A;  1R1A 2;  3N36 A;  5BNN C;  4W50 A;  2P3K A;  1UKR A;  5FZE A;  2D6K A;  3AX4 A;  3POI A;  2GC3 A;  5LY1 A;  2RS3 3;  3D3A A;  5EFU A;  2VUL A;  1TNF A;  4JGY C;  5C8C A;  4EN0 A;  3LDR A;  4XFG A;  4Q4Y 1;  4Q1R A;  1ODN A;  2HWB 2;  3LA7 A;  3HWJ A;  3GZA A;  2AYH A;  1S0I A;  1QHD A;  3ILF A;  1BEV 2;  3E1F 1;  2OT7 A;  4GIQ A;  1AYM 3;  3J7H A;  1MZ5 A;  3UJO A;  1COV 1;  5I91 A;  2C9K A;  5DAX A;  2JG9 C;  4QX7 A;  2WT1 A;  3R4U A;  4YVS C;  4LOS A;  5T5O A;  3D6E A;  3LF7 A;  5BNO A;  2OYZ A;  1PX4 A;  1ONA A;  4GUL A;  3E6D A;  2FDK A;  1W8T A;  1BZW A;  5FYS A;  4JQR A;  3USU B;  1N47 A;  5LZ6 A;  4NIH A;  1VRH 3;  3W59 A;  4E2G A;  3HEI A;  4P9L A;  4UXA A;  5HCF A;  5CB7 A;  3AFK A;  2HWE 3;  4A7Y A;  4NJ4 A;  4CZS A;  2D3P A;  3AZX A;  1OF3 A;  1J3R A;  1HIX A;  1SFY A;  1B35 B;  3U1X A;  3GBF A;  4J1X A;  3KSC A;  2MEV 3;  1U0A A;  3RWN A;  2VMH A;  2RM2 2;  3BAL A;  1HDK A;  1YJL A;  4LKE A;  5F3I A;  5BNO C;  3VV1 A;  3OJB A;  2RS5 3;  4YZ1 A;  4LT5 A;  3VZJ A;  3L9J T;  1H0B A;  1RUJ 2;  4GH4 B;  1DCS A;  5DZF A;  3UL2 A;  2R16 A;  1W3V A;  1RJ7 A;  1YQ8 A;  1YQ5 A;  3AKT A;  1SAC A;  4RSU A;  3RVH A;  3SHR A;  4BIF A;  2QZ3 A;  3FFZ A;  2C9A A;  3H9A A;  5A3N A;  3TEW A;  2WS9 3;  4K20 A;  4P5Y A;  5DUX A;  2GMM A;  4YZ2 A;  1BHG A;  1UY0 A;  4M4P A;  4AHZ A;  3M1H A;  4DMI A;  1AR9 2;  5BPX A;  1HLC A;  4IER A;  5A3T A;  2VXJ A;  1VLN A;  1OPO A;  2PHU A;  4JC1 A;  2B5H A;  2ZX3 A;  4IV3 C;  5K7P A;  1JYC A;  3IT8 A;  4YGB A;  3H1Y A;  3WP3 A;  3ZR6 A;  4AED A;  3NV4 A;  4N43 A;  2JG8 C;  4DUV A;  4Z2W A;  1HN0 A;  3NJZ A;  3MF9 A;  2WT0 A;  4L8Q A;  1KEX A;  4FXG B;  2UWB A;  4LIU A;  2A3Y A;  5G04 L;  1QEX A;  3RMY A;  5BNP B;  3BU7 A;  4QX2 A;  5JXJ A;  4FTS A;  3WXP A;  1DU3 D;  5SV8 A;  3ZN6 A;  4CDQ A;  1U5I A;  2X29 A;  5A3O A;  1X50 A;  3UGF A;  3QD6 A;  4MOA A;  4YRD A;  1POV 3;  4AI1 A;  2VBB A;  3HMY A;  4QKN A;  1W03 A;  3LD8 A;  4Q4Y 3;  3CL1 A;  1W8U A;  2BVB A;  5D8A A;  4FOW A;  5FZK A;  1ZZC A;  1AR6 3;  4E2S A;  3IN9 A;  3NJY A;  4SLI A;  1CZV A;  2OZ6 A;  5I0D A;  1S0F A;  2ZXQ A;  1QJY 1;  1ZVF A;  3VKL A;  1SCS A;  3GZU C;  1CPN A;  2VZ3 A;  1POV 1;  3VHP A;  4TYS A;  5FZF A;  3KB5 A;  1YCI A;  2ZBJ A;  2ET1 A;  3CJI A;  2LW8 A;  4IE7 A;  4WVM B;  1HB4 A;  1ULO A;  2VUA A;  3CHX A;  3AYD A;  3M3C A;  1QOT A;  2WT2 A;  2XKO A;  3KZ4 C;  2RDQ A;  4J25 A;  4DB5 A;  4FPF A;  4QX3 A;  4NII A;  1GOF A;  3VL9 A;  3U0Z A;  5JXI A;  3U4X A;  5HCH A;  2BPA 2;  3PIG A;  2J1E A;  5FBJ A;  3ZN4 A;  1GAN A;  1TE1 B;  3NNG A;  3VL8 A;  1MS5 A;  1OKQ A;  2E9Q A;  1QU0 A;  4XVH A;  5F3C A;  3TEY A;  2PLV 1;  4MX3 A;  1D4M 2;  3LIG A;  3M3E A;  1WZX A;  2VCA A;  2JE9 A;  1CIY A;  4HSJ A;  4U2A A;  5FAX A;  1OF4 A;  4LBM A;  5F5A A;  4ZXE A;  2RHP A;  3B01 A;  4C8D A;  2E33 A;  1NG0 A;  1VB2 A;  2JIG A;  2DFC A;  4CUB A;  3ILR A;  4DQA A;  2DWR A;  2D6M A;  3WP5 A;  3B93 A;  1C8M 3;  1WA6 X;  2OPW A;  1ASJ 2;  3N9N A;  3WNX A;  5AFE A;  2ILM A;  4GMP 0;  1AJK A;  1A8M A;  2VO5 A;  2Y0I A;  2CTV A;  5FUN A;  2EXJ A;  2VM9 A;  5T50 A;  2R06 3;  3UNP A;  2GN3 A;  3KVA A;  1H4H A;  1DYP A;  2HKX A;  4FT8 A;  3OOX A;  2VR4 A;  3VBO A;  4GWM A;  3SH5 A;  1BBT 2;  5F32 A;  1IS4 A;  1WA4 A;  2G4I A;  4CDW B;  1OA2 A;  4PBO A;  1J3P A;  1RJ8 A;  3MUZ 1;  4RHV 3;  4JGZ A;  3ES1 A;  4K9S A;  4ATE A;  4FAH A;  1CAU A;  1BQP A;  4YW5 A;  4AF9 A;  2GP3 A;  2HEV F;  3K4D A;  1AYN 3;  5L7O B;  4EYU A;  4G4F A;  2WQ4 A;  3OYW B;  4Q4V 2;  4QQO A;  3I59 B;  4LBQ B;  3S57 A;  5E16 A;  1H8T A;  2D3R A;  2YGM A;  2JD9 A;  1IS6 A;  1QOO A;  5BNP A;  4XCB A;  3CO2 A;  2PLV 2;  1AYM 1;  1H1I A;  2Y6L A;  1VMJ A;  1QQP 3;  1JZ4 A;  2BP6 A;  4YW2 A;  2Z2S B;  3KQ4 B;  4XTM A;  1U5X A;  3ZO0 B;  5C5U A;  5KXE A;  4Y5Z 0;  2VEC A;  3GBG A;  1HQW A;  2VZU A;  4QKF A;  1PZ8 A;  1OUS A;  2WYS A;  3MBW A;  4YVS B;  5FXW A;  5AC9 1;  4RHV 2;  5FPX A;  4AHW A;  2F4L A;  2UYA A;  3T1L A;  4JHT A;  1AF9 A;  1TMF 3;  2UYB A;  1SFP A;  4WVW A;  4AYU A;  2R07 1;  4Z8B A;  4WM7 B;  2JJ6 A;  2CGN A;  1OVP A;  5FP8 A;  2W68 A;  3MIC A;  4P14 A;  2YG0 A;  2CWS A;  2VZR A;  5JVV A;  2ZHK A;  2WO7 A;  2A70 A;  3AP9 A;  3T2O A;  3J9S A;  1W6P B;  4ISQ A;  3PVB B;  2TNF A;  4M4R A;  2Z69 A;  4OUL A;  3I2F A;  2WFF 1;  1HW5 A;  3QCW A;  4OHW A;  2X53 S;  2XOM A;  1JH5 A;  1RUD 1;  1LOB A;  2A7A A;  4Y1V A;  1UWW A;  5EJ3 A;  4AGG A;  4BIO A;  5FMO S;  2D5F A;  2NYY A;  3ZFE B;  1CZT A;  4FFG A;  3JXS A;  2OQ6 A;  3SKV A;  4HKL A;  3NRU A;  4M3C E;  2CL2 A;  4H14 A;  4MET A;  3T30 A;  4QXB A;  4AZZ A;  5JOY A;  2V5D A;  5ANQ A;  5JI7 A;  4BQ4 A;  5FY8 A;  2P5B A;  3ZKU A;  4HKW A;  3I54 A;  4DIN B;  4NWV A;  2X5I A;  1JI6 A;  2W47 A;  3Q9O A;  4AFB A;  4RA0 A;  2XJS A;  4ZZ8 A;  1UF2 C;  2A6W A;  3PUA A;  4PIZ A;  4E2Q A;  4CDW C;  5FY0 A;  1V9U 2;  2YXS A;  4K7J A;  1LUL A;  3S5A A;  2EIE A;  3MIH A;  4Q4V 1;  2AEZ A;  4FPY A;  3SCH A;  5FK8 A;  4YW7 A;  2FBE A;  4K21 A;  4KG0 A;  5FMB A;  5J36 A;  3DPR C;  3RS6 A;  1LHV A;  1WWY A;  4CP0 A;  1TME 1;  4O61 A;  5CG9 A;  4XJW A;  3CDZ B;  4AK3 A;  1W8N A;  1XNA A;  4EN7 B;  3ZSM A;  3GBW A;  5IAV A;  2AGS A;  3WNL A;  3FLR A;  4Y22 A;  4N9I A;  4XF4 A;  2VCC A;  4XC9 A;  4EN8 B;  1UU5 A;  3UT0 A;  1A6C A;  3LOI A;  4A6O A;  1VR3 A;  3WUD A;  4QDQ A;  2ARE A;  3DPR A;  2DUR A;  5ERL A;  1NXD 1;  4CDU B;  1CES A;  5CAZ A;  1O3S A;  2AAC A;  1UOF A;  5E6H A;  3MV0 1;  3ACI A;  1CAX B;  2E7Q A;  4YM1 A;  4XUP A;  4PDW C;  5LA9 A;  1FV3 A;  2ZGL A;  2QNK A;  4HET A;  1C4R A;  4MGI E;  4IEZ A;  3PNA A;  3POJ A;  4OHX A;  4AEK A;  3M4F A;  2CHH A;  4ZPI A;  3T1M A;  4F83 A;  2BGP A;  1SPP B;  2W52 A;  2NM1 A;  2X5I C;  3B02 A;  4CSW A;  1RUO A;  3I2G A;  5C4W B;  2GC2 A;  2R04 1;  2CU5 A;  2O1Q A;  1U5Y A;  3VZO A;  1H4G A;  1JOD A;  3BGA A;  1YO8 A;  5FO7 B;  3T2Q A;  5CA6 A;  3CEW A;  1NA1 B;  4NMI A;  3KV5 A;  4FO9 A;  1QWR A;  5A1A A;  4YVS A;  4B4R A;  3DUI A;  5FYT A;  2O8Q A;  3KM5 A;  1MS9 A;  2ARB A;  3LIH A;  1Z7S 1;  4IUG A;  2V73 A;  4UAP A;  4EN9 B;  1QMJ A;  3WNK A;  4P9X A;  3TNP B;  5A7W A;  4CU6 A;  1VPH A;  1HX6 A;  2BNN A;  3QOP A;  1ENX A;  3WF2 A;  4DUX A;  5GZG A;  2DVD A;  3AJY A;  3AM2 A;  2TEP A;  3H7J A;  3NAP C;  3UKT A;  4CDX A;  3H8X A;  3THP A;  1W9W A;  4H7M A;  1OH4 A;  4UFJ A;  1W9S A;  2BZD A;  1P8J A;  5FZI A;  1R08 3;  1W2A X;  3OTF A;  3AFG A;  4FQZ A;  1N3O A;  2P3J A;  2ARA A;  1EAH 3;  4DXR A;  5JOW A;  2XHK A;  1GP5 A;  4L99 A;  4NRO A;  4WV8 A;  1XPW A;  3ZM8 A;  1TQ5 A;  1HB1 A;  1QF3 A;  3WW2 A;  5DUW A;  4QPG C;  1A3K A;  1AR6 1;  2XJU A;  1S55 A;  1REF A;  1YC6 1;  2VU9 A;  1SCR A;  3VBF B;  2ZGS A;  5A3W A;  5F5C A;  3A23 A;  3MEP A;  4M3C F;  3WDX A;  5A6Y A;  4PDW B;  3H0O A;  1CAW A;  2GH2 A;  1UMI A;  1SLL A;  1NXM A;  1RL3 A;  1AR7 3;  1OKO A;  2HWF 2;  3KV9 A;  3WZ1 A;  3W58 A;  4DPN A;  5GM0 A;  3IDE A;  3N4M A;  2GP5 A;  5JLV A;  2NPI A;  3K77 A;  3A7Q A;  4ZON A;  4BA6 A;  4IXL A;  1XE0 A;  3C7H A;  4K1Z A;  5CVR A;  5A80 A;  3O1O A;  1UYY A;  4Z07 A;  5FQ0 B;  2VD7 A;  3RFR A;  2RJ2 A;  5CFD B;  4XDO A;  4M0H A;  3MFA A;  1E5I A;  2WAO A;  2W91 A;  1IPJ A;  4B7E A;  5EQU A;  4URA A;  1IQA A;  4B7K A;  5SV5 A;  4L0P A;  2R0F A;  3AL5 A;  1BVV A;  1OBN A;  1M4W A;  3VHN A;  5L19 A;  4IE5 A;  5E89 A;  4ZU5 A;  4OUM A;  1AUY A;  1QJY 3;  2F6B A;  1OQD A;  3J7N A;  5FZL A;  3FJS A;  1MZF A;  5FY4 A;  3VBO C;  3ES4 A;  4CEW C;  1STM A;  1AL2 3;  3ZR5 A;  1GOG A;  1S0D A;  2HWE 1;  5F6K A;  2EIB A;  3WF0 A;  4LXL A;  2CGP A;  4LOR A;  4OYU A;  3UKV A;  1YI9 A;  4AQT A;  5FPU A;  1ZRI A;  3GJA A;  5F3E A;  1YQ6 A;  3RRD A;  3JU9 A;  1BK1 A;  3MIF A;  1PMJ X;  5H9S A;  4FVV A;  2XVG A;  4E8D A;  5D8A C;  2VL4 A;  4I3P A;  4E4Z A;  4XQW A;  2Q8E A;  5IVE A;  4IND A;  3VBF C;  1YIP A;  2VXR A;  1V6K A;  4F8A A;  4QDS A;  1H2L A;  4TWT A;  3TNQ A;  2NLR A;  5CAD A;  4C0B A;  2BV4 A;  1G9A A;  3MIE A;  4BQ3 A;  4LJH A;  3NMB A;  1RYY A;  3O0X A;  4LIV A;  1N1T A;  4AAX A;  2PXJ A;  1DZQ A;  5IVB A;  2GND A;  2PHW A;  2Y26 A;  1RUD 3;  3NVC A;  4JZR A;  4N43 C;  4BIS A;  1ZBA 2;  2W46 A;  2J1A A;  2JIJ A;  3D8C A;  2BDR A;  4M3C B;  4N7I A;  2CAU A;  4I2O A;  1RXF A;  4KGQ A;  5FKB A;  1XYP A;  2WLQ A;  1VAM A;  4MYE A;  2HWC 3;  4XCA A;  1YXW A;  4D3W A;  4AFA A;  1UZY A;  1POQ A;  3GCW A;  2JB8 A;  2XQR A;  1MZE A;  4DY5 A;  1WCD J;  4CVU A;  5A70 A;  2OX0 A;  3RMX A;  1BYH A;  4HZF A;  3TB0 A;  5EJ1 B;  4Q5O A;  1B35 A;  4XUO A;  2LAL A;  1GSL A;  3AMM A;  5FY1 A;  5LCW L;  3VD4 A;  4Y1X A;  2NQY A;  3OUI A;  1O7F A;  2CWM A;  1BBT 1;  1RHI 3;  3IKW A;  5FY9 A;  3KCY A;  2WQZ C;  5JSR A;  4GMP 1;  4EWD A;  1D0H A;  3IAP A;  4DY3 A;  3MLK A;  3MW2 A;  3VBH B;  2YFU A;  5KR7 A;  3HJR A;  4KWL A;  4L9B A;  3WX5 A;  1V6L A;  4HK8 A;  1LNS A;  3BPS A;  4CA9 A;  4AW7 A;  5IVJ A;  3IWZ A;  3PME A;  3AP7 A;  5JPM B;  3GJB A;  1H30 A;  1HXS 2;  2BVV A;  2RDN A;  5F5I A;  1OLM E;  1UKG A;  4MSV A;  1JYI A;  4A41 A;  3FN9 A;  2KR2 A;  5T54 A;  5FPB A;  5DZG A;  1B09 A;  1NLQ A;  1W6N A;  1DQ5 A;  3S7E A;  2DUO A;  4QGL A;  4QM9 A;  3CF6 E;  5DQ0 A;  1MQT C;  4Q4X 1;  3FLP A;  5FYY A;  2NZ9 A;  2YBS A;  4L97 A;  3Q8C A;  4KGG A;  1NCR B;  1ZBE 1;  2WNU A;  4QXC A;  3ZYJ B;  1IG0 A;  1F5J A;  1O91 A;  1POV 0;  4RN5 A;  2RMU 3;  1W6P A;  1NLS A;  5JOZ A;  5FZH A;  3T0A A;  5JSP A;  2WIN B;  4CP9 A;  4CDQ B;  4AQ2 A;  2W9X A;  3ZYP A;  1UY4 A;  1UY2 A;  2ZGP A;  4ASL A;  5JR7 B;  2XGX A;  2ZHM A;  3T09 A;  2DCT A;  3DXU A;  3OBR A;  3THD A;  2OUJ A;  3OPW A;  1KQR A;  1N1V A;  1HV0 A;  2JDZ A;  5C9A A;  3LSD A;  4LE3 A;  5DN2 A;  3MID A;  5F1R A;  4LHN A;  1COV 2;  1JUI A;  1DGW X;  2KXL A;  4ZZ5 A;  4SBV A;  4XUN A;  3N9M A;  5KHK A;  1K5M C;  2ZX4 A;  1UOJ A;  4GJY A;  2HWF 3;  3ZFE C;  3HN1 A;  2DBI A;  5EYY A;  2PLV 3;  1VBE 1;  5G05 L;  5HXV A;  4AQ6 A;  5FP4 A;  4KWU A;  2GH8 A;  2VMG A;  4AR2 A;  2Z79 A;  1NA1 C;  1FV2 A;  5C4W C;  4ONU A;  1EP0 A;  5BNQ A;  4NIG A;  4Y4R A;  3GHM A;  5IYY A;  5FYV A;  4BLI A;  3OYW A;  2VUJ A;  4BB3 A;  4Y1U A;  4HBN A;  1RUF 2;  4R52 A;  1LHU A;  4HN1 A;  4K40 A;  2HJI A;  4O9G A;  4MXV A;  4CP2 A;  2BQP A;  3QAC A;  2A71 A;  2FCU A;  4ZS3 A;  3RNS A;  3ZMO A;  4CU9 A;  1UZZ A;  1US3 A;  2WNV B;  4EJR A;  1C1F A;  3VKN A;  3T3Y A;  2RJL A;  4CE8 A;  3PMS A;  2YC0 A;  2D44 A;  3RG0 A;  3WDW A;  2HLE A;  5L9B A;  1PIV 2;  2W5F A;  3BOP A;  5C3S A;  1OLM A;  4Q26 A;  1DFQ A;  1WW4 A;  4QB6 A;  3T2T A;  1I9R A;  2HWB 3;  1BMV 1;  2PQQ A;  1LOG A;  2K0G A;  3EMR A;  4M01 A;  3WG1 A;  1NCQ A;  1ZRF A;  3WUC A;  3O14 A;  3AMN A;  3WQB A;  3E6B A;  1PVC 1;  3IDB B;  1S0C A;  4OZO A;  1EV1 1;  5CKN A;  3DEC A;  4LHK A;  3WP4 A;  1NCR C;  3K48 A;  3NNF A;  1W2N A;  5A7W B;  1C5I A;  2GZW A;  4HK9 A;  1AYN 1;  1SLI A;  2JXA A;  3APB A;  4XFC A;  1GNY A;  3ZFE A;  3ACL A;  4ITC A;  3UJQ A;  4BQY A;  2P17 A;  2ZX0 A;  3ME2 A;  4AL9 A;  2ZCW A;  4NRQ A;  4OLL A;  4EZ4 A;  5J96 B;  2WC2 A;  3LA3 A;  1VBC 1;  1I3H A;  2QQW A;  4QQ2 A;  5D8A B;  4OHZ A;  5C3P A;  3EBR A;  5C9A C;  5FO8 B;  1XBF A;  1GWL A;  1RMU 2;  1JN2 P;  3K46 A;  3S30 A;  2D93 A;  4AED C;  1PVC 2;  3HPN A;  5GAL A;  3AVS A;  4JDO A;  2C26 A;  3A21 A;  4Y20 A;  3BN6 A;  5CZK A;  5EZW A;  5KXC A;  1W9T A;  2MEV 2;  3ZN6 B;  4LUL A;  1RIR A;  2VMF A;  4AQS A;  3C7O A;  1CJP A;  1DGR N;  3LB9 A;  4WVM A;  4YWA A;  2YC4 A;  4QXK A;  1JYT A;  2R49 A;  3Q8A A;  1ZM1 A;  4N9H A;  3ZFG C;  3P6B A;  5LW9 A;  5A7Q A;  4EWA A;  1AR8 2;  2RE9 A;  1QIQ A;  1NX9 A;  1OPM A;  5FRA A;  2H6B A;  2YC2 A;  1O4T A;  1GP4 A;  1S2E A;  1RVF 1;  2A5Z A;  2O0O A;  1M06 G;  5FZO B;  3HD8 B;  2A73 B;  4XDQ A;  3AKQ A;  4FTE A;  4UFI A;  1NLR A;  2BUK A;  2VZV A;  1KDM A;  1C5H A;  3PTR B;  2HWD 1;  5LBC A;  1CON A;  1Z78 A;  1PVC 3;  2WYF A;  2VAU A;  3WG4 A;  1VBD 3;  2VGD A;  4LBJ A;  3DL3 A;  3KHB A;  4G9S B;  3LPF A;  3W21 A;  1QY4 A;  4QGM A;  5C71 A;  2FDH A;  4I09 A;  1LOD A;  1L7Q A;  2C0Z A;  2VZP A;  3BTZ A;  3H3L A;  3ZSJ A;  5JDB A;  3WIN E;  4LNV A;  4IGP A;  4AI8 A;  4UW6 A;  1RUC 2;  4OVE A;  2VMD A;  4B1M A;  4Z2A A;  4XJ8 A;  1LJ7 A;  3HT1 A;  2VZ1 A;  1KJR A;  1ASJ 1;  2VOK A;  4MXW A;  4HN0 A;  4W6W A;  1W6M B;  2WN3 A;  2HWC 1;  2ZX2 A;  2J1R A;  3MW4 A;  4AVV A;  4GH4 C;  2WKK A;  4CUC A;  1HQN A;  2VME A;  3FL7 A;  4QPY A;  4QX1 A;  1HKD A;  5I0U A;  4EE2 A;  4DEV A;  3VZL A;  2WLP A;  1X9T A;  2BBA A;  5KXD A;  3C7E A;  3EQE A;  5D1I A;  1FI2 A;  5IAX A;  2HWC 2;  3I2H A;  4M0N A;  4GQ7 A;  2DVG A;  5FYM A;  2VE1 A;  2JB4 A;  2Y8K A;  4HLT A;  1AJO A;  4HT1 T;  5I0T A;  4EV0 A;  4LHS A;  5FO9 B;  2E32 A;  2JG8 A;  1RUC 3;  3ENR A;  4LO6 B;  4UBH A;  3WHU A;  2WJS A;  3KT1 A;  5GZF A;  3NV2 A;  1LAJ A;  4AHX A;  3VD9 A;  2D43 A;  4IV3 B;  4QKB A;  4XJU A;  1RHI 2;  1PNG A;  3KF3 A;  1YRZ A;  4Q0P A;  1MR5 A;  4LO7 A;  1WW7 A;  4CU8 A;  2XG3 A;  1UOG A;  1CAV A;  3Q8E A;  1EAH 2;  2Z5W A;  1UNB A;  4CCO A;  1AX2 A;  1SLT A;  3DCQ A;  2G9G A;  3FMG A;  4WZF A;  2Q8D A;  3RJR A;  3ZYI B;  2HWD 2;  4DUW A;  4GB3 3;  1HRV 3;  1IPK A;  1WUV A;  2JG9 B;  3JD7 3;  4M3C A;  2FMD A;  4UWD A;  3I2D A;  1BXH A;  4IE4 A;  2D97 A;  1H2N A;  2R0H A;  2WNE A;  3LE0 A;  4Y26 A;  1LOC A;  3I3M A;  2G1M A;  4X8N A;  2GME A;  3E5X A;  1LHO A;  2TUN A;  1PGW 2;  3N9P A;  1NE6 A;  1QXP A;  4MV2 A;  5J48 A;  1PO2 2;  4YW6 A;  2AZ5 A;  1UN1 A;  2RMU 2;  1QGL A;  4URT A;  2BOJ A;  4W4Z A;  5I8T A;  3U07 A;  5HXM A;  2Y6G A;  1PGL 1;  1PK6 B;  1SBE A;  3ECQ A;  1W8H A;  4YW1 A;  3SQO A;  4DOU A;  5LEJ A;  5K8S A;  4QPW A;  2J7M A;  2RS1 3;  4C1X A;  1O3Q A;  5JCT A;  1JMU B;  1KD7 A;  5JXH A;  1X8M A;  1AYN 2;  2ZGQ A;  3ETP A;  3PUR A;  4Q4W 3;  2J1V A;  4Z82 A;  4OI4 A;  2P4E A;  3VDD B;  3WDV A;  4JGZ B;  1QOS A;  2BWC A;  4FP3 A;  4FBF A;  3BB6 A;  5FMD A;  3IPV B;  5DZE A;  4LBL A;  2XJQ A;  1WMX A;  3PLQ A;  3I2K A;  3HR9 A;  2FDG A;  4C0H A;  3F95 A;  4E4H A;  1JZ3 A;  4FCA A;  5C3O A;  2A6Y A;  1PO2 3;  4NAM A;  3MPP G;  1ND3 A;  1MVE A;  4LPL A;  4XPV A;  3WQ7 A;  2R1D A;  2E53 A;  5LWB A;  1RUN A;  1HRV 1;  1QJY 2;  1PO1 1;  1ZZ8 A;  3HN3 A;  2Y6H A;  1ST8 A;  2UY9 A;  4IL7 A;  5KHI A;  1K5M B;  1TMF 2;  3LCP A;  4I30 A;  4WM7 A;  1AL2 2;  4CCM A;  5A1F A;  3ATG A;  3C8X A;  3PU3 A;  1SDD B;  5BNP C;  1MAC A;  2DFB A;  3DV8 A;  2I2S A;  4Q4W 2;  4MGS A;  4XHX A;  1ULC A;  4YVW A;  2CYF A;  5IFP A;  3VDB A;  5FQ0 A;  1JUH A;  3NWK A;  4Q0Q A;  4P5H A;  4XXA A;  4E9K A;  3SH3 A;  4Y5T A;  5FLI A;  1DGR A;  2VCM A;  2WFF 2;  4H3W A;  5A7S A;  3ZN5 A;  1W6N B;  1ZA7 A;  2A6Z A;  4BWO A;  1H1M A;  2VZQ A;  4FFH A;  5T3N A;  2YUE A;  4KL1 A;  5FYI A;  4RGK A;  2W87 A;  1S0B A;  1YUD A;  4JDM A;  2RS1 1;  1EV1 3;  3MF6 A;  4W65 A;  3UYJ A;  3ZXL A;  3PUQ A;  3VBU B;  4LA2 A;  2BFU S;  1SBD A;  4COW A;  2WSU A;  1Y43 B;  1OOP A;  2Y0O A;  1RIT A;  4TLF A;  3E6C C;  1D2S A;  4MUV A;  4EZH A;  4AOC A;  1VBE 2;  1VAV A;  1K5J A;  2Y34 A;  1ZBA 3;  2G9F A;  3VBH A;  1DHK B;  2YZ4 A;  2JX9 A;  3VZK A;  4DXZ A;  1RUG 2;  3FWE A;  3IZO A;  1DGL A;  1WLT A;  2PMW B; 
#chains in the Genus database with same CATH homology
 3BGA A;  3C7F A;  2WDB A;  3T2Q A;  1PX3 A;  3OGV A;  5A1A A;  3WEZ A;  2VC9 A;  1JU3 A;  1XNT A;  3CZJ A;  4IUG A;  4UAP A;  3IAQ A;  3I3B A;  1W0N A;  3WNK A;  2QQJ A;  3MUY 1;  2JE8 A;  4CU6 A;  4BJ0 A;  2VTF A;  4DUX A;  2X05 A;  1UZ0 A;  3WF2 A;  5HPO A;  3C7G A;  2L9L A;  4HG6 B;  3K4Z A;  1MPX A;  2J1S A;  1W9W A;  1OH4 A;  1W9S A;  2BZD A;  1P8J A;  3OBA A;  3ACH A;  3GM8 A;  1JHJ A;  2XON A;  4DXR A;  3PUH A;  3I2J A;  2B4K A;  2WO2 A;  2W1S A;  1XPW A;  2Y6K A;  1K42 A;  2C4X A;  4MAD A;  3WF3 A;  2CDP A;  3I2I A;  1UXX X;  3A23 A;  4QB2 A;  2LS6 A;  1KGY A;  1OD3 A;  1UMI A;  2VZT A;  4P08 A;  3HNM A;  3EB7 A;  3OB8 A;  1W8O A;  3F2Z A;  2DCK A;  3K77 A;  4UI9 L;  3A7Q A;  3DYM A;  3HNB M;  4XUT A;  3C7H A;  3SEP A;  1UYY A;  1ULP A;  2QQM A;  2OKX A;  2RJ2 A;  2V4V A;  2WAO A;  3LEG A;  2W91 A;  5J1X A;  4L0P A;  5JR2 A;  1NAE A;  1JYW A;  3FHQ A;  2ORZ A;  4W8J A;  1J83 A;  1DYO A;  5LA0 A;  3K4A A;  1UYX A;  2WAB A;  3GXU A;  5JUV A;  3WF4 A;  1GOG A;  5IJR A;  3WF0 A;  3LQC A;  4JKL A;  2EIB A;  1UY1 A;  4BXS V;  2XHN A;  3EYP A;  2XQX A;  4OYU A;  3WNP A;  4KI5 M;  3NQH A;  1TVG A;  1PMJ X;  4E8D A;  4TTG A;  1WCQ A;  2VL4 A;  1F4A A;  2VJX A;  2WQ8 A;  2R7E B;  2E26 A;  4QDS A;  4P00 B;  1RYY A;  1H6Y A;  3III A;  2QQI A;  2QQO A;  4TXW A;  4AAX A;  4BK5 A;  2VCB A;  2ORX A;  5FUI A;  2Y6J A;  1OT5 A;  2W46 A;  5DMY A;  3T0D A;  4A45 A;  2J1A A;  2ID4 A;  2BER A;  2W92 A;  5LA2 A;  4CVU A;  3CIH A;  4A3Z A;  1UMH A;  5EJ1 B;  5IFT A;  4XUO A;  5LCW L;  3VD4 A;  3PUI A;  3IAP A;  3VD5 A;  4ARY A;  2YFU A;  4XUQ A;  3CQO A;  3WNN A;  1GMM A;  3HJR A;  5B4X A;  2ZEW A;  4DEQ A;  3AC0 A;  1LNS A;  3W5N A;  3CMG A;  1JYV A;  1GUI A;  2DCJ A;  1K45 A;  5CYY A;  4JKK A;  3GDB A;  5C70 A;  1F4H A;  3ABZ A;  1JZ8 A;  4A41 A;  3CKH A;  1WKY A;  3I3D A;  4DXT A;  3FN9 A;  1O8P A;  3SEE A;  3WNM A;  4A44 A;  5DQ0 A;  1SHW B;  4AG4 A;  4W50 A;  2VQT A;  4XZU G;  3D3A A;  4RN5 A;  2VQU A;  3T0A A;  1EUT A;  2W9X A;  1UY4 A;  1UY2 A;  2W1Q A;  3E1F 1;  3T09 A;  3J7H A;  3THD A;  2VOT A;  2C9K A;  2J1T A;  4FI9 A;  5DN2 A;  3T0B A;  4ZZ5 A;  4XUN A;  1DLC A;  2ZEX A;  1JZ6 A;  1PX4 A;  1DP0 A;  3IB3 A;  3GGL A;  3SKJ E;  5G05 L;  2KD7 A;  3WNO A;  4KWU A;  5EJZ B;  2WBK A;  2YB7 A;  5C7G A;  3HEI A;  4PQQ A;  3OEA A;  2JDA A;  5IYY A;  1OF3 A;  3FHA A;  1CX1 A;  1J84 A;  2EID A;  2RV9 A;  3A22 A;  2W1U A;  4QB1 A;  2WO3 A;  2VZS A;  2HYX A;  3ACF A;  4D8M A;  4CU9 A;  1US3 A;  4CUA A;  4GWJ A;  4OMC A;  2WO1 A;  4E8C A;  2HLE A;  2W5F A;  4P5Y A;  3VDC A;  1BHG A;  1UY0 A;  4QB6 A;  4M4P A;  3UES A;  4ET7 A;  3NJV A;  3WQB A;  2VZO A;  2PQS A;  2BGO A;  4OMD A;  2WAA A;  4OZO A;  3DEC A;  2W95 A;  2Z4F A;  1UXZ A;  1NKG A;  3LEK A;  4BK4 A;  4DUV A;  1KEX A;  2E31 A;  1JZ5 A;  5G04 L;  1GNY A;  4QX2 A;  5JXJ A;  2WUH A;  2B9V A;  3HNY M;  1D7P M;  4MOA A;  4P02 B;  3CZU A;  5F7U A;  3K46 A;  3HPN A;  5CZK A;  5DPN A;  2C26 A;  3A21 A;  3BN6 A;  2V72 A;  2JKX A;  1CZV A;  4QDR A;  1W9T A;  2ZXQ A;  5I0D A;  2EIC A;  3P1I A;  2VMF A;  3C7O A;  3OEB A;  2VZ3 A;  1US2 A;  1XC6 A;  2X09 A;  5IHR A;  2YC4 A;  4PF1 A;  2QQK A;  4MO3 M;  2W94 A;  2LW8 A;  3P6B A;  3OG2 A;  3T2P A;  1ULO A;  1NX9 A;  1GOH A;  1CZS A;  2YC2 A;  2QBX A;  1O8S A;  4JKM A;  4QX3 A;  1GOF A;  5JXI A;  4CU7 A;  2VZV A;  2J1E A;  3WSO A;  3NNG A;  1R64 A;  4PT6 A;  2W3J A;  4ZY9 A;  4DXS A;  4XVH A;  1UYZ A;  1K12 A;  3LPF A;  4RYD A;  3MO4 A;  2VCA A;  1CIY A;  5C71 A;  1OF4 A;  1L7Q A;  4QX0 A;  2VZP A;  4JX0 A;  4ZXE A;  2E33 A;  4YPJ A;  4CUB A;  4QAW A;  2VMC A;  1EUU A;  1GQP A;  4Z2A A;  2VMD A;  4UOJ A;  3T08 A;  2VO5 A;  2VZ1 A;  1GU3 A;  3DYP A;  1W99 A;  2VM9 A;  2WN3 A;  4LQR A;  2J1R A;  4CUC A;  3UNP A;  2VME A;  3FL7 A;  4QX1 A;  3W5M A;  1NUK A;  2VR4 A;  1YQ2 A;  1H6X A;  2Y64 A;  4DEV A;  2BBA A;  4KMQ A;  3C7E A;  3I2H A;  3MUZ 1;  2ZEY A;  2Y8K A;  2CDO A;  4D0Q A;  4LHS A;  3K4D A;  2E32 A;  2WN2 A;  3VD9 A;  2RVA A;  2J22 A;  3I3E A;  3THC A;  2JD9 A;  1JZ2 A;  3K75 B;  4MGQ A;  1K3I A;  2Y6L A;  1JZ4 A;  2J1U A;  4CU8 A;  1SG3 A;  3VD3 A;  3NJX A;  1IQD C;  1JU4 A;  2VZU A;  2WYS A;  2WZ8 A;  3MBW A;  2QQN A;  3LEI A;  4DUW A;  1JYN A;  2WZE A;  3LPG A;  1HN1 A;  1PMH X;  3DYO A;  3LE0 A;  2YG0 A;  4LKS A;  2VZR A;  1I5P A;  3T2O A;  4M4R A;  3ACG A;  1UY3 A;  3I2F A;  4ARX A;  2XOM A;  4W4Z A;  4BDV B;  5HXM A;  1UWW A;  2Y6G A;  3HOB A;  5B4N A;  1TG7 A;  3ECQ A;  1CZT A;  4QPW A;  2J7M A;  3JXS A;  3I97 A;  3SKV A;  1JZ7 A;  3NRU A;  3WF1 A;  5JXH A;  2V5D A;  3ETP A;  2J1V A;  1JI6 A;  2ZEZ A;  2W47 A;  4XUR A;  1L7R A;  2W1W A;  4ZZ8 A;  3U37 A;  3I2K A;  1O59 A;  1JZ3 A;  2EIE A;  3VDA A;  4LPL A;  3ZM8 A;  1T2X A;  3OGR A;  3HN3 A;  2Y6H A;  3MV1 1;  2X10 A;  3CDZ B;  3C8X A;  1SDD B;  1W8N A;  1XNA A;  3VDB A;  4MGS A;  4JHZ A;  3WNL A;  5IFP A;  1JYX A;  2YFZ A;  4A4A A;  2VCC A;  4GZ9 A;  3OGS A;  3IDA A;  3UET A;  4A6O A;  4QDQ A;  2VZQ A;  2W87 A;  2DDU A;  2QQL A;  4A42 A;  3MV0 1;  3ACI A;  4XUP A;  5JXG A;  4OUE A;  5JMO A;  5LA1 A;  5EIY B;  1UX7 A;  2BGP A;  3VD7 A;  3I2G A;  4GWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...