5FVLA

Crystal structure of vps4-vps20 complex from s.cerevisiae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
b'HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvlA00
1WCRA 4U7YA 2JQKA 2LRKA 2A9UA 2V6YB 4ZEYA 1WR0A 1WFDA 5CGMA 4U33A 4U2YA 2V6YA 4P1NA 4WZXA 2CPTA 4A5XA 3ZT6A 2CRBA 2W2UA 3ZT7A 5CJ5A 3K1SA 2WWVA 3ZSSA 4NIQA 3ZT5A 4U2ZA 2JQ9A 4CN6A 1YXRA 2MPKA 5FVKA 4CN1A 2WY2A 3EABA 5FVLA 3ZSTA 4IT4A 5LB7B 2JQHA 4CN4A 2V6XA 2K3WA 2RPAA 4U3CA 2DL1A 2XZEA 4U7IA 2LRLA 4U31A
chains in the Genus database with same CATH superfamily
2I0MA 3OKQA 3EI0A 3H3AA 2BVLA 3RQUA 1M62A 3UFEA 4KHPT 4OFZA 5HXCA 4U2ZA 3PUVF 4IL4A 4HFHA 3C64A 3OBVE 3RQWA 3KV4A 3OPCA 2BS4A 5ABFA 5EK4A 4I43B 1ZHCA 4QXCB 1MNDA 3VU7H 4EV6A 3K3NA 5FXZA 2E9XA 5JR9A 4WYVA 3RYHE 4PFOA 4ERRA 2I59A 1G8XA 3IBPA 1VCTA 4X5TA 2XQ5A 2WU2A 4U3CA 3EUHA 4X64T 2NTYA 1HR0T 2K24A 3E08A 3PUGA 4EEBA 1U5PA 2X0HA 2JIWA 3C4ZA 4NIQA 4PAGA 4IREA 1D0ZA 5BMVE 4TNWA 1WLXA 3SFDA 1Z0PA 1FMVA 4YTMA 3CK6A 1D1AA 3DTOA 3ZKRA 4ZI3D 2CPTA 3IA3A 2I6HA 2IC9A 4QH4A 1XMOT 5HEHA 4CN6A 1XDPA 4AQFA 1IJ5A 5LYJE 5FP3A 2CXFA 3AE8A 1EZ3A 5GONE 5FKYA 1ZV4X 4KP3C 5AQJB 3C4WA 3PV0F 4QH1A 4A5XA 3K1SA 3CX7B 4XZCA 2VASA 5HCMA 1S35A 1YKHB 1KNRA 3CQGB 2QRXA 2KT9A 2PBIA 2WBLA 1NAFA 5JDFA 3GN5A 3AE4A 1W9RA 3A7MA 4O2BE 1QLBA 1X79A 4ISSA 2VKOA 2CWYA 2J1DG 4UXNB 2J47A 1BR2A 1O3XA 1JNRA 2W0GA 5ABHA 4UEMA 5J2TE 1Y01A 4KHZF 3L39A 4I50E 3AXJB 2XHEB 3U78A 4HE8A 4UF0A 1HNZT 3QUJA 4PW8A 5BR8T 4QXBB 5M4YA 2IIUA 2V8SV 1MMNA 4DNDA 5H6QB 2V6XA 4TX5A 1OEDB 2WS3A 3E22E 5J1GA 3KBUA 2NW8A 5L3DB 5LMNT 3ZSSA 3B57A 3TKLB 3WAKA 3SS1A 3MXZA 3DP7A 3B5MA 2E9XD 3AE6A 5HYAA 1J5WA 1XWMA 3KFWX 5LG4A 4HFBA 4QHOA 1T8BA 2NTXA 2V1DB 3NZQA 1NWMX 3VHLA 4QH5A 4TZ4C 5FY0A 2RPAA 1HX8A 2JQKA 4DO0A 5LG3A 4DV6T 3EVYA 3AA7B 2VURA 2ZM8A 1LVFA 4B3TT 3ZPOA 2BG9B 2WCAA 2UUCT 4K0UA 1XNQT 1OEDC 2LM2A 4X62T 3AAEB 3V5UA 4CI2B 4AKRB 2W67A 3N9NA 3JAEA 2JPFA 3LFMA 2BDEA 2XY8B 4AKLA 3CVRA 3ZT5A 4Z8XA 4JUYA 4DR5T 1N33T 3UQ4A 3N9LA 4IDPA 2VKHA 3PUQA 4LF6T 4DR7T 2HPLA 2EHOA 4H9SE 2NW7A 3P8CD 5FY1A 3KV9A 2XAJB 4CN4A 4KBMB 2LRLA 1WCRA 2LSJA 1HG5A 3HL6A 4DV3T 2NW9A 1GQEA 2BG9C 3G06A 2XQ4A 3VR9A 4OHFA 5DQWA 4IE6A 1UURA 3AA6B 4H9RC 4HWIB 2X51A 3UTKA 3UQ7A 4YTNA 1MNEA 4COFA 2X0YA 2LHRA 4WZXA 2WZIA 2N1GA 5AQKB 2FUPA 3AE9A 2LOSA 3UU3A 4JI4T 2D5UA 4DV1T 3KINB 2ACXA 3M3ZB 2VVNA 2QVAA 3OYZA 5HXRA 3LDQB 2XAGB 2D2SA 1LKXA 3P4SA 2KINB 4J2CA 5DQVA 2A9UA 3KVAA 1IZNB 5F8PA 1UK5A 3CMLA 2CA5A 3UUBA 3LBXA 3C50A 3PJAJ 2XM2A 2W00A 3ETUA 4UVBB 5HEOA 2V7IA 4PFPA 2B1EA 4OYJA 5L3EB 4X66T 4EB6E 4ILUA 4AIUA 1E1HB 2KNDA 3P7IA 2ODUA 1T7SA 4ILCA 2B76A 5TAOA 4AISA 2D0UA 2V7JA 1Z8UA 2VKDA 2WDRA 2WM9A 5AQFB 4WNKA 3ZEFB 1FMWA 2WAUA 3PUAA 4IE5A 2X9XA 4FI5A 2X66A 4ZZCA 3LK3B 5FVLA 2FJDA 3FZKB 2WWVA 2XAQB 1FJGT 3SOLA 3H3MA 4BJNA 2FBWA 2IMLA 2BZBA 2VL8A 1AJ3A 4QX8B 4QX7B 4EXTA 3AEFA 2YDSA 2C5KT 2Q9QA 2PG8A 5LJMA 3AB3B 2JRKA 5FYMA 4V1Av 2MYSA 3TLTA 5JDLA 2N2NA 2LHNA 4CN1A 1L0VA 2AE9A 2XQ7A 4NXNT 4QXHB 1WFDA 4GIWA 3W15B 3FBLA 3I1AA 3ABVA 4GKJT 5LGTB 3I0OA 2W62A 3ZYKA 2L3LA 4JV5T 2CXDA 2H7VC 1W0AA 3PE0A 3FXDB 4GKKT 3Q5WA 3KVBA 3C4XA 5HAXA 4U7YA 4ZOLE 4XAXB 2VVSA 3BQKA 4H63V 3PUSA 3RIUC 3P4RA 4ZI2D 4EAHA 1YKEB 4A97A 3RRWA 1J1JA 1D0YA 4EIWA 3K8PC 2E5LT 5LGUB 4EZHA 3P4QA 3NVOA 5HEUA 1S94A 4XBFB 2BS2A 1ZOYA 3ESLA 3P4WA 1HFAA 4F8HA 4AQYT 3UU8A 3EHZA 1MMAA 1R8IA 2UXDT 5HXSA 3AE2A 4BA9A 4B3MT 4U74A 4DBQA 5CGMA 3RYFE 4CI3B 2JQQA 4TWFA 3LG7A 3M65A 4AKHA 4KUMB 4CZZB 3JC6D 1OEDE 5IYZE 2YDRA 3B13A 3CQCB 3NZPA 4QWNB 2W4XA 4U2YA 3S4UA 4ZS3A 2UXNB 5AQHB 2LM9A 2A72A 2UU9T 2BBHA 4MHCA 5LJNA 2CBIA 3NBXX 3K3QC 5JVDE 1ZEEA 1MIVA 4UIGA 1UGOA 4X1IE 2W66A 3ZCIA 4E7SA 4IE7A 4EYYR 1J5ET 1E2AA 4DV2T 4JI1T 2LT3A 1Y64B 4CXYA 1T72A 2Q9QD 2H3RA 3NWIA 2LEHA 2BS3A 4WW0A 5JH7E 2L8KA 4ZEYA 3OVUA 5KMGP 2BKPA 3LJCA 4JI3T 2DHRA 2BG9E 4HN9A 4JEUB 5KXJA 4YTPA 3RYCE 2DWGA 2KWIB 3MZKB 2K5BB 3AXJA 1QSDA 3N9OA 5ABGA 3QC9A 2WWUA 3RF1A 2JMHA 2CMRA 2VL0A 4B3ST 4P0BA 4LFAT 3PURA 2V6YB 2FJAA 4OX9T 2A3DA 3ZYMA 1OEDA 4A98A 1BR0A 4HWHA 5HEJA 5J0ZA 2YOEA 2YK0A 5FY7A 4B6XA 1LRZA 4BAYB 4DUZT 3I0QA 2XPKA 2SPCA 2OA5A 2DCFA 3VRBA 1HTJF 1HNXT 3J7Yq 4BJMA 4X1YE 3RYIE 3FZFB 4NXMT 4K0KT 4LF8T 4YXDA 2XM1A 2YEVC 2X9HA 2JMKA 2IDOB 5AQTB 5LNKA 5L3GB 5JTGA 1SHZC 3UUNA 1I94T 1XDOA 2KSRA 2XQAA 5LMUT 2LKGA 2BG9A 4IT4A 2K3WA 4ZI7E 4JI5T 4GK0E 1FIOA 1U4QA 3AECA 5KX5E 4KI0F 2DNXA 5HCJA 3AE3A 3QB5K 4H9NC 2CE7A 5FVKA 3N2OA 3RC8A 3BK9A 5L3BB 3O1IA 2OLTA 4WBNE 3GMIA 1H7CA 2JQ9A 2NP9A 2X0LB 2MPKA 2XASB 2C5JA 3V5SA 4UR9A 3T1YT 3CPZA 4HTEA 3IHRA 2K9AA 4TWHA 4NUUA 4YJ2E 3AEGA 4TN7B 1KFYA 4HFIA 2ACZA 4ASKA 1UCUA 1HS7A 3PUXF 2UXXB 1YW0A 4LMKA 4UVCB 4C91A 5EK2A 4UV9B 3AA0B 2QYWA 4YSXA 3O9XA 4ZZBA 2ES0A 5H6RB 5AQSB 2K48A 1HG2A 3AE5A 5CFBA 4JLEA 1E7PA 2MAWA 3EDVA 4HWFA 2C0SA 4I0UA 3ONJA 2WQYA 4LF5T 4DUYT 5E0OA 3RC3A 4PK6A 3F57A 3MACA 2VQFT 2UXCT 4HFCA 3N9MA 4JI8T 2RP4A 2ZM6T 3FZLB 3TLUA 2LLYA 1N34T 3AA1B 5AQQB 2H7OA 3ZSTA 4LMJA 3VR8A 1KK7A 4U33A 3ZJ2A 1NEKA 2ODVA 2W61A 2YKSA 4CXXA 3RPUA 4LFBT 5AQMB 4EOZB 2IAKA 5LGNB 3AVSA 5HXEA 2AXDS 3FZHB 3JCFA 2HH7A 4MFRA 3ANWB 3HKDE 3Q9DA 1LVKA 2G0UA 5JDMA 5ETWA 4JI6T 3AEEA 2NWBA 2W2UA 1M7KA 4IDOA 3RKGA 3SWHA 4L5GA 2X9WA 3EDUA 3DJBA 3MKDA 2VQET 5FXWA 5AQPB 3X1DA 3UT5E 4B3RT 5EK3A 2DLRA 3KV6A 3UULA 2V5CA 2UUBT 3EABA 2PJQA 3AEAA 5JRCA 2V5DA 4UELA 5LHIB 3O4XE 3P4PA 3HI2A 2V7LA 2CRBA 5AQVB 1QUUA 5LBQB 1N32T 3U3IA 3OJAA 4G2AA 4DR2T 4E7ZA 1YXRA 2C5IT 2V7MA 2LSGA 4H63H 2XUEA 2EHOD 3QB5A 5LBMA 4G63A 4MALA 3UU4A 1NENA 4YJ3E 4ZS2A 2ZM0A 5F5WA 1D1BA 2J4GA 3AVRA 4NUVA 4ZI2C 2LE8A 1SE7A 3F2EA 5C8YE 2X68A 4TV9E 4PJMA 4DR6T 1KF6A 2OV9A 5FL0A 4LFCT 3R84B 2P9BA 5JREA 3RLFF 1HNWT 3ZYLA 5CA1E 1WYBA 3HKEE 5LCYA 4IDZA 1DU2A 2XTLA 5HWYA 2MBGA 4IHJE 4AXPA 2BKOA 2LSYA 1YQ3A 1IJ6A 3JC6C 3Q5DA 2M67A 3A5XA 5AQGB 2DI4A 4LF9T 3GWHA 4O4HE 4JI0T 2CEAA 2KXPB 2DWKA 3KBTA 5L47A 3AEBA 3HKBE 4PJNA 1WRDA 3ZJ1A 5L3CB 3PDYA 4YSZA 3ZC1A 2XZEA 3UFGA 1WR0A 4ZI3C 3ZT7A 4Z91A 3RI5A 3ZN0B 2CHOA 3R6NA 3ZMUB 2CLYB 2Q9QC 4TNVA 2E8IA 4DIDB 2WY2A 2N9DA 2PFVA 2HN1A 2BVMA 5JDGA 3OTOT 5LHHB 4C90A 2VB6A 3H37A 3I9WA 1BR1A 4DVDA 4X65T 2WU5A 2M6BA 3FZMB 5J2UE 2XAHB 5ABFB 3J9X1 2YN6A 3JAFA 2WMOA 2WB5A 4U7IA 3UU6A 4U31A 2MOZA 2H88A 2E9XB 4JEHB 5JR9B 3PU8A 2LKHA 4MLKA 4EGWA 4HEAA 4YSYA 2YDQA 1WR6A 5FMNA 1XZYA 1OWAA 4Z90A 2XQ9A 3FXEB 4ZHQE 4PNIA 3HA4A 5FXVA 5KDMC 5FXXA 4O4IE 3KDSE 1X9BA 2KLQA 1V9DA 2LRKA 2XQ3A 3WAJA 2CLYC 1UX5A 2QA7A 2XQ6A 3T8OA 5AQIB 3SFEA 3C51A 1T98A 3VKGA 3PUWF 3TLWA 5DABA 2HHHT 4ANJA 3UUMA 2XQYA 2WSSV 2M6IA 2V6YA 3NRYA 3LSVA 1IBLT 5C2TA 2CM0A 2WP9A 1G73A 2XJ7A 4UV8B 4PK4A 4HGAA 2VKJA 3RH3A 2XSAA 2X67A 2E9XC 5JR9C 5JDNA 5JQGE 3N5LA 3Q2MA 2FJEA 1YD8G 3L3PA 3RGLA 1D1CA 3VRAA 4JBWF 4IIJE 5L4EA 2XSBA 2F4VT 1SA0E 3JADA 2WZHA 4A56A 3E0ZA 4GOUA 3N2KE 2YINA 3GN5B 4IE0A 3ONXA 2BBJA 2ZM2A 4AI6A 1VOMA 4DV7T 1MMGA 2Y6XA 2CBJA 4F6RC 1N36T 3ZC0A 4DMVA 2LJLA 3AEDA 4O8SA 4UF0B 1CUNA 1HX1B 3ZLIA 4AQFC 1ZKEA 3BQIA 2LSIA 3ONLC 3FHNA 4YLHA 3PUYF 2WMNA 3O1JA 3BQLA 3RIAA 4ILAA 1OXZA 4ADZA 4CI1B 2MTQA 4P0AA 2UUAT 3IEEA 2HPJA 3OYXA 4YHHT 2FJBA 2NR4A 4EZ4A 3PJAA 5FNVE 2IC6A 4Q25A 3AE7A 4TUYE 5IUXA 3MA9A 4QKNA 3WI3A 4ISTA 3VKHA 2DL1A 4GYRA 2H89A 1UX4A 1W0BA 4HFEA 3RHWA 2KZ7B 2IW5B 2VK9A 5AFUL 2YU1A 3CWZB 4DR3T 2RA1A 3Q5XA 2BKNA 4AKIA 3AE1A 4X20E 4DR1T 4UVAB 5L3FB 3N9PA 2JJ9A 2X9YA 3MK7C 4WBOA 3ZMSB 3T1HT 1W09A 3N2GE 1WYCA 4L9IA 2VWAA 4EYUA 4NPPA 2WDQA 5LA6E 5LXTE 3L09A 3ZMTB 3ZT6A 3CKDA 2V7KA 3F31A 4DBRA 4ILBA 1D0XA 3AAAB 3D0TA 2IUBA 2J62A 1SUMB 4YHJA 2EHOB 2D0TA 4FJOA 5A1LA 1IBKT 3TLVA 1I6ZA 4CQIA 2PTFA 1KEYA 4PK5A 4X1KE 4JI2T 4JI7T 3N9QA 3PTRB 4OYKA 3ZN1B 4EEDA 2ZLYA 2Y48B 2ZMAA 3QK6A 3ZCJA 1CHUA 3ANWA 4DV0T 4AKGA 2IHR1 3LK2B 4YY3T 2A2FX 2KWHA 3ZMZB 5ADXL 4I4TE 3NKZA 2LSKA 4HWDA 4TV8E 4IDNA 2JQHA 3SRZA 5DJQC 3RKOA 3MJXA 5JDHA 5HEGA 4O2AE 1VRBA 4DMWA 2CCQA 4IGUA 1MMDA 3UUXB 4N78D 5IHYA 2KMFA 3C98B 4H9OC 3CX6B 5F3JA 5FL1A 2EHOC 5LB7B 4YT0A 4PJJA 3CQXC 3HR0A 3LBXB 4IDQA 4DV5T 3I9YA 3PUZF 4IE4A 5IWAT 1XMQT 3FBZA 4JYAT 3RIFA 2QGSA 2WDVA 3P50A 2YU2A 1YQ4A 4HFDA 3ZMVB 3O1HA 5AQRB 1KNZA 1ZP0A 3RIUA 1KNPA 4AQGA 3EAMA 5AQNB 5ABEA 5L2LA 3ETVA 5AQLB 1MIYA 4CXWA 4H9QC 3GA8A 3UU5A 2W63A 4O4LE 1BR4A 2E5VA 2Z6EA 2L9QA 4HKAA 3NRXA 3QOFA 4PJLA 2NOXA 5JDQA 2E2AA 4P1NA 3L8RA 1US7B 1UUSA 3CIRA 4KMCA 2UXBT 3LK42 3K3OA 5JRCB 3AAIA 2XAFB 3PU3A 1FEWA 2CHNA 2Y8DA 3TLSA 3A8YC 5C3JA 4H9PC 2HN2A 4MBQA 1IAPA 4L0RA 2CWOA 4DR4T 2CXLA 2XQ8A 4TWDA 3RX6A 4KX6A 2V26A 4IL9A 2Q9QB 4LF4T 5L4HA 5CB4E 1HF8A 5LHGB 3HKCE 5CA0E 5LP6E 4GYSA 4LF7T 2D9DA 1HCIA 4YFSA 5HXHA 4U72A 1VCSA 4LMLA 4ZXLA 4I55E 4OK0A 2LOPA 2GK9A 5LOVE 1IBMT 4HWCA 4M1PA 3KV5A 5EZYE 4P09A 5AQOB 3QNUA 1JNZA 3CX8B 3Q5EA 4HFVA 5CJ5A 3RRCA 1B7TA 2R6GF 4GK5E 5AQUB 3IF8B 4DV4T 1MIWA 3FB2A 1XNRT 5HWXA 4O4JE
chains in the Genus database with same CATH topology
1WCRA 4U7YA 2JQKA 2LRKA 2A9UA 2V6YB 4ZEYA 1WR0A 1WFDA 5CGMA 4U33A 4U2YA 2V6YA 4P1NA 4WZXA 2CPTA 4A5XA 3ZT6A 2CRBA 2W2UA 3ZT7A 5CJ5A 3K1SA 2WWVA 3ZSSA 4NIQA 3ZT5A 4U2ZA 2JQ9A 4CN6A 1YXRA 2MPKA 5FVKA 4CN1A 2WY2A 3EABA 5FVLA 3ZSTA 4IT4A 5LB7B 2JQHA 4CN4A 2V6XA 2K3WA 2RPAA 4U3CA 2DL1A 2XZEA 4U7IA 2LRLA 4U31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCR A;  4U7Y A;  2JQK A;  2LRK A;  2A9U A;  2V6Y B;  4ZEY A;  1WR0 A;  1WFD A;  5CGM A;  4U33 A;  4U2Y A;  2V6Y A;  4P1N A;  4WZX A;  2CPT A;  4A5X A;  3ZT6 A;  2CRB A;  2W2U A;  3ZT7 A;  5CJ5 A;  3K1S A;  2WWV A;  3ZSS A;  4NIQ A;  3ZT5 A;  4U2Z A;  2JQ9 A;  4CN6 A;  1YXR A;  2MPK A;  5FVK A;  4CN1 A;  2WY2 A;  3EAB A;  5FVL A;  3ZST A;  4IT4 A;  5LB7 B;  2JQH A;  4CN4 A;  2V6X A;  2K3W A;  2RPA A;  4U3C A;  2DL1 A;  2XZE A;  4U7I A;  2LRL A;  4U31 A; 
#chains in the Genus database with same CATH topology
 2I0M A;  3OKQ A;  3EI0 A;  3H3A A;  2BVL A;  3RQU A;  1M62 A;  3UFE A;  4KHP T;  4OFZ A;  5HXC A;  4U2Z A;  3PUV F;  4IL4 A;  4HFH A;  3C64 A;  3OBV E;  3RQW A;  3KV4 A;  3OPC A;  2BS4 A;  5ABF A;  5EK4 A;  4I43 B;  1ZHC A;  4QXC B;  1MND A;  3VU7 H;  4EV6 A;  3K3N A;  5FXZ A;  2E9X A;  5JR9 A;  4WYV A;  3RYH E;  4PFO A;  4ERR A;  2I59 A;  1G8X A;  3IBP A;  1VCT A;  4X5T A;  2XQ5 A;  2WU2 A;  4U3C A;  3EUH A;  4X64 T;  2NTY A;  1HR0 T;  2K24 A;  3E08 A;  3PUG A;  4EEB A;  1U5P A;  2X0H A;  2JIW A;  3C4Z A;  4NIQ A;  4PAG A;  4IRE A;  1D0Z A;  5BMV E;  4TNW A;  1WLX A;  3SFD A;  1Z0P A;  1FMV A;  4YTM A;  3CK6 A;  1D1A A;  3DTO A;  3ZKR A;  4ZI3 D;  2CPT A;  3IA3 A;  2I6H A;  2IC9 A;  4QH4 A;  1XMO T;  5HEH A;  4CN6 A;  1XDP A;  4AQF A;  1IJ5 A;  5LYJ E;  5FP3 A;  2CXF A;  3AE8 A;  1EZ3 A;  5GON E;  5FKY A;  1ZV4 X;  4KP3 C;  5AQJ B;  3C4W A;  3PV0 F;  4QH1 A;  4A5X A;  3K1S A;  3CX7 B;  4XZC A;  2VAS A;  5HCM A;  1S35 A;  1YKH B;  1KNR A;  3CQG B;  2QRX A;  2KT9 A;  2PBI A;  2WBL A;  1NAF A;  5JDF A;  3GN5 A;  3AE4 A;  1W9R A;  3A7M A;  4O2B E;  1QLB A;  1X79 A;  4ISS A;  2VKO A;  2CWY A;  2J1D G;  4UXN B;  2J47 A;  1BR2 A;  1O3X A;  1JNR A;  2W0G A;  5ABH A;  4UEM A;  5J2T E;  1Y01 A;  4KHZ F;  3L39 A;  4I50 E;  3AXJ B;  2XHE B;  3U78 A;  4HE8 A;  4UF0 A;  1HNZ T;  3QUJ A;  4PW8 A;  5BR8 T;  4QXB B;  5M4Y A;  2IIU A;  2V8S V;  1MMN A;  4DND A;  5H6Q B;  2V6X A;  4TX5 A;  1OED B;  2WS3 A;  3E22 E;  5J1G A;  3KBU A;  2NW8 A;  5L3D B;  5LMN T;  3ZSS A;  3B57 A;  3TKL B;  3WAK A;  3SS1 A;  3MXZ A;  3DP7 A;  3B5M A;  2E9X D;  3AE6 A;  5HYA A;  1J5W A;  1XWM A;  3KFW X;  5LG4 A;  4HFB A;  4QHO A;  1T8B A;  2NTX A;  2V1D B;  3NZQ A;  1NWM X;  3VHL A;  4QH5 A;  4TZ4 C;  5FY0 A;  2RPA A;  1HX8 A;  2JQK A;  4DO0 A;  5LG3 A;  4DV6 T;  3EVY A;  3AA7 B;  2VUR A;  2ZM8 A;  1LVF A;  4B3T T;  3ZPO A;  2BG9 B;  2WCA A;  2UUC T;  4K0U A;  1XNQ T;  1OED C;  2LM2 A;  4X62 T;  3AAE B;  3V5U A;  4CI2 B;  4AKR B;  2W67 A;  3N9N A;  3JAE A;  2JPF A;  3LFM A;  2BDE A;  2XY8 B;  4AKL A;  3CVR A;  3ZT5 A;  4Z8X A;  4JUY A;  4DR5 T;  1N33 T;  3UQ4 A;  3N9L A;  4IDP A;  2VKH A;  3PUQ A;  4LF6 T;  4DR7 T;  2HPL A;  2EHO A;  4H9S E;  2NW7 A;  3P8C D;  5FY1 A;  3KV9 A;  2XAJ B;  4CN4 A;  4KBM B;  2LRL A;  1WCR A;  2LSJ A;  1HG5 A;  3HL6 A;  4DV3 T;  2NW9 A;  1GQE A;  2BG9 C;  3G06 A;  2XQ4 A;  3VR9 A;  4OHF A;  5DQW A;  4IE6 A;  1UUR A;  3AA6 B;  4H9R C;  4HWI B;  2X51 A;  3UTK A;  3UQ7 A;  4YTN A;  1MNE A;  4COF A;  2X0Y A;  2LHR A;  4WZX A;  2WZI A;  2N1G A;  5AQK B;  2FUP A;  3AE9 A;  2LOS A;  3UU3 A;  4JI4 T;  2D5U A;  4DV1 T;  3KIN B;  2ACX A;  3M3Z B;  2VVN A;  2QVA A;  3OYZ A;  5HXR A;  3LDQ B;  2XAG B;  2D2S A;  1LKX A;  3P4S A;  2KIN B;  4J2C A;  5DQV A;  2A9U A;  3KVA A;  1IZN B;  5F8P A;  1UK5 A;  3CML A;  2CA5 A;  3UUB A;  3LBX A;  3C50 A;  3PJA J;  2XM2 A;  2W00 A;  3ETU A;  4UVB B;  5HEO A;  2V7I A;  4PFP A;  2B1E A;  4OYJ A;  5L3E B;  4X66 T;  4EB6 E;  4ILU A;  4AIU A;  1E1H B;  2KND A;  3P7I A;  2ODU A;  1T7S A;  4ILC A;  2B76 A;  5TAO A;  4AIS A;  2D0U A;  2V7J A;  1Z8U A;  2VKD A;  2WDR A;  2WM9 A;  5AQF B;  4WNK A;  3ZEF B;  1FMW A;  2WAU A;  3PUA A;  4IE5 A;  2X9X A;  4FI5 A;  2X66 A;  4ZZC A;  3LK3 B;  5FVL A;  2FJD A;  3FZK B;  2WWV A;  2XAQ B;  1FJG T;  3SOL A;  3H3M A;  4BJN A;  2FBW A;  2IML A;  2BZB A;  2VL8 A;  1AJ3 A;  4QX8 B;  4QX7 B;  4EXT A;  3AEF A;  2YDS A;  2C5K T;  2Q9Q A;  2PG8 A;  5LJM A;  3AB3 B;  2JRK A;  5FYM A;  4V1A v;  2MYS A;  3TLT A;  5JDL A;  2N2N A;  2LHN A;  4CN1 A;  1L0V A;  2AE9 A;  2XQ7 A;  4NXN T;  4QXH B;  1WFD A;  4GIW A;  3W15 B;  3FBL A;  3I1A A;  3ABV A;  4GKJ T;  5LGT B;  3I0O A;  2W62 A;  3ZYK A;  2L3L A;  4JV5 T;  2CXD A;  2H7V C;  1W0A A;  3PE0 A;  3FXD B;  4GKK T;  3Q5W A;  3KVB A;  3C4X A;  5HAX A;  4U7Y A;  4ZOL E;  4XAX B;  2VVS A;  3BQK A;  4H63 V;  3PUS A;  3RIU C;  3P4R A;  4ZI2 D;  4EAH A;  1YKE B;  4A97 A;  3RRW A;  1J1J A;  1D0Y A;  4EIW A;  3K8P C;  2E5L T;  5LGU B;  4EZH A;  3P4Q A;  3NVO A;  5HEU A;  1S94 A;  4XBF B;  2BS2 A;  1ZOY A;  3ESL A;  3P4W A;  1HFA A;  4F8H A;  4AQY T;  3UU8 A;  3EHZ A;  1MMA A;  1R8I A;  2UXD T;  5HXS A;  3AE2 A;  4BA9 A;  4B3M T;  4U74 A;  4DBQ A;  5CGM A;  3RYF E;  4CI3 B;  2JQQ A;  4TWF A;  3LG7 A;  3M65 A;  4AKH A;  4KUM B;  4CZZ B;  3JC6 D;  1OED E;  5IYZ E;  2YDR A;  3B13 A;  3CQC B;  3NZP A;  4QWN B;  2W4X A;  4U2Y A;  3S4U A;  4ZS3 A;  2UXN B;  5AQH B;  2LM9 A;  2A72 A;  2UU9 T;  2BBH A;  4MHC A;  5LJN A;  2CBI A;  3NBX X;  3K3Q C;  5JVD E;  1ZEE A;  1MIV A;  4UIG A;  1UGO A;  4X1I E;  2W66 A;  3ZCI A;  4E7S A;  4IE7 A;  4EYY R;  1J5E T;  1E2A A;  4DV2 T;  4JI1 T;  2LT3 A;  1Y64 B;  4CXY A;  1T72 A;  2Q9Q D;  2H3R A;  3NWI A;  2LEH A;  2BS3 A;  4WW0 A;  5JH7 E;  2L8K A;  4ZEY A;  3OVU A;  5KMG P;  2BKP A;  3LJC A;  4JI3 T;  2DHR A;  2BG9 E;  4HN9 A;  4JEU B;  5KXJ A;  4YTP A;  3RYC E;  2DWG A;  2KWI B;  3MZK B;  2K5B B;  3AXJ A;  1QSD A;  3N9O A;  5ABG A;  3QC9 A;  2WWU A;  3RF1 A;  2JMH A;  2CMR A;  2VL0 A;  4B3S T;  4P0B A;  4LFA T;  3PUR A;  2V6Y B;  2FJA A;  4OX9 T;  2A3D A;  3ZYM A;  1OED A;  4A98 A;  1BR0 A;  4HWH A;  5HEJ A;  5J0Z A;  2YOE A;  2YK0 A;  5FY7 A;  4B6X A;  1LRZ A;  4BAY B;  4DUZ T;  3I0Q A;  2XPK A;  2SPC A;  2OA5 A;  2DCF A;  3VRB A;  1HTJ F;  1HNX T;  3J7Y q;  4BJM A;  4X1Y E;  3RYI E;  3FZF B;  4NXM T;  4K0K T;  4LF8 T;  4YXD A;  2XM1 A;  2YEV C;  2X9H A;  2JMK A;  2IDO B;  5AQT B;  5LNK A;  5L3G B;  5JTG A;  1SHZ C;  3UUN A;  1I94 T;  1XDO A;  2KSR A;  2XQA A;  5LMU T;  2LKG A;  2BG9 A;  4IT4 A;  2K3W A;  4ZI7 E;  4JI5 T;  4GK0 E;  1FIO A;  1U4Q A;  3AEC A;  5KX5 E;  4KI0 F;  2DNX A;  5HCJ A;  3AE3 A;  3QB5 K;  4H9N C;  2CE7 A;  5FVK A;  3N2O A;  3RC8 A;  3BK9 A;  5L3B B;  3O1I A;  2OLT A;  4WBN E;  3GMI A;  1H7C A;  2JQ9 A;  2NP9 A;  2X0L B;  2MPK A;  2XAS B;  2C5J A;  3V5S A;  4UR9 A;  3T1Y T;  3CPZ A;  4HTE A;  3IHR A;  2K9A A;  4TWH A;  4NUU A;  4YJ2 E;  3AEG A;  4TN7 B;  1KFY A;  4HFI A;  2ACZ A;  4ASK A;  1UCU A;  1HS7 A;  3PUX F;  2UXX B;  1YW0 A;  4LMK A;  4UVC B;  4C91 A;  5EK2 A;  4UV9 B;  3AA0 B;  2QYW A;  4YSX A;  3O9X A;  4ZZB A;  2ES0 A;  5H6R B;  5AQS B;  2K48 A;  1HG2 A;  3AE5 A;  5CFB A;  4JLE A;  1E7P A;  2MAW A;  3EDV A;  4HWF A;  2C0S A;  4I0U A;  3ONJ A;  2WQY A;  4LF5 T;  4DUY T;  5E0O A;  3RC3 A;  4PK6 A;  3F57 A;  3MAC A;  2VQF T;  2UXC T;  4HFC A;  3N9M A;  4JI8 T;  2RP4 A;  2ZM6 T;  3FZL B;  3TLU A;  2LLY A;  1N34 T;  3AA1 B;  5AQQ B;  2H7O A;  3ZST A;  4LMJ A;  3VR8 A;  1KK7 A;  4U33 A;  3ZJ2 A;  1NEK A;  2ODV A;  2W61 A;  2YKS A;  4CXX A;  3RPU A;  4LFB T;  5AQM B;  4EOZ B;  2IAK A;  5LGN B;  3AVS A;  5HXE A;  2AXD S;  3FZH B;  3JCF A;  2HH7 A;  4MFR A;  3ANW B;  3HKD E;  3Q9D A;  1LVK A;  2G0U A;  5JDM A;  5ETW A;  4JI6 T;  3AEE A;  2NWB A;  2W2U A;  1M7K A;  4IDO A;  3RKG A;  3SWH A;  4L5G A;  2X9W A;  3EDU A;  3DJB A;  3MKD A;  2VQE T;  5FXW A;  5AQP B;  3X1D A;  3UT5 E;  4B3R T;  5EK3 A;  2DLR A;  3KV6 A;  3UUL A;  2V5C A;  2UUB T;  3EAB A;  2PJQ A;  3AEA A;  5JRC A;  2V5D A;  4UEL A;  5LHI B;  3O4X E;  3P4P A;  3HI2 A;  2V7L A;  2CRB A;  5AQV B;  1QUU A;  5LBQ B;  1N32 T;  3U3I A;  3OJA A;  4G2A A;  4DR2 T;  4E7Z A;  1YXR A;  2C5I T;  2V7M A;  2LSG A;  4H63 H;  2XUE A;  2EHO D;  3QB5 A;  5LBM A;  4G63 A;  4MAL A;  3UU4 A;  1NEN A;  4YJ3 E;  4ZS2 A;  2ZM0 A;  5F5W A;  1D1B A;  2J4G A;  3AVR A;  4NUV A;  4ZI2 C;  2LE8 A;  1SE7 A;  3F2E A;  5C8Y E;  2X68 A;  4TV9 E;  4PJM A;  4DR6 T;  1KF6 A;  2OV9 A;  5FL0 A;  4LFC T;  3R84 B;  2P9B A;  5JRE A;  3RLF F;  1HNW T;  3ZYL A;  5CA1 E;  1WYB A;  3HKE E;  5LCY A;  4IDZ A;  1DU2 A;  2XTL A;  5HWY A;  2MBG A;  4IHJ E;  4AXP A;  2BKO A;  2LSY A;  1YQ3 A;  1IJ6 A;  3JC6 C;  3Q5D A;  2M67 A;  3A5X A;  5AQG B;  2DI4 A;  4LF9 T;  3GWH A;  4O4H E;  4JI0 T;  2CEA A;  2KXP B;  2DWK A;  3KBT A;  5L47 A;  3AEB A;  3HKB E;  4PJN A;  1WRD A;  3ZJ1 A;  5L3C B;  3PDY A;  4YSZ A;  3ZC1 A;  2XZE A;  3UFG A;  1WR0 A;  4ZI3 C;  3ZT7 A;  4Z91 A;  3RI5 A;  3ZN0 B;  2CHO A;  3R6N A;  3ZMU B;  2CLY B;  2Q9Q C;  4TNV A;  2E8I A;  4DID B;  2WY2 A;  2N9D A;  2PFV A;  2HN1 A;  2BVM A;  5JDG A;  3OTO T;  5LHH B;  4C90 A;  2VB6 A;  3H37 A;  3I9W A;  1BR1 A;  4DVD A;  4X65 T;  2WU5 A;  2M6B A;  3FZM B;  5J2U E;  2XAH B;  5ABF B;  3J9X 1;  2YN6 A;  3JAF A;  2WMO A;  2WB5 A;  4U7I A;  3UU6 A;  4U31 A;  2MOZ A;  2H88 A;  2E9X B;  4JEH B;  5JR9 B;  3PU8 A;  2LKH A;  4MLK A;  4EGW A;  4HEA A;  4YSY A;  2YDQ A;  1WR6 A;  5FMN A;  1XZY A;  1OWA A;  4Z90 A;  2XQ9 A;  3FXE B;  4ZHQ E;  4PNI A;  3HA4 A;  5FXV A;  5KDM C;  5FXX A;  4O4I E;  3KDS E;  1X9B A;  2KLQ A;  1V9D A;  2LRK A;  2XQ3 A;  3WAJ A;  2CLY C;  1UX5 A;  2QA7 A;  2XQ6 A;  3T8O A;  5AQI B;  3SFE A;  3C51 A;  1T98 A;  3VKG A;  3PUW F;  3TLW A;  5DAB A;  2HHH T;  4ANJ A;  3UUM A;  2XQY A;  2WSS V;  2M6I A;  2V6Y A;  3NRY A;  3LSV A;  1IBL T;  5C2T A;  2CM0 A;  2WP9 A;  1G73 A;  2XJ7 A;  4UV8 B;  4PK4 A;  4HGA A;  2VKJ A;  3RH3 A;  2XSA A;  2X67 A;  2E9X C;  5JR9 C;  5JDN A;  5JQG E;  3N5L A;  3Q2M A;  2FJE A;  1YD8 G;  3L3P A;  3RGL A;  1D1C A;  3VRA A;  4JBW F;  4IIJ E;  5L4E A;  2XSB A;  2F4V T;  1SA0 E;  3JAD A;  2WZH A;  4A56 A;  3E0Z A;  4GOU A;  3N2K E;  2YIN A;  3GN5 B;  4IE0 A;  3ONX A;  2BBJ A;  2ZM2 A;  4AI6 A;  1VOM A;  4DV7 T;  1MMG A;  2Y6X A;  2CBJ A;  4F6R C;  1N36 T;  3ZC0 A;  4DMV A;  2LJL A;  3AED A;  4O8S A;  4UF0 B;  1CUN A;  1HX1 B;  3ZLI A;  4AQF C;  1ZKE A;  3BQI A;  2LSI A;  3ONL C;  3FHN A;  4YLH A;  3PUY F;  2WMN A;  3O1J A;  3BQL A;  3RIA A;  4ILA A;  1OXZ A;  4ADZ A;  4CI1 B;  2MTQ A;  4P0A A;  2UUA T;  3IEE A;  2HPJ A;  3OYX A;  4YHH T;  2FJB A;  2NR4 A;  4EZ4 A;  3PJA A;  5FNV E;  2IC6 A;  4Q25 A;  3AE7 A;  4TUY E;  5IUX A;  3MA9 A;  4QKN A;  3WI3 A;  4IST A;  3VKH A;  2DL1 A;  4GYR A;  2H89 A;  1UX4 A;  1W0B A;  4HFE A;  3RHW A;  2KZ7 B;  2IW5 B;  2VK9 A;  5AFU L;  2YU1 A;  3CWZ B;  4DR3 T;  2RA1 A;  3Q5X A;  2BKN A;  4AKI A;  3AE1 A;  4X20 E;  4DR1 T;  4UVA B;  5L3F B;  3N9P A;  2JJ9 A;  2X9Y A;  3MK7 C;  4WBO A;  3ZMS B;  3T1H T;  1W09 A;  3N2G E;  1WYC A;  4L9I A;  2VWA A;  4EYU A;  4NPP A;  2WDQ A;  5LA6 E;  5LXT E;  3L09 A;  3ZMT B;  3ZT6 A;  3CKD A;  2V7K A;  3F31 A;  4DBR A;  4ILB A;  1D0X A;  3AAA B;  3D0T A;  2IUB A;  2J62 A;  1SUM B;  4YHJ A;  2EHO B;  2D0T A;  4FJO A;  5A1L A;  1IBK T;  3TLV A;  1I6Z A;  4CQI A;  2PTF A;  1KEY A;  4PK5 A;  4X1K E;  4JI2 T;  4JI7 T;  3N9Q A;  3PTR B;  4OYK A;  3ZN1 B;  4EED A;  2ZLY A;  2Y48 B;  2ZMA A;  3QK6 A;  3ZCJ A;  1CHU A;  3ANW A;  4DV0 T;  4AKG A;  2IHR 1;  3LK2 B;  4YY3 T;  2A2F X;  2KWH A;  3ZMZ B;  5ADX L;  4I4T E;  3NKZ A;  2LSK A;  4HWD A;  4TV8 E;  4IDN A;  2JQH A;  3SRZ A;  5DJQ C;  3RKO A;  3MJX A;  5JDH A;  5HEG A;  4O2A E;  1VRB A;  4DMW A;  2CCQ A;  4IGU A;  1MMD A;  3UUX B;  4N78 D;  5IHY A;  2KMF A;  3C98 B;  4H9O C;  3CX6 B;  5F3J A;  5FL1 A;  2EHO C;  5LB7 B;  4YT0 A;  4PJJ A;  3CQX C;  3HR0 A;  3LBX B;  4IDQ A;  4DV5 T;  3I9Y A;  3PUZ F;  4IE4 A;  5IWA T;  1XMQ T;  3FBZ A;  4JYA T;  3RIF A;  2QGS A;  2WDV A;  3P50 A;  2YU2 A;  1YQ4 A;  4HFD A;  3ZMV B;  3O1H A;  5AQR B;  1KNZ A;  1ZP0 A;  3RIU A;  1KNP A;  4AQG A;  3EAM A;  5AQN B;  5ABE A;  5L2L A;  3ETV A;  5AQL B;  1MIY A;  4CXW A;  4H9Q C;  3GA8 A;  3UU5 A;  2W63 A;  4O4L E;  1BR4 A;  2E5V A;  2Z6E A;  2L9Q A;  4HKA A;  3NRX A;  3QOF A;  4PJL A;  2NOX A;  5JDQ A;  2E2A A;  4P1N A;  3L8R A;  1US7 B;  1UUS A;  3CIR A;  4KMC A;  2UXB T;  3LK4 2;  3K3O A;  5JRC B;  3AAI A;  2XAF B;  3PU3 A;  1FEW A;  2CHN A;  2Y8D A;  3TLS A;  3A8Y C;  5C3J A;  4H9P C;  2HN2 A;  4MBQ A;  1IAP A;  4L0R A;  2CWO A;  4DR4 T;  2CXL A;  2XQ8 A;  4TWD A;  3RX6 A;  4KX6 A;  2V26 A;  4IL9 A;  2Q9Q B;  4LF4 T;  5L4H A;  5CB4 E;  1HF8 A;  5LHG B;  3HKC E;  5CA0 E;  5LP6 E;  4GYS A;  4LF7 T;  2D9D A;  1HCI A;  4YFS A;  5HXH A;  4U72 A;  1VCS A;  4LML A;  4ZXL A;  4I55 E;  4OK0 A;  2LOP A;  2GK9 A;  5LOV E;  1IBM T;  4HWC A;  4M1P A;  3KV5 A;  5EZY E;  4P09 A;  5AQO B;  3QNU A;  1JNZ A;  3CX8 B;  3Q5E A;  4HFV A;  5CJ5 A;  3RRC A;  1B7T A;  2R6G F;  4GK5 E;  5AQU B;  3IF8 B;  4DV4 T;  1MIW A;  3FB2 A;  1XNR T;  5HWX A;  4O4J E; 
#chains in the Genus database with same CATH homology
 1WCR A;  4U7Y A;  2JQK A;  2LRK A;  2A9U A;  2V6Y B;  4ZEY A;  1WR0 A;  1WFD A;  5CGM A;  4U33 A;  4U2Y A;  2V6Y A;  4P1N A;  4WZX A;  2CPT A;  4A5X A;  3ZT6 A;  2CRB A;  2W2U A;  3ZT7 A;  5CJ5 A;  3K1S A;  2WWV A;  3ZSS A;  4NIQ A;  3ZT5 A;  4U2Z A;  2JQ9 A;  4CN6 A;  1YXR A;  2MPK A;  5FVK A;  4CN1 A;  2WY2 A;  3EAB A;  5FVL A;  3ZST A;  4IT4 A;  5LB7 B;  2JQH A;  4CN4 A;  2V6X A;  2K3W A;  2RPA A;  4U3C A;  2DL1 A;  2XZE A;  4U7I A;  2LRL A;  4U31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...