5FVIA

Structure of irisfp in mineral grease at 100 k.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
221
structure length
220
Chain Sequence
MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GREEN TO RED PHOTOCONVERTIBLE GPF-LIKE PROTEIN EOSFP
publication title Serial Femtosecond Crystallography and Ultrafast Absorption Spectroscopy of the Photoswitchable Fluorescent Protein Irisfp.
pubmed doi rcsb
source organism Lobophyllia hemprichii
molecule tags Fluorescent protein
total genus 60
structure length 220
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5fviA00
2Z1OA 3DQMA 1MYWA 3EKJA 4Q9WA 4W7DA 4Z4MA 1OXEA 2QRFA 4KAGA 2QU1A 3SVBA 3CFHA 3E5VA 3GJ2A 2VADA 4W7CA 3EK7A 4W6RA 4W69A 4AR7A 4UTSA 3DQ9A 2G2SB 1YFPA 3ED8A 4N3DA 3DQ3A 3NT9A 3UFZA 2VVHA 2OKYA 4XOVA 4JC2A 5LTRA 2P4MA 2VVJA 4HVFA 2Y0GA 2WHTA 5DRGA 1GL4A 5DU0A 4P1QA 5FHVA 4TZAA 2IOVA 3GJ1A 1BFPA 2HCGA 4H48A 2AWKA 5FVFA 1Q73A 5DQMA 3DQ7A 4W6SA 4EMQA 1EMLA 2GX0A 5BQLA 3DQ2A 1XSSA 3SVOA 5EJUA 1QYQA 2DUFA 4RYWA 4JFGA 3DQ1A 3TMTA 3AKOA 4P76A 2DUGA 4KGEA 5EXCI 4GOBA 2OKWA 3DQFA 1YJFA 2H8QA 4KF5A 5HZOA 1EMCA 4W6DA 4U2VA 4W7EA 2WIQA 5EXBA 4KEXA 2OTEA 3CBEA 3DQNA 4PPKA 4EN1A 4DXIA 3NEDA 3TMRA 4HQ8A 3V3DA 4LJCA 4KF4A 3RWAA 2DD7A 3EK8A 3U0KA 3OGOA 4W6HA 3EVUA 3OSRA 1H4UA 3SG2A 3CFAA 1HCJA 3LF3A 3ST4A 4JEOA 3LSAA 5EHUA 4OY4A 4W6BA 3SVCA 2O24A 3AI5A 4W6FA 3UG0A 4KF5C 1EMEA 3VK1A 2G16B 4H3MA 3BXCA 3DPZA 1Q4BA 2POXA 4Q7RA 4LQTA 4W6JA 4BDUA 3SS0A 2V4EC 3H1RA 5H88A 2PXWA 1Q4CA 4L1IA 4W72A 1Z1QA 4PPLA 4W6CA 3EVRA 1ZGOA 3ZUJA 5HW9A 2IE2A 5DPJA 2ZMWA 3IP2A 2HPWA 4Q9XA 5FVIA 3GL4A 1QYOA 4W75A 5DPGA 1ZGPA 4IK4A 4R6DA 2C9IA 3A8SA 4W6AA 5J2OA 4TZGA 4DXNA 3W1DA 3DQUA 1W7SA 3K1KA 5EXUA 3I19A 1W7TA 1QXTA 5LTPA 3NEZA 2WHUA 1EMAA 3SVEA 3M22A 1JC0A 2H6VA 3VHTA 3RWTA 4H3NA 1EMMA 1QYFA 2G3OA 2H9WA 3VICA 4XGYA 1YZWA 5DTZA 4ZINA 2FL1A 2G6EA 3G9AA 5DTYA 3SG5A 2A48A 2RH7A 2Z6ZA 4GF6B 2EMOA 3E5WA 1HUYA 3U8PA 4W7XA 2QT2A 2DUHA 4L13A 1OXDA 4W6PA 3WCKA 2AWMA 3SV5A 2ZO6A 3LS3A 4Z4KA 4W74A 5LK4A 1C4FA 5DRFA 2G6XA 4LJBA 3W1CA 1XAEA 3DQ8A 5HZUA 4DXQA 2DDCA 2H5QA 3U8AA 4ZF4A 4IK1A 4JF9A 3ADFA 4W77A 2ZMUA 3H1OA 2JADA 3GB3A 1JC1A 1RMPA 4DXMA 1Q4DA 2DDDA 4EDSA 4KPIA 1B9CA 5DTXA 3DQOA 5T3IA 5DTLA 2V4EA 2IB5A 4PFEA 1F0BA 2VZXA 5KTGA 2QLGA 1RMOA 1MOVA 3SSHA 4EULA 2HGYA 2PXSA 3VHTB 3ZULA 2WSNA 4KGFA 4W6KA 1JBZA 1KYSA 3DQ6A 5DPHA 4ZB1A 4XOWA 3SG4A 4IZNA 3DQJA 1G7KA 2ARLA 3BX9A 5HGEA 5AQBB 4AS8A 3SG3A 4PPJA 4LJDA 1ZGQA 2DD9A 5HZTA 4KA9A 1H6RA 4Q7UA 3EKHA 1KYRA 2YDZA 3ST3A 3M24A 4HQCA 3SVRA 1ZUXA 2B3QA 2HQKA 4ZF3A 3O78A 4HQ9A 2FWQA 3SSLA 3DQHA 3DPWA 3DQCA 3PIBA 3SSKA 3AI4A 1Q4AA 5DQBA 4ZIOA 3U0LA 2WISA 2FZUA 2A56B 1W7UA 2HJOA 4DKMA 4J88A 4KW9A 4OQWA 2G3DB 2QLEA 3BXBA 5DY6A 4ORNA 2VVIA 4RTCA 1YHGA 3ZTFA 2V4EB 1CV7A 4LJDC 1Q4EA 3KCTA 2QLGB 2Z6YA 3MGFA 3NF0A 4J8AA 2O29A 5F9GA 3EK4A 2HRSA 4JGEA 3CB9A 2H5OA 4W6TA 3DQKA 4OHSA 3BXAA 4B30A 3LA1A 3SSYA 1YHHA 1KP5A 2DUEA 4RYSA 2AWLA 5H89A 2GX2A 2A46A 2YE1A 4LW5A 3OSQA 4W6IA 3EVPA 2Z6XA 1EMBA 2H5PA 3ST2A 2QLIA 3E5TA 3SVNA 1QY3A 3O77A 2AHAA 4IK3A 4IK5A 2GW3A 4R6BA 2A54B 3SVDA 5EB6A 5FVGA 1EMGA 2HQZA 4HE4A 4W6GA 4J89A 3CD1A 3DQAA 3S05A 2ICRA 1MOUA 4Q7TA 4DXOA 2G5ZB 4W76A 3U0MA 4EDOA 2Q57A 2A50B 4GESB 2YE0A 2G6YA 4W73A 3SSVA 3EVVA 2YFPA 1S6ZA 4JRBA 3WLDA 1UISA 3SG7A 4W6NA 5BTTA 2ZO7A 5H87A 4NWSA 1KYPA 4DKNA 3PJBA 1GGXA 3SVUA 4KW8A 4B30B 2HFCA 5EB7A 2IB6A 1JBYA 1Z1PA 3DQ4A 3GEXA 3LVCA 3SSPA 3ZUFA 2BTJA 2WURA 4IK8A 3DQDA 4W7RA 3P8UA 4KW4A 3KCSA 2A47A 2C9JA 4ANJA 2OGRA 2QZ0A 2EMNA 2WSOA 2B3PA 4W6OA 3NT3A 3U8CA 3DPXA 2GW4B 1XMZA 4ZF5A 1XQMA 4H3LA 2AH8A 4H47A 5EBJA 3DQIA 2WHSA 3DQLA 3CFFA 3LVDA 3ST0A 1F09A 3SSTA 2HGDA 1RRXA 1OXFA 4ZFSA 3LF4B 2VAEA 2A53B 4LQUA 4B5YA 2H5RA 1RMMA 4XL5A 2O2BA 1XA9A 1EMKA 4I2YA 5DPIA 5HZSA 4OGSA 2QLHA 3WLCA 2EMDA 4L12A 3SG6A 5BT0A 4W6MA 3U0NA 3CGLA 4XVPA 5LTQA 3LVAA 1YHIA 2DUIA 3PJ5A 3DQEA 4W7FA 3DQ5A 1YJ2A 4IK9A 1RM9A 1GFLA 2OJKA 3SRYA 5BTTB 3PJ7A 4W6UA 4OJ0A 4W6LA 3IR8A 1EMFA 2OTBA 4DXPA 2A52B 4W7AA 2AWJA 4ZBLA 3CD9A 3SVSA 3P28A 5HBDA 2Q6PA
chains in the Genus database with same CATH superfamily
2Z1OA 3DQMA 1MYWA 3EKJA 4Q9WA 4W7DA 4Z4MA 1OXEA 2QRFA 4KAGA 2QU1A 3SVBA 3CFHA 3E5VA 3GJ2A 2VADA 4W7CA 3EK7A 4W6RA 4W69A 4AR7A 4UTSA 3DQ9A 2G2SB 1YFPA 3ED8A 4N3DA 3DQ3A 3NT9A 3UFZA 2VVHA 2OKYA 4XOVA 4JC2A 5LTRA 2P4MA 2VVJA 4HVFA 2Y0GA 2WHTA 5DRGA 1GL4A 5DU0A 4P1QA 5FHVA 4TZAA 2IOVA 3GJ1A 1BFPA 2HCGA 4H48A 2AWKA 5FVFA 1Q73A 5DQMA 3DQ7A 4W6SA 4EMQA 1EMLA 2GX0A 5BQLA 3DQ2A 1XSSA 3SVOA 5EJUA 1QYQA 2DUFA 4RYWA 4JFGA 3DQ1A 3TMTA 3AKOA 4P76A 2DUGA 4KGEA 5EXCI 4GOBA 2OKWA 3DQFA 1YJFA 2H8QA 4KF5A 5HZOA 1EMCA 4W6DA 4U2VA 4W7EA 2WIQA 5EXBA 4KEXA 2OTEA 3CBEA 3DQNA 4PPKA 4EN1A 4DXIA 3NEDA 3TMRA 4HQ8A 3V3DA 4LJCA 4KF4A 3RWAA 2DD7A 3EK8A 3U0KA 3OGOA 4W6HA 3EVUA 3OSRA 1H4UA 3SG2A 3CFAA 1HCJA 3LF3A 3ST4A 4JEOA 3LSAA 5EHUA 4OY4A 4W6BA 3SVCA 2O24A 3AI5A 4W6FA 3UG0A 4KF5C 1EMEA 3VK1A 2G16B 4H3MA 3BXCA 3DPZA 1Q4BA 2POXA 4Q7RA 4LQTA 4W6JA 4BDUA 3SS0A 2V4EC 3H1RA 5H88A 2PXWA 1Q4CA 4L1IA 4W72A 1Z1QA 4PPLA 4W6CA 3EVRA 1ZGOA 3ZUJA 5HW9A 2IE2A 5DPJA 2ZMWA 3IP2A 2HPWA 4Q9XA 5FVIA 3GL4A 1QYOA 4W75A 5DPGA 1ZGPA 4IK4A 4R6DA 2C9IA 3A8SA 4W6AA 5J2OA 4TZGA 4DXNA 3W1DA 3DQUA 1W7SA 3K1KA 5EXUA 3I19A 1W7TA 1QXTA 5LTPA 3NEZA 2WHUA 1EMAA 3SVEA 3M22A 1JC0A 2H6VA 3VHTA 3RWTA 4H3NA 1EMMA 1QYFA 2G3OA 2H9WA 3VICA 4XGYA 1YZWA 5DTZA 4ZINA 2FL1A 2G6EA 3G9AA 5DTYA 3SG5A 2A48A 2RH7A 2Z6ZA 4GF6B 2EMOA 3E5WA 1HUYA 3U8PA 4W7XA 2QT2A 2DUHA 4L13A 1OXDA 4W6PA 3WCKA 2AWMA 3SV5A 2ZO6A 3LS3A 4Z4KA 4W74A 5LK4A 1C4FA 5DRFA 2G6XA 4LJBA 3W1CA 1XAEA 3DQ8A 5HZUA 4DXQA 2DDCA 2H5QA 3U8AA 4ZF4A 4IK1A 4JF9A 3ADFA 4W77A 2ZMUA 3H1OA 2JADA 3GB3A 1JC1A 1RMPA 4DXMA 1Q4DA 2DDDA 4EDSA 4KPIA 1B9CA 5DTXA 3DQOA 5T3IA 5DTLA 2V4EA 2IB5A 4PFEA 1F0BA 2VZXA 5KTGA 2QLGA 1RMOA 1MOVA 3SSHA 4EULA 2HGYA 2PXSA 3VHTB 3ZULA 2WSNA 4KGFA 4W6KA 1JBZA 1KYSA 3DQ6A 5DPHA 4ZB1A 4XOWA 3SG4A 4IZNA 3DQJA 1G7KA 2ARLA 3BX9A 5HGEA 5AQBB 4AS8A 3SG3A 4PPJA 4LJDA 1ZGQA 2DD9A 5HZTA 4KA9A 1H6RA 4Q7UA 3EKHA 1KYRA 2YDZA 3ST3A 3M24A 4HQCA 3SVRA 1ZUXA 2B3QA 2HQKA 4ZF3A 3O78A 4HQ9A 2FWQA 3SSLA 3DQHA 3DPWA 3DQCA 3PIBA 3SSKA 3AI4A 1Q4AA 5DQBA 4ZIOA 3U0LA 2WISA 2FZUA 2A56B 1W7UA 2HJOA 4DKMA 4J88A 4KW9A 4OQWA 2G3DB 2QLEA 3BXBA 5DY6A 4ORNA 2VVIA 4RTCA 1YHGA 3ZTFA 2V4EB 1CV7A 4LJDC 1Q4EA 3KCTA 2QLGB 2Z6YA 3MGFA 3NF0A 4J8AA 2O29A 5F9GA 3EK4A 2HRSA 4JGEA 3CB9A 2H5OA 4W6TA 3DQKA 4OHSA 3BXAA 4B30A 3LA1A 3SSYA 1YHHA 1KP5A 2DUEA 4RYSA 2AWLA 5H89A 2GX2A 2A46A 2YE1A 4LW5A 3OSQA 4W6IA 3EVPA 2Z6XA 1EMBA 2H5PA 3ST2A 2QLIA 3E5TA 3SVNA 1QY3A 3O77A 2AHAA 4IK3A 4IK5A 2GW3A 4R6BA 2A54B 3SVDA 5EB6A 5FVGA 1EMGA 2HQZA 4HE4A 4W6GA 4J89A 3CD1A 3DQAA 3S05A 2ICRA 1MOUA 4Q7TA 4DXOA 2G5ZB 4W76A 3U0MA 4EDOA 2Q57A 2A50B 4GESB 2YE0A 2G6YA 4W73A 3SSVA 3EVVA 2YFPA 1S6ZA 4JRBA 3WLDA 1UISA 3SG7A 4W6NA 5BTTA 2ZO7A 5H87A 4NWSA 1KYPA 4DKNA 3PJBA 1GGXA 3SVUA 4KW8A 4B30B 2HFCA 5EB7A 2IB6A 1JBYA 1Z1PA 3DQ4A 3GEXA 3LVCA 3SSPA 3ZUFA 2BTJA 2WURA 4IK8A 3DQDA 4W7RA 3P8UA 4KW4A 3KCSA 2A47A 2C9JA 4ANJA 2OGRA 2QZ0A 2EMNA 2WSOA 2B3PA 4W6OA 3NT3A 3U8CA 3DPXA 2GW4B 1XMZA 4ZF5A 1XQMA 4H3LA 2AH8A 4H47A 5EBJA 3DQIA 2WHSA 3DQLA 3CFFA 3LVDA 3ST0A 1F09A 3SSTA 2HGDA 1RRXA 1OXFA 4ZFSA 3LF4B 2VAEA 2A53B 4LQUA 4B5YA 2H5RA 1RMMA 4XL5A 2O2BA 1XA9A 1EMKA 4I2YA 5DPIA 5HZSA 4OGSA 2QLHA 3WLCA 2EMDA 4L12A 3SG6A 5BT0A 4W6MA 3U0NA 3CGLA 4XVPA 5LTQA 3LVAA 1YHIA 2DUIA 3PJ5A 3DQEA 4W7FA 3DQ5A 1YJ2A 4IK9A 1RM9A 1GFLA 2OJKA 3SRYA 5BTTB 3PJ7A 4W6UA 4OJ0A 4W6LA 3IR8A 1EMFA 2OTBA 4DXPA 2A52B 4W7AA 2AWJA 4ZBLA 3CD9A 3SVSA 3P28A 5HBDA 2Q6PA
chains in the Genus database with same CATH topology
2Z1OA 3DQMA 1MYWA 3EKJA 4Q9WA 4W7DA 4Z4MA 1OXEA 2QRFA 4KAGA 2QU1A 3SVBA 3CFHA 3E5VA 3GJ2A 2VADA 4W7CA 3EK7A 4W6RA 4W69A 4AR7A 4UTSA 3DQ9A 2G2SB 1YFPA 3ED8A 4N3DA 3DQ3A 3NT9A 3UFZA 2VVHA 2OKYA 4XOVA 4JC2A 5LTRA 2P4MA 2VVJA 4HVFA 2Y0GA 2WHTA 5DRGA 1GL4A 5DU0A 4P1QA 5FHVA 4TZAA 2IOVA 3GJ1A 1BFPA 2HCGA 4H48A 2AWKA 5FVFA 1Q73A 5DQMA 3DQ7A 4W6SA 4EMQA 1EMLA 2GX0A 5BQLA 3DQ2A 1XSSA 3SVOA 5EJUA 1QYQA 2DUFA 4RYWA 4JFGA 3DQ1A 3TMTA 3AKOA 4P76A 2DUGA 4KGEA 5EXCI 4GOBA 2OKWA 3DQFA 1YJFA 2H8QA 4KF5A 5HZOA 1EMCA 4W6DA 4U2VA 4W7EA 2WIQA 5EXBA 4KEXA 2OTEA 3CBEA 3DQNA 4PPKA 4EN1A 4DXIA 3NEDA 3TMRA 4HQ8A 3V3DA 4LJCA 4KF4A 3RWAA 2DD7A 3EK8A 3U0KA 3OGOA 4W6HA 3EVUA 3OSRA 1H4UA 3SG2A 3CFAA 1HCJA 3LF3A 3ST4A 4JEOA 3LSAA 5EHUA 4OY4A 4W6BA 3SVCA 2O24A 3AI5A 4W6FA 3UG0A 4KF5C 1EMEA 3VK1A 2G16B 4H3MA 3BXCA 3DPZA 1Q4BA 2POXA 4Q7RA 4LQTA 4W6JA 4BDUA 3SS0A 2V4EC 3H1RA 5H88A 2PXWA 1Q4CA 4L1IA 4W72A 1Z1QA 4PPLA 4W6CA 3EVRA 1ZGOA 3ZUJA 5HW9A 2IE2A 5DPJA 2ZMWA 3IP2A 2HPWA 4Q9XA 5FVIA 3GL4A 1QYOA 4W75A 5DPGA 1ZGPA 4IK4A 4R6DA 2C9IA 3A8SA 4W6AA 5J2OA 4TZGA 4DXNA 3W1DA 3DQUA 1W7SA 3K1KA 5EXUA 3I19A 1W7TA 1QXTA 5LTPA 3NEZA 2WHUA 1EMAA 3SVEA 3M22A 1JC0A 2H6VA 3VHTA 3RWTA 4H3NA 1EMMA 1QYFA 2G3OA 2H9WA 3VICA 4XGYA 1YZWA 5DTZA 4ZINA 2FL1A 2G6EA 3G9AA 5DTYA 3SG5A 2A48A 2RH7A 2Z6ZA 4GF6B 2EMOA 3E5WA 1HUYA 3U8PA 4W7XA 2QT2A 2DUHA 4L13A 1OXDA 4W6PA 3WCKA 2AWMA 3SV5A 2ZO6A 3LS3A 4Z4KA 4W74A 5LK4A 1C4FA 5DRFA 2G6XA 4LJBA 3W1CA 1XAEA 3DQ8A 5HZUA 4DXQA 2DDCA 2H5QA 3U8AA 4ZF4A 4IK1A 4JF9A 3ADFA 4W77A 2ZMUA 3H1OA 2JADA 3GB3A 1JC1A 1RMPA 4DXMA 1Q4DA 2DDDA 4EDSA 4KPIA 1B9CA 5DTXA 3DQOA 5T3IA 5DTLA 2V4EA 2IB5A 4PFEA 1F0BA 2VZXA 5KTGA 2QLGA 1RMOA 1MOVA 3SSHA 4EULA 2HGYA 2PXSA 3VHTB 3ZULA 2WSNA 4KGFA 4W6KA 1JBZA 1KYSA 3DQ6A 5DPHA 4ZB1A 4XOWA 3SG4A 4IZNA 3DQJA 1G7KA 2ARLA 3BX9A 5HGEA 5AQBB 4AS8A 3SG3A 4PPJA 4LJDA 1ZGQA 2DD9A 5HZTA 4KA9A 1H6RA 4Q7UA 3EKHA 1KYRA 2YDZA 3ST3A 3M24A 4HQCA 3SVRA 1ZUXA 2B3QA 2HQKA 4ZF3A 3O78A 4HQ9A 2FWQA 3SSLA 3DQHA 3DPWA 3DQCA 3PIBA 3SSKA 3AI4A 1Q4AA 5DQBA 4ZIOA 3U0LA 2WISA 2FZUA 2A56B 1W7UA 2HJOA 4DKMA 4J88A 4KW9A 4OQWA 2G3DB 2QLEA 3BXBA 5DY6A 4ORNA 2VVIA 4RTCA 1YHGA 3ZTFA 2V4EB 1CV7A 4LJDC 1Q4EA 3KCTA 2QLGB 2Z6YA 3MGFA 3NF0A 4J8AA 2O29A 5F9GA 3EK4A 2HRSA 4JGEA 3CB9A 2H5OA 4W6TA 3DQKA 4OHSA 3BXAA 4B30A 3LA1A 3SSYA 1YHHA 1KP5A 2DUEA 4RYSA 2AWLA 5H89A 2GX2A 2A46A 2YE1A 4LW5A 3OSQA 4W6IA 3EVPA 2Z6XA 1EMBA 2H5PA 3ST2A 2QLIA 3E5TA 3SVNA 1QY3A 3O77A 2AHAA 4IK3A 4IK5A 2GW3A 4R6BA 2A54B 3SVDA 5EB6A 5FVGA 1EMGA 2HQZA 4HE4A 4W6GA 4J89A 3CD1A 3DQAA 3S05A 2ICRA 1MOUA 4Q7TA 4DXOA 2G5ZB 4W76A 3U0MA 4EDOA 2Q57A 2A50B 4GESB 2YE0A 2G6YA 4W73A 3SSVA 3EVVA 2YFPA 1S6ZA 4JRBA 3WLDA 1UISA 3SG7A 4W6NA 5BTTA 2ZO7A 5H87A 4NWSA 1KYPA 4DKNA 3PJBA 1GGXA 3SVUA 4KW8A 4B30B 2HFCA 5EB7A 2IB6A 1JBYA 1Z1PA 3DQ4A 3GEXA 3LVCA 3SSPA 3ZUFA 2BTJA 2WURA 4IK8A 3DQDA 4W7RA 3P8UA 4KW4A 3KCSA 2A47A 2C9JA 4ANJA 2OGRA 2QZ0A 2EMNA 2WSOA 2B3PA 4W6OA 3NT3A 3U8CA 3DPXA 2GW4B 1XMZA 4ZF5A 1XQMA 4H3LA 2AH8A 4H47A 5EBJA 3DQIA 2WHSA 3DQLA 3CFFA 3LVDA 3ST0A 1F09A 3SSTA 2HGDA 1RRXA 1OXFA 4ZFSA 3LF4B 2VAEA 2A53B 4LQUA 4B5YA 2H5RA 1RMMA 4XL5A 2O2BA 1XA9A 1EMKA 4I2YA 5DPIA 5HZSA 4OGSA 2QLHA 3WLCA 2EMDA 4L12A 3SG6A 5BT0A 4W6MA 3U0NA 3CGLA 4XVPA 5LTQA 3LVAA 1YHIA 2DUIA 3PJ5A 3DQEA 4W7FA 3DQ5A 1YJ2A 4IK9A 1RM9A 1GFLA 2OJKA 3SRYA 5BTTB 3PJ7A 4W6UA 4OJ0A 4W6LA 3IR8A 1EMFA 2OTBA 4DXPA 2A52B 4W7AA 2AWJA 4ZBLA 3CD9A 3SVSA 3P28A 5HBDA 2Q6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1O A;  3DQM A;  1MYW A;  3EKJ A;  4Q9W A;  4W7D A;  4Z4M A;  1OXE A;  2QRF A;  4KAG A;  2QU1 A;  3SVB A;  3CFH A;  3E5V A;  3GJ2 A;  2VAD A;  4W7C A;  3EK7 A;  4W6R A;  4W69 A;  4AR7 A;  4UTS A;  3DQ9 A;  2G2S B;  1YFP A;  3ED8 A;  4N3D A;  3DQ3 A;  3NT9 A;  3UFZ A;  2VVH A;  2OKY A;  4XOV A;  4JC2 A;  5LTR A;  2P4M A;  2VVJ A;  4HVF A;  2Y0G A;  2WHT A;  5DRG A;  1GL4 A;  5DU0 A;  4P1Q A;  5FHV A;  4TZA A;  2IOV A;  3GJ1 A;  1BFP A;  2HCG A;  4H48 A;  2AWK A;  5FVF A;  1Q73 A;  5DQM A;  3DQ7 A;  4W6S A;  4EMQ A;  1EML A;  2GX0 A;  5BQL A;  3DQ2 A;  1XSS A;  3SVO A;  5EJU A;  1QYQ A;  2DUF A;  4RYW A;  4JFG A;  3DQ1 A;  3TMT A;  3AKO A;  4P76 A;  2DUG A;  4KGE A;  5EXC I;  4GOB A;  2OKW A;  3DQF A;  1YJF A;  2H8Q A;  4KF5 A;  5HZO A;  1EMC A;  4W6D A;  4U2V A;  4W7E A;  2WIQ A;  5EXB A;  4KEX A;  2OTE A;  3CBE A;  3DQN A;  4PPK A;  4EN1 A;  4DXI A;  3NED A;  3TMR A;  4HQ8 A;  3V3D A;  4LJC A;  4KF4 A;  3RWA A;  2DD7 A;  3EK8 A;  3U0K A;  3OGO A;  4W6H A;  3EVU A;  3OSR A;  1H4U A;  3SG2 A;  3CFA A;  1HCJ A;  3LF3 A;  3ST4 A;  4JEO A;  3LSA A;  5EHU A;  4OY4 A;  4W6B A;  3SVC A;  2O24 A;  3AI5 A;  4W6F A;  3UG0 A;  4KF5 C;  1EME A;  3VK1 A;  2G16 B;  4H3M A;  3BXC A;  3DPZ A;  1Q4B A;  2POX A;  4Q7R A;  4LQT A;  4W6J A;  4BDU A;  3SS0 A;  2V4E C;  3H1R A;  5H88 A;  2PXW A;  1Q4C A;  4L1I A;  4W72 A;  1Z1Q A;  4PPL A;  4W6C A;  3EVR A;  1ZGO A;  3ZUJ A;  5HW9 A;  2IE2 A;  5DPJ A;  2ZMW A;  3IP2 A;  2HPW A;  4Q9X A;  5FVI A;  3GL4 A;  1QYO A;  4W75 A;  5DPG A;  1ZGP A;  4IK4 A;  4R6D A;  2C9I A;  3A8S A;  4W6A A;  5J2O A;  4TZG A;  4DXN A;  3W1D A;  3DQU A;  1W7S A;  3K1K A;  5EXU A;  3I19 A;  1W7T A;  1QXT A;  5LTP A;  3NEZ A;  2WHU A;  1EMA A;  3SVE A;  3M22 A;  1JC0 A;  2H6V A;  3VHT A;  3RWT A;  4H3N A;  1EMM A;  1QYF A;  2G3O A;  2H9W A;  3VIC A;  4XGY A;  1YZW A;  5DTZ A;  4ZIN A;  2FL1 A;  2G6E A;  3G9A A;  5DTY A;  3SG5 A;  2A48 A;  2RH7 A;  2Z6Z A;  4GF6 B;  2EMO A;  3E5W A;  1HUY A;  3U8P A;  4W7X A;  2QT2 A;  2DUH A;  4L13 A;  1OXD A;  4W6P A;  3WCK A;  2AWM A;  3SV5 A;  2ZO6 A;  3LS3 A;  4Z4K A;  4W74 A;  5LK4 A;  1C4F A;  5DRF A;  2G6X A;  4LJB A;  3W1C A;  1XAE A;  3DQ8 A;  5HZU A;  4DXQ A;  2DDC A;  2H5Q A;  3U8A A;  4ZF4 A;  4IK1 A;  4JF9 A;  3ADF A;  4W77 A;  2ZMU A;  3H1O A;  2JAD A;  3GB3 A;  1JC1 A;  1RMP A;  4DXM A;  1Q4D A;  2DDD A;  4EDS A;  4KPI A;  1B9C A;  5DTX A;  3DQO A;  5T3I A;  5DTL A;  2V4E A;  2IB5 A;  4PFE A;  1F0B A;  2VZX A;  5KTG A;  2QLG A;  1RMO A;  1MOV A;  3SSH A;  4EUL A;  2HGY A;  2PXS A;  3VHT B;  3ZUL A;  2WSN A;  4KGF A;  4W6K A;  1JBZ A;  1KYS A;  3DQ6 A;  5DPH A;  4ZB1 A;  4XOW A;  3SG4 A;  4IZN A;  3DQJ A;  1G7K A;  2ARL A;  3BX9 A;  5HGE A;  5AQB B;  4AS8 A;  3SG3 A;  4PPJ A;  4LJD A;  1ZGQ A;  2DD9 A;  5HZT A;  4KA9 A;  1H6R A;  4Q7U A;  3EKH A;  1KYR A;  2YDZ A;  3ST3 A;  3M24 A;  4HQC A;  3SVR A;  1ZUX A;  2B3Q A;  2HQK A;  4ZF3 A;  3O78 A;  4HQ9 A;  2FWQ A;  3SSL A;  3DQH A;  3DPW A;  3DQC A;  3PIB A;  3SSK A;  3AI4 A;  1Q4A A;  5DQB A;  4ZIO A;  3U0L A;  2WIS A;  2FZU A;  2A56 B;  1W7U A;  2HJO A;  4DKM A;  4J88 A;  4KW9 A;  4OQW A;  2G3D B;  2QLE A;  3BXB A;  5DY6 A;  4ORN A;  2VVI A;  4RTC A;  1YHG A;  3ZTF A;  2V4E B;  1CV7 A;  4LJD C;  1Q4E A;  3KCT A;  2QLG B;  2Z6Y A;  3MGF A;  3NF0 A;  4J8A A;  2O29 A;  5F9G A;  3EK4 A;  2HRS A;  4JGE A;  3CB9 A;  2H5O A;  4W6T A;  3DQK A;  4OHS A;  3BXA A;  4B30 A;  3LA1 A;  3SSY A;  1YHH A;  1KP5 A;  2DUE A;  4RYS A;  2AWL A;  5H89 A;  2GX2 A;  2A46 A;  2YE1 A;  4LW5 A;  3OSQ A;  4W6I A;  3EVP A;  2Z6X A;  1EMB A;  2H5P A;  3ST2 A;  2QLI A;  3E5T A;  3SVN A;  1QY3 A;  3O77 A;  2AHA A;  4IK3 A;  4IK5 A;  2GW3 A;  4R6B A;  2A54 B;  3SVD A;  5EB6 A;  5FVG A;  1EMG A;  2HQZ A;  4HE4 A;  4W6G A;  4J89 A;  3CD1 A;  3DQA A;  3S05 A;  2ICR A;  1MOU A;  4Q7T A;  4DXO A;  2G5Z B;  4W76 A;  3U0M A;  4EDO A;  2Q57 A;  2A50 B;  4GES B;  2YE0 A;  2G6Y A;  4W73 A;  3SSV A;  3EVV A;  2YFP A;  1S6Z A;  4JRB A;  3WLD A;  1UIS A;  3SG7 A;  4W6N A;  5BTT A;  2ZO7 A;  5H87 A;  4NWS A;  1KYP A;  4DKN A;  3PJB A;  1GGX A;  3SVU A;  4KW8 A;  4B30 B;  2HFC A;  5EB7 A;  2IB6 A;  1JBY A;  1Z1P A;  3DQ4 A;  3GEX A;  3LVC A;  3SSP A;  3ZUF A;  2BTJ A;  2WUR A;  4IK8 A;  3DQD A;  4W7R A;  3P8U A;  4KW4 A;  3KCS A;  2A47 A;  2C9J A;  4ANJ A;  2OGR A;  2QZ0 A;  2EMN A;  2WSO A;  2B3P A;  4W6O A;  3NT3 A;  3U8C A;  3DPX A;  2GW4 B;  1XMZ A;  4ZF5 A;  1XQM A;  4H3L A;  2AH8 A;  4H47 A;  5EBJ A;  3DQI A;  2WHS A;  3DQL A;  3CFF A;  3LVD A;  3ST0 A;  1F09 A;  3SST A;  2HGD A;  1RRX A;  1OXF A;  4ZFS A;  3LF4 B;  2VAE A;  2A53 B;  4LQU A;  4B5Y A;  2H5R A;  1RMM A;  4XL5 A;  2O2B A;  1XA9 A;  1EMK A;  4I2Y A;  5DPI A;  5HZS A;  4OGS A;  2QLH A;  3WLC A;  2EMD A;  4L12 A;  3SG6 A;  5BT0 A;  4W6M A;  3U0N A;  3CGL A;  4XVP A;  5LTQ A;  3LVA A;  1YHI A;  2DUI A;  3PJ5 A;  3DQE A;  4W7F A;  3DQ5 A;  1YJ2 A;  4IK9 A;  1RM9 A;  1GFL A;  2OJK A;  3SRY A;  5BTT B;  3PJ7 A;  4W6U A;  4OJ0 A;  4W6L A;  3IR8 A;  1EMF A;  2OTB A;  4DXP A;  2A52 B;  4W7A A;  2AWJ A;  4ZBL A;  3CD9 A;  3SVS A;  3P28 A;  5HBD A;  2Q6P A; 
#chains in the Genus database with same CATH topology
 2Z1O A;  3DQM A;  1MYW A;  3EKJ A;  4Q9W A;  4W7D A;  4Z4M A;  1OXE A;  2QRF A;  4KAG A;  2QU1 A;  3SVB A;  3CFH A;  3E5V A;  3GJ2 A;  2VAD A;  4W7C A;  3EK7 A;  4W6R A;  4W69 A;  4AR7 A;  4UTS A;  3DQ9 A;  2G2S B;  1YFP A;  3ED8 A;  4N3D A;  3DQ3 A;  3NT9 A;  3UFZ A;  2VVH A;  2OKY A;  4XOV A;  4JC2 A;  5LTR A;  2P4M A;  2VVJ A;  4HVF A;  2Y0G A;  2WHT A;  5DRG A;  1GL4 A;  5DU0 A;  4P1Q A;  5FHV A;  4TZA A;  2IOV A;  3GJ1 A;  1BFP A;  2HCG A;  4H48 A;  2AWK A;  5FVF A;  1Q73 A;  5DQM A;  3DQ7 A;  4W6S A;  4EMQ A;  1EML A;  2GX0 A;  5BQL A;  3DQ2 A;  1XSS A;  3SVO A;  5EJU A;  1QYQ A;  2DUF A;  4RYW A;  4JFG A;  3DQ1 A;  3TMT A;  3AKO A;  4P76 A;  2DUG A;  4KGE A;  5EXC I;  4GOB A;  2OKW A;  3DQF A;  1YJF A;  2H8Q A;  4KF5 A;  5HZO A;  1EMC A;  4W6D A;  4U2V A;  4W7E A;  2WIQ A;  5EXB A;  4KEX A;  2OTE A;  3CBE A;  3DQN A;  4PPK A;  4EN1 A;  4DXI A;  3NED A;  3TMR A;  4HQ8 A;  3V3D A;  4LJC A;  4KF4 A;  3RWA A;  2DD7 A;  3EK8 A;  3U0K A;  3OGO A;  4W6H A;  3EVU A;  3OSR A;  1H4U A;  3SG2 A;  3CFA A;  1HCJ A;  3LF3 A;  3ST4 A;  4JEO A;  3LSA A;  5EHU A;  4OY4 A;  4W6B A;  3SVC A;  2O24 A;  3AI5 A;  4W6F A;  3UG0 A;  4KF5 C;  1EME A;  3VK1 A;  2G16 B;  4H3M A;  3BXC A;  3DPZ A;  1Q4B A;  2POX A;  4Q7R A;  4LQT A;  4W6J A;  4BDU A;  3SS0 A;  2V4E C;  3H1R A;  5H88 A;  2PXW A;  1Q4C A;  4L1I A;  4W72 A;  1Z1Q A;  4PPL A;  4W6C A;  3EVR A;  1ZGO A;  3ZUJ A;  5HW9 A;  2IE2 A;  5DPJ A;  2ZMW A;  3IP2 A;  2HPW A;  4Q9X A;  5FVI A;  3GL4 A;  1QYO A;  4W75 A;  5DPG A;  1ZGP A;  4IK4 A;  4R6D A;  2C9I A;  3A8S A;  4W6A A;  5J2O A;  4TZG A;  4DXN A;  3W1D A;  3DQU A;  1W7S A;  3K1K A;  5EXU A;  3I19 A;  1W7T A;  1QXT A;  5LTP A;  3NEZ A;  2WHU A;  1EMA A;  3SVE A;  3M22 A;  1JC0 A;  2H6V A;  3VHT A;  3RWT A;  4H3N A;  1EMM A;  1QYF A;  2G3O A;  2H9W A;  3VIC A;  4XGY A;  1YZW A;  5DTZ A;  4ZIN A;  2FL1 A;  2G6E A;  3G9A A;  5DTY A;  3SG5 A;  2A48 A;  2RH7 A;  2Z6Z A;  4GF6 B;  2EMO A;  3E5W A;  1HUY A;  3U8P A;  4W7X A;  2QT2 A;  2DUH A;  4L13 A;  1OXD A;  4W6P A;  3WCK A;  2AWM A;  3SV5 A;  2ZO6 A;  3LS3 A;  4Z4K A;  4W74 A;  5LK4 A;  1C4F A;  5DRF A;  2G6X A;  4LJB A;  3W1C A;  1XAE A;  3DQ8 A;  5HZU A;  4DXQ A;  2DDC A;  2H5Q A;  3U8A A;  4ZF4 A;  4IK1 A;  4JF9 A;  3ADF A;  4W77 A;  2ZMU A;  3H1O A;  2JAD A;  3GB3 A;  1JC1 A;  1RMP A;  4DXM A;  1Q4D A;  2DDD A;  4EDS A;  4KPI A;  1B9C A;  5DTX A;  3DQO A;  5T3I A;  5DTL A;  2V4E A;  2IB5 A;  4PFE A;  1F0B A;  2VZX A;  5KTG A;  2QLG A;  1RMO A;  1MOV A;  3SSH A;  4EUL A;  2HGY A;  2PXS A;  3VHT B;  3ZUL A;  2WSN A;  4KGF A;  4W6K A;  1JBZ A;  1KYS A;  3DQ6 A;  5DPH A;  4ZB1 A;  4XOW A;  3SG4 A;  4IZN A;  3DQJ A;  1G7K A;  2ARL A;  3BX9 A;  5HGE A;  5AQB B;  4AS8 A;  3SG3 A;  4PPJ A;  4LJD A;  1ZGQ A;  2DD9 A;  5HZT A;  4KA9 A;  1H6R A;  4Q7U A;  3EKH A;  1KYR A;  2YDZ A;  3ST3 A;  3M24 A;  4HQC A;  3SVR A;  1ZUX A;  2B3Q A;  2HQK A;  4ZF3 A;  3O78 A;  4HQ9 A;  2FWQ A;  3SSL A;  3DQH A;  3DPW A;  3DQC A;  3PIB A;  3SSK A;  3AI4 A;  1Q4A A;  5DQB A;  4ZIO A;  3U0L A;  2WIS A;  2FZU A;  2A56 B;  1W7U A;  2HJO A;  4DKM A;  4J88 A;  4KW9 A;  4OQW A;  2G3D B;  2QLE A;  3BXB A;  5DY6 A;  4ORN A;  2VVI A;  4RTC A;  1YHG A;  3ZTF A;  2V4E B;  1CV7 A;  4LJD C;  1Q4E A;  3KCT A;  2QLG B;  2Z6Y A;  3MGF A;  3NF0 A;  4J8A A;  2O29 A;  5F9G A;  3EK4 A;  2HRS A;  4JGE A;  3CB9 A;  2H5O A;  4W6T A;  3DQK A;  4OHS A;  3BXA A;  4B30 A;  3LA1 A;  3SSY A;  1YHH A;  1KP5 A;  2DUE A;  4RYS A;  2AWL A;  5H89 A;  2GX2 A;  2A46 A;  2YE1 A;  4LW5 A;  3OSQ A;  4W6I A;  3EVP A;  2Z6X A;  1EMB A;  2H5P A;  3ST2 A;  2QLI A;  3E5T A;  3SVN A;  1QY3 A;  3O77 A;  2AHA A;  4IK3 A;  4IK5 A;  2GW3 A;  4R6B A;  2A54 B;  3SVD A;  5EB6 A;  5FVG A;  1EMG A;  2HQZ A;  4HE4 A;  4W6G A;  4J89 A;  3CD1 A;  3DQA A;  3S05 A;  2ICR A;  1MOU A;  4Q7T A;  4DXO A;  2G5Z B;  4W76 A;  3U0M A;  4EDO A;  2Q57 A;  2A50 B;  4GES B;  2YE0 A;  2G6Y A;  4W73 A;  3SSV A;  3EVV A;  2YFP A;  1S6Z A;  4JRB A;  3WLD A;  1UIS A;  3SG7 A;  4W6N A;  5BTT A;  2ZO7 A;  5H87 A;  4NWS A;  1KYP A;  4DKN A;  3PJB A;  1GGX A;  3SVU A;  4KW8 A;  4B30 B;  2HFC A;  5EB7 A;  2IB6 A;  1JBY A;  1Z1P A;  3DQ4 A;  3GEX A;  3LVC A;  3SSP A;  3ZUF A;  2BTJ A;  2WUR A;  4IK8 A;  3DQD A;  4W7R A;  3P8U A;  4KW4 A;  3KCS A;  2A47 A;  2C9J A;  4ANJ A;  2OGR A;  2QZ0 A;  2EMN A;  2WSO A;  2B3P A;  4W6O A;  3NT3 A;  3U8C A;  3DPX A;  2GW4 B;  1XMZ A;  4ZF5 A;  1XQM A;  4H3L A;  2AH8 A;  4H47 A;  5EBJ A;  3DQI A;  2WHS A;  3DQL A;  3CFF A;  3LVD A;  3ST0 A;  1F09 A;  3SST A;  2HGD A;  1RRX A;  1OXF A;  4ZFS A;  3LF4 B;  2VAE A;  2A53 B;  4LQU A;  4B5Y A;  2H5R A;  1RMM A;  4XL5 A;  2O2B A;  1XA9 A;  1EMK A;  4I2Y A;  5DPI A;  5HZS A;  4OGS A;  2QLH A;  3WLC A;  2EMD A;  4L12 A;  3SG6 A;  5BT0 A;  4W6M A;  3U0N A;  3CGL A;  4XVP A;  5LTQ A;  3LVA A;  1YHI A;  2DUI A;  3PJ5 A;  3DQE A;  4W7F A;  3DQ5 A;  1YJ2 A;  4IK9 A;  1RM9 A;  1GFL A;  2OJK A;  3SRY A;  5BTT B;  3PJ7 A;  4W6U A;  4OJ0 A;  4W6L A;  3IR8 A;  1EMF A;  2OTB A;  4DXP A;  2A52 B;  4W7A A;  2AWJ A;  4ZBL A;  3CD9 A;  3SVS A;  3P28 A;  5HBD A;  2Q6P A; 
#chains in the Genus database with same CATH homology
 2Z1O A;  3DQM A;  1MYW A;  3EKJ A;  4Q9W A;  4W7D A;  4Z4M A;  1OXE A;  2QRF A;  4KAG A;  2QU1 A;  3SVB A;  3CFH A;  3E5V A;  3GJ2 A;  2VAD A;  4W7C A;  3EK7 A;  4W6R A;  4W69 A;  4AR7 A;  4UTS A;  3DQ9 A;  2G2S B;  1YFP A;  3ED8 A;  4N3D A;  3DQ3 A;  3NT9 A;  3UFZ A;  2VVH A;  2OKY A;  4XOV A;  4JC2 A;  5LTR A;  2P4M A;  2VVJ A;  4HVF A;  2Y0G A;  2WHT A;  5DRG A;  1GL4 A;  5DU0 A;  4P1Q A;  5FHV A;  4TZA A;  2IOV A;  3GJ1 A;  1BFP A;  2HCG A;  4H48 A;  2AWK A;  5FVF A;  1Q73 A;  5DQM A;  3DQ7 A;  4W6S A;  4EMQ A;  1EML A;  2GX0 A;  5BQL A;  3DQ2 A;  1XSS A;  3SVO A;  5EJU A;  1QYQ A;  2DUF A;  4RYW A;  4JFG A;  3DQ1 A;  3TMT A;  3AKO A;  4P76 A;  2DUG A;  4KGE A;  5EXC I;  4GOB A;  2OKW A;  3DQF A;  1YJF A;  2H8Q A;  4KF5 A;  5HZO A;  1EMC A;  4W6D A;  4U2V A;  4W7E A;  2WIQ A;  5EXB A;  4KEX A;  2OTE A;  3CBE A;  3DQN A;  4PPK A;  4EN1 A;  4DXI A;  3NED A;  3TMR A;  4HQ8 A;  3V3D A;  4LJC A;  4KF4 A;  3RWA A;  2DD7 A;  3EK8 A;  3U0K A;  3OGO A;  4W6H A;  3EVU A;  3OSR A;  1H4U A;  3SG2 A;  3CFA A;  1HCJ A;  3LF3 A;  3ST4 A;  4JEO A;  3LSA A;  5EHU A;  4OY4 A;  4W6B A;  3SVC A;  2O24 A;  3AI5 A;  4W6F A;  3UG0 A;  4KF5 C;  1EME A;  3VK1 A;  2G16 B;  4H3M A;  3BXC A;  3DPZ A;  1Q4B A;  2POX A;  4Q7R A;  4LQT A;  4W6J A;  4BDU A;  3SS0 A;  2V4E C;  3H1R A;  5H88 A;  2PXW A;  1Q4C A;  4L1I A;  4W72 A;  1Z1Q A;  4PPL A;  4W6C A;  3EVR A;  1ZGO A;  3ZUJ A;  5HW9 A;  2IE2 A;  5DPJ A;  2ZMW A;  3IP2 A;  2HPW A;  4Q9X A;  5FVI A;  3GL4 A;  1QYO A;  4W75 A;  5DPG A;  1ZGP A;  4IK4 A;  4R6D A;  2C9I A;  3A8S A;  4W6A A;  5J2O A;  4TZG A;  4DXN A;  3W1D A;  3DQU A;  1W7S A;  3K1K A;  5EXU A;  3I19 A;  1W7T A;  1QXT A;  5LTP A;  3NEZ A;  2WHU A;  1EMA A;  3SVE A;  3M22 A;  1JC0 A;  2H6V A;  3VHT A;  3RWT A;  4H3N A;  1EMM A;  1QYF A;  2G3O A;  2H9W A;  3VIC A;  4XGY A;  1YZW A;  5DTZ A;  4ZIN A;  2FL1 A;  2G6E A;  3G9A A;  5DTY A;  3SG5 A;  2A48 A;  2RH7 A;  2Z6Z A;  4GF6 B;  2EMO A;  3E5W A;  1HUY A;  3U8P A;  4W7X A;  2QT2 A;  2DUH A;  4L13 A;  1OXD A;  4W6P A;  3WCK A;  2AWM A;  3SV5 A;  2ZO6 A;  3LS3 A;  4Z4K A;  4W74 A;  5LK4 A;  1C4F A;  5DRF A;  2G6X A;  4LJB A;  3W1C A;  1XAE A;  3DQ8 A;  5HZU A;  4DXQ A;  2DDC A;  2H5Q A;  3U8A A;  4ZF4 A;  4IK1 A;  4JF9 A;  3ADF A;  4W77 A;  2ZMU A;  3H1O A;  2JAD A;  3GB3 A;  1JC1 A;  1RMP A;  4DXM A;  1Q4D A;  2DDD A;  4EDS A;  4KPI A;  1B9C A;  5DTX A;  3DQO A;  5T3I A;  5DTL A;  2V4E A;  2IB5 A;  4PFE A;  1F0B A;  2VZX A;  5KTG A;  2QLG A;  1RMO A;  1MOV A;  3SSH A;  4EUL A;  2HGY A;  2PXS A;  3VHT B;  3ZUL A;  2WSN A;  4KGF A;  4W6K A;  1JBZ A;  1KYS A;  3DQ6 A;  5DPH A;  4ZB1 A;  4XOW A;  3SG4 A;  4IZN A;  3DQJ A;  1G7K A;  2ARL A;  3BX9 A;  5HGE A;  5AQB B;  4AS8 A;  3SG3 A;  4PPJ A;  4LJD A;  1ZGQ A;  2DD9 A;  5HZT A;  4KA9 A;  1H6R A;  4Q7U A;  3EKH A;  1KYR A;  2YDZ A;  3ST3 A;  3M24 A;  4HQC A;  3SVR A;  1ZUX A;  2B3Q A;  2HQK A;  4ZF3 A;  3O78 A;  4HQ9 A;  2FWQ A;  3SSL A;  3DQH A;  3DPW A;  3DQC A;  3PIB A;  3SSK A;  3AI4 A;  1Q4A A;  5DQB A;  4ZIO A;  3U0L A;  2WIS A;  2FZU A;  2A56 B;  1W7U A;  2HJO A;  4DKM A;  4J88 A;  4KW9 A;  4OQW A;  2G3D B;  2QLE A;  3BXB A;  5DY6 A;  4ORN A;  2VVI A;  4RTC A;  1YHG A;  3ZTF A;  2V4E B;  1CV7 A;  4LJD C;  1Q4E A;  3KCT A;  2QLG B;  2Z6Y A;  3MGF A;  3NF0 A;  4J8A A;  2O29 A;  5F9G A;  3EK4 A;  2HRS A;  4JGE A;  3CB9 A;  2H5O A;  4W6T A;  3DQK A;  4OHS A;  3BXA A;  4B30 A;  3LA1 A;  3SSY A;  1YHH A;  1KP5 A;  2DUE A;  4RYS A;  2AWL A;  5H89 A;  2GX2 A;  2A46 A;  2YE1 A;  4LW5 A;  3OSQ A;  4W6I A;  3EVP A;  2Z6X A;  1EMB A;  2H5P A;  3ST2 A;  2QLI A;  3E5T A;  3SVN A;  1QY3 A;  3O77 A;  2AHA A;  4IK3 A;  4IK5 A;  2GW3 A;  4R6B A;  2A54 B;  3SVD A;  5EB6 A;  5FVG A;  1EMG A;  2HQZ A;  4HE4 A;  4W6G A;  4J89 A;  3CD1 A;  3DQA A;  3S05 A;  2ICR A;  1MOU A;  4Q7T A;  4DXO A;  2G5Z B;  4W76 A;  3U0M A;  4EDO A;  2Q57 A;  2A50 B;  4GES B;  2YE0 A;  2G6Y A;  4W73 A;  3SSV A;  3EVV A;  2YFP A;  1S6Z A;  4JRB A;  3WLD A;  1UIS A;  3SG7 A;  4W6N A;  5BTT A;  2ZO7 A;  5H87 A;  4NWS A;  1KYP A;  4DKN A;  3PJB A;  1GGX A;  3SVU A;  4KW8 A;  4B30 B;  2HFC A;  5EB7 A;  2IB6 A;  1JBY A;  1Z1P A;  3DQ4 A;  3GEX A;  3LVC A;  3SSP A;  3ZUF A;  2BTJ A;  2WUR A;  4IK8 A;  3DQD A;  4W7R A;  3P8U A;  4KW4 A;  3KCS A;  2A47 A;  2C9J A;  4ANJ A;  2OGR A;  2QZ0 A;  2EMN A;  2WSO A;  2B3P A;  4W6O A;  3NT3 A;  3U8C A;  3DPX A;  2GW4 B;  1XMZ A;  4ZF5 A;  1XQM A;  4H3L A;  2AH8 A;  4H47 A;  5EBJ A;  3DQI A;  2WHS A;  3DQL A;  3CFF A;  3LVD A;  3ST0 A;  1F09 A;  3SST A;  2HGD A;  1RRX A;  1OXF A;  4ZFS A;  3LF4 B;  2VAE A;  2A53 B;  4LQU A;  4B5Y A;  2H5R A;  1RMM A;  4XL5 A;  2O2B A;  1XA9 A;  1EMK A;  4I2Y A;  5DPI A;  5HZS A;  4OGS A;  2QLH A;  3WLC A;  2EMD A;  4L12 A;  3SG6 A;  5BT0 A;  4W6M A;  3U0N A;  3CGL A;  4XVP A;  5LTQ A;  3LVA A;  1YHI A;  2DUI A;  3PJ5 A;  3DQE A;  4W7F A;  3DQ5 A;  1YJ2 A;  4IK9 A;  1RM9 A;  1GFL A;  2OJK A;  3SRY A;  5BTT B;  3PJ7 A;  4W6U A;  4OJ0 A;  4W6L A;  3IR8 A;  1EMF A;  2OTB A;  4DXP A;  2A52 B;  4W7A A;  2AWJ A;  4ZBL A;  3CD9 A;  3SVS A;  3P28 A;  5HBD A;  2Q6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...