5FVLA

Crystal structure of vps4-vps20 complex from s.cerevisiae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvlA00
5FVLA 4ZEYA 4U33A 4U31A 4U7IA 2V6XA 2XZEA 2JQHA 4P1NA 2W2UA 2RPAA 1YXRA 4CN4A 4CN1A 3ZT6A 4NIQA 2A9UA 3ZT7A 2V6YB 5LB7B 2LRLA 3ZSSA 5CJ5A 2V6YA 4IT4A 2JQ9A 2K3WA 5FVKA 4A5XA 4CN6A 1WFDA 2CPTA 5CGMA 2WY2A 4U2ZA 2CRBA 3K1SA 2WWVA 3ZT5A 3EABA 3ZSTA 2DL1A 1WCRA 4U2YA 2JQKA 4WZXA 2MPKA 4U3CA 2LRKA 1WR0A 4U7YA
chains in the Genus database with same CATH superfamily
4JLEA 2DWGA 3KVBA 4F6RC 1BR1A 3JC6C 2CLYB 4L0RA 2J4GA 4I4TE 5FL0A 2YKSA 3CIRA 4PW8A 2C0SA 4O4JE 4EGWA 3O1IA 4DR1T 3AB3B 3QUJA 4FJOA 4TUYE 1XMQT 4B3RT 4IHJE 4EXTA 5FYMA 3AA6B 3ZYKA 4C91A 4WBNE 1D0YA 3GMIA 3P7IA 4QKNA 1VCSA 2FJAA 5HEHA 2E5VA 2YDSA 2DNXA 3ZEFB 3AXJA 5FXXA 4YSZA 3C4WA 1NENA 1HX1B 3I0QA 2X0LB 1CUNA 3A7MA 4CI2B 2N1GA 4LF7T 5C3JA 1HNZT 3UTKA 2VKDA 3AE3A 2H7OA 2XAJB 5AQSB 4ZS3A 1S35A 4HKAA 4Q25A 5JDLA 2W61A 3RRWA 1JNZA 2CBJA 3N2KE 3UUXB 1ZEEA 3DJBA 1IBLT 3E08A 2QA7A 3NRXA 1BR2A 2LSIA 3AEDA 4ILCA 2ZM6T 4LFCT 2X0HA 4MHCA 3ZCIA 4DV0T 2E8IA 4U31A 4DV3T 3MACA 2EHOB 3FZLB 2LKGA 3AAEB 3JAEA 1H7CA 3O1HA 4YLHA 1XZYA 2Q9QC 2ACZA 3PUYF 3RYCE 5CA1E 4LF4T 2V8SV 5JRCA 1X79A 2KXPB 3LDQB 2CLYC 3RH3A 3AXJB 3I0OA 4X1YE 3HR0A 4DMVA 1YKHB 3KINB 4LMKA 2IC6A 4ZS2A 1HR0T 5HCMA 3L09A 4IT4A 3UT5E 4CN6A 2LSYA 5KX5E 5L3DB 2X66A 3PUVF 3PUSA 3FB2A 4UF0A 3C64A 1U5PA 1Y64B 2DL1A 4B3TT 1KEYA 2Y6XA 2BG9C 4QWNB 2CBIA 4U72A 5CB4E 1BR0A 4X20E 1KF6A 3EAMA 2K24A 1JNRA 2KSRA 2LOSA 4CXYA 2X0YA 1R8IA 4HWDA 4ZEYA 1Z0PA 5LHGB 1LVFA 3N9QA 4ZZCA 3PURA 3U78A 2WWUA 3UU8A 2NP9A 3ZJ1A 3AAIA 4AKHA 2BS3A 2LM2A 2EHOC 3IA3A 3K8PC 3CMLA 4HWCA 1MNDA 2BVLA 2UU9T 4AXPA 5LBQB 1L0VA 4ILAA 4NIQA 3ZMVB 5AQTB 4IREA 3FZKB 4DMWA 4YTNA 4AQGA 4IDPA 3LK2B 5L3EB 1WFDA 3Q5EA 1NEKA 2Q9QD 3K3QC 4TNWA 4U2ZA 2NW9A 2CA5A 2VL0A 3CX6B 3KBUA 4PFPA 3ZT5A 4ZI7E 2XJ7A 2WU2A 3HKDE 2IUBA 1US7B 5JDNA 2IHR1 1ZOYA 4KHZF 4X62T 2MAWA 2X9HA 3P4RA 2XTLA 4XZCA 5HEUA 3RKGA 2LRKA 3VRAA 3X1DA 5LG4A 3LFMA 5L3GB 3JC6D 4B3ST 3G06A 5JDMA 2W67A 4H9QC 4WBOA 1D1AA 2XZEA 4WYVA 4H63H 3DP7A 4GYSA 3IBPA 5M4YA 3ANWA 1YXRA 2JMHA 2UXNB 2WDVA 3HKEE 3N9MA 1QUUA 3EUHA 4HFEA 2LHNA 3CX8B 5AQLB 4X66T 2B76A 4IE6A 1SA0E 2KNDA 2NWBA 4ISSA 5TAOA 4KMCA 4KBMB 5E0OA 3RYHE 3UFEA 5J2UE 3MJXA 3UFGA 1IBMT 2H7VC 2BBHA 2FJEA 3RQUA 2K3WA 3C50A 3PUQA 3TLSA 3ZMTB 4AKLA 5C8YE 2NOXA 2A3DA 2CM0A 3AEEA 3OPCA 5ADXL 4IDNA 4KI0F 2XQ6A 2PJQA 3ZLIA 3S4UA 3R6NA 2XAFB 4LF9T 2FJBA 1IJ5A 2HN1A 2JQKA 2W66A 3LK3B 3PE0A 4HFHA 4ZXLA 5LGUB 4EV6A 4K0UA 3R84B 2R6GF 3MK7C 5L3FB 5J0ZA 4ZZBA 1LRZA 5HWYA 2H3RA 3ZKRA 2ZLYA 2LJLA 4O4HE 5FY1A 4A97A 5JTGA 3AA0B 2BKOA 4YXDA 2CHNA 3AECA 2K48A 3MXZA 3RIUC 4AKRB 3RHWA 4DV4T 5LJNA 1Y01A 2I0MA 3N2GE 4HGAA 3AVSA 5JVDE 4BA9A 3RRCA 3QK6A 4QXHB 4EYYR 3PV0F 4GK5E 1WR6A 2EHOA 2ES0A 2WSSV 2HHHT 4JI4T 2X51A 5HYAA 2QYWA 1HG5A 3F57A 3U3IA 4H9PC 2J1DG 3C4XA 1AJ3A 4I0UA 2QVAA 3H3AA 4LF6T 2CXFA 3F2EA 3TLTA 3ZYMA 2IDOB 3FHNA 1MMNA 4OHFA 2Y8DA 3KDSE 2VKJA 2X68A 2E9XA 3MZKB 3ZPOA 4JI1T 2FJDA 2LKHA 3KFWX 3RX6A 3NRYA 2KT9A 4AQFA 4IDQA 4EZ4A 3Q5XA 4TWDA 4AQYT 3GWHA 4OK0A 4PJJA 1YQ3A 2C5IT 4O2BE 3LBXA 5DJQC 3SS1A 4EEDA 1G73A 1ZKEA 3KV4A 2XPKA 3W15B 3UUNA 4EB6E 5LGTB 3HA4A 4HWFA 3WI3A 4HWHA 2XUEA 2F4VT 4KP3C 1ZP0A 4JBWF 1J5WA 2CMRA 2ZM0A 3AEAA 3F31A 3K3OA 4O2AE 5AQGB 2BKNA 4LMLA 1WLXA 2BG9A 2LM9A 3BK9A 3OVUA 4JEHB 4PNIA 3VR9A 3ZSSA 3OTOT 2XQ8A 4Z90A 2RP4A 2I6HA 2NW8A 4AKIA 4Z8XA 4LF8T 2K9AA 3HL6A 4QX8B 5AQVB 3O1JA 5LP6E 4JI8T 3BQIA 3TKLB 5AQUB 2WAUA 1O3XA 1WYBA 2WZIA 3EHZA 3C51A 4UVCB 3ZMZB 3RC8A 3E0ZA 3T1HT 2UUCT 4DR6T 4ILUA 3FZFB 4IL9A 2HH7A 3T1YT 4F8HA 2DLRA 5FVLA 3CK6A 4HEAA 4PK5A 3QB5K 1KNPA 1EZ3A 5LMNT 1T8BA 2LOPA 4UEMA 5AQNB 2XAQB 5FY7A 4CQIA 3AEGA 1N36T 2QRXA 3ZYLA 4IDZA 4DUYT 2VVSA 3P4SA 3RIUA 4MALA 3CQGB 4C90A 2BG9B 2UXBT 4DV2T 3ZT7A 3MA9A 3NZPA 1KNRA 3OYXA 5L4EA 4TX5A 1D0ZA 2V6YA 5EZYE 3VHLA 4AKGA 3BQKA 2YDRA 3ANWB 3M3ZB 4X1IE 2CWOA 3LG7A 4EZHA 2XM1A 4IE4A 3PTRB 4IIJE 4A56A 4DR3T 3UU5A 5L47A 4P0AA 2V7LA 4DV7T 4OYJA 2CCQA 4U7YA 4TZ4C 5JR9C 2VASA 3ESLA 5JREA 4NUVA 2ACXA 5EK4A 5J1GA 5L4HA 4JI7T 3P8CD 2CHOA 2OLTA 2NR4A 2BS2A 3Q5DA 3T8OA 4A98A 4E7SA 2E2AA 3DTOA 2FBWA 5KXJA 2W2UA 3RC3A 1I6ZA 2XAHB 4ERRA 5HAXA 1HNXT 2J47A 3PJAA 3AA7B 4TWHA 3RIAA 3AA1B 4CN4A 2B1EA 4GKJT 2IAKA 2V5DA 4IGUA 4L9IA 1HCIA 3JADA 4GK0E 3RLFF 4O4LE 2VQFT 3AEBA 5JDFA 2V6YB 4P09A 5AQMB 3ZN1B 3TLVA 1NWMX 5H6RB 3OBVE 2BVMA 4V1Av 3UUMA 5DQVA 3UU6A 1HNWT 3ZSTA 4IE0A 3K3NA 4IDOA 4ANJA 1V9DA 1HFAA 2Z6EA 3D0TA 3L39A 4G63A 4U2YA 5AQJB 5LOVE 3Q9DA 3VRBA 5BR8T 2L9QA 2V5CA 4CI3B 2LLYA 1HG2A 1Z8UA 3OJAA 5LMUT 1HS7A 4L5GA 4YHJA 2BDEA 1ZHCA 3I1AA 2RA1A 3ZC0A 1E2AA 3AE8A 1M62A 3M65A 5F5WA 2V7KA 3AEFA 2KMFA 4X5TA 4AIUA 2BBJA 5HEOA 1XMOT 3RYFE 5DQWA 4DUZT 4H9RC 4ZI3D 2VKOA 4O4IE 3UULA 5JDGA 4JI5T 5DABA 1YD8G 2JIWA 2XM2A 5FXZA 1FEWA 1ZV4X 2WZHA 4IE5A 2XAGB 1KFYA 1E1HB 5JDQA 3H37A 2E5LT 4IL4A 4COFA 2JJ9A 4YJ2E 4YSXA 3UUBA 1CHUA 2EHOD 2P9BA 3AE4A 5LNKA 2Q9QB 4DBRA 4WZXA 3AE1A 4UIGA 3NKZA 1MIVA 2PFVA 2UUAT 4PAGA 4HN9A 4ASKA 1XNQT 4NUUA 3VU7H 4CI1B 4EIWA 2V6XA 3SWHA 2V26A 3AE5A 1UGOA 3EI0A 4HFBA 2XQ5A 2E9XD 5AQIB 3TLUA 4ZI2D 2KWIB 3L8RA 4JYAT 4JUYA 2YK0A 3AVRA 4GKKT 1MMGA 3SRZA 5AQKB 1D1CA 2LSKA 2VL8A 5HWXA 1KK7A 3IEEA 5L3BB 4X64T 4DR2T 2MOZA 2UXCT 3KBTA 4DR5T 3IHRA 2DCFA 3QOFA 3JAFA 2V1DB 2WP9A 5LB7B 2E9XB 4QX7B 1VOMA 3RPUA 5CJ5A 5F3JA 1OEDA 3OYZA 2VB6A 3N9LA 2C5JA 3NVOA 4DBQA 2YINA 4DR7T 3AE2A 4H9OC 2XASB 5AQOB 1WCRA 2YN6A 2DI4A 2IIUA 1GQEA 2YEVC 3HKBE 5HEGA 5HCJA 5LCYA 3RGLA 3ZJ2A 2ZMAA 3OKQA 2W4XA 5ABFB 4DV1T 2UUBT 1XDPA 5FL1A 5KDMC 4PJLA 3J7Yq 3B13A 3AE9A 2A2FX 2XQ4A 2LHRA 2XQ7A 4PFOA 3UQ4A 3MKDA 2XQAA 4PJMA 4ZHQE 3WAKA 2UXXB 3RKOA 1SHZC 4JI3T 4NXMT 1XNRT 2L3LA 3O4XE 4YT0A 3WAJA 4Z91A 2BKPA 1UK5A 2V7MA 3JCFA 3BQLA 3FBLA 2XQ3A 5ABHA 3FXDB 2H88A 2NTYA 3NZQA 5FP3A 2WB5A 3ABVA 2GK9A 2XQ9A 4NPPA 5HXCA 4A5XA 2E9XC 4XBFB 1QSDA 2CRBA 1J5ET 1J1JA 2WWVA 2PG8A 4EYUA 2WS3A 3FXEB 5AQHB 2AE9A 2W62A 3ETUA 5LA6E 2LSJA 4I50E 2Y48B 4CXXA 3PU3A 1IZNB 4DR4T 4YTPA 2IC9A 2XQYA 5ABFA 1FIOA 1WR0A 5FKYA 3SOLA 2AXDS 5HEJA 3EDUA 4UR9A 2M6IA 4PJNA 1N34T 2V7JA 2WBLA 1FMVA 2IMLA 3SFEA 2VQET 2ODUA 4EAHA 4GOUA 2JPFA 3CX7B 2ODVA 3L3PA 1BR4A 4ISTA 5A1LA 5J2TE 2OA5A 5C2TA 4CN1A 3CVRA 3V5UA 3FZMB 2CEAA 4KX6A 1HTJF 3I9YA 4UV9B 5IYZE 2VVNA 3KVAA 4HFCA 3ONXA 3P4QA 4P0BA 2D9DA 3CPZA 5IHYA 5JH7E 1MNEA 4TN7B 2ZM8A 2LE8A 3QB5A 3H3MA 3UU4A 4LFBT 4LMJA 4BAYB 4CZZB 4QHOA 4X65T 4AISA 1IBKT 5LBMA 2H89A 4O8SA 2KLQA 3C4ZA 3PUWF 4YTMA 5LYJE 2NW7A 4M1PA 4DV5T 2LEHA 2WQYA 3P50A 4OYKA 4U7IA 4ADZA 5IWAT 2XHEB 4DNDA 5FY0A 2JQHA 4U74A 4DVDA 2G0UA 4PK6A 4DIDB 3ZMUB 1KNZA 2V7IA 1D0XA 4IE7A 2XY8B 3PUZF 4YHHT 4XAXB 3LBXB 4N78D 4B3MT 4HFIA 3EVYA 3UQ7A 1MMDA 2A72A 2D5UA 4NXNT 3LSVA 3QNUA 3TLWA 4K0KT 4LFAT 2A9UA 4DV6T 1WYCA 3CKDA 4I55E 5JDHA 1HF8A 1UX4A 2VURA 4E7ZA 3AE7A 2CWYA 1T7SA 2D2SA 2PTFA 3K1SA 2W00A 5KMGP 2C5KT 4YY3T 4JI0T 2OV9A 2N2NA 4QH5A 5FNVE 2IW5B 3VKGA 1OXZA 1FMWA 3N5LA 4JEUB 3Q2MA 3CWZB 3N9PA 2MPKA 2BG9E 2WU5A 4JI6T 2X9XA 2YU1A 2HPJA 3HKCE 3ONLC 2K5BB 4DO0A 1LKXA 1T72A 1OEDB 3VKHA 4HTEA 2D0TA 2XSBA 3O9XA 4P1NA 4HFVA 3A8YC 4ILBA 5LJMA 2M67A 3KV5A 4TV9E 1S94A 1U4QA 1T98A 2SPCA 3AE6A 3N9OA 4WNKA 4X1KE 4OX9T 1UX5A 1W0AA 4H9SE 3QC9A 2WMNA 3GN5B 3ZT6A 5HXEA 2YDQA 3ZCJA 3J9X1 2X9YA 3LJCA 4KUMB 2WCAA 3AAAB 2JQ9A 2VWAA 3E22E 3FZHB 3PDYA 5FVKA 2JMKA 5AQPB 5FXWA 3UU3A 3N9NA 3LK42 1MIWA 4QXBB 4TV8E 5LHHB 3FBZA 1IAPA 5FMNA 3P4WA 5CA0E 4UV8B 3VR8A 4HE8A 1VRBA 5BMVE 1FJGT 4JV5T 3RYIE 1N32T 1LVKA 2WMOA 3P4PA 2NTXA 5GONE 5JRCB 3Q5WA 2MBGA 2W63A 4U3CA 4UVAB 4JI2T 4YSYA 1N33T 1WRDA 3KV6A 3PUXF 4U33A 4QH1A 4H63V 2D0UA 3PJAJ 2FUPA 1W0BA 2YU2A 1W09A 2QGSA 2LSGA 4BJMA 5CFBA 2RPAA 2BS4A 5FXVA 5HXRA 3IF8B 4UVBB 2DWKA 2X67A 2CXDA 4ZI2C 5LXTE 4J2CA 4UF0B 1E7PA 5AFUL 2HN2A 1XDOA 1SUMB 2N9DA 4TWFA 3GN5A 4QH4A 4OFZA 2MTQA 3C98B 3GA8A 2W0GA 3NWIA 3RIFA 5ABGA 2JQQA 1OEDE 2VK9A 4BJNA 5EK2A 2MYSA 5HXSA 4H9NC 5JQGE 1IJ6A 4CXWA 2CPTA 4LF5T 1OEDC 4PK4A 2BZBA 2KWHA 3ONJA 5ABEA 1OWAA 1QLBA 1B7TA 2L8KA 3A5XA 3ETVA 3ZMSB 1YW0A 2CE7A 5JR9A 3I9WA 3ZC1A 1UCUA 2LT3A 5L2LA 2UXDT 4YJ3E 3RQWA 4HFDA 3EABA 1MIYA 1VCTA 2WDRA 2WDQA 2CXLA 3B5MA 5AQQB 5F8PA 1HX8A 5LG3A 3V5SA 5HXHA 4TNVA 4MBQA 3B57A 5IUXA 2ZM2A 3HI2A 1I94T 3PU8A 5LGNB 2VKHA 4WW0A 4EOZB 2PBIA 3CQCB 1G8XA 2KINB 4MFRA 4QXCB 4FI5A 3PUGA 4HWIB 4YFSA 3RF1A 3RI5A 4B6XA 1MMAA 1DU2A 1UURA 2YOEA 4UXNB 5AQRB 2I59A 1W9RA 2JRKA 4AQFC 4MLKA 5ETWA 4EEBA 4ZOLE 1YKEB 3PUAA 5LHIB 1SE7A 3SFDA 2LRLA 1NAFA 5CGMA 5AQFB 1YQ4A 1XWMA 4ZI3C 2KZ7B 2WY2A 2X9WA 5EK3A 4UELA 4AI6A 2DHRA 3KV9A 2J62A 4GYRA 2HPLA 2XSAA 3NBXX 5H6QB 5JR9B 2M6BA 1D1BA 2WM9A 3CQXC 3ZN0B 1UUSA 3N2OA 2Q9QA 3EDVA 4G2AA 1X9BA 1M7KA 5L3CB 4KHPT 4GIWA 4I43B
chains in the Genus database with same CATH topology
5FVLA 4ZEYA 4U33A 4U31A 4U7IA 2V6XA 2XZEA 2JQHA 4P1NA 2W2UA 2RPAA 1YXRA 4CN4A 4CN1A 3ZT6A 4NIQA 2A9UA 3ZT7A 2V6YB 5LB7B 2LRLA 3ZSSA 5CJ5A 2V6YA 4IT4A 2JQ9A 2K3WA 5FVKA 4A5XA 4CN6A 1WFDA 2CPTA 5CGMA 2WY2A 4U2ZA 2CRBA 3K1SA 2WWVA 3ZT5A 3EABA 3ZSTA 2DL1A 1WCRA 4U2YA 2JQKA 4WZXA 2MPKA 4U3CA 2LRKA 1WR0A 4U7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVL A;  4ZEY A;  4U33 A;  4U31 A;  4U7I A;  2V6X A;  2XZE A;  2JQH A;  4P1N A;  2W2U A;  2RPA A;  1YXR A;  4CN4 A;  4CN1 A;  3ZT6 A;  4NIQ A;  2A9U A;  3ZT7 A;  2V6Y B;  5LB7 B;  2LRL A;  3ZSS A;  5CJ5 A;  2V6Y A;  4IT4 A;  2JQ9 A;  2K3W A;  5FVK A;  4A5X A;  4CN6 A;  1WFD A;  2CPT A;  5CGM A;  2WY2 A;  4U2Z A;  2CRB A;  3K1S A;  2WWV A;  3ZT5 A;  3EAB A;  3ZST A;  2DL1 A;  1WCR A;  4U2Y A;  2JQK A;  4WZX A;  2MPK A;  4U3C A;  2LRK A;  1WR0 A;  4U7Y A; 
#chains in the Genus database with same CATH topology
 4JLE A;  2DWG A;  3KVB A;  4F6R C;  1BR1 A;  3JC6 C;  2CLY B;  4L0R A;  2J4G A;  4I4T E;  5FL0 A;  2YKS A;  3CIR A;  4PW8 A;  2C0S A;  4O4J E;  4EGW A;  3O1I A;  4DR1 T;  3AB3 B;  3QUJ A;  4FJO A;  4TUY E;  1XMQ T;  4B3R T;  4IHJ E;  4EXT A;  5FYM A;  3AA6 B;  3ZYK A;  4C91 A;  4WBN E;  1D0Y A;  3GMI A;  3P7I A;  4QKN A;  1VCS A;  2FJA A;  5HEH A;  2E5V A;  2YDS A;  2DNX A;  3ZEF B;  3AXJ A;  5FXX A;  4YSZ A;  3C4W A;  1NEN A;  1HX1 B;  3I0Q A;  2X0L B;  1CUN A;  3A7M A;  4CI2 B;  2N1G A;  4LF7 T;  5C3J A;  1HNZ T;  3UTK A;  2VKD A;  3AE3 A;  2H7O A;  2XAJ B;  5AQS B;  4ZS3 A;  1S35 A;  4HKA A;  4Q25 A;  5JDL A;  2W61 A;  3RRW A;  1JNZ A;  2CBJ A;  3N2K E;  3UUX B;  1ZEE A;  3DJB A;  1IBL T;  3E08 A;  2QA7 A;  3NRX A;  1BR2 A;  2LSI A;  3AED A;  4ILC A;  2ZM6 T;  4LFC T;  2X0H A;  4MHC A;  3ZCI A;  4DV0 T;  2E8I A;  4U31 A;  4DV3 T;  3MAC A;  2EHO B;  3FZL B;  2LKG A;  3AAE B;  3JAE A;  1H7C A;  3O1H A;  4YLH A;  1XZY A;  2Q9Q C;  2ACZ A;  3PUY F;  3RYC E;  5CA1 E;  4LF4 T;  2V8S V;  5JRC A;  1X79 A;  2KXP B;  3LDQ B;  2CLY C;  3RH3 A;  3AXJ B;  3I0O A;  4X1Y E;  3HR0 A;  4DMV A;  1YKH B;  3KIN B;  4LMK A;  2IC6 A;  4ZS2 A;  1HR0 T;  5HCM A;  3L09 A;  4IT4 A;  3UT5 E;  4CN6 A;  2LSY A;  5KX5 E;  5L3D B;  2X66 A;  3PUV F;  3PUS A;  3FB2 A;  4UF0 A;  3C64 A;  1U5P A;  1Y64 B;  2DL1 A;  4B3T T;  1KEY A;  2Y6X A;  2BG9 C;  4QWN B;  2CBI A;  4U72 A;  5CB4 E;  1BR0 A;  4X20 E;  1KF6 A;  3EAM A;  2K24 A;  1JNR A;  2KSR A;  2LOS A;  4CXY A;  2X0Y A;  1R8I A;  4HWD A;  4ZEY A;  1Z0P A;  5LHG B;  1LVF A;  3N9Q A;  4ZZC A;  3PUR A;  3U78 A;  2WWU A;  3UU8 A;  2NP9 A;  3ZJ1 A;  3AAI A;  4AKH A;  2BS3 A;  2LM2 A;  2EHO C;  3IA3 A;  3K8P C;  3CML A;  4HWC A;  1MND A;  2BVL A;  2UU9 T;  4AXP A;  5LBQ B;  1L0V A;  4ILA A;  4NIQ A;  3ZMV B;  5AQT B;  4IRE A;  3FZK B;  4DMW A;  4YTN A;  4AQG A;  4IDP A;  3LK2 B;  5L3E B;  1WFD A;  3Q5E A;  1NEK A;  2Q9Q D;  3K3Q C;  4TNW A;  4U2Z A;  2NW9 A;  2CA5 A;  2VL0 A;  3CX6 B;  3KBU A;  4PFP A;  3ZT5 A;  4ZI7 E;  2XJ7 A;  2WU2 A;  3HKD E;  2IUB A;  1US7 B;  5JDN A;  2IHR 1;  1ZOY A;  4KHZ F;  4X62 T;  2MAW A;  2X9H A;  3P4R A;  2XTL A;  4XZC A;  5HEU A;  3RKG A;  2LRK A;  3VRA A;  3X1D A;  5LG4 A;  3LFM A;  5L3G B;  3JC6 D;  4B3S T;  3G06 A;  5JDM A;  2W67 A;  4H9Q C;  4WBO A;  1D1A A;  2XZE A;  4WYV A;  4H63 H;  3DP7 A;  4GYS A;  3IBP A;  5M4Y A;  3ANW A;  1YXR A;  2JMH A;  2UXN B;  2WDV A;  3HKE E;  3N9M A;  1QUU A;  3EUH A;  4HFE A;  2LHN A;  3CX8 B;  5AQL B;  4X66 T;  2B76 A;  4IE6 A;  1SA0 E;  2KND A;  2NWB A;  4ISS A;  5TAO A;  4KMC A;  4KBM B;  5E0O A;  3RYH E;  3UFE A;  5J2U E;  3MJX A;  3UFG A;  1IBM T;  2H7V C;  2BBH A;  2FJE A;  3RQU A;  2K3W A;  3C50 A;  3PUQ A;  3TLS A;  3ZMT B;  4AKL A;  5C8Y E;  2NOX A;  2A3D A;  2CM0 A;  3AEE A;  3OPC A;  5ADX L;  4IDN A;  4KI0 F;  2XQ6 A;  2PJQ A;  3ZLI A;  3S4U A;  3R6N A;  2XAF B;  4LF9 T;  2FJB A;  1IJ5 A;  2HN1 A;  2JQK A;  2W66 A;  3LK3 B;  3PE0 A;  4HFH A;  4ZXL A;  5LGU B;  4EV6 A;  4K0U A;  3R84 B;  2R6G F;  3MK7 C;  5L3F B;  5J0Z A;  4ZZB A;  1LRZ A;  5HWY A;  2H3R A;  3ZKR A;  2ZLY A;  2LJL A;  4O4H E;  5FY1 A;  4A97 A;  5JTG A;  3AA0 B;  2BKO A;  4YXD A;  2CHN A;  3AEC A;  2K48 A;  3MXZ A;  3RIU C;  4AKR B;  3RHW A;  4DV4 T;  5LJN A;  1Y01 A;  2I0M A;  3N2G E;  4HGA A;  3AVS A;  5JVD E;  4BA9 A;  3RRC A;  3QK6 A;  4QXH B;  4EYY R;  3PV0 F;  4GK5 E;  1WR6 A;  2EHO A;  2ES0 A;  2WSS V;  2HHH T;  4JI4 T;  2X51 A;  5HYA A;  2QYW A;  1HG5 A;  3F57 A;  3U3I A;  4H9P C;  2J1D G;  3C4X A;  1AJ3 A;  4I0U A;  2QVA A;  3H3A A;  4LF6 T;  2CXF A;  3F2E A;  3TLT A;  3ZYM A;  2IDO B;  3FHN A;  1MMN A;  4OHF A;  2Y8D A;  3KDS E;  2VKJ A;  2X68 A;  2E9X A;  3MZK B;  3ZPO A;  4JI1 T;  2FJD A;  2LKH A;  3KFW X;  3RX6 A;  3NRY A;  2KT9 A;  4AQF A;  4IDQ A;  4EZ4 A;  3Q5X A;  4TWD A;  4AQY T;  3GWH A;  4OK0 A;  4PJJ A;  1YQ3 A;  2C5I T;  4O2B E;  3LBX A;  5DJQ C;  3SS1 A;  4EED A;  1G73 A;  1ZKE A;  3KV4 A;  2XPK A;  3W15 B;  3UUN A;  4EB6 E;  5LGT B;  3HA4 A;  4HWF A;  3WI3 A;  4HWH A;  2XUE A;  2F4V T;  4KP3 C;  1ZP0 A;  4JBW F;  1J5W A;  2CMR A;  2ZM0 A;  3AEA A;  3F31 A;  3K3O A;  4O2A E;  5AQG B;  2BKN A;  4LML A;  1WLX A;  2BG9 A;  2LM9 A;  3BK9 A;  3OVU A;  4JEH B;  4PNI A;  3VR9 A;  3ZSS A;  3OTO T;  2XQ8 A;  4Z90 A;  2RP4 A;  2I6H A;  2NW8 A;  4AKI A;  4Z8X A;  4LF8 T;  2K9A A;  3HL6 A;  4QX8 B;  5AQV B;  3O1J A;  5LP6 E;  4JI8 T;  3BQI A;  3TKL B;  5AQU B;  2WAU A;  1O3X A;  1WYB A;  2WZI A;  3EHZ A;  3C51 A;  4UVC B;  3ZMZ B;  3RC8 A;  3E0Z A;  3T1H T;  2UUC T;  4DR6 T;  4ILU A;  3FZF B;  4IL9 A;  2HH7 A;  3T1Y T;  4F8H A;  2DLR A;  5FVL A;  3CK6 A;  4HEA A;  4PK5 A;  3QB5 K;  1KNP A;  1EZ3 A;  5LMN T;  1T8B A;  2LOP A;  4UEM A;  5AQN B;  2XAQ B;  5FY7 A;  4CQI A;  3AEG A;  1N36 T;  2QRX A;  3ZYL A;  4IDZ A;  4DUY T;  2VVS A;  3P4S A;  3RIU A;  4MAL A;  3CQG B;  4C90 A;  2BG9 B;  2UXB T;  4DV2 T;  3ZT7 A;  3MA9 A;  3NZP A;  1KNR A;  3OYX A;  5L4E A;  4TX5 A;  1D0Z A;  2V6Y A;  5EZY E;  3VHL A;  4AKG A;  3BQK A;  2YDR A;  3ANW B;  3M3Z B;  4X1I E;  2CWO A;  3LG7 A;  4EZH A;  2XM1 A;  4IE4 A;  3PTR B;  4IIJ E;  4A56 A;  4DR3 T;  3UU5 A;  5L47 A;  4P0A A;  2V7L A;  4DV7 T;  4OYJ A;  2CCQ A;  4U7Y A;  4TZ4 C;  5JR9 C;  2VAS A;  3ESL A;  5JRE A;  4NUV A;  2ACX A;  5EK4 A;  5J1G A;  5L4H A;  4JI7 T;  3P8C D;  2CHO A;  2OLT A;  2NR4 A;  2BS2 A;  3Q5D A;  3T8O A;  4A98 A;  4E7S A;  2E2A A;  3DTO A;  2FBW A;  5KXJ A;  2W2U A;  3RC3 A;  1I6Z A;  2XAH B;  4ERR A;  5HAX A;  1HNX T;  2J47 A;  3PJA A;  3AA7 B;  4TWH A;  3RIA A;  3AA1 B;  4CN4 A;  2B1E A;  4GKJ T;  2IAK A;  2V5D A;  4IGU A;  4L9I A;  1HCI A;  3JAD A;  4GK0 E;  3RLF F;  4O4L E;  2VQF T;  3AEB A;  5JDF A;  2V6Y B;  4P09 A;  5AQM B;  3ZN1 B;  3TLV A;  1NWM X;  5H6R B;  3OBV E;  2BVM A;  4V1A v;  3UUM A;  5DQV A;  3UU6 A;  1HNW T;  3ZST A;  4IE0 A;  3K3N A;  4IDO A;  4ANJ A;  1V9D A;  1HFA A;  2Z6E A;  3D0T A;  3L39 A;  4G63 A;  4U2Y A;  5AQJ B;  5LOV E;  3Q9D A;  3VRB A;  5BR8 T;  2L9Q A;  2V5C A;  4CI3 B;  2LLY A;  1HG2 A;  1Z8U A;  3OJA A;  5LMU T;  1HS7 A;  4L5G A;  4YHJ A;  2BDE A;  1ZHC A;  3I1A A;  2RA1 A;  3ZC0 A;  1E2A A;  3AE8 A;  1M62 A;  3M65 A;  5F5W A;  2V7K A;  3AEF A;  2KMF A;  4X5T A;  4AIU A;  2BBJ A;  5HEO A;  1XMO T;  3RYF E;  5DQW A;  4DUZ T;  4H9R C;  4ZI3 D;  2VKO A;  4O4I E;  3UUL A;  5JDG A;  4JI5 T;  5DAB A;  1YD8 G;  2JIW A;  2XM2 A;  5FXZ A;  1FEW A;  1ZV4 X;  2WZH A;  4IE5 A;  2XAG B;  1KFY A;  1E1H B;  5JDQ A;  3H37 A;  2E5L T;  4IL4 A;  4COF A;  2JJ9 A;  4YJ2 E;  4YSX A;  3UUB A;  1CHU A;  2EHO D;  2P9B A;  3AE4 A;  5LNK A;  2Q9Q B;  4DBR A;  4WZX A;  3AE1 A;  4UIG A;  3NKZ A;  1MIV A;  2PFV A;  2UUA T;  4PAG A;  4HN9 A;  4ASK A;  1XNQ T;  4NUU A;  3VU7 H;  4CI1 B;  4EIW A;  2V6X A;  3SWH A;  2V26 A;  3AE5 A;  1UGO A;  3EI0 A;  4HFB A;  2XQ5 A;  2E9X D;  5AQI B;  3TLU A;  4ZI2 D;  2KWI B;  3L8R A;  4JYA T;  4JUY A;  2YK0 A;  3AVR A;  4GKK T;  1MMG A;  3SRZ A;  5AQK B;  1D1C A;  2LSK A;  2VL8 A;  5HWX A;  1KK7 A;  3IEE A;  5L3B B;  4X64 T;  4DR2 T;  2MOZ A;  2UXC T;  3KBT A;  4DR5 T;  3IHR A;  2DCF A;  3QOF A;  3JAF A;  2V1D B;  2WP9 A;  5LB7 B;  2E9X B;  4QX7 B;  1VOM A;  3RPU A;  5CJ5 A;  5F3J A;  1OED A;  3OYZ A;  2VB6 A;  3N9L A;  2C5J A;  3NVO A;  4DBQ A;  2YIN A;  4DR7 T;  3AE2 A;  4H9O C;  2XAS B;  5AQO B;  1WCR A;  2YN6 A;  2DI4 A;  2IIU A;  1GQE A;  2YEV C;  3HKB E;  5HEG A;  5HCJ A;  5LCY A;  3RGL A;  3ZJ2 A;  2ZMA A;  3OKQ A;  2W4X A;  5ABF B;  4DV1 T;  2UUB T;  1XDP A;  5FL1 A;  5KDM C;  4PJL A;  3J7Y q;  3B13 A;  3AE9 A;  2A2F X;  2XQ4 A;  2LHR A;  2XQ7 A;  4PFO A;  3UQ4 A;  3MKD A;  2XQA A;  4PJM A;  4ZHQ E;  3WAK A;  2UXX B;  3RKO A;  1SHZ C;  4JI3 T;  4NXM T;  1XNR T;  2L3L A;  3O4X E;  4YT0 A;  3WAJ A;  4Z91 A;  2BKP A;  1UK5 A;  2V7M A;  3JCF A;  3BQL A;  3FBL A;  2XQ3 A;  5ABH A;  3FXD B;  2H88 A;  2NTY A;  3NZQ A;  5FP3 A;  2WB5 A;  3ABV A;  2GK9 A;  2XQ9 A;  4NPP A;  5HXC A;  4A5X A;  2E9X C;  4XBF B;  1QSD A;  2CRB A;  1J5E T;  1J1J A;  2WWV A;  2PG8 A;  4EYU A;  2WS3 A;  3FXE B;  5AQH B;  2AE9 A;  2W62 A;  3ETU A;  5LA6 E;  2LSJ A;  4I50 E;  2Y48 B;  4CXX A;  3PU3 A;  1IZN B;  4DR4 T;  4YTP A;  2IC9 A;  2XQY A;  5ABF A;  1FIO A;  1WR0 A;  5FKY A;  3SOL A;  2AXD S;  5HEJ A;  3EDU A;  4UR9 A;  2M6I A;  4PJN A;  1N34 T;  2V7J A;  2WBL A;  1FMV A;  2IML A;  3SFE A;  2VQE T;  2ODU A;  4EAH A;  4GOU A;  2JPF A;  3CX7 B;  2ODV A;  3L3P A;  1BR4 A;  4IST A;  5A1L A;  5J2T E;  2OA5 A;  5C2T A;  4CN1 A;  3CVR A;  3V5U A;  3FZM B;  2CEA A;  4KX6 A;  1HTJ F;  3I9Y A;  4UV9 B;  5IYZ E;  2VVN A;  3KVA A;  4HFC A;  3ONX A;  3P4Q A;  4P0B A;  2D9D A;  3CPZ A;  5IHY A;  5JH7 E;  1MNE A;  4TN7 B;  2ZM8 A;  2LE8 A;  3QB5 A;  3H3M A;  3UU4 A;  4LFB T;  4LMJ A;  4BAY B;  4CZZ B;  4QHO A;  4X65 T;  4AIS A;  1IBK T;  5LBM A;  2H89 A;  4O8S A;  2KLQ A;  3C4Z A;  3PUW F;  4YTM A;  5LYJ E;  2NW7 A;  4M1P A;  4DV5 T;  2LEH A;  2WQY A;  3P50 A;  4OYK A;  4U7I A;  4ADZ A;  5IWA T;  2XHE B;  4DND A;  5FY0 A;  2JQH A;  4U74 A;  4DVD A;  2G0U A;  4PK6 A;  4DID B;  3ZMU B;  1KNZ A;  2V7I A;  1D0X A;  4IE7 A;  2XY8 B;  3PUZ F;  4YHH T;  4XAX B;  3LBX B;  4N78 D;  4B3M T;  4HFI A;  3EVY A;  3UQ7 A;  1MMD A;  2A72 A;  2D5U A;  4NXN T;  3LSV A;  3QNU A;  3TLW A;  4K0K T;  4LFA T;  2A9U A;  4DV6 T;  1WYC A;  3CKD A;  4I55 E;  5JDH A;  1HF8 A;  1UX4 A;  2VUR A;  4E7Z A;  3AE7 A;  2CWY A;  1T7S A;  2D2S A;  2PTF A;  3K1S A;  2W00 A;  5KMG P;  2C5K T;  4YY3 T;  4JI0 T;  2OV9 A;  2N2N A;  4QH5 A;  5FNV E;  2IW5 B;  3VKG A;  1OXZ A;  1FMW A;  3N5L A;  4JEU B;  3Q2M A;  3CWZ B;  3N9P A;  2MPK A;  2BG9 E;  2WU5 A;  4JI6 T;  2X9X A;  2YU1 A;  2HPJ A;  3HKC E;  3ONL C;  2K5B B;  4DO0 A;  1LKX A;  1T72 A;  1OED B;  3VKH A;  4HTE A;  2D0T A;  2XSB A;  3O9X A;  4P1N A;  4HFV A;  3A8Y C;  4ILB A;  5LJM A;  2M67 A;  3KV5 A;  4TV9 E;  1S94 A;  1U4Q A;  1T98 A;  2SPC A;  3AE6 A;  3N9O A;  4WNK A;  4X1K E;  4OX9 T;  1UX5 A;  1W0A A;  4H9S E;  3QC9 A;  2WMN A;  3GN5 B;  3ZT6 A;  5HXE A;  2YDQ A;  3ZCJ A;  3J9X 1;  2X9Y A;  3LJC A;  4KUM B;  2WCA A;  3AAA B;  2JQ9 A;  2VWA A;  3E22 E;  3FZH B;  3PDY A;  5FVK A;  2JMK A;  5AQP B;  5FXW A;  3UU3 A;  3N9N A;  3LK4 2;  1MIW A;  4QXB B;  4TV8 E;  5LHH B;  3FBZ A;  1IAP A;  5FMN A;  3P4W A;  5CA0 E;  4UV8 B;  3VR8 A;  4HE8 A;  1VRB A;  5BMV E;  1FJG T;  4JV5 T;  3RYI E;  1N32 T;  1LVK A;  2WMO A;  3P4P A;  2NTX A;  5GON E;  5JRC B;  3Q5W A;  2MBG A;  2W63 A;  4U3C A;  4UVA B;  4JI2 T;  4YSY A;  1N33 T;  1WRD A;  3KV6 A;  3PUX F;  4U33 A;  4QH1 A;  4H63 V;  2D0U A;  3PJA J;  2FUP A;  1W0B A;  2YU2 A;  1W09 A;  2QGS A;  2LSG A;  4BJM A;  5CFB A;  2RPA A;  2BS4 A;  5FXV A;  5HXR A;  3IF8 B;  4UVB B;  2DWK A;  2X67 A;  2CXD A;  4ZI2 C;  5LXT E;  4J2C A;  4UF0 B;  1E7P A;  5AFU L;  2HN2 A;  1XDO A;  1SUM B;  2N9D A;  4TWF A;  3GN5 A;  4QH4 A;  4OFZ A;  2MTQ A;  3C98 B;  3GA8 A;  2W0G A;  3NWI A;  3RIF A;  5ABG A;  2JQQ A;  1OED E;  2VK9 A;  4BJN A;  5EK2 A;  2MYS A;  5HXS A;  4H9N C;  5JQG E;  1IJ6 A;  4CXW A;  2CPT A;  4LF5 T;  1OED C;  4PK4 A;  2BZB A;  2KWH A;  3ONJ A;  5ABE A;  1OWA A;  1QLB A;  1B7T A;  2L8K A;  3A5X A;  3ETV A;  3ZMS B;  1YW0 A;  2CE7 A;  5JR9 A;  3I9W A;  3ZC1 A;  1UCU A;  2LT3 A;  5L2L A;  2UXD T;  4YJ3 E;  3RQW A;  4HFD A;  3EAB A;  1MIY A;  1VCT A;  2WDR A;  2WDQ A;  2CXL A;  3B5M A;  5AQQ B;  5F8P A;  1HX8 A;  5LG3 A;  3V5S A;  5HXH A;  4TNV A;  4MBQ A;  3B57 A;  5IUX A;  2ZM2 A;  3HI2 A;  1I94 T;  3PU8 A;  5LGN B;  2VKH A;  4WW0 A;  4EOZ B;  2PBI A;  3CQC B;  1G8X A;  2KIN B;  4MFR A;  4QXC B;  4FI5 A;  3PUG A;  4HWI B;  4YFS A;  3RF1 A;  3RI5 A;  4B6X A;  1MMA A;  1DU2 A;  1UUR A;  2YOE A;  4UXN B;  5AQR B;  2I59 A;  1W9R A;  2JRK A;  4AQF C;  4MLK A;  5ETW A;  4EEB A;  4ZOL E;  1YKE B;  3PUA A;  5LHI B;  1SE7 A;  3SFD A;  2LRL A;  1NAF A;  5CGM A;  5AQF B;  1YQ4 A;  1XWM A;  4ZI3 C;  2KZ7 B;  2WY2 A;  2X9W A;  5EK3 A;  4UEL A;  4AI6 A;  2DHR A;  3KV9 A;  2J62 A;  4GYR A;  2HPL A;  2XSA A;  3NBX X;  5H6Q B;  5JR9 B;  2M6B A;  1D1B A;  2WM9 A;  3CQX C;  3ZN0 B;  1UUS A;  3N2O A;  2Q9Q A;  3EDV A;  4G2A A;  1X9B A;  1M7K A;  5L3C B;  4KHP T;  4GIW A;  4I43 B; 
#chains in the Genus database with same CATH homology
 5FVL A;  4ZEY A;  4U33 A;  4U31 A;  4U7I A;  2V6X A;  2XZE A;  2JQH A;  4P1N A;  2W2U A;  2RPA A;  1YXR A;  4CN4 A;  4CN1 A;  3ZT6 A;  4NIQ A;  2A9U A;  3ZT7 A;  2V6Y B;  5LB7 B;  2LRL A;  3ZSS A;  5CJ5 A;  2V6Y A;  4IT4 A;  2JQ9 A;  2K3W A;  5FVK A;  4A5X A;  4CN6 A;  1WFD A;  2CPT A;  5CGM A;  2WY2 A;  4U2Z A;  2CRB A;  3K1S A;  2WWV A;  3ZT5 A;  3EAB A;  3ZST A;  2DL1 A;  1WCR A;  4U2Y A;  2JQK A;  4WZX A;  2MPK A;  4U3C A;  2LRK A;  1WR0 A;  4U7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...