5FUSA

Crystal structure of b. cenocepacia dfsa
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
269
structure length
269
Chain Sequence
b'CRPFYEAGELSQLTAFYEEGRNVMWMMLRSEPRPCFNQQLVTDIIHLARVARDSGLTFDFWVTGSLVPELFNVGGDLSFFVDAIRSGRRDQLMAYARSCIDGVYEIYTGFGTGAISIAMVEGSALGGGFEAALAHHYVLAQKGVKLGFPEIAFNLFPGMGGYSLVARKANRGLAESLIATGEAHAAEWYEDCGLIDETFDAGDAYLATRTFIDVTKPKLNGIRAMLRARERVFQLSRSELMDITEAWVHAAFTIEPKDLAYMERLVMLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ENOYL COA HYDRATASE
publication title The Crystal Structure of Burkholderia Cenocepacia Dfsa Provides Insights Into Substrate Recognition and Quorum Sensing Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
total genus 107
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5fusA01
1YG6A 3K8XA 1PIXA 5KDRA 5DTPA 1TG6A 2UZFA 5FUSA 4QIIA 3HLN1 4K2NA 3FF6A 3QYRA 4MI2A 3H81A 4RYFH 3KQFA 4ZDEA 3R9QA 3OC7A 4KPKA 3Q1TA 3ZWAA 4I42A 3SLLA 4JCRA 4U18A 5E0SH 3TVUA 3NJBA 5FIFA 4WCZA 3V5EA 4ELXA 3L3SA 2CBYA 3R9SA 4GM2A 2Q35A 1K39A 5C90A 3I47A 3GLMA 3KTKA 3OMEA 2VSUE 1UYTA 4ASIA 3PE8A 2F6QA 3P85A 3QK8A 2ZL0A 4Q1IA 5DTWA 3BF0A 1FC6A 1RJMA 4FN7A 5C9GA 1SZOA 3U9TB 4YLHA 2DUBA 3K50A 3ISAA 4Z0MA 4EMMA 3KTJA 1ON9A 3T8AA 4KNPA 3NJDA 2X24A 4RCNA 1FCFA 4ZDBA 5JBXA 3T88A 1OD4A 5G1RA 1MJ3A 3BEZA 4KWBA 3FDUA 3JU1A 3KTHA 1NZYA 4ZDFA 4OLQA 4JWVA 3R6HA 4HC8A 3TV5A 1XNVA 3U9RB 4B3IA 3DJAA 2PPYA 3PZKA 3SWXA 1UYSA 2VX2A 2A81A 2VSSE 5MGBA 4FNDA 5DUFA 3HINA 3QMJA 2FBMA 4NEKA 3ZW8A 3N6RB 3U9SB 3HP0A 2FW2A 3TVWA 3RSIA 3T89A 1RJNA 3M6MA 3IAVA 4QFEA 3H0QA 4DI1A 3R0OA 4F47A 1HZDA 2J5II 2J5IB 3ZWCA 2PG8A 1N6FA 2ZQRA 4IZCA 3HRXA 3GF3A 3TRRA 4EMPA 2PBPA 1SG4A 3QWDA 1DCIA 5E0SA 3IB9A 1OD2A 3T8BA 2HW5A 3PEAA 1NZYB 1VRGA 3VIVA 5DKPA 5DL1A 5G1SA 1PJHA 2F6IA 2A7KA 4EMLA 2BZRA 3TT7A 4B3HA 2J5IA 4ZU2A 3G64A 4K3WA 1FC7A 3PGQA 1EY3A 2EJ5A 3RSTA 4G2RA 4FJWD 2J5GD 3ZWBA 4OMRA 2W3PA 2VSUC 4ELSA 4MXIA 1JXZA 3R9TA 3V5IA 3RRVA 2VSSA 3QXIA 4U0GH 2X58A 4B3JA 4JJTA 5CTBA 3ZW9A 3MT6A 1N6EA 4IZBA 4LK5A 1YG8A 4NNQA 3GMAA 2VREA 3H0SA 3H0UA 1HNOA 3P5MA 4L6WA 1DUBA 4I52A 3Q0JA 2VSUF 1UIYA 5DZKH 2ZL2A 4IZDA 1HNUA 4KD6A 1Y7OA 4JCQA 4FB8A 5DU6A 1WDLA 3T3WA 4JOTA 3TLFA 1UYRA 1J7XA 2A7SA 2IEXA 3BPPA 4RYFA 4WZ8B 4JVTA 3GF7A 4ZDDA 1O8UA 4U0HA 2QQ3A 4JCSA 3Q0GA 4U1AA 3OT6A 4QIJA 2DEOA 2VSUA 1WDKA 2F9IB 3LKEA 4L8KA 4FN8A 3MYBA 4FZWC 3MOYA 3IBBA 2ZQQA 5INGA 2FZSA 1XNYA 5DU4A 5DU8A 3GKBA 5KJPA 1X0UA 5CTCA 1N6DA 4U19A 1TYFA 1EF8A 2C8TA 2VSSF 4ELWA 5INIA 4ZDCA 3TT6A 4FNBA 3P2LA 1UYVA 4WYOB 1XNWA 2WTBA 4JYLA 4K29A 3H02A 4I4ZA 2F9YB 4JYJA 5IKLB 3WG5A 1XO6A 2D3TA 3ST9A 3DORA 3TZ3A 2F9IA 2GTRA 3HE2A 2ZL4A 4GHNA 1WZ8A 1FC9A 2Q2XA 4OG1A 2ZL3A 4HNKA 4JSBA 4U0GA 2CE3A 1Q51A 1XX4A 3Q7HA 2Q34A 5E0NX 5KDRB 1K32A 5G1QA 3TDCA 3KTGA 4FZWA 4Q0GA 1ON3A 1Q52A 5DUCA 3LAOA 3QREA 3QXZA 1W2XA 2F9YA 4MOUA 2J5SA 5INFA 3H0JA 3STAA 4JFCA 5DZKA 4JCTA 1EF9A 2J5GA 5JBWA 2NP9A 1WDMA 3M6NA 3QKAA 3KTIA 3MFMA
chains in the Genus database with same CATH superfamily
1YG6A 3K8XA 1PIXA 5KDRA 5DTPA 1TG6A 2UZFA 5FUSA 4QIIA 3HLN1 4K2NA 3FF6A 3QYRA 4MI2A 3H81A 4RYFH 2YJGA 3KQFA 4ZDEA 3R9QA 3OC7A 4HDTA 4KPKA 3Q1TA 3ZWAA 4I42A 3SLLA 4JCRA 4U18A 5E0SH 3TVUA 3NJBA 5FIFA 4WCZA 3V5EA 4ELXA 3L3SA 2CBYA 3R9SA 4GM2A 2Q35A 1K39A 5C90A 3I47A 3GLMA 3KTKA 3OMEA 2VSUE 1UYTA 4ASIA 5HUQA 3PE8A 2F6QA 3P85A 3QK8A 2ZL0A 4Q1IA 5DTWA 3BF0A 1FC6A 1RJMA 4FN7A 5C9GA 1SZOA 3U9TB 4YLHA 2DUBA 3K50A 3ISAA 4Z0MA 4EMMA 3KTJA 1ON9A 3T8AA 4KNPA 3NJDA 2X24A 4RCNA 1FCFA 4ZDBA 5JBXA 3T88A 1OD4A 5G1RA 1MJ3A 3BEZA 4KWBA 3FDUA 3JU1A 3KTHA 1NZYA 4ZDFA 4OLQA 4JWVA 3R6HA 4HC8A 3TV5A 1XNVA 3U9RB 4B3IA 3DJAA 2PPYA 3PZKA 3SWXA 1UYSA 2VX2A 2A81A 2VSSE 5MGBA 4FNDA 5DUFA 3HINA 3QMJA 2FBMA 4NEKA 3ZW8A 3N6RB 3U9SB 3HP0A 2FW2A 3TVWA 3RSIA 3T89A 1RJNA 3M6MA 3IAVA 4QFEA 3BPTA 3H0QA 4DI1A 3R0OA 4F47A 1HZDA 2J5II 2J5IB 3ZWCA 2PG8A 1N6FA 2ZQRA 4IZCA 3HRXA 3GF3A 3TRRA 4EMPA 2PBPA 1SG4A 3QWDA 1DCIA 5E0SA 3IB9A 1OD2A 3T8BA 2HW5A 3PEAA 1NZYB 1VRGA 3VIVA 5DKPA 5DL1A 5G1SA 1PJHA 2F6IA 2A7KA 4EMLA 2BZRA 3TT7A 4B3HA 2J5IA 4ZU2A 3G64A 4K3WA 1FC7A 3PGQA 1EY3A 2EJ5A 3RSTA 4G2RA 4FJWD 2J5GD 3ZWBA 4OMRA 2W3PA 2VSUC 4ELSA 4MXIA 1JXZA 3R9TA 3V5IA 3RRVA 2VSSA 3QXIA 4U0GH 2X58A 4B3JA 4JJTA 5CTBA 3ZW9A 3MT6A 1N6EA 4IZBA 4LK5A 1YG8A 4NNQA 3GMAA 2VREA 3H0SA 3H0UA 1HNOA 3P5MA 4L6WA 1DUBA 4I52A 3Q0JA 4NARA 2VSUF 1UIYA 5DZKH 2ZL2A 4IZDA 1HNUA 4KD6A 1Y7OA 4JCQA 4FB8A 5DU6A 1WDLA 3T3WA 4JOTA 4J2UA 3TLFA 1UYRA 1J7XA 2A7SA 2IEXA 3BPPA 4RYFA 4WZ8B 4JVTA 3GF7A 4ZDDA 1O8UA 4U0HA 2QQ3A 4JCSA 3Q0GA 4U1AA 3OT6A 4QIJA 2DEOA 2VSUA 1WDKA 2F9IB 3LKEA 4L8KA 4FN8A 3MYBA 4FZWC 3MOYA 3IBBA 2ZQQA 5INGA 2FZSA 1XNYA 5DU4A 5DU8A 3GKBA 5KJPA 1X0UA 5CTCA 1N6DA 4U19A 1TYFA 1EF8A 2C8TA 2VSSF 4ELWA 5INIA 4ZDCA 3TT6A 4FNBA 3P2LA 1UYVA 4WYOB 1XNWA 2WTBA 4JYLA 4K29A 3H02A 4I4ZA 2F9YB 4JYJA 5IKLB 3WG5A 1XO6A 2D3TA 3ST9A 3DORA 3TZ3A 2F9IA 2GTRA 3HE2A 2ZL4A 4GHNA 1WZ8A 1FC9A 2Q2XA 4OG1A 2ZL3A 4HNKA 4JSBA 4U0GA 2CE3A 1Q51A 1XX4A 3Q7HA 2Q34A 5E0NX 5KDRB 1K32A 5G1QA 3TDCA 3KTGA 4FZWA 4Q0GA 1ON3A 1Q52A 5DUCA 3LAOA 3QREA 3QXZA 1W2XA 2F9YA 4MOUA 2J5SA 5INFA 3H0JA 3STAA 4JFCA 5DZKA 4JCTA 1EF9A 2J5GA 5JBWA 2NP9A 1WDMA 3M6NA 3QKAA 3KTIA 3MFMA
chains in the Genus database with same CATH topology
1YG6A 3K8XA 1PIXA 5KDRA 5DTPA 1TG6A 2UZFA 5FUSA 4QIIA 3HLN1 4K2NA 3FF6A 3QYRA 4MI2A 3H81A 4RYFH 2YJGA 3KQFA 4ZDEA 3R9QA 3OC7A 4HDTA 4KPKA 3Q1TA 3ZWAA 4I42A 3SLLA 4JCRA 4U18A 5E0SH 3TVUA 3NJBA 5FIFA 4WCZA 3V5EA 4ELXA 3L3SA 2CBYA 3R9SA 4GM2A 2Q35A 1K39A 5C90A 3I47A 3GLMA 3KTKA 3OMEA 2VSUE 1UYTA 4ASIA 5HUQA 3PE8A 2F6QA 3P85A 3QK8A 2ZL0A 4Q1IA 5DTWA 3BF0A 1FC6A 1RJMA 4FN7A 5C9GA 1SZOA 3U9TB 4YLHA 2DUBA 3K50A 3ISAA 4Z0MA 4EMMA 3KTJA 1ON9A 3T8AA 4KNPA 3NJDA 2X24A 4RCNA 1FCFA 4ZDBA 5JBXA 3T88A 1OD4A 5G1RA 1MJ3A 3BEZA 4KWBA 3FDUA 3JU1A 3KTHA 1NZYA 4ZDFA 4OLQA 4JWVA 3R6HA 4HC8A 3TV5A 1XNVA 3U9RB 4B3IA 3DJAA 2PPYA 3PZKA 3SWXA 1UYSA 2VX2A 2A81A 2VSSE 5MGBA 4FNDA 5DUFA 3HINA 3QMJA 2FBMA 4NEKA 3ZW8A 3N6RB 3U9SB 3HP0A 2FW2A 3TVWA 3RSIA 3T89A 1RJNA 3M6MA 3IAVA 4QFEA 3BPTA 3H0QA 4DI1A 3R0OA 4F47A 1HZDA 2J5II 2J5IB 3ZWCA 2PG8A 1N6FA 2ZQRA 4IZCA 3HRXA 3GF3A 3TRRA 4EMPA 2PBPA 1SG4A 3QWDA 1DCIA 5E0SA 3IB9A 1OD2A 3T8BA 2HW5A 3PEAA 1NZYB 1VRGA 3VIVA 5DKPA 5DL1A 5G1SA 1PJHA 2F6IA 2A7KA 4EMLA 2BZRA 3TT7A 4B3HA 2J5IA 4ZU2A 3G64A 4K3WA 1FC7A 3PGQA 1EY3A 2EJ5A 3RSTA 4G2RA 4FJWD 2J5GD 3ZWBA 4OMRA 2W3PA 2VSUC 4ELSA 4MXIA 1JXZA 3R9TA 3V5IA 3RRVA 2VSSA 3QXIA 4U0GH 2X58A 4B3JA 4JJTA 5CTBA 3ZW9A 3MT6A 1N6EA 4IZBA 4LK5A 1YG8A 4NNQA 3GMAA 2VREA 3H0SA 3H0UA 1HNOA 3P5MA 4L6WA 1DUBA 4I52A 3Q0JA 4NARA 2VSUF 1UIYA 5DZKH 2ZL2A 4IZDA 1HNUA 4KD6A 1Y7OA 4JCQA 4FB8A 5DU6A 1WDLA 3T3WA 4JOTA 4J2UA 3TLFA 1UYRA 1J7XA 2A7SA 2IEXA 3BPPA 4RYFA 4WZ8B 4JVTA 3GF7A 4ZDDA 1O8UA 4U0HA 2QQ3A 4JCSA 3Q0GA 4U1AA 3OT6A 4QIJA 2DEOA 2VSUA 1WDKA 2F9IB 3LKEA 4L8KA 4FN8A 3MYBA 4FZWC 3MOYA 3IBBA 2ZQQA 5INGA 2FZSA 1XNYA 5DU4A 5DU8A 3GKBA 5KJPA 1X0UA 5CTCA 1N6DA 4U19A 1TYFA 1EF8A 2C8TA 2VSSF 4ELWA 5INIA 4ZDCA 3TT6A 4FNBA 3P2LA 1UYVA 4WYOB 1XNWA 2WTBA 4JYLA 4K29A 3H02A 4I4ZA 2F9YB 4JYJA 5IKLB 3WG5A 1XO6A 2D3TA 3ST9A 3DORA 3TZ3A 2F9IA 2GTRA 3HE2A 2ZL4A 4GHNA 1WZ8A 1FC9A 2Q2XA 4OG1A 2ZL3A 4HNKA 4JSBA 4U0GA 2CE3A 1Q51A 1XX4A 3Q7HA 2Q34A 5E0NX 5KDRB 1K32A 5G1QA 3TDCA 3KTGA 4FZWA 4Q0GA 1ON3A 1Q52A 5DUCA 3LAOA 3QREA 3QXZA 1W2XA 2F9YA 4MOUA 2J5SA 5INFA 3H0JA 3STAA 4JFCA 5DZKA 4JCTA 1EF9A 2J5GA 5JBWA 2NP9A 1WDMA 3M6NA 3QKAA 3KTIA 3MFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YG6 A;  3K8X A;  1PIX A;  5KDR A;  5DTP A;  1TG6 A;  2UZF A;  5FUS A;  4QII A;  3HLN 1;  4K2N A;  3FF6 A;  3QYR A;  4MI2 A;  3H81 A;  4RYF H;  3KQF A;  4ZDE A;  3R9Q A;  3OC7 A;  4KPK A;  3Q1T A;  3ZWA A;  4I42 A;  3SLL A;  4JCR A;  4U18 A;  5E0S H;  3TVU A;  3NJB A;  5FIF A;  4WCZ A;  3V5E A;  4ELX A;  3L3S A;  2CBY A;  3R9S A;  4GM2 A;  2Q35 A;  1K39 A;  5C90 A;  3I47 A;  3GLM A;  3KTK A;  3OME A;  2VSU E;  1UYT A;  4ASI A;  3PE8 A;  2F6Q A;  3P85 A;  3QK8 A;  2ZL0 A;  4Q1I A;  5DTW A;  3BF0 A;  1FC6 A;  1RJM A;  4FN7 A;  5C9G A;  1SZO A;  3U9T B;  4YLH A;  2DUB A;  3K50 A;  3ISA A;  4Z0M A;  4EMM A;  3KTJ A;  1ON9 A;  3T8A A;  4KNP A;  3NJD A;  2X24 A;  4RCN A;  1FCF A;  4ZDB A;  5JBX A;  3T88 A;  1OD4 A;  5G1R A;  1MJ3 A;  3BEZ A;  4KWB A;  3FDU A;  3JU1 A;  3KTH A;  1NZY A;  4ZDF A;  4OLQ A;  4JWV A;  3R6H A;  4HC8 A;  3TV5 A;  1XNV A;  3U9R B;  4B3I A;  3DJA A;  2PPY A;  3PZK A;  3SWX A;  1UYS A;  2VX2 A;  2A81 A;  2VSS E;  5MGB A;  4FND A;  5DUF A;  3HIN A;  3QMJ A;  2FBM A;  4NEK A;  3ZW8 A;  3N6R B;  3U9S B;  3HP0 A;  2FW2 A;  3TVW A;  3RSI A;  3T89 A;  1RJN A;  3M6M A;  3IAV A;  4QFE A;  3H0Q A;  4DI1 A;  3R0O A;  4F47 A;  1HZD A;  2J5I I;  2J5I B;  3ZWC A;  2PG8 A;  1N6F A;  2ZQR A;  4IZC A;  3HRX A;  3GF3 A;  3TRR A;  4EMP A;  2PBP A;  1SG4 A;  3QWD A;  1DCI A;  5E0S A;  3IB9 A;  1OD2 A;  3T8B A;  2HW5 A;  3PEA A;  1NZY B;  1VRG A;  3VIV A;  5DKP A;  5DL1 A;  5G1S A;  1PJH A;  2F6I A;  2A7K A;  4EML A;  2BZR A;  3TT7 A;  4B3H A;  2J5I A;  4ZU2 A;  3G64 A;  4K3W A;  1FC7 A;  3PGQ A;  1EY3 A;  2EJ5 A;  3RST A;  4G2R A;  4FJW D;  2J5G D;  3ZWB A;  4OMR A;  2W3P A;  2VSU C;  4ELS A;  4MXI A;  1JXZ A;  3R9T A;  3V5I A;  3RRV A;  2VSS A;  3QXI A;  4U0G H;  2X58 A;  4B3J A;  4JJT A;  5CTB A;  3ZW9 A;  3MT6 A;  1N6E A;  4IZB A;  4LK5 A;  1YG8 A;  4NNQ A;  3GMA A;  2VRE A;  3H0S A;  3H0U A;  1HNO A;  3P5M A;  4L6W A;  1DUB A;  4I52 A;  3Q0J A;  2VSU F;  1UIY A;  5DZK H;  2ZL2 A;  4IZD A;  1HNU A;  4KD6 A;  1Y7O A;  4JCQ A;  4FB8 A;  5DU6 A;  1WDL A;  3T3W A;  4JOT A;  3TLF A;  1UYR A;  1J7X A;  2A7S A;  2IEX A;  3BPP A;  4RYF A;  4WZ8 B;  4JVT A;  3GF7 A;  4ZDD A;  1O8U A;  4U0H A;  2QQ3 A;  4JCS A;  3Q0G A;  4U1A A;  3OT6 A;  4QIJ A;  2DEO A;  2VSU A;  1WDK A;  2F9I B;  3LKE A;  4L8K A;  4FN8 A;  3MYB A;  4FZW C;  3MOY A;  3IBB A;  2ZQQ A;  5ING A;  2FZS A;  1XNY A;  5DU4 A;  5DU8 A;  3GKB A;  5KJP A;  1X0U A;  5CTC A;  1N6D A;  4U19 A;  1TYF A;  1EF8 A;  2C8T A;  2VSS F;  4ELW A;  5INI A;  4ZDC A;  3TT6 A;  4FNB A;  3P2L A;  1UYV A;  4WYO B;  1XNW A;  2WTB A;  4JYL A;  4K29 A;  3H02 A;  4I4Z A;  2F9Y B;  4JYJ A;  5IKL B;  3WG5 A;  1XO6 A;  2D3T A;  3ST9 A;  3DOR A;  3TZ3 A;  2F9I A;  2GTR A;  3HE2 A;  2ZL4 A;  4GHN A;  1WZ8 A;  1FC9 A;  2Q2X A;  4OG1 A;  2ZL3 A;  4HNK A;  4JSB A;  4U0G A;  2CE3 A;  1Q51 A;  1XX4 A;  3Q7H A;  2Q34 A;  5E0N X;  5KDR B;  1K32 A;  5G1Q A;  3TDC A;  3KTG A;  4FZW A;  4Q0G A;  1ON3 A;  1Q52 A;  5DUC A;  3LAO A;  3QRE A;  3QXZ A;  1W2X A;  2F9Y A;  4MOU A;  2J5S A;  5INF A;  3H0J A;  3STA A;  4JFC A;  5DZK A;  4JCT A;  1EF9 A;  2J5G A;  5JBW A;  2NP9 A;  1WDM A;  3M6N A;  3QKA A;  3KTI A;  3MFM A; 
#chains in the Genus database with same CATH topology
 1YG6 A;  3K8X A;  1PIX A;  5KDR A;  5DTP A;  1TG6 A;  2UZF A;  5FUS A;  4QII A;  3HLN 1;  4K2N A;  3FF6 A;  3QYR A;  4MI2 A;  3H81 A;  4RYF H;  2YJG A;  3KQF A;  4ZDE A;  3R9Q A;  3OC7 A;  4HDT A;  4KPK A;  3Q1T A;  3ZWA A;  4I42 A;  3SLL A;  4JCR A;  4U18 A;  5E0S H;  3TVU A;  3NJB A;  5FIF A;  4WCZ A;  3V5E A;  4ELX A;  3L3S A;  2CBY A;  3R9S A;  4GM2 A;  2Q35 A;  1K39 A;  5C90 A;  3I47 A;  3GLM A;  3KTK A;  3OME A;  2VSU E;  1UYT A;  4ASI A;  5HUQ A;  3PE8 A;  2F6Q A;  3P85 A;  3QK8 A;  2ZL0 A;  4Q1I A;  5DTW A;  3BF0 A;  1FC6 A;  1RJM A;  4FN7 A;  5C9G A;  1SZO A;  3U9T B;  4YLH A;  2DUB A;  3K50 A;  3ISA A;  4Z0M A;  4EMM A;  3KTJ A;  1ON9 A;  3T8A A;  4KNP A;  3NJD A;  2X24 A;  4RCN A;  1FCF A;  4ZDB A;  5JBX A;  3T88 A;  1OD4 A;  5G1R A;  1MJ3 A;  3BEZ A;  4KWB A;  3FDU A;  3JU1 A;  3KTH A;  1NZY A;  4ZDF A;  4OLQ A;  4JWV A;  3R6H A;  4HC8 A;  3TV5 A;  1XNV A;  3U9R B;  4B3I A;  3DJA A;  2PPY A;  3PZK A;  3SWX A;  1UYS A;  2VX2 A;  2A81 A;  2VSS E;  5MGB A;  4FND A;  5DUF A;  3HIN A;  3QMJ A;  2FBM A;  4NEK A;  3ZW8 A;  3N6R B;  3U9S B;  3HP0 A;  2FW2 A;  3TVW A;  3RSI A;  3T89 A;  1RJN A;  3M6M A;  3IAV A;  4QFE A;  3BPT A;  3H0Q A;  4DI1 A;  3R0O A;  4F47 A;  1HZD A;  2J5I I;  2J5I B;  3ZWC A;  2PG8 A;  1N6F A;  2ZQR A;  4IZC A;  3HRX A;  3GF3 A;  3TRR A;  4EMP A;  2PBP A;  1SG4 A;  3QWD A;  1DCI A;  5E0S A;  3IB9 A;  1OD2 A;  3T8B A;  2HW5 A;  3PEA A;  1NZY B;  1VRG A;  3VIV A;  5DKP A;  5DL1 A;  5G1S A;  1PJH A;  2F6I A;  2A7K A;  4EML A;  2BZR A;  3TT7 A;  4B3H A;  2J5I A;  4ZU2 A;  3G64 A;  4K3W A;  1FC7 A;  3PGQ A;  1EY3 A;  2EJ5 A;  3RST A;  4G2R A;  4FJW D;  2J5G D;  3ZWB A;  4OMR A;  2W3P A;  2VSU C;  4ELS A;  4MXI A;  1JXZ A;  3R9T A;  3V5I A;  3RRV A;  2VSS A;  3QXI A;  4U0G H;  2X58 A;  4B3J A;  4JJT A;  5CTB A;  3ZW9 A;  3MT6 A;  1N6E A;  4IZB A;  4LK5 A;  1YG8 A;  4NNQ A;  3GMA A;  2VRE A;  3H0S A;  3H0U A;  1HNO A;  3P5M A;  4L6W A;  1DUB A;  4I52 A;  3Q0J A;  4NAR A;  2VSU F;  1UIY A;  5DZK H;  2ZL2 A;  4IZD A;  1HNU A;  4KD6 A;  1Y7O A;  4JCQ A;  4FB8 A;  5DU6 A;  1WDL A;  3T3W A;  4JOT A;  4J2U A;  3TLF A;  1UYR A;  1J7X A;  2A7S A;  2IEX A;  3BPP A;  4RYF A;  4WZ8 B;  4JVT A;  3GF7 A;  4ZDD A;  1O8U A;  4U0H A;  2QQ3 A;  4JCS A;  3Q0G A;  4U1A A;  3OT6 A;  4QIJ A;  2DEO A;  2VSU A;  1WDK A;  2F9I B;  3LKE A;  4L8K A;  4FN8 A;  3MYB A;  4FZW C;  3MOY A;  3IBB A;  2ZQQ A;  5ING A;  2FZS A;  1XNY A;  5DU4 A;  5DU8 A;  3GKB A;  5KJP A;  1X0U A;  5CTC A;  1N6D A;  4U19 A;  1TYF A;  1EF8 A;  2C8T A;  2VSS F;  4ELW A;  5INI A;  4ZDC A;  3TT6 A;  4FNB A;  3P2L A;  1UYV A;  4WYO B;  1XNW A;  2WTB A;  4JYL A;  4K29 A;  3H02 A;  4I4Z A;  2F9Y B;  4JYJ A;  5IKL B;  3WG5 A;  1XO6 A;  2D3T A;  3ST9 A;  3DOR A;  3TZ3 A;  2F9I A;  2GTR A;  3HE2 A;  2ZL4 A;  4GHN A;  1WZ8 A;  1FC9 A;  2Q2X A;  4OG1 A;  2ZL3 A;  4HNK A;  4JSB A;  4U0G A;  2CE3 A;  1Q51 A;  1XX4 A;  3Q7H A;  2Q34 A;  5E0N X;  5KDR B;  1K32 A;  5G1Q A;  3TDC A;  3KTG A;  4FZW A;  4Q0G A;  1ON3 A;  1Q52 A;  5DUC A;  3LAO A;  3QRE A;  3QXZ A;  1W2X A;  2F9Y A;  4MOU A;  2J5S A;  5INF A;  3H0J A;  3STA A;  4JFC A;  5DZK A;  4JCT A;  1EF9 A;  2J5G A;  5JBW A;  2NP9 A;  1WDM A;  3M6N A;  3QKA A;  3KTI A;  3MFM A; 
#chains in the Genus database with same CATH homology
 1YG6 A;  3K8X A;  1PIX A;  5KDR A;  5DTP A;  1TG6 A;  2UZF A;  5FUS A;  4QII A;  3HLN 1;  4K2N A;  3FF6 A;  3QYR A;  4MI2 A;  3H81 A;  4RYF H;  2YJG A;  3KQF A;  4ZDE A;  3R9Q A;  3OC7 A;  4HDT A;  4KPK A;  3Q1T A;  3ZWA A;  4I42 A;  3SLL A;  4JCR A;  4U18 A;  5E0S H;  3TVU A;  3NJB A;  5FIF A;  4WCZ A;  3V5E A;  4ELX A;  3L3S A;  2CBY A;  3R9S A;  4GM2 A;  2Q35 A;  1K39 A;  5C90 A;  3I47 A;  3GLM A;  3KTK A;  3OME A;  2VSU E;  1UYT A;  4ASI A;  5HUQ A;  3PE8 A;  2F6Q A;  3P85 A;  3QK8 A;  2ZL0 A;  4Q1I A;  5DTW A;  3BF0 A;  1FC6 A;  1RJM A;  4FN7 A;  5C9G A;  1SZO A;  3U9T B;  4YLH A;  2DUB A;  3K50 A;  3ISA A;  4Z0M A;  4EMM A;  3KTJ A;  1ON9 A;  3T8A A;  4KNP A;  3NJD A;  2X24 A;  4RCN A;  1FCF A;  4ZDB A;  5JBX A;  3T88 A;  1OD4 A;  5G1R A;  1MJ3 A;  3BEZ A;  4KWB A;  3FDU A;  3JU1 A;  3KTH A;  1NZY A;  4ZDF A;  4OLQ A;  4JWV A;  3R6H A;  4HC8 A;  3TV5 A;  1XNV A;  3U9R B;  4B3I A;  3DJA A;  2PPY A;  3PZK A;  3SWX A;  1UYS A;  2VX2 A;  2A81 A;  2VSS E;  5MGB A;  4FND A;  5DUF A;  3HIN A;  3QMJ A;  2FBM A;  4NEK A;  3ZW8 A;  3N6R B;  3U9S B;  3HP0 A;  2FW2 A;  3TVW A;  3RSI A;  3T89 A;  1RJN A;  3M6M A;  3IAV A;  4QFE A;  3BPT A;  3H0Q A;  4DI1 A;  3R0O A;  4F47 A;  1HZD A;  2J5I I;  2J5I B;  3ZWC A;  2PG8 A;  1N6F A;  2ZQR A;  4IZC A;  3HRX A;  3GF3 A;  3TRR A;  4EMP A;  2PBP A;  1SG4 A;  3QWD A;  1DCI A;  5E0S A;  3IB9 A;  1OD2 A;  3T8B A;  2HW5 A;  3PEA A;  1NZY B;  1VRG A;  3VIV A;  5DKP A;  5DL1 A;  5G1S A;  1PJH A;  2F6I A;  2A7K A;  4EML A;  2BZR A;  3TT7 A;  4B3H A;  2J5I A;  4ZU2 A;  3G64 A;  4K3W A;  1FC7 A;  3PGQ A;  1EY3 A;  2EJ5 A;  3RST A;  4G2R A;  4FJW D;  2J5G D;  3ZWB A;  4OMR A;  2W3P A;  2VSU C;  4ELS A;  4MXI A;  1JXZ A;  3R9T A;  3V5I A;  3RRV A;  2VSS A;  3QXI A;  4U0G H;  2X58 A;  4B3J A;  4JJT A;  5CTB A;  3ZW9 A;  3MT6 A;  1N6E A;  4IZB A;  4LK5 A;  1YG8 A;  4NNQ A;  3GMA A;  2VRE A;  3H0S A;  3H0U A;  1HNO A;  3P5M A;  4L6W A;  1DUB A;  4I52 A;  3Q0J A;  4NAR A;  2VSU F;  1UIY A;  5DZK H;  2ZL2 A;  4IZD A;  1HNU A;  4KD6 A;  1Y7O A;  4JCQ A;  4FB8 A;  5DU6 A;  1WDL A;  3T3W A;  4JOT A;  4J2U A;  3TLF A;  1UYR A;  1J7X A;  2A7S A;  2IEX A;  3BPP A;  4RYF A;  4WZ8 B;  4JVT A;  3GF7 A;  4ZDD A;  1O8U A;  4U0H A;  2QQ3 A;  4JCS A;  3Q0G A;  4U1A A;  3OT6 A;  4QIJ A;  2DEO A;  2VSU A;  1WDK A;  2F9I B;  3LKE A;  4L8K A;  4FN8 A;  3MYB A;  4FZW C;  3MOY A;  3IBB A;  2ZQQ A;  5ING A;  2FZS A;  1XNY A;  5DU4 A;  5DU8 A;  3GKB A;  5KJP A;  1X0U A;  5CTC A;  1N6D A;  4U19 A;  1TYF A;  1EF8 A;  2C8T A;  2VSS F;  4ELW A;  5INI A;  4ZDC A;  3TT6 A;  4FNB A;  3P2L A;  1UYV A;  4WYO B;  1XNW A;  2WTB A;  4JYL A;  4K29 A;  3H02 A;  4I4Z A;  2F9Y B;  4JYJ A;  5IKL B;  3WG5 A;  1XO6 A;  2D3T A;  3ST9 A;  3DOR A;  3TZ3 A;  2F9I A;  2GTR A;  3HE2 A;  2ZL4 A;  4GHN A;  1WZ8 A;  1FC9 A;  2Q2X A;  4OG1 A;  2ZL3 A;  4HNK A;  4JSB A;  4U0G A;  2CE3 A;  1Q51 A;  1XX4 A;  3Q7H A;  2Q34 A;  5E0N X;  5KDR B;  1K32 A;  5G1Q A;  3TDC A;  3KTG A;  4FZW A;  4Q0G A;  1ON3 A;  1Q52 A;  5DUC A;  3LAO A;  3QRE A;  3QXZ A;  1W2X A;  2F9Y A;  4MOU A;  2J5S A;  5INF A;  3H0J A;  3STA A;  4JFC A;  5DZK A;  4JCT A;  1EF9 A;  2J5G A;  5JBW A;  2NP9 A;  1WDM A;  3M6N A;  3QKA A;  3KTI A;  3MFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...