5FVLA

Crystal structure of vps4-vps20 complex from s.cerevisiae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvlA00
4P1NA 2WWVA 1YXRA 3ZT7A 2LRKA 2RPAA 4CN1A 2CRBA 4U2ZA 4CN6A 2W2UA 2V6XA 2V6YB 1WFDA 4U7IA 4U33A 4U3CA 5CJ5A 1WR0A 2WY2A 3ZT6A 5CGMA 4CN4A 3ZT5A 2K3WA 4IT4A 4ZEYA 4NIQA 5FVLA 2JQHA 3K1SA 4A5XA 5LB7B 2MPKA 2CPTA 3EABA 4U7YA 4WZXA 5FVKA 3ZSSA 3ZSTA 1WCRA 2XZEA 2JQ9A 2DL1A 4U2YA 2V6YA 2LRLA 2JQKA 4U31A 2A9UA
chains in the Genus database with same CATH superfamily
3O9XA 1G73A 2LSJA 3ZPOA 2W66A 4UVCB 3UU4A 1T7SA 2LM9A 4CI2B 1N32T 2N9DA 4KHZF 5FXZA 3AA1B 3QOFA 2HH7A 5LHHB 2MYSA 1QUUA 1OWAA 2W2UA 4UELA 5LJMA 5AQLB 5JR9C 3SOLA 2P9BA 1SUMB 1VRBA 3N9NA 4PK6A 1US7B 5JH7E 2J4GA 2WY2A 2VQET 2UUBT 3D0TA 1HCIA 2J1DG 4ZXLA 4JV5T 4P0BA 5AQSB 2CMRA 4G2AA 5JR9A 2JIWA 4OK0A 4QH4A 1LVFA 2IUBA 5EK2A 2NW9A 3K3QC 4I55E 2CPTA 2YINA 3OKQA 4TZ4C 4AKLA 3JADA 3AEEA 2Y8DA 3CX8B 3I9WA 4JLEA 4IDPA 3UUMA 2WAUA 2JPFA 1WCRA 2PTFA 3MK7C 2IC9A 2Y48B 1FMVA 3PU8A 3QC9A 5AQIB 5LCYA 3SRZA 2LSGA 1E7PA 5FYMA 4AXPA 3H3MA 4A97A 3N9OA 3E0ZA 4UV9B 3DTOA 4DR2T 4DUYT 3EUHA 2XUEA 5IUXA 2CRBA 4LF5T 4Q25A 5J2UE 2PJQA 1MNDA 3FZLB 4TWDA 1IJ5A 4ZI3C 2N2NA 4X62T 5C8YE 3CQGB 2J47A 1YQ4A 4QH5A 4U33A 5ETWA 1HNWT 3PUGA 4QH1A 4YSYA 1D0YA 4ILCA 4EAHA 1WYBA 3LK42 3P4WA 3HKCE 2CCQA 4O2BE 5AQPB 3CX7B 1V9DA 3ZJ2A 5HEUA 4AQGA 1IZNB 2D2SA 3TLSA 1NENA 1UK5A 4I50E 3EAMA 2IC6A 4K0UA 2D0UA 5FMNA 1BR4A 2NTYA 4HWCA 4U2YA 2LKGA 3T8OA 4DV5T 2LLYA 3OPCA 3ESLA 4LFBT 2FBWA 3AEBA 3J7Yq 2B76A 2QYWA 2DNXA 3PV0F 4U31A 5ABGA 4IE4A 2LE8A 2UXBT 4DBQA 5HWYA 1T98A 2IAKA 1YQ3A 5JDFA 4EIWA 1J5ET 2A72A 3PUAA 5LG3A 4IREA 4IE6A 3KBTA 3MXZA 4YT0A 3UQ7A 3FZMB 3KV6A 1ZEEA 2FJEA 3Q5EA 4GK0E 4P09A 3N9QA 4PAGA 3I9YA 2NR4A 4LMKA 1JNRA 2BG9C 2YK0A 5AQVB 2BVLA 3KDSE 5FVLA 2ODUA 3AAIA 3RGLA 2MPKA 4LF6T 2XQAA 3CMLA 4L5GA 3VKHA 1IBKT 3QUJA 5FY1A 5HXCA 2BBHA 3L8RA 5FXXA 4L9IA 1XMQT 1XNQT 4N78D 2E9XB 3LK2B 5LMUT 3RH3A 2CM0A 2NWBA 2WS3A 3VU7H 1ZP0A 4X20E 5LHGB 2WSSV 4TV9E 4ZOLE 5M4YA 2V26A 2YU2A 3ONLC 2WDVA 1YKEB 2YDRA 3N2OA 2W00A 2LHRA 1UGOA 3JC6C 2YEVC 2KWIB 3T1HT 4LF8T 2CLYB 5AQQB 3GWHA 4IIJE 1KNZA 2QRXA 3RF1A 5L3BB 5AQMB 5A1LA 5AFUL 2DWKA 1WR0A 2NW8A 2XJ7A 4GOUA 3SFEA 5AQFB 2M6IA 2OLTA 1UURA 1E2AA 1IBMT 4JI6T 1J5WA 1U4QA 3JC6D 2XASB 2X9WA 4IT4A 3C4ZA 3ZN1B 2ZM0A 5FKYA 4NIQA 4YXDA 2K5BB 2WP9A 4DV3T 3AE4A 4DMWA 2CA5A 2Y6XA 4YHJA 3RKOA 3ZCIA 1HG2A 4HFIA 3N9MA 5BR8T 2XQ5A 2WZIA 4TNVA 4YSZA 2IMLA 4DV4T 2IIUA 1VCSA 4M1PA 4ZS3A 2A9UA 1LVKA 3M3ZB 4H9OC 2UXCT 2BBJA 2VQFT 2A2FX 1N33T 3QK6A 3ANWB 2JMKA 3FBZA 1FJGT 4U2ZA 3C98B 3M65A 2ZM8A 4AISA 2V6XA 3P4RA 3TKLB 4EGWA 3ZCJA 3PJAJ 4JI8T 2EHOD 2V8SV 4AKIA 3P4QA 4IDZA 4DV2T 3O1IA 2W0GA 5CJ5A 4ILAA 2CBJA 2V7JA 2MAWA 2XAJB 3ZT6A 2JJ9A 3ZMZB 3S4UA 1ZHCA 4DR3T 2VVSA 3OVUA 4HWIB 4OHFA 4HN9A 4LF4T 1MIYA 3CWZB 1W09A 5FVKA 2W61A 3ZMUB 1J1JA 1QSDA 4LF9T 3KFWX 3FZHB 3PUVF 5HCMA 3ZSTA 5J0ZA 2HHHT 1IBLT 2K9AA 4MFRA 2UUAT 4EZ4A 3ZMSB 3P4SA 3Q5DA 2CXDA 3L39A 3JAEA 4L0RA 3R6NA 4YTNA 4P1NA 1Z0PA 3WAJA 5JVDE 2YOEA 4PJLA 2CBIA 2KINB 2Q9QD 4H9SE 4IDOA 3F57A 1YD8G 1LKXA 3N2GE 3PUYF 4TN7B 1MMNA 1MMGA 2E8IA 4PW8A 5LBMA 4CN6A 4AQYT 1D1BA 3ZC1A 3C50A 3CK6A 3ABVA 4HWHA 5ABEA 1WR6A 3RYIE 2K24A 2LOSA 4HGAA 4EB6E 2H7OA 3KBUA 4B3ST 2RP4A 3RIUC 1I94T 3TLVA 2I6HA 2W63A 3ZYLA 4AIUA 5JRCA 4ZEYA 2FJAA 4I0UA 4MBQA 4WW0A 1SHZC 3OBVE 3U78A 4YY3T 3F31A 2D9DA 2XQ3A 1I6ZA 4H9PC 2UU9T 4JI4T 3LBXB 3P8CD 3ZJ1A 4IDNA 4NXMT 3E22E 3ETVA 1OEDC 2LJLA 4ZZBA 4YHHT 2W67A 3JAFA 2D5UA 3ZN0B 3RLFF 3AXJB 2SPCA 1ZKEA 4GKKT 4HKAA 2ZM6T 3NRYA 2BKPA 1GQEA 1HG5A 5FXWA 1T8BA 3VRBA 4Z90A 2KSRA 3O1JA 1OEDA 3WAKA 3HKDE 1OXZA 4QX7B 2E9XC 2VKJA 3AEFA 2BDEA 2CXFA 2C5KT 1XMOT 2CHOA 4C91A 4X65T 3SFDA 5F8PA 2CXLA 3V5SA 4EYYR 2KNDA 4GIWA 5AQRB 3RYCE 1N34T 2V7KA 5LGNB 2ZMAA 2EHOC 5LBQB 2LM2A 2L8KA 4H9QC 2BS3A 3BQIA 2K48A 3RC3A 2I0MA 3K1SA 5DQWA 2PBIA 4EZHA 1D1AA 3ETUA 4KX6A 5DQVA 5LB7B 4Z91A 3MKDA 4B6XA 3RIUA 4BAYB 2KLQA 3RRCA 4EEDA 2BKOA 4EXTA 5AQHB 3AE9A 4EEBA 2BKNA 2H89A 2XQ7A 3RIFA 4ADZA 2CEAA 1KNPA 5AQGB 5AQOB 2L3LA 5L4EA 3RIAA 4ZI7E 3Q5XA 4AQFC 2E5VA 3ZT7A 4LF7T 1YW0A 1VOMA 2LKHA 3GN5A 3GA8A 2X0HA 3L3PA 1MIVA 1OEDE 3AE2A 2XQ8A 3NBXX 5CA1E 2HN2A 3AE6A 3UUNA 4IE7A 4CXXA 3TLWA 4DR4T 3FXEB 5LG4A 5HXEA 2X9XA 5LXTE 2QGSA 3N9PA 5HEHA 3CVRA 1DU2A 3X1DA 3CQXC 3AAEB 5JDGA 1SA0E 3BQLA 4PFOA 2VL8A 5JQGE 5KMGP 5L3CB 1CHUA 2M67A 3UFGA 3ZYKA 3PU3A 4A5XA 1QLBA 2LSYA 2X9YA 3AA0B 3AE1A 3HR0A 3Q2MA 4X1KE 2VL0A 2V5DA 5HXRA 4AQFA 4PJNA 4DUZT 4GKJT 2C0SA 4O4LE 5FY0A 4BJNA 2BG9B 2J62A 2YKSA 3EDVA 3ZMVB 3ZEFB 3AVSA 3U3IA 4HWFA 2X66A 3UU3A 2IW5B 3CX6B 2WCAA 3UTKA 3VHLA 5L2LA 1HNXT 2XQ4A 5E0OA 2VK9A 4JYAT 4KP3C 2VASA 2V6YB 3PTRB 3IA3A 3ZKRA 5JTGA 5DJQC 3HKBE 5HEOA 2CHNA 2JQQA 4U7IA 2CWOA 3AEGA 3TLTA 3H37A 1D1CA 2VB6A 2KZ7B 2V7IA 1HR0T 2B1EA 2QVAA 5CFBA 5HYAA 3ZT5A 2K3WA 3ONJA 2E9XD 3Q9DA 3VR9A 5LP6E 4OX9T 1XNRT 3LJCA 4LFCT 4UVAB 1WLXA 1UX5A 2UXXB 2XM2A 2XAHB 2H3RA 2YN6A 3L09A 3QNUA 4TNWA 2V1DB 2D0TA 4C90A 5ADXL 5LGTB 4B3TT 1BR0A 1OEDB 3KV4A 3CPZA 4QXCB 2V7LA 3UUBA 4DR1T 2XHEB 1Z8UA 2IHR1 4UF0B 1KEYA 4KHPT 4KBMB 4HFCA 2YDSA 1XDOA 2WBLA 1SE7A 4HTEA 2VWAA 4KMCA 2CLYC 1ZV4X 4O4HE 5JREA 1MMAA 3MA9A 3RYFE 4DV6T 1B7TA 5JDLA 2LOPA 2EHOA 3P7IA 4CQIA 4MALA 3RI5A 5HEJA 4JEHB 3UU5A 5JDQA 2DLRA 4JI0T 5AQUB 2XQYA 4E7ZA 2V5CA 1ZOYA 3ZMTB 4O2AE 3A7MA 5C3JA 4HFVA 3LBXA 3OYXA 1EZ3A 2XSBA 3A5XA 4IE0A 3RX6A 1AJ3A 4X64T 4ZI3D 3UT5E 4JI5T 2XAFB 2Z6EA 3AE8A 2LT3A 3IBPA 1W0AA 2E5LT 3R84B 2L9QA 3BQKA 2G0UA 4X1IE 2X0LB 2XAGB 3C64A 4TX5A 2FJBA 2LEHA 4X5TA 3J9X1 4E7SA 3HA4A 3AAAB 3SS1A 2DL1A 5L3GB 4YJ3E 5ABFB 1KK7A 4PK4A 5L3EB 2XAQB 2KWHA 5LA6E 2LRKA 2RPAA 3SWHA 3EDUA 1W9RA 3C51A 1XZYA 3K8PC 5LJNA 3ZC0A 4XAXB 2DWGA 4BA9A 3PE0A 3BK9A 4O4JE 3NZQA 4ANJA 3CKDA 4IGUA 5ABFA 3OYZA 1HX8A 4KI0F 1UX4A 1W0BA 4IDQA 4JEUB 5C2TA 4NUUA 4O8SA 3RQUA 4TWFA 2H7VC 3VRAA 4ZI2C 5JDNA 4DV1T 4CZZB 5TAOA 2WU5A 3P50A 4H9RC 5FL0A 3KV5A 2UXNB 2E9XA 2ZLYA 3MJXA 4FJOA 4IE5A 5H6RB 4B3MT 4HFHA 3KVBA 2FJDA 3PURA 1NWMX 2AE9A 2HPLA 4O4IE 4WZXA 4H9NC 5FXVA 4JI1T 3PDYA 3ZSSA 4HEAA 1MNEA 2WWUA 3AEAA 5HCJA 3IF8B 5L4HA 2NOXA 4CI1B 4ZS2A 4IL9A 2ES0A 2QA7A 4EYUA 5CB4E 3VKGA 2WWVA 3DJBA 2KT9A 2NTXA 3RC8A 1Y64B 3AA6B 4WBOA 1R8IA 5AQKB 1H7CA 1NAFA 2GK9A 2A3DA 3AE3A 4UF0A 5FY7A 5LHIB 1LRZA 3HL6A 3A8YC 2C5IT 1IAPA 2CWYA 3AECA 4U3CA 4GK5E 2HN1A 4HFBA 3WI3A 4PJMA 2VURA 4HWDA 3Q5WA 4UXNB 1MMDA 1UCUA 1CUNA 3B5MA 4J2CA 2X51A 5AQJB 5CGMA 5L3FB 1X79A 2VKOA 2WU2A 2DI4A 3FZKB 1Y01A 3PJAA 3QB5K 4OFZA 1IJ6A 3PUQA 1FMWA 4DMVA 4DBRA 1D0XA 2MTQA 2NW7A 4JI3T 4DV7T 3C4WA 4P0AA 4K0KT 1N36T 2EHOB 4QKNA 2BZBA 3B57A 3K3NA 2V6YA 3KVAA 5JRCB 2BS2A 4PNIA 4NUVA 4TUYE 4DVDA 1M62A 2LRLA 4XZCA 4PK5A 4HFDA 1S35A 3KINB 4H63H 4ZZCA 5J2TE 2PFVA 4ILBA 1HTJF 3AE5A 4JUYA 2X9HA 5EK4A 2M6BA 3RQWA 3K3OA 3UU8A 2DCFA 5FP3A 2FUPA 5EZYE 3NWIA 4QXBB 4DR5T 1WFDA 2IDOB 2LHNA 2VKDA 3AB3B 3FXDB 2C5JA 3IHRA 3ONXA 1FIOA 4QXHB 1L0VA 3RYHE 3QB5A 3I1AA 2WM9A 3B13A 3PUXF 4ZHQE 5JDHA 4JI7T 1HX1B 3V5UA 2W4XA 1FEWA 5IHYA 3AXJA 4G63A 4OYKA 2NP9A 1YKHB 4QWNB 3ANWA 4U7YA 3O1HA 2OV9A 4FI5A 1HFAA 4KUMB 3UULA 4A56A 3FHNA 4DNDA 3NRXA 5CA0E 5LOVE 2UUCT 2WMOA 3TLUA 1KF6A 2JQ9A 2XZEA 3G06A 3NZPA 2XM1A 5JR9B 3H3AA 4IHJE 4V1Av 4UR9A 5HEGA 4BJMA 4CXWA 1G8XA 4X66T 2WZHA 4PJJA 2X68A 1U5PA 3FB2A 3NKZA 5L3DB 2RA1A 2YDQA 4NPPA 1D0ZA 3EHZA 3NVOA 4UIGA 5AQNB 5F5WA 3ZYMA 5HXSA 3C4XA 3AVRA 3LFMA 2KMFA 2JRKA 2W62A 3HI2A 4MLKA 3F2EA 4U72A 5LGUB 1HNZT 2KXPB 1HS7A 2Q9QA 4PFPA 1O3XA 4WBNE 5LNKA 4F6RC 4COFA 1KFYA 2WQYA 1E1HB 2HPJA 2WDQA 4CI3B 2OA5A 4ISSA 4DR7T 2BVMA 4IL4A 2JQHA 4MHCA 3ZLIA 4ASKA 3PUSA 5L47A 2JMHA 2ACXA 2LSIA 3LK3B 4WNKA 5AQTB 3O4XE 4H63V 2BG9E 5FL1A 1XDPA 4LMLA 5LMNT 5FNVE 4AKRB 3RRWA 3MACA 1XWMA 3LG7A 3KV9A 4UEMA 3RPUA 3VR8A 2XQ9A 3IEEA 4WYVA 5IWAT 4ISTA 2ZM2A 4EOZB 5HAXA 1YXRA 4JBWF 4F8HA 2VVNA 3AEDA 2XPKA 4CN1A 3OTOT 3HKEE 4X1YE 4HFEA 1T72A 4I43B 2BS4A 4YSXA 4TWHA 3CIRA 2DHRA 2ACZA 5IYZE 4XBFB 4ILUA 2XSAA 3UQ4A 4ZI2D 3MZKB 3W15B 4HE8A 1UUSA 3N9LA 4DIDB 3GN5B 4Z8XA 4JI2T 2UXDT 2F4VT 1KNRA 2Q9QC 3PUWF 2X67A 4B3RT 2X0YA 5LYJE 5DABA 2XQ6A 1JNZA 1VCTA 2WB5A 4QX8B 5ABHA 4DV0T 4NXNT 2MOZA 4GYSA 3EI0A 4EV6A 3I0QA 4YTMA 4YLHA 5BMVE 1BR1A 4YTPA 5H6QB 5KXJA 1S94A 1HF8A 2I59A 2Q9QB 2JQKA 4U74A 5KX5E 5J1GA 1M7KA 2VKHA 2XY8B 3LDQB 4AKGA 1X9BA 3FZFB 2XTLA 5GONE 2MBGA 4A98A 3EVYA 3DP7A 3LSVA 4LMJA 4QHOA 3AA7B 3E08A 3P4PA 3RKGA 2N1GA 3UFEA 4DR6T 2ODVA 4UV8B 5F3JA 2BG9A 3RHWA 1MIWA 3OJAA 2V7MA 2WMNA 4OYJA 3UUXB 1WRDA 5HWXA 5JDMA 4AI6A 2CE7A 4ERRA 5KDMC 4CN4A 4I4TE 4DO0A 2WDRA 3I0OA 3N5LA 4YJ2E 4AKHA 3FBLA 3GMIA 4TV8E 3CQCB 3JCFA 5HXHA 3EABA 2E2AA 5EK3A 3T1YT 4CXYA 2H88A 4YFSA 1WYCA 3AE7A 3PUZF 1NEKA 2PG8A 2R6GF 4GYRA 3N2KE 4UVBB 3UU6A 4LFAT 2YU1A 2AXDS 1BR2A 2LSKA
chains in the Genus database with same CATH topology
4P1NA 2WWVA 1YXRA 3ZT7A 2LRKA 2RPAA 4CN1A 2CRBA 4U2ZA 4CN6A 2W2UA 2V6XA 2V6YB 1WFDA 4U7IA 4U33A 4U3CA 5CJ5A 1WR0A 2WY2A 3ZT6A 5CGMA 4CN4A 3ZT5A 2K3WA 4IT4A 4ZEYA 4NIQA 5FVLA 2JQHA 3K1SA 4A5XA 5LB7B 2MPKA 2CPTA 3EABA 4U7YA 4WZXA 5FVKA 3ZSSA 3ZSTA 1WCRA 2XZEA 2JQ9A 2DL1A 4U2YA 2V6YA 2LRLA 2JQKA 4U31A 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1N A;  2WWV A;  1YXR A;  3ZT7 A;  2LRK A;  2RPA A;  4CN1 A;  2CRB A;  4U2Z A;  4CN6 A;  2W2U A;  2V6X A;  2V6Y B;  1WFD A;  4U7I A;  4U33 A;  4U3C A;  5CJ5 A;  1WR0 A;  2WY2 A;  3ZT6 A;  5CGM A;  4CN4 A;  3ZT5 A;  2K3W A;  4IT4 A;  4ZEY A;  4NIQ A;  5FVL A;  2JQH A;  3K1S A;  4A5X A;  5LB7 B;  2MPK A;  2CPT A;  3EAB A;  4U7Y A;  4WZX A;  5FVK A;  3ZSS A;  3ZST A;  1WCR A;  2XZE A;  2JQ9 A;  2DL1 A;  4U2Y A;  2V6Y A;  2LRL A;  2JQK A;  4U31 A;  2A9U A; 
#chains in the Genus database with same CATH topology
 3O9X A;  1G73 A;  2LSJ A;  3ZPO A;  2W66 A;  4UVC B;  3UU4 A;  1T7S A;  2LM9 A;  4CI2 B;  1N32 T;  2N9D A;  4KHZ F;  5FXZ A;  3AA1 B;  3QOF A;  2HH7 A;  5LHH B;  2MYS A;  1QUU A;  1OWA A;  2W2U A;  4UEL A;  5LJM A;  5AQL B;  5JR9 C;  3SOL A;  2P9B A;  1SUM B;  1VRB A;  3N9N A;  4PK6 A;  1US7 B;  5JH7 E;  2J4G A;  2WY2 A;  2VQE T;  2UUB T;  3D0T A;  1HCI A;  2J1D G;  4ZXL A;  4JV5 T;  4P0B A;  5AQS B;  2CMR A;  4G2A A;  5JR9 A;  2JIW A;  4OK0 A;  4QH4 A;  1LVF A;  2IUB A;  5EK2 A;  2NW9 A;  3K3Q C;  4I55 E;  2CPT A;  2YIN A;  3OKQ A;  4TZ4 C;  4AKL A;  3JAD A;  3AEE A;  2Y8D A;  3CX8 B;  3I9W A;  4JLE A;  4IDP A;  3UUM A;  2WAU A;  2JPF A;  1WCR A;  2PTF A;  3MK7 C;  2IC9 A;  2Y48 B;  1FMV A;  3PU8 A;  3QC9 A;  5AQI B;  5LCY A;  3SRZ A;  2LSG A;  1E7P A;  5FYM A;  4AXP A;  3H3M A;  4A97 A;  3N9O A;  3E0Z A;  4UV9 B;  3DTO A;  4DR2 T;  4DUY T;  3EUH A;  2XUE A;  5IUX A;  2CRB A;  4LF5 T;  4Q25 A;  5J2U E;  2PJQ A;  1MND A;  3FZL B;  4TWD A;  1IJ5 A;  4ZI3 C;  2N2N A;  4X62 T;  5C8Y E;  3CQG B;  2J47 A;  1YQ4 A;  4QH5 A;  4U33 A;  5ETW A;  1HNW T;  3PUG A;  4QH1 A;  4YSY A;  1D0Y A;  4ILC A;  4EAH A;  1WYB A;  3LK4 2;  3P4W A;  3HKC E;  2CCQ A;  4O2B E;  5AQP B;  3CX7 B;  1V9D A;  3ZJ2 A;  5HEU A;  4AQG A;  1IZN B;  2D2S A;  3TLS A;  1NEN A;  1UK5 A;  4I50 E;  3EAM A;  2IC6 A;  4K0U A;  2D0U A;  5FMN A;  1BR4 A;  2NTY A;  4HWC A;  4U2Y A;  2LKG A;  3T8O A;  4DV5 T;  2LLY A;  3OPC A;  3ESL A;  4LFB T;  2FBW A;  3AEB A;  3J7Y q;  2B76 A;  2QYW A;  2DNX A;  3PV0 F;  4U31 A;  5ABG A;  4IE4 A;  2LE8 A;  2UXB T;  4DBQ A;  5HWY A;  1T98 A;  2IAK A;  1YQ3 A;  5JDF A;  4EIW A;  1J5E T;  2A72 A;  3PUA A;  5LG3 A;  4IRE A;  4IE6 A;  3KBT A;  3MXZ A;  4YT0 A;  3UQ7 A;  3FZM B;  3KV6 A;  1ZEE A;  2FJE A;  3Q5E A;  4GK0 E;  4P09 A;  3N9Q A;  4PAG A;  3I9Y A;  2NR4 A;  4LMK A;  1JNR A;  2BG9 C;  2YK0 A;  5AQV B;  2BVL A;  3KDS E;  5FVL A;  2ODU A;  3AAI A;  3RGL A;  2MPK A;  4LF6 T;  2XQA A;  3CML A;  4L5G A;  3VKH A;  1IBK T;  3QUJ A;  5FY1 A;  5HXC A;  2BBH A;  3L8R A;  5FXX A;  4L9I A;  1XMQ T;  1XNQ T;  4N78 D;  2E9X B;  3LK2 B;  5LMU T;  3RH3 A;  2CM0 A;  2NWB A;  2WS3 A;  3VU7 H;  1ZP0 A;  4X20 E;  5LHG B;  2WSS V;  4TV9 E;  4ZOL E;  5M4Y A;  2V26 A;  2YU2 A;  3ONL C;  2WDV A;  1YKE B;  2YDR A;  3N2O A;  2W00 A;  2LHR A;  1UGO A;  3JC6 C;  2YEV C;  2KWI B;  3T1H T;  4LF8 T;  2CLY B;  5AQQ B;  3GWH A;  4IIJ E;  1KNZ A;  2QRX A;  3RF1 A;  5L3B B;  5AQM B;  5A1L A;  5AFU L;  2DWK A;  1WR0 A;  2NW8 A;  2XJ7 A;  4GOU A;  3SFE A;  5AQF B;  2M6I A;  2OLT A;  1UUR A;  1E2A A;  1IBM T;  4JI6 T;  1J5W A;  1U4Q A;  3JC6 D;  2XAS B;  2X9W A;  4IT4 A;  3C4Z A;  3ZN1 B;  2ZM0 A;  5FKY A;  4NIQ A;  4YXD A;  2K5B B;  2WP9 A;  4DV3 T;  3AE4 A;  4DMW A;  2CA5 A;  2Y6X A;  4YHJ A;  3RKO A;  3ZCI A;  1HG2 A;  4HFI A;  3N9M A;  5BR8 T;  2XQ5 A;  2WZI A;  4TNV A;  4YSZ A;  2IML A;  4DV4 T;  2IIU A;  1VCS A;  4M1P A;  4ZS3 A;  2A9U A;  1LVK A;  3M3Z B;  4H9O C;  2UXC T;  2BBJ A;  2VQF T;  2A2F X;  1N33 T;  3QK6 A;  3ANW B;  2JMK A;  3FBZ A;  1FJG T;  4U2Z A;  3C98 B;  3M65 A;  2ZM8 A;  4AIS A;  2V6X A;  3P4R A;  3TKL B;  4EGW A;  3ZCJ A;  3PJA J;  4JI8 T;  2EHO D;  2V8S V;  4AKI A;  3P4Q A;  4IDZ A;  4DV2 T;  3O1I A;  2W0G A;  5CJ5 A;  4ILA A;  2CBJ A;  2V7J A;  2MAW A;  2XAJ B;  3ZT6 A;  2JJ9 A;  3ZMZ B;  3S4U A;  1ZHC A;  4DR3 T;  2VVS A;  3OVU A;  4HWI B;  4OHF A;  4HN9 A;  4LF4 T;  1MIY A;  3CWZ B;  1W09 A;  5FVK A;  2W61 A;  3ZMU B;  1J1J A;  1QSD A;  4LF9 T;  3KFW X;  3FZH B;  3PUV F;  5HCM A;  3ZST A;  5J0Z A;  2HHH T;  1IBL T;  2K9A A;  4MFR A;  2UUA T;  4EZ4 A;  3ZMS B;  3P4S A;  3Q5D A;  2CXD A;  3L39 A;  3JAE A;  4L0R A;  3R6N A;  4YTN A;  4P1N A;  1Z0P A;  3WAJ A;  5JVD E;  2YOE A;  4PJL A;  2CBI A;  2KIN B;  2Q9Q D;  4H9S E;  4IDO A;  3F57 A;  1YD8 G;  1LKX A;  3N2G E;  3PUY F;  4TN7 B;  1MMN A;  1MMG A;  2E8I A;  4PW8 A;  5LBM A;  4CN6 A;  4AQY T;  1D1B A;  3ZC1 A;  3C50 A;  3CK6 A;  3ABV A;  4HWH A;  5ABE A;  1WR6 A;  3RYI E;  2K24 A;  2LOS A;  4HGA A;  4EB6 E;  2H7O A;  3KBU A;  4B3S T;  2RP4 A;  3RIU C;  1I94 T;  3TLV A;  2I6H A;  2W63 A;  3ZYL A;  4AIU A;  5JRC A;  4ZEY A;  2FJA A;  4I0U A;  4MBQ A;  4WW0 A;  1SHZ C;  3OBV E;  3U78 A;  4YY3 T;  3F31 A;  2D9D A;  2XQ3 A;  1I6Z A;  4H9P C;  2UU9 T;  4JI4 T;  3LBX B;  3P8C D;  3ZJ1 A;  4IDN A;  4NXM T;  3E22 E;  3ETV A;  1OED C;  2LJL A;  4ZZB A;  4YHH T;  2W67 A;  3JAF A;  2D5U A;  3ZN0 B;  3RLF F;  3AXJ B;  2SPC A;  1ZKE A;  4GKK T;  4HKA A;  2ZM6 T;  3NRY A;  2BKP A;  1GQE A;  1HG5 A;  5FXW A;  1T8B A;  3VRB A;  4Z90 A;  2KSR A;  3O1J A;  1OED A;  3WAK A;  3HKD E;  1OXZ A;  4QX7 B;  2E9X C;  2VKJ A;  3AEF A;  2BDE A;  2CXF A;  2C5K T;  1XMO T;  2CHO A;  4C91 A;  4X65 T;  3SFD A;  5F8P A;  2CXL A;  3V5S A;  4EYY R;  2KND A;  4GIW A;  5AQR B;  3RYC E;  1N34 T;  2V7K A;  5LGN B;  2ZMA A;  2EHO C;  5LBQ B;  2LM2 A;  2L8K A;  4H9Q C;  2BS3 A;  3BQI A;  2K48 A;  3RC3 A;  2I0M A;  3K1S A;  5DQW A;  2PBI A;  4EZH A;  1D1A A;  3ETU A;  4KX6 A;  5DQV A;  5LB7 B;  4Z91 A;  3MKD A;  4B6X A;  3RIU A;  4BAY B;  2KLQ A;  3RRC A;  4EED A;  2BKO A;  4EXT A;  5AQH B;  3AE9 A;  4EEB A;  2BKN A;  2H89 A;  2XQ7 A;  3RIF A;  4ADZ A;  2CEA A;  1KNP A;  5AQG B;  5AQO B;  2L3L A;  5L4E A;  3RIA A;  4ZI7 E;  3Q5X A;  4AQF C;  2E5V A;  3ZT7 A;  4LF7 T;  1YW0 A;  1VOM A;  2LKH A;  3GN5 A;  3GA8 A;  2X0H A;  3L3P A;  1MIV A;  1OED E;  3AE2 A;  2XQ8 A;  3NBX X;  5CA1 E;  2HN2 A;  3AE6 A;  3UUN A;  4IE7 A;  4CXX A;  3TLW A;  4DR4 T;  3FXE B;  5LG4 A;  5HXE A;  2X9X A;  5LXT E;  2QGS A;  3N9P A;  5HEH A;  3CVR A;  1DU2 A;  3X1D A;  3CQX C;  3AAE B;  5JDG A;  1SA0 E;  3BQL A;  4PFO A;  2VL8 A;  5JQG E;  5KMG P;  5L3C B;  1CHU A;  2M67 A;  3UFG A;  3ZYK A;  3PU3 A;  4A5X A;  1QLB A;  2LSY A;  2X9Y A;  3AA0 B;  3AE1 A;  3HR0 A;  3Q2M A;  4X1K E;  2VL0 A;  2V5D A;  5HXR A;  4AQF A;  4PJN A;  4DUZ T;  4GKJ T;  2C0S A;  4O4L E;  5FY0 A;  4BJN A;  2BG9 B;  2J62 A;  2YKS A;  3EDV A;  3ZMV B;  3ZEF B;  3AVS A;  3U3I A;  4HWF A;  2X66 A;  3UU3 A;  2IW5 B;  3CX6 B;  2WCA A;  3UTK A;  3VHL A;  5L2L A;  1HNX T;  2XQ4 A;  5E0O A;  2VK9 A;  4JYA T;  4KP3 C;  2VAS A;  2V6Y B;  3PTR B;  3IA3 A;  3ZKR A;  5JTG A;  5DJQ C;  3HKB E;  5HEO A;  2CHN A;  2JQQ A;  4U7I A;  2CWO A;  3AEG A;  3TLT A;  3H37 A;  1D1C A;  2VB6 A;  2KZ7 B;  2V7I A;  1HR0 T;  2B1E A;  2QVA A;  5CFB A;  5HYA A;  3ZT5 A;  2K3W A;  3ONJ A;  2E9X D;  3Q9D A;  3VR9 A;  5LP6 E;  4OX9 T;  1XNR T;  3LJC A;  4LFC T;  4UVA B;  1WLX A;  1UX5 A;  2UXX B;  2XM2 A;  2XAH B;  2H3R A;  2YN6 A;  3L09 A;  3QNU A;  4TNW A;  2V1D B;  2D0T A;  4C90 A;  5ADX L;  5LGT B;  4B3T T;  1BR0 A;  1OED B;  3KV4 A;  3CPZ A;  4QXC B;  2V7L A;  3UUB A;  4DR1 T;  2XHE B;  1Z8U A;  2IHR 1;  4UF0 B;  1KEY A;  4KHP T;  4KBM B;  4HFC A;  2YDS A;  1XDO A;  2WBL A;  1SE7 A;  4HTE A;  2VWA A;  4KMC A;  2CLY C;  1ZV4 X;  4O4H E;  5JRE A;  1MMA A;  3MA9 A;  3RYF E;  4DV6 T;  1B7T A;  5JDL A;  2LOP A;  2EHO A;  3P7I A;  4CQI A;  4MAL A;  3RI5 A;  5HEJ A;  4JEH B;  3UU5 A;  5JDQ A;  2DLR A;  4JI0 T;  5AQU B;  2XQY A;  4E7Z A;  2V5C A;  1ZOY A;  3ZMT B;  4O2A E;  3A7M A;  5C3J A;  4HFV A;  3LBX A;  3OYX A;  1EZ3 A;  2XSB A;  3A5X A;  4IE0 A;  3RX6 A;  1AJ3 A;  4X64 T;  4ZI3 D;  3UT5 E;  4JI5 T;  2XAF B;  2Z6E A;  3AE8 A;  2LT3 A;  3IBP A;  1W0A A;  2E5L T;  3R84 B;  2L9Q A;  3BQK A;  2G0U A;  4X1I E;  2X0L B;  2XAG B;  3C64 A;  4TX5 A;  2FJB A;  2LEH A;  4X5T A;  3J9X 1;  4E7S A;  3HA4 A;  3AAA B;  3SS1 A;  2DL1 A;  5L3G B;  4YJ3 E;  5ABF B;  1KK7 A;  4PK4 A;  5L3E B;  2XAQ B;  2KWH A;  5LA6 E;  2LRK A;  2RPA A;  3SWH A;  3EDU A;  1W9R A;  3C51 A;  1XZY A;  3K8P C;  5LJN A;  3ZC0 A;  4XAX B;  2DWG A;  4BA9 A;  3PE0 A;  3BK9 A;  4O4J E;  3NZQ A;  4ANJ A;  3CKD A;  4IGU A;  5ABF A;  3OYZ A;  1HX8 A;  4KI0 F;  1UX4 A;  1W0B A;  4IDQ A;  4JEU B;  5C2T A;  4NUU A;  4O8S A;  3RQU A;  4TWF A;  2H7V C;  3VRA A;  4ZI2 C;  5JDN A;  4DV1 T;  4CZZ B;  5TAO A;  2WU5 A;  3P50 A;  4H9R C;  5FL0 A;  3KV5 A;  2UXN B;  2E9X A;  2ZLY A;  3MJX A;  4FJO A;  4IE5 A;  5H6R B;  4B3M T;  4HFH A;  3KVB A;  2FJD A;  3PUR A;  1NWM X;  2AE9 A;  2HPL A;  4O4I E;  4WZX A;  4H9N C;  5FXV A;  4JI1 T;  3PDY A;  3ZSS A;  4HEA A;  1MNE A;  2WWU A;  3AEA A;  5HCJ A;  3IF8 B;  5L4H A;  2NOX A;  4CI1 B;  4ZS2 A;  4IL9 A;  2ES0 A;  2QA7 A;  4EYU A;  5CB4 E;  3VKG A;  2WWV A;  3DJB A;  2KT9 A;  2NTX A;  3RC8 A;  1Y64 B;  3AA6 B;  4WBO A;  1R8I A;  5AQK B;  1H7C A;  1NAF A;  2GK9 A;  2A3D A;  3AE3 A;  4UF0 A;  5FY7 A;  5LHI B;  1LRZ A;  3HL6 A;  3A8Y C;  2C5I T;  1IAP A;  2CWY A;  3AEC A;  4U3C A;  4GK5 E;  2HN1 A;  4HFB A;  3WI3 A;  4PJM A;  2VUR A;  4HWD A;  3Q5W A;  4UXN B;  1MMD A;  1UCU A;  1CUN A;  3B5M A;  4J2C A;  2X51 A;  5AQJ B;  5CGM A;  5L3F B;  1X79 A;  2VKO A;  2WU2 A;  2DI4 A;  3FZK B;  1Y01 A;  3PJA A;  3QB5 K;  4OFZ A;  1IJ6 A;  3PUQ A;  1FMW A;  4DMV A;  4DBR A;  1D0X A;  2MTQ A;  2NW7 A;  4JI3 T;  4DV7 T;  3C4W A;  4P0A A;  4K0K T;  1N36 T;  2EHO B;  4QKN A;  2BZB A;  3B57 A;  3K3N A;  2V6Y A;  3KVA A;  5JRC B;  2BS2 A;  4PNI A;  4NUV A;  4TUY E;  4DVD A;  1M62 A;  2LRL A;  4XZC A;  4PK5 A;  4HFD A;  1S35 A;  3KIN B;  4H63 H;  4ZZC A;  5J2T E;  2PFV A;  4ILB A;  1HTJ F;  3AE5 A;  4JUY A;  2X9H A;  5EK4 A;  2M6B A;  3RQW A;  3K3O A;  3UU8 A;  2DCF A;  5FP3 A;  2FUP A;  5EZY E;  3NWI A;  4QXB B;  4DR5 T;  1WFD A;  2IDO B;  2LHN A;  2VKD A;  3AB3 B;  3FXD B;  2C5J A;  3IHR A;  3ONX A;  1FIO A;  4QXH B;  1L0V A;  3RYH E;  3QB5 A;  3I1A A;  2WM9 A;  3B13 A;  3PUX F;  4ZHQ E;  5JDH A;  4JI7 T;  1HX1 B;  3V5U A;  2W4X A;  1FEW A;  5IHY A;  3AXJ A;  4G63 A;  4OYK A;  2NP9 A;  1YKH B;  4QWN B;  3ANW A;  4U7Y A;  3O1H A;  2OV9 A;  4FI5 A;  1HFA A;  4KUM B;  3UUL A;  4A56 A;  3FHN A;  4DND A;  3NRX A;  5CA0 E;  5LOV E;  2UUC T;  2WMO A;  3TLU A;  1KF6 A;  2JQ9 A;  2XZE A;  3G06 A;  3NZP A;  2XM1 A;  5JR9 B;  3H3A A;  4IHJ E;  4V1A v;  4UR9 A;  5HEG A;  4BJM A;  4CXW A;  1G8X A;  4X66 T;  2WZH A;  4PJJ A;  2X68 A;  1U5P A;  3FB2 A;  3NKZ A;  5L3D B;  2RA1 A;  2YDQ A;  4NPP A;  1D0Z A;  3EHZ A;  3NVO A;  4UIG A;  5AQN B;  5F5W A;  3ZYM A;  5HXS A;  3C4X A;  3AVR A;  3LFM A;  2KMF A;  2JRK A;  2W62 A;  3HI2 A;  4MLK A;  3F2E A;  4U72 A;  5LGU B;  1HNZ T;  2KXP B;  1HS7 A;  2Q9Q A;  4PFP A;  1O3X A;  4WBN E;  5LNK A;  4F6R C;  4COF A;  1KFY A;  2WQY A;  1E1H B;  2HPJ A;  2WDQ A;  4CI3 B;  2OA5 A;  4ISS A;  4DR7 T;  2BVM A;  4IL4 A;  2JQH A;  4MHC A;  3ZLI A;  4ASK A;  3PUS A;  5L47 A;  2JMH A;  2ACX A;  2LSI A;  3LK3 B;  4WNK A;  5AQT B;  3O4X E;  4H63 V;  2BG9 E;  5FL1 A;  1XDP A;  4LML A;  5LMN T;  5FNV E;  4AKR B;  3RRW A;  3MAC A;  1XWM A;  3LG7 A;  3KV9 A;  4UEM A;  3RPU A;  3VR8 A;  2XQ9 A;  3IEE A;  4WYV A;  5IWA T;  4IST A;  2ZM2 A;  4EOZ B;  5HAX A;  1YXR A;  4JBW F;  4F8H A;  2VVN A;  3AED A;  2XPK A;  4CN1 A;  3OTO T;  3HKE E;  4X1Y E;  4HFE A;  1T72 A;  4I43 B;  2BS4 A;  4YSX A;  4TWH A;  3CIR A;  2DHR A;  2ACZ A;  5IYZ E;  4XBF B;  4ILU A;  2XSA A;  3UQ4 A;  4ZI2 D;  3MZK B;  3W15 B;  4HE8 A;  1UUS A;  3N9L A;  4DID B;  3GN5 B;  4Z8X A;  4JI2 T;  2UXD T;  2F4V T;  1KNR A;  2Q9Q C;  3PUW F;  2X67 A;  4B3R T;  2X0Y A;  5LYJ E;  5DAB A;  2XQ6 A;  1JNZ A;  1VCT A;  2WB5 A;  4QX8 B;  5ABH A;  4DV0 T;  4NXN T;  2MOZ A;  4GYS A;  3EI0 A;  4EV6 A;  3I0Q A;  4YTM A;  4YLH A;  5BMV E;  1BR1 A;  4YTP A;  5H6Q B;  5KXJ A;  1S94 A;  1HF8 A;  2I59 A;  2Q9Q B;  2JQK A;  4U74 A;  5KX5 E;  5J1G A;  1M7K A;  2VKH A;  2XY8 B;  3LDQ B;  4AKG A;  1X9B A;  3FZF B;  2XTL A;  5GON E;  2MBG A;  4A98 A;  3EVY A;  3DP7 A;  3LSV A;  4LMJ A;  4QHO A;  3AA7 B;  3E08 A;  3P4P A;  3RKG A;  2N1G A;  3UFE A;  4DR6 T;  2ODV A;  4UV8 B;  5F3J A;  2BG9 A;  3RHW A;  1MIW A;  3OJA A;  2V7M A;  2WMN A;  4OYJ A;  3UUX B;  1WRD A;  5HWX A;  5JDM A;  4AI6 A;  2CE7 A;  4ERR A;  5KDM C;  4CN4 A;  4I4T E;  4DO0 A;  2WDR A;  3I0O A;  3N5L A;  4YJ2 E;  4AKH A;  3FBL A;  3GMI A;  4TV8 E;  3CQC B;  3JCF A;  5HXH A;  3EAB A;  2E2A A;  5EK3 A;  3T1Y T;  4CXY A;  2H88 A;  4YFS A;  1WYC A;  3AE7 A;  3PUZ F;  1NEK A;  2PG8 A;  2R6G F;  4GYR A;  3N2K E;  4UVB B;  3UU6 A;  4LFA T;  2YU1 A;  2AXD S;  1BR2 A;  2LSK A; 
#chains in the Genus database with same CATH homology
 4P1N A;  2WWV A;  1YXR A;  3ZT7 A;  2LRK A;  2RPA A;  4CN1 A;  2CRB A;  4U2Z A;  4CN6 A;  2W2U A;  2V6X A;  2V6Y B;  1WFD A;  4U7I A;  4U33 A;  4U3C A;  5CJ5 A;  1WR0 A;  2WY2 A;  3ZT6 A;  5CGM A;  4CN4 A;  3ZT5 A;  2K3W A;  4IT4 A;  4ZEY A;  4NIQ A;  5FVL A;  2JQH A;  3K1S A;  4A5X A;  5LB7 B;  2MPK A;  2CPT A;  3EAB A;  4U7Y A;  4WZX A;  5FVK A;  3ZSS A;  3ZST A;  1WCR A;  2XZE A;  2JQ9 A;  2DL1 A;  4U2Y A;  2V6Y A;  2LRL A;  2JQK A;  4U31 A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...