5FVLA

Crystal structure of vps4-vps20 complex from s.cerevisiae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvlA00
4IT4A 2JQ9A 4CN4A 4WZXA 2CPTA 1WCRA 4U33A 5LB7B 2V6YA 2WWVA 5CJ5A 2V6YB 2JQKA 5FVKA 4CN6A 4U31A 3ZSSA 4NIQA 2K3WA 4U7IA 3ZT6A 4U2ZA 4U3CA 1YXRA 2W2UA 2MPKA 5CGMA 2CRBA 2WY2A 2V6XA 3ZT7A 3EABA 3ZT5A 3K1SA 4ZEYA 1WR0A 2RPAA 4U2YA 3ZSTA 2JQHA 2LRLA 2DL1A 1WFDA 4CN1A 2A9UA 4P1NA 4U7YA 4A5XA 2LRKA 5FVLA 2XZEA
chains in the Genus database with same CATH superfamily
2KT9A 4COFA 4Q25A 3UU8A 3AE2A 2IIUA 2LT3A 4HFEA 4IE5A 3OTOT 3VRBA 4YHJA 2JIWA 3OVUA 3UUXB 2BBHA 2KNDA 2V5CA 4B3ST 4JI2T 4IDOA 3VR8A 3CWZB 2CCQA 3PV0F 2IW5B 2KSRA 1ZKEA 1YQ3A 2LSKA 2CRBA 2W62A 5ABFA 4O4LE 2UXCT 2WMOA 2LHRA 2CXDA 3SFDA 3AAAB 1XDOA 3GMIA 2BG9C 3V5UA 5A1LA 1LVKA 3B13A 2VKJA 4G2AA 4QHOA 2E9XD 5F3JA 2GK9A 4C90A 3CPZA 3RX6A 1Y01A 4DV5T 1KFYA 4EYYR 3ZSTA 2LRLA 2JMHA 5KX5E 3UUBA 3ANWA 4U33A 4WYVA 3RLFF 3KFWX 2KWIB 4NXNT 3FBLA 5IYZE 2HN2A 4N78D 3I0OA 3UU5A 2XJ7A 4AQFA 5CB4E 1YKEB 4BJNA 5ADXL 4DV3T 2KWHA 1IJ6A 2Y48B 4WNKA 4DV4T 5LGNB 1BR1A 4UXNB 4YSXA 1UURA 4U72A 4UIGA 2M6IA 5FY7A 2I0MA 4DMWA 3CX6B 1CHUA 4TX5A 5LMNT 1T8BA 3X1DA 2G0UA 4YXDA 5EK3A 1JNZA 3Q5EA 3C4WA 4OYJA 3LDQB 2WM9A 2LRKA 5AQUB 3IF8B 5M4YA 2Q9QC 4GYSA 3PJAA 4XZCA 4HGAA 3AEGA 3PUGA 3E0ZA 5L2LA 1XNRT 3O9XA 2EHOD 1Z0PA 4PAGA 4AKRB 3K1SA 2H88A 4MHCA 2I6HA 1SE7A 3AE8A 4AKIA 5L3CB 4JI0T 2LSJA 2DWGA 3J9X1 4EV6A 4U2ZA 3RHWA 2VVNA 3OYZA 1J5WA 1WYBA 4F6RC 5HCMA 4Z91A 4EGWA 4QH4A 5FXZA 2LOSA 4LF9T 4UEMA 5HWXA 3AE5A 4U31A 2AE9A 2CBJA 1HNZT 5CA0E 5LBQB 4HWFA 4Z8XA 2KZ7B 1HX8A 3FXDB 4YSZA 2UU9T 4P0BA 3SOLA 3K3OA 4JI1T 1GQEA 3SFEA 3ZC1A 4ZI2D 4EXTA 4DIDB 2OA5A 4WZXA 4TWFA 3ZC0A 4HTEA 3ONJA 4CQIA 3FZHB 2VB6A 3MZKB 4DNDA 2QGSA 2CHNA 4UELA 1FIOA 4HFCA 2A2FX 3VKGA 5J0ZA 1H7CA 3Q5WA 1WRDA 3N5LA 1W0BA 2XAFB 4DV2T 4GOUA 5CA1E 2X0YA 3PUZF 4GK5E 1VOMA 4X1YE 2M6BA 5GONE 2C5IT 3RPUA 2R6GF 4PW8A 3AEDA 1WR6A 5LB7B 2CXLA 2BG9B 2WDVA 4BA9A 1NEKA 3OJAA 4EOZB 1V9DA 4U7IA 2OV9A 2B1EA 3V5SA 2DI4A 2J47A 3N9QA 4AKLA 3Q9DA 2W63A 5LXTE 4IT4A 1VRBA 2D0UA 5HXRA 4H9QC 4NUUA 1UX4A 3C98B 5JDLA 1M7KA 1D1BA 3NRXA 5LCYA 2XQ3A 1JNRA 2BS2A 4TV9E 3RYHE 4AQFC 4NUVA 3AA1B 2JJ9A 2XAGB 4PJNA 3NZQA 2WQYA 4JI5T 3L3PA 3HA4A 4JV5T 2WDQA 5AQHB 3Q5XA 4KUMB 1HR0T 2BS4A 5KXJA 4UF0B 3CQGB 2LJLA 3ZSSA 3AAIA 5JRCA 4ZS3A 3IA3A 4JEHB 4PFPA 4IHJE 3TLVA 2YU1A 2K48A 1IBLT 3N9LA 4V1Av 2Q9QB 3ZYLA 2V7MA 4H9NC 3MKDA 5JDQA 3N2GE 2VKOA 1UUSA 3I0QA 5C8YE 2VQFT 1OEDE 1W0AA 3EI0A 3ZCJA 1HG5A 4H9SE 5JTGA 3GWHA 4JI6T 4ILCA 4CZZB 1XWMA 4IE0A 4A5XA 3EDUA 4X1KE 3AXJA 2E5LT 2M67A 4DR1T 5CFBA 5FYMA 2QVAA 4DR4T 1WR0A 3P8CD 3CKDA 5E0OA 3PUYF 4EAHA 3N9NA 5JH7E 1W09A 1IBKT 3K3QC 1LRZA 2YOEA 5L4EA 1U4QA 1U5PA 2FBWA 3TLWA 1R8IA 2V7KA 2DNXA 3IBPA 3JC6C 4C91A 2VURA 3IHRA 2C5KT 1VCTA 3DJBA 3CVRA 2FJAA 2MTQA 3N9MA 4YLHA 2F4VT 3JAFA 1KNZA 3RI5A 3AEEA 4H9OC 1KK7A 2YK0A 2MBGA 2XSBA 1YD8G 2X0HA 3M3ZB 4O2AE 1MNDA 3RYFE 3K8PC 3S4UA 1HG2A 4IREA 4IL4A 4LFAT 4IDPA 2JMKA 3RIFA 2MAWA 4X66T 3AVSA 4HFBA 1IJ5A 5TAOA 5FMNA 3LK42 2BKNA 3ZYKA 2BS3A 2V6YA 4A56A 3Q5DA 1KNPA 3AA7B 4CXWA 3C51A 2VQET 2XSAA 4GK0E 2V7JA 3ZKRA 4MBQA 3W15B 3ZLIA 2LEHA 2ODVA 2XHEB 1FMVA 3LJCA 1VCSA 3MXZA 3NBXX 3N9OA 3JAEA 1D0XA 2VL0A 3SRZA 2AXDS 5AQKB 1BR2A 2D9DA 4TWHA 2P9BA 4X5TA 2MYSA 4DBQA 4Z90A 2Q9QD 1DU2A 3PJAJ 5BMVE 3ZPOA 3EVYA 4WW0A 2ACZA 5FVKA 1EZ3A 2E2AA 4E7ZA 3A7MA 2MOZA 2JPFA 2UXNB 3FZKB 3AE7A 3N2OA 3A8YC 2K24A 1D1CA 2IC9A 2ACXA 4YSYA 2UUBT 3I9YA 3T1HT 2XQ8A 2IHR1 5HEUA 4ERRA 4GIWA 1MIVA 4M1PA 3EABA 3DP7A 3UU6A 4IDQA 4IGUA 3AE9A 3QUJA 4DR3T 2WWUA 4TWDA 4LFCT 1T72A 3BQLA 3RYIE 2Z6EA 4YJ2E 2J62A 5DQWA 3HKEE 2YINA 3U78A 3NWIA 1UX5A 2NOXA 4I4TE 4HE8A 3HKCE 3H3AA 4B6XA 2VVSA 5L3EB 1NAFA 1WLXA 3AA0B 4I50E 4H63V 4HN9A 4AKGA 1XZYA 3ZT6A 3UUMA 2FUPA 4ILBA 5JREA 5LGUB 3ZJ2A 3P4WA 3E08A 3RGLA 3P4QA 5LG3A 1I6ZA 4JUYA 2CHOA 3BQIA 3ZMVB 1YQ4A 5L47A 4TN7B 4YHHT 1J5ET 2WY2A 1LVFA 2BDEA 3RC3A 3K3NA 5HEOA 2XAHB 5LHGB 4AISA 5CJ5A 3N2KE 2CBIA 3ZN1B 3GN5A 2NP9A 2V1DB 4ZI7E 5J2TE 3C4ZA 4HWIB 2UXBT 2NTYA 2WU5A 5DABA 4JI8T 2QRXA 5AQMB 2CM0A 3H3MA 4QKNA 3ETUA 5AQNB 2JQKA 5C2TA 4QXCB 4LF6T 4ANJA 5DQVA 2C0SA 3C64A 5HEHA 5AQJB 5KDMC 5LJNA 2LSYA 4JBWF 2ZM6T 4PJMA 1YKHB 4X64T 1NWMX 3UUNA 4HFIA 3LK2B 3PU8A 4FJOA 4ADZA 4QX7B 4DBRA 1HFAA 3RIUC 2WZIA 4P1NA 1T98A 2BKOA 2BKPA 5AQRB 5JDHA 2WWVA 3O4XE 4QH1A 3QOFA 4QXHB 2XUEA 3EAMA 4JYAT 5LHHB 2X67A 4AXPA 3A5XA 4CI2B 3ABVA 5DJQC 4HWCA 1KF6A 5L4HA 2HPLA 4F8HA 4UR9A 3CX8B 2LLYA 5HXHA 1IZNB 3FB2A 5H6QB 2VKHA 4DR2T 3AE1A 2SPCA 5FXWA 4A97A 4ZOLE 2OLTA 5FP3A 2CWYA 3IEEA 5FKYA 3FZLB 5JR9A 1FEWA 4ZZBA 5AQSB 3UT5E 1E1HB 3HI2A 5FXVA 2V7IA 3PUSA 2WMNA 4DR6T 2A72A 3QK6A 4GKKT 3JC6D 1MMNA 3JCFA 1HS7A 4AQGA 1AJ3A 3PDYA 4JEUB 4TUYE 4EYUA 4KMCA 2VL8A 4ILUA 3L39A 2WS3A 4EIWA 2KMFA 3AEBA 4ZHQE 2K3WA 2PBIA 5ABEA 1WYCA 2X9YA 5LMUT 3AECA 1FJGT 3AEAA 4NPPA 4PFOA 3ONXA 1S94A 1KEYA 2YKSA 2HH7A 2N9DA 3ETVA 2UXXB 4B3TT 3KV6A 3AA6B 4PK5A 4QXBB 3O1HA 4KP3C 2FJDA 4TV8E 2KLQA 4X65T 5L3DB 3ZMUB 3H37A 4UVBB 2W0GA 2UXDT 2BVLA 2PG8A 3NVOA 3ZEFB 4QH5A 1D0ZA 3SS1A 2IDOB 3UFEA 4ASKA 3MACA 2KINB 2CLYC 2UUAT 2XQ7A 4NXMT 2BG9E 3AVRA 1D1AA 4O4HE 4MLKA 3PUWF 5BR8T 2QA7A 3UU3A 2I59A 4IDNA 5EZYE 4LF8T 2XZEA 2XPKA 2NWBA 5HCJA 3P4PA 4PJLA 4CI3B 5KMGP 2Y8DA 2XQAA 2A3DA 4DO0A 3I9WA 2RPAA 3GA8A 3VU7H 2WSSV 2W4XA 1FMWA 1UGOA 2X9XA 4CN6A 2XM2A 1HNXT 1N34T 3OBVE 4K0UA 3T8OA 4DUYT 1XDPA 3AE3A 1OEDA 2W66A 4MALA 2CE7A 4KHZF 4UV8B 4OK0A 4CI1B 3I1AA 1ZEEA 3LBXA 2CWOA 3ZMSB 4KBMB 4KX6A 4QWNB 4DR7T 4ZZCA 2FJBA 3LK3B 1BR4A 4TZ4C 1Y64B 3F31A 3LSVA 3UTKA 3TLSA 5JR9C 3Q2MA 3P7IA 3KINB 2WBLA 2NW7A 4O4IE 1IBMT 4LF4T 4K0KT 4HFVA 5ABFB 3BK9A 4U2YA 2V5DA 1HNWT 3PU3A 3PUQA 1WFDA 2BVMA 3R84B 3VRAA 3PUVF 3KDSE 4NIQA 5AQVB 2NW8A 2LHNA 5AQGB 2CEAA 4IE4A 3ANWB 1Z8UA 4ZS2A 2XM1A 4LF5T 3F57A 3ZYMA 2W67A 2W61A 2ZM0A 3J7Yq 5JQGE 3PURA 4PNIA 4GYRA 1T7SA 5FNVE 4IIJE 1NENA 1E2AA 3GN5B 3EHZA 5AQLB 4QX8B 4YTPA 5JDGA 2BZBA 3KV4A 3NRYA 4JI3T 3QNUA 3UULA 3KVAA 5JDFA 2WB5A 1HTJF 2IC6A 2X9HA 3HKDE 3EDVA 3PE0A 1D0YA 2RA1A 2H7OA 2K9AA 3LFMA 4ZEYA 3QB5K 2WAUA 3CIRA 1MMDA 4B3MT 3L09A 5FVLA 3AEFA 3AAEB 2H7VC 3PTRB 2V7LA 4DV1T 4DR5T 5FY1A 2E9XA 2L9QA 4I55E 2X0LB 2LSGA 3KV5A 1IAPA 5L3FB 5LBMA 2X9WA 3M65A 3RQWA 2JQ9A 4AIUA 3UFGA 4ILAA 3KVBA 4EEBA 3VHLA 4KI0F 2W2UA 3PUXF 3ZT7A 4J2CA 3CX7B 4HWDA 2WDRA 5AQTB 1L0VA 4YTMA 1UK5A 1G73A 2NW9A 1OEDC 1US7B 3L8RA 3HR0A 4P09A 5LNKA 3MA9A 3FHNA 2QYWA 2YU2A 4DMVA 3CMLA 3KV9A 2PFVA 4LMJA 2X66A 4GKJT 5JR9B 4O8SA 4OHFA 2KXPB 2CMRA 2EHOA 5H6RB 2J1DG 2H89A 4DVDA 1MNEA 4LMKA 4H9RC 3ZJ1A 1ZOYA 1MMAA 3C4XA 3AE4A 2IAKA 4EB6E 3DTOA 2VWAA 3TLTA 1HX1B 4O4JE 4AI6A 3ONLC 1BR0A 1QLBA 5LYJE 2XAJB 4XBFB 5AFUL 4ZI3C 3PUAA 2Y6XA 5AQPB 5LOVE 2LE8A 3BQKA 3FXEB 3RRCA 5FL0A 3CQCB 4HWHA 4EEDA 2N1GA 3P4SA 1HCIA 1ZV4X 1MMGA 5FL1A 5FXXA 2LKHA 2LM2A 4X62T 4XAXB 3HKBE 2W00A 3NZPA 4OYKA 3UQ7A 2XQ9A 5LG4A 1OXZA 2PJQA 5JRCB 3C50A 5EK2A 5LGTB 5EK4A 5CGMA 1QSDA 3O1IA 3QC9A 1O3XA 3QB5A 2XASB 2DHRA 4U74A 3SWHA 5L3GB 2XY8B 3KBTA 3ZN0B 5J2UE 2ZLYA 2LKGA 1E7PA 2ES0A 2V26A 1UCUA 4O2BE 4JLEA 4CN1A 4U7YA 2YDRA 4JI4T 3F2EA 2BBJA 5AQFB 4LF7T 4IL9A 3AXJB 1N32T 3CQXC 4IE7A 4H9PC 2CA5A 3R6NA 2XQ6A 2E9XC 2DWKA 3AB3B 4I0UA 4E7SA 3E22E 4ZXLA 5L3BB 3B57A 4MFRA 4UVCB 4P0AA 1KNRA 3WI3A 2WU2A 5HXSA 2YDSA 3RH3A 3FBZA 3VKHA 2XAQB 4G63A 2N2NA 1OEDB 5C3JA 1MIWA 4L5GA 1B7TA 2ODUA 5LHIB 2L8KA 2VKDA 4B3RT 2DCFA 2ZM8A 3LBXB 3OYXA 1SUMB 3O1JA 2ZM2A 2YDQA 2HPJA 4LMLA 5FY0A 1SA0E 2J4GA 1X9BA 2H3RA 3P50A 3ESLA 2XQYA 3RKGA 5HAXA 5ABHA 3OKQA 4IE6A 4FI5A 5LJMA 1N33T 4DUZT 4HFHA 1YXRA 2EHOC 2D5UA 4L0RA 2ZMAA 2VK9A 4TNVA 4YY3T 2XQ5A 5LA6E 1WCRA 3NKZA 2V6YB 3U3IA 4PK4A 4H63H 5JDMA 4UV9B 4HKAA 4EZ4A 4DV0T 1XNQT 5J1GA 3T1YT 4BJMA 2RP4A 1I94T 1XMQT 3RRWA 2L3LA 2DLRA 2JRKA 4L9IA 3TKLB 2IUBA 1CUNA 2X51A 1W9RA 2K5BB 3MJXA 2A9UA 3KBUA 3RF1A 3RYCE 4ZI2C 3P4RA 5IUXA 2IMLA 4HEAA 3ZCIA 1YW0A 5HEJA 4DV7T 3LG7A 5HEGA 4WBNE 2V6XA 3WAJA 2V8SV 4X20E 2XQ4A 4HFDA 4WBOA 3FZMB 4YT0A 2BG9A 4CN4A 2UUCT 1X79A 4YJ3E 4CXXA 3UQ4A 4YTNA 1ZHCA 3TLUA 2D2SA 1OWAA 2HHHT 2E8IA 3D0TA 3CK6A 4I43B 3RKOA 4EZHA 2YN6A 5JVDE 3FZFB 3UU4A 1J1JA 4A98A 2NTXA 2YEVC 5HXEA 2E9XB 3ZMTB 5ABGA 3N9PA 5AQQB 1LKXA 2CXFA 2DL1A 2HN1A 4AQYT 2WCAA 2XTLA 2E5VA 4UF0A 5F5WA 2B76A 5HXCA 5HWYA 4DV6T 4IDZA 3RQUA 1XMOT 2X68A 4CXYA 4AKHA 3MK7C 3RC8A 2LOPA 4ISSA 2Q9QA 1M62A 4YFSA 4UVAB 3OPCA 2WP9A 2NR4A 5IHYA 5IWAT 3G06A 2D0TA 3WAKA 1N36T 4LFBT 5ETWA 4U3CA 2MPKA 3HL6A 1QUUA 3ZT5A 2VASA 2JQQA 3EUHA 4KHPT 1HF8A 1ZP0A 1MIYA 4PK6A 5AQIB 4BAYB 2EHOB 4OFZA 5HYAA 3RIUA 4OX9T 4TNWA 3VR9A 2LM9A 2JQHA 3RIAA 2WZHA 5JDNA 4ZI3D 1SHZC 2PTFA 4X1IE 4PJJA 2CLYB 2CPTA 2FJEA 2C5JA 1S35A 3AE6A 5F8PA 2LSIA 4JI7T 3B5MA 3JADA 5AQOB 4ISTA 3ZMZB 5LP6E 1G8XA
chains in the Genus database with same CATH topology
4IT4A 2JQ9A 4CN4A 4WZXA 2CPTA 1WCRA 4U33A 5LB7B 2V6YA 2WWVA 5CJ5A 2V6YB 2JQKA 5FVKA 4CN6A 4U31A 3ZSSA 4NIQA 2K3WA 4U7IA 3ZT6A 4U2ZA 4U3CA 1YXRA 2W2UA 2MPKA 5CGMA 2CRBA 2WY2A 2V6XA 3ZT7A 3EABA 3ZT5A 3K1SA 4ZEYA 1WR0A 2RPAA 4U2YA 3ZSTA 2JQHA 2LRLA 2DL1A 1WFDA 4CN1A 2A9UA 4P1NA 4U7YA 4A5XA 2LRKA 5FVLA 2XZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  2JQ9 A;  4CN4 A;  4WZX A;  2CPT A;  1WCR A;  4U33 A;  5LB7 B;  2V6Y A;  2WWV A;  5CJ5 A;  2V6Y B;  2JQK A;  5FVK A;  4CN6 A;  4U31 A;  3ZSS A;  4NIQ A;  2K3W A;  4U7I A;  3ZT6 A;  4U2Z A;  4U3C A;  1YXR A;  2W2U A;  2MPK A;  5CGM A;  2CRB A;  2WY2 A;  2V6X A;  3ZT7 A;  3EAB A;  3ZT5 A;  3K1S A;  4ZEY A;  1WR0 A;  2RPA A;  4U2Y A;  3ZST A;  2JQH A;  2LRL A;  2DL1 A;  1WFD A;  4CN1 A;  2A9U A;  4P1N A;  4U7Y A;  4A5X A;  2LRK A;  5FVL A;  2XZE A; 
#chains in the Genus database with same CATH topology
 2KT9 A;  4COF A;  4Q25 A;  3UU8 A;  3AE2 A;  2IIU A;  2LT3 A;  4HFE A;  4IE5 A;  3OTO T;  3VRB A;  4YHJ A;  2JIW A;  3OVU A;  3UUX B;  2BBH A;  2KND A;  2V5C A;  4B3S T;  4JI2 T;  4IDO A;  3VR8 A;  3CWZ B;  2CCQ A;  3PV0 F;  2IW5 B;  2KSR A;  1ZKE A;  1YQ3 A;  2LSK A;  2CRB A;  2W62 A;  5ABF A;  4O4L E;  2UXC T;  2WMO A;  2LHR A;  2CXD A;  3SFD A;  3AAA B;  1XDO A;  3GMI A;  2BG9 C;  3V5U A;  5A1L A;  1LVK A;  3B13 A;  2VKJ A;  4G2A A;  4QHO A;  2E9X D;  5F3J A;  2GK9 A;  4C90 A;  3CPZ A;  3RX6 A;  1Y01 A;  4DV5 T;  1KFY A;  4EYY R;  3ZST A;  2LRL A;  2JMH A;  5KX5 E;  3UUB A;  3ANW A;  4U33 A;  4WYV A;  3RLF F;  3KFW X;  2KWI B;  4NXN T;  3FBL A;  5IYZ E;  2HN2 A;  4N78 D;  3I0O A;  3UU5 A;  2XJ7 A;  4AQF A;  5CB4 E;  1YKE B;  4BJN A;  5ADX L;  4DV3 T;  2KWH A;  1IJ6 A;  2Y48 B;  4WNK A;  4DV4 T;  5LGN B;  1BR1 A;  4UXN B;  4YSX A;  1UUR A;  4U72 A;  4UIG A;  2M6I A;  5FY7 A;  2I0M A;  4DMW A;  3CX6 B;  1CHU A;  4TX5 A;  5LMN T;  1T8B A;  3X1D A;  2G0U A;  4YXD A;  5EK3 A;  1JNZ A;  3Q5E A;  3C4W A;  4OYJ A;  3LDQ B;  2WM9 A;  2LRK A;  5AQU B;  3IF8 B;  5M4Y A;  2Q9Q C;  4GYS A;  3PJA A;  4XZC A;  4HGA A;  3AEG A;  3PUG A;  3E0Z A;  5L2L A;  1XNR T;  3O9X A;  2EHO D;  1Z0P A;  4PAG A;  4AKR B;  3K1S A;  2H88 A;  4MHC A;  2I6H A;  1SE7 A;  3AE8 A;  4AKI A;  5L3C B;  4JI0 T;  2LSJ A;  2DWG A;  3J9X 1;  4EV6 A;  4U2Z A;  3RHW A;  2VVN A;  3OYZ A;  1J5W A;  1WYB A;  4F6R C;  5HCM A;  4Z91 A;  4EGW A;  4QH4 A;  5FXZ A;  2LOS A;  4LF9 T;  4UEM A;  5HWX A;  3AE5 A;  4U31 A;  2AE9 A;  2CBJ A;  1HNZ T;  5CA0 E;  5LBQ B;  4HWF A;  4Z8X A;  2KZ7 B;  1HX8 A;  3FXD B;  4YSZ A;  2UU9 T;  4P0B A;  3SOL A;  3K3O A;  4JI1 T;  1GQE A;  3SFE A;  3ZC1 A;  4ZI2 D;  4EXT A;  4DID B;  2OA5 A;  4WZX A;  4TWF A;  3ZC0 A;  4HTE A;  3ONJ A;  4CQI A;  3FZH B;  2VB6 A;  3MZK B;  4DND A;  2QGS A;  2CHN A;  4UEL A;  1FIO A;  4HFC A;  2A2F X;  3VKG A;  5J0Z A;  1H7C A;  3Q5W A;  1WRD A;  3N5L A;  1W0B A;  2XAF B;  4DV2 T;  4GOU A;  5CA1 E;  2X0Y A;  3PUZ F;  4GK5 E;  1VOM A;  4X1Y E;  2M6B A;  5GON E;  2C5I T;  3RPU A;  2R6G F;  4PW8 A;  3AED A;  1WR6 A;  5LB7 B;  2CXL A;  2BG9 B;  2WDV A;  4BA9 A;  1NEK A;  3OJA A;  4EOZ B;  1V9D A;  4U7I A;  2OV9 A;  2B1E A;  3V5S A;  2DI4 A;  2J47 A;  3N9Q A;  4AKL A;  3Q9D A;  2W63 A;  5LXT E;  4IT4 A;  1VRB A;  2D0U A;  5HXR A;  4H9Q C;  4NUU A;  1UX4 A;  3C98 B;  5JDL A;  1M7K A;  1D1B A;  3NRX A;  5LCY A;  2XQ3 A;  1JNR A;  2BS2 A;  4TV9 E;  3RYH E;  4AQF C;  4NUV A;  3AA1 B;  2JJ9 A;  2XAG B;  4PJN A;  3NZQ A;  2WQY A;  4JI5 T;  3L3P A;  3HA4 A;  4JV5 T;  2WDQ A;  5AQH B;  3Q5X A;  4KUM B;  1HR0 T;  2BS4 A;  5KXJ A;  4UF0 B;  3CQG B;  2LJL A;  3ZSS A;  3AAI A;  5JRC A;  4ZS3 A;  3IA3 A;  4JEH B;  4PFP A;  4IHJ E;  3TLV A;  2YU1 A;  2K48 A;  1IBL T;  3N9L A;  4V1A v;  2Q9Q B;  3ZYL A;  2V7M A;  4H9N C;  3MKD A;  5JDQ A;  3N2G E;  2VKO A;  1UUS A;  3I0Q A;  5C8Y E;  2VQF T;  1OED E;  1W0A A;  3EI0 A;  3ZCJ A;  1HG5 A;  4H9S E;  5JTG A;  3GWH A;  4JI6 T;  4ILC A;  4CZZ B;  1XWM A;  4IE0 A;  4A5X A;  3EDU A;  4X1K E;  3AXJ A;  2E5L T;  2M67 A;  4DR1 T;  5CFB A;  5FYM A;  2QVA A;  4DR4 T;  1WR0 A;  3P8C D;  3CKD A;  5E0O A;  3PUY F;  4EAH A;  3N9N A;  5JH7 E;  1W09 A;  1IBK T;  3K3Q C;  1LRZ A;  2YOE A;  5L4E A;  1U4Q A;  1U5P A;  2FBW A;  3TLW A;  1R8I A;  2V7K A;  2DNX A;  3IBP A;  3JC6 C;  4C91 A;  2VUR A;  3IHR A;  2C5K T;  1VCT A;  3DJB A;  3CVR A;  2FJA A;  2MTQ A;  3N9M A;  4YLH A;  2F4V T;  3JAF A;  1KNZ A;  3RI5 A;  3AEE A;  4H9O C;  1KK7 A;  2YK0 A;  2MBG A;  2XSB A;  1YD8 G;  2X0H A;  3M3Z B;  4O2A E;  1MND A;  3RYF E;  3K8P C;  3S4U A;  1HG2 A;  4IRE A;  4IL4 A;  4LFA T;  4IDP A;  2JMK A;  3RIF A;  2MAW A;  4X66 T;  3AVS A;  4HFB A;  1IJ5 A;  5TAO A;  5FMN A;  3LK4 2;  2BKN A;  3ZYK A;  2BS3 A;  2V6Y A;  4A56 A;  3Q5D A;  1KNP A;  3AA7 B;  4CXW A;  3C51 A;  2VQE T;  2XSA A;  4GK0 E;  2V7J A;  3ZKR A;  4MBQ A;  3W15 B;  3ZLI A;  2LEH A;  2ODV A;  2XHE B;  1FMV A;  3LJC A;  1VCS A;  3MXZ A;  3NBX X;  3N9O A;  3JAE A;  1D0X A;  2VL0 A;  3SRZ A;  2AXD S;  5AQK B;  1BR2 A;  2D9D A;  4TWH A;  2P9B A;  4X5T A;  2MYS A;  4DBQ A;  4Z90 A;  2Q9Q D;  1DU2 A;  3PJA J;  5BMV E;  3ZPO A;  3EVY A;  4WW0 A;  2ACZ A;  5FVK A;  1EZ3 A;  2E2A A;  4E7Z A;  3A7M A;  2MOZ A;  2JPF A;  2UXN B;  3FZK B;  3AE7 A;  3N2O A;  3A8Y C;  2K24 A;  1D1C A;  2IC9 A;  2ACX A;  4YSY A;  2UUB T;  3I9Y A;  3T1H T;  2XQ8 A;  2IHR 1;  5HEU A;  4ERR A;  4GIW A;  1MIV A;  4M1P A;  3EAB A;  3DP7 A;  3UU6 A;  4IDQ A;  4IGU A;  3AE9 A;  3QUJ A;  4DR3 T;  2WWU A;  4TWD A;  4LFC T;  1T72 A;  3BQL A;  3RYI E;  2Z6E A;  4YJ2 E;  2J62 A;  5DQW A;  3HKE E;  2YIN A;  3U78 A;  3NWI A;  1UX5 A;  2NOX A;  4I4T E;  4HE8 A;  3HKC E;  3H3A A;  4B6X A;  2VVS A;  5L3E B;  1NAF A;  1WLX A;  3AA0 B;  4I50 E;  4H63 V;  4HN9 A;  4AKG A;  1XZY A;  3ZT6 A;  3UUM A;  2FUP A;  4ILB A;  5JRE A;  5LGU B;  3ZJ2 A;  3P4W A;  3E08 A;  3RGL A;  3P4Q A;  5LG3 A;  1I6Z A;  4JUY A;  2CHO A;  3BQI A;  3ZMV B;  1YQ4 A;  5L47 A;  4TN7 B;  4YHH T;  1J5E T;  2WY2 A;  1LVF A;  2BDE A;  3RC3 A;  3K3N A;  5HEO A;  2XAH B;  5LHG B;  4AIS A;  5CJ5 A;  3N2K E;  2CBI A;  3ZN1 B;  3GN5 A;  2NP9 A;  2V1D B;  4ZI7 E;  5J2T E;  3C4Z A;  4HWI B;  2UXB T;  2NTY A;  2WU5 A;  5DAB A;  4JI8 T;  2QRX A;  5AQM B;  2CM0 A;  3H3M A;  4QKN A;  3ETU A;  5AQN B;  2JQK A;  5C2T A;  4QXC B;  4LF6 T;  4ANJ A;  5DQV A;  2C0S A;  3C64 A;  5HEH A;  5AQJ B;  5KDM C;  5LJN A;  2LSY A;  4JBW F;  2ZM6 T;  4PJM A;  1YKH B;  4X64 T;  1NWM X;  3UUN A;  4HFI A;  3LK2 B;  3PU8 A;  4FJO A;  4ADZ A;  4QX7 B;  4DBR A;  1HFA A;  3RIU C;  2WZI A;  4P1N A;  1T98 A;  2BKO A;  2BKP A;  5AQR B;  5JDH A;  2WWV A;  3O4X E;  4QH1 A;  3QOF A;  4QXH B;  2XUE A;  3EAM A;  4JYA T;  5LHH B;  2X67 A;  4AXP A;  3A5X A;  4CI2 B;  3ABV A;  5DJQ C;  4HWC A;  1KF6 A;  5L4H A;  2HPL A;  4F8H A;  4UR9 A;  3CX8 B;  2LLY A;  5HXH A;  1IZN B;  3FB2 A;  5H6Q B;  2VKH A;  4DR2 T;  3AE1 A;  2SPC A;  5FXW A;  4A97 A;  4ZOL E;  2OLT A;  5FP3 A;  2CWY A;  3IEE A;  5FKY A;  3FZL B;  5JR9 A;  1FEW A;  4ZZB A;  5AQS B;  3UT5 E;  1E1H B;  3HI2 A;  5FXV A;  2V7I A;  3PUS A;  2WMN A;  4DR6 T;  2A72 A;  3QK6 A;  4GKK T;  3JC6 D;  1MMN A;  3JCF A;  1HS7 A;  4AQG A;  1AJ3 A;  3PDY A;  4JEU B;  4TUY E;  4EYU A;  4KMC A;  2VL8 A;  4ILU A;  3L39 A;  2WS3 A;  4EIW A;  2KMF A;  3AEB A;  4ZHQ E;  2K3W A;  2PBI A;  5ABE A;  1WYC A;  2X9Y A;  5LMU T;  3AEC A;  1FJG T;  3AEA A;  4NPP A;  4PFO A;  3ONX A;  1S94 A;  1KEY A;  2YKS A;  2HH7 A;  2N9D A;  3ETV A;  2UXX B;  4B3T T;  3KV6 A;  3AA6 B;  4PK5 A;  4QXB B;  3O1H A;  4KP3 C;  2FJD A;  4TV8 E;  2KLQ A;  4X65 T;  5L3D B;  3ZMU B;  3H37 A;  4UVB B;  2W0G A;  2UXD T;  2BVL A;  2PG8 A;  3NVO A;  3ZEF B;  4QH5 A;  1D0Z A;  3SS1 A;  2IDO B;  3UFE A;  4ASK A;  3MAC A;  2KIN B;  2CLY C;  2UUA T;  2XQ7 A;  4NXM T;  2BG9 E;  3AVR A;  1D1A A;  4O4H E;  4MLK A;  3PUW F;  5BR8 T;  2QA7 A;  3UU3 A;  2I59 A;  4IDN A;  5EZY E;  4LF8 T;  2XZE A;  2XPK A;  2NWB A;  5HCJ A;  3P4P A;  4PJL A;  4CI3 B;  5KMG P;  2Y8D A;  2XQA A;  2A3D A;  4DO0 A;  3I9W A;  2RPA A;  3GA8 A;  3VU7 H;  2WSS V;  2W4X A;  1FMW A;  1UGO A;  2X9X A;  4CN6 A;  2XM2 A;  1HNX T;  1N34 T;  3OBV E;  4K0U A;  3T8O A;  4DUY T;  1XDP A;  3AE3 A;  1OED A;  2W66 A;  4MAL A;  2CE7 A;  4KHZ F;  4UV8 B;  4OK0 A;  4CI1 B;  3I1A A;  1ZEE A;  3LBX A;  2CWO A;  3ZMS B;  4KBM B;  4KX6 A;  4QWN B;  4DR7 T;  4ZZC A;  2FJB A;  3LK3 B;  1BR4 A;  4TZ4 C;  1Y64 B;  3F31 A;  3LSV A;  3UTK A;  3TLS A;  5JR9 C;  3Q2M A;  3P7I A;  3KIN B;  2WBL A;  2NW7 A;  4O4I E;  1IBM T;  4LF4 T;  4K0K T;  4HFV A;  5ABF B;  3BK9 A;  4U2Y A;  2V5D A;  1HNW T;  3PU3 A;  3PUQ A;  1WFD A;  2BVM A;  3R84 B;  3VRA A;  3PUV F;  3KDS E;  4NIQ A;  5AQV B;  2NW8 A;  2LHN A;  5AQG B;  2CEA A;  4IE4 A;  3ANW B;  1Z8U A;  4ZS2 A;  2XM1 A;  4LF5 T;  3F57 A;  3ZYM A;  2W67 A;  2W61 A;  2ZM0 A;  3J7Y q;  5JQG E;  3PUR A;  4PNI A;  4GYR A;  1T7S A;  5FNV E;  4IIJ E;  1NEN A;  1E2A A;  3GN5 B;  3EHZ A;  5AQL B;  4QX8 B;  4YTP A;  5JDG A;  2BZB A;  3KV4 A;  3NRY A;  4JI3 T;  3QNU A;  3UUL A;  3KVA A;  5JDF A;  2WB5 A;  1HTJ F;  2IC6 A;  2X9H A;  3HKD E;  3EDV A;  3PE0 A;  1D0Y A;  2RA1 A;  2H7O A;  2K9A A;  3LFM A;  4ZEY A;  3QB5 K;  2WAU A;  3CIR A;  1MMD A;  4B3M T;  3L09 A;  5FVL A;  3AEF A;  3AAE B;  2H7V C;  3PTR B;  2V7L A;  4DV1 T;  4DR5 T;  5FY1 A;  2E9X A;  2L9Q A;  4I55 E;  2X0L B;  2LSG A;  3KV5 A;  1IAP A;  5L3F B;  5LBM A;  2X9W A;  3M65 A;  3RQW A;  2JQ9 A;  4AIU A;  3UFG A;  4ILA A;  3KVB A;  4EEB A;  3VHL A;  4KI0 F;  2W2U A;  3PUX F;  3ZT7 A;  4J2C A;  3CX7 B;  4HWD A;  2WDR A;  5AQT B;  1L0V A;  4YTM A;  1UK5 A;  1G73 A;  2NW9 A;  1OED C;  1US7 B;  3L8R A;  3HR0 A;  4P09 A;  5LNK A;  3MA9 A;  3FHN A;  2QYW A;  2YU2 A;  4DMV A;  3CML A;  3KV9 A;  2PFV A;  4LMJ A;  2X66 A;  4GKJ T;  5JR9 B;  4O8S A;  4OHF A;  2KXP B;  2CMR A;  2EHO A;  5H6R B;  2J1D G;  2H89 A;  4DVD A;  1MNE A;  4LMK A;  4H9R C;  3ZJ1 A;  1ZOY A;  1MMA A;  3C4X A;  3AE4 A;  2IAK A;  4EB6 E;  3DTO A;  2VWA A;  3TLT A;  1HX1 B;  4O4J E;  4AI6 A;  3ONL C;  1BR0 A;  1QLB A;  5LYJ E;  2XAJ B;  4XBF B;  5AFU L;  4ZI3 C;  3PUA A;  2Y6X A;  5AQP B;  5LOV E;  2LE8 A;  3BQK A;  3FXE B;  3RRC A;  5FL0 A;  3CQC B;  4HWH A;  4EED A;  2N1G A;  3P4S A;  1HCI A;  1ZV4 X;  1MMG A;  5FL1 A;  5FXX A;  2LKH A;  2LM2 A;  4X62 T;  4XAX B;  3HKB E;  2W00 A;  3NZP A;  4OYK A;  3UQ7 A;  2XQ9 A;  5LG4 A;  1OXZ A;  2PJQ A;  5JRC B;  3C50 A;  5EK2 A;  5LGT B;  5EK4 A;  5CGM A;  1QSD A;  3O1I A;  3QC9 A;  1O3X A;  3QB5 A;  2XAS B;  2DHR A;  4U74 A;  3SWH A;  5L3G B;  2XY8 B;  3KBT A;  3ZN0 B;  5J2U E;  2ZLY A;  2LKG A;  1E7P A;  2ES0 A;  2V26 A;  1UCU A;  4O2B E;  4JLE A;  4CN1 A;  4U7Y A;  2YDR A;  4JI4 T;  3F2E A;  2BBJ A;  5AQF B;  4LF7 T;  4IL9 A;  3AXJ B;  1N32 T;  3CQX C;  4IE7 A;  4H9P C;  2CA5 A;  3R6N A;  2XQ6 A;  2E9X C;  2DWK A;  3AB3 B;  4I0U A;  4E7S A;  3E22 E;  4ZXL A;  5L3B B;  3B57 A;  4MFR A;  4UVC B;  4P0A A;  1KNR A;  3WI3 A;  2WU2 A;  5HXS A;  2YDS A;  3RH3 A;  3FBZ A;  3VKH A;  2XAQ B;  4G63 A;  2N2N A;  1OED B;  5C3J A;  1MIW A;  4L5G A;  1B7T A;  2ODU A;  5LHI B;  2L8K A;  2VKD A;  4B3R T;  2DCF A;  2ZM8 A;  3LBX B;  3OYX A;  1SUM B;  3O1J A;  2ZM2 A;  2YDQ A;  2HPJ A;  4LML A;  5FY0 A;  1SA0 E;  2J4G A;  1X9B A;  2H3R A;  3P50 A;  3ESL A;  2XQY A;  3RKG A;  5HAX A;  5ABH A;  3OKQ A;  4IE6 A;  4FI5 A;  5LJM A;  1N33 T;  4DUZ T;  4HFH A;  1YXR A;  2EHO C;  2D5U A;  4L0R A;  2ZMA A;  2VK9 A;  4TNV A;  4YY3 T;  2XQ5 A;  5LA6 E;  1WCR A;  3NKZ A;  2V6Y B;  3U3I A;  4PK4 A;  4H63 H;  5JDM A;  4UV9 B;  4HKA A;  4EZ4 A;  4DV0 T;  1XNQ T;  5J1G A;  3T1Y T;  4BJM A;  2RP4 A;  1I94 T;  1XMQ T;  3RRW A;  2L3L A;  2DLR A;  2JRK A;  4L9I A;  3TKL B;  2IUB A;  1CUN A;  2X51 A;  1W9R A;  2K5B B;  3MJX A;  2A9U A;  3KBU A;  3RF1 A;  3RYC E;  4ZI2 C;  3P4R A;  5IUX A;  2IML A;  4HEA A;  3ZCI A;  1YW0 A;  5HEJ A;  4DV7 T;  3LG7 A;  5HEG A;  4WBN E;  2V6X A;  3WAJ A;  2V8S V;  4X20 E;  2XQ4 A;  4HFD A;  4WBO A;  3FZM B;  4YT0 A;  2BG9 A;  4CN4 A;  2UUC T;  1X79 A;  4YJ3 E;  4CXX A;  3UQ4 A;  4YTN A;  1ZHC A;  3TLU A;  2D2S A;  1OWA A;  2HHH T;  2E8I A;  3D0T A;  3CK6 A;  4I43 B;  3RKO A;  4EZH A;  2YN6 A;  5JVD E;  3FZF B;  3UU4 A;  1J1J A;  4A98 A;  2NTX A;  2YEV C;  5HXE A;  2E9X B;  3ZMT B;  5ABG A;  3N9P A;  5AQQ B;  1LKX A;  2CXF A;  2DL1 A;  2HN1 A;  4AQY T;  2WCA A;  2XTL A;  2E5V A;  4UF0 A;  5F5W A;  2B76 A;  5HXC A;  5HWY A;  4DV6 T;  4IDZ A;  3RQU A;  1XMO T;  2X68 A;  4CXY A;  4AKH A;  3MK7 C;  3RC8 A;  2LOP A;  4ISS A;  2Q9Q A;  1M62 A;  4YFS A;  4UVA B;  3OPC A;  2WP9 A;  2NR4 A;  5IHY A;  5IWA T;  3G06 A;  2D0T A;  3WAK A;  1N36 T;  4LFB T;  5ETW A;  4U3C A;  2MPK A;  3HL6 A;  1QUU A;  3ZT5 A;  2VAS A;  2JQQ A;  3EUH A;  4KHP T;  1HF8 A;  1ZP0 A;  1MIY A;  4PK6 A;  5AQI B;  4BAY B;  2EHO B;  4OFZ A;  5HYA A;  3RIU A;  4OX9 T;  4TNW A;  3VR9 A;  2LM9 A;  2JQH A;  3RIA A;  2WZH A;  5JDN A;  4ZI3 D;  1SHZ C;  2PTF A;  4X1I E;  4PJJ A;  2CLY B;  2CPT A;  2FJE A;  2C5J A;  1S35 A;  3AE6 A;  5F8P A;  2LSI A;  4JI7 T;  3B5M A;  3JAD A;  5AQO B;  4IST A;  3ZMZ B;  5LP6 E;  1G8X A; 
#chains in the Genus database with same CATH homology
 4IT4 A;  2JQ9 A;  4CN4 A;  4WZX A;  2CPT A;  1WCR A;  4U33 A;  5LB7 B;  2V6Y A;  2WWV A;  5CJ5 A;  2V6Y B;  2JQK A;  5FVK A;  4CN6 A;  4U31 A;  3ZSS A;  4NIQ A;  2K3W A;  4U7I A;  3ZT6 A;  4U2Z A;  4U3C A;  1YXR A;  2W2U A;  2MPK A;  5CGM A;  2CRB A;  2WY2 A;  2V6X A;  3ZT7 A;  3EAB A;  3ZT5 A;  3K1S A;  4ZEY A;  1WR0 A;  2RPA A;  4U2Y A;  3ZST A;  2JQH A;  2LRL A;  2DL1 A;  1WFD A;  4CN1 A;  2A9U A;  4P1N A;  4U7Y A;  4A5X A;  2LRK A;  5FVL A;  2XZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...