5FVLA

Crystal structure of vps4-vps20 complex from s.cerevisiae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
b'HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvlA00
4U2ZA 2K3WA 2DL1A 3K1SA 3ZT7A 2RPAA 5LB7B 2JQ9A 4U2YA 1WR0A 4IT4A 4A5XA 5FVKA 4ZEYA 2W2UA 1WCRA 5CGMA 4U33A 4CN6A 2WWVA 4P1NA 2CRBA 3ZSTA 4WZXA 2LRKA 3EABA 2CPTA 2JQHA 2V6XA 4U7IA 1WFDA 2LRLA 4U7YA 1YXRA 3ZSSA 5CJ5A 2WY2A 4CN4A 2V6YA 2XZEA 2V6YB 4U3CA 2JQKA 4NIQA 3ZT5A 4U31A 2MPKA 5FVLA 4CN1A 3ZT6A 2A9UA
chains in the Genus database with same CATH superfamily
4U2ZA 4DIDB 2J1DG 2CHNA 2EHOC 3OJAA 4UV8B 2V7MA 4BJNA 3O4XE 2ZM0A 3AXJA 3N9OA 3WAJA 5FY0A 2W66A 3AA7B 2XAJB 3RHWA 4U3CA 3K3NA 4LF7T 3AVRA 2H3RA 3CMLA 3UQ7A 5L3CB 2RA1A 5LGUB 1ZKEA 4UR9A 4A98A 3P4PA 4OYJA 3D0TA 4TZ4C 2SPCA 3AEGA 2YK0A 3EDVA 1L0VA 4ZI3D 2LKHA 3ZLIA 4DO0A 4KI0F 2YDQA 4B3RT 1IAPA 4HFCA 5C3JA 2EHOD 3I0OA 5LA6E 4DR5T 5JR9C 3C50A 2L8KA 3KV4A 5IYZE 3ABVA 4C91A 1SHZC 4I50E 3RYIE 3BQKA 4EV6A 1W0BA 3JCFA 4TNWA 3UU6A 4AISA 1FMVA 3P50A 2IMLA 4KUMB 3NZQA 3UU4A 1W9RA 2LSGA 2MOZA 4QH5A 3AE9A 3ZN1B 1Y01A 3RF1A 3VKHA 3PUSA 4TNVA 4IT4A 2LE8A 5J1GA 2J62A 4AKLA 2CXFA 2CRBA 2DWGA 4TWHA 4WZXA 4LF9T 4IIJE 1NWMX 3TKLB 4DR7T 4ILAA 4U31A 3AB3B 3BK9A 1OWAA 3Q9DA 3VRBA 2W62A 2XAGB 3LG7A 4YHHT 2QA7A 2BS3A 4X1IE 1UX4A 4JI1T 2BS2A 2VKDA 3U3IA 2KSRA 2VWAA 5H6RB 3E22E 4P0AA 2W63A 4UIGA 3PURA 5AQPB 5GONE 2X0LB 2IAKA 2ES0A 3LBXB 3UTKA 4IDQA 1H7CA 3UUBA 3FZHB 5JDFA 4EGWA 3AAAB 2QVAA 4PJJA 4GKJT 3AEFA 2ODUA 2WMNA 5JR9B 3WI3A 4JYAT 4PFOA 3AE7A 4UVAB 3EI0A 4DR1T 1S35A 3AAEB 2BKNA 5LMUT 1J5WA 4UEMA 5AQLB 1WYBA 5CGMA 3PU8A 3WAKA 3RQUA 5FY7A 2VASA 3S4UA 4NIQA 3ZC0A 2NTYA 2HN1A 2DHRA 2PG8A 2LLYA 4YT0A 4TV9E 3RIAA 2LOSA 2K5BB 1WCRA 5JQGE 2IC6A 1IZNB 4QH1A 4CXYA 2KINB 3N9LA 3ZN0B 4JI7T 2AE9A 4CXWA 2LSYA 1D0YA 1M62A 4FI5A 4EB6E 4H9NC 3N9MA 1WYCA 2WU2A 3LBXA 2KNDA 3O1IA 2XAFB 4DR6T 4FJOA 3LK42 1UX5A 4H63H 3PUVF 4DV6T 2V7KA 5JVDE 3B5MA 4YSYA 3N2OA 5L3GB 2BBHA 2HN2A 1ZHCA 2RPAA 3NRYA 5FXVA 3EDUA 3OPCA 2Y6XA 5JR9A 1XDOA 2H88A 4TV8E 2NW9A 3ZCJA 2DCFA 2XQYA 2CPTA 4PFPA 4ZI2C 1Z0PA 3MJXA 4DR4T 4U74A 4A97A 3F31A 3AE3A 4U33A 5DJQC 3SRZA 1MNDA 4UF0B 2X0HA 4H9SE 4IL4A 5JDMA 2VVNA 2XQ6A 4X64T 2VB6A 4DV5T 5AQGB 5BMVE 3RYFE 4QXHB 2LSJA 4H9OC 3AA6B 3ZPOA 2C5IT 4AIUA 3KINB 2WB5A 2KXPB 4DNDA 5L47A 1YD8G 5L4EA 4ILUA 5LG4A 1XNQT 4I0UA 4NXMT 1D1AA 2NW8A 2VVSA 3ZSSA 4EZ4A 3J7Yq 1LVFA 4LF4T 2I6HA 5LMNT 2UU9T 3OVUA 2CWYA 5BR8T 2DL1A 2DWKA 3FB2A 1VRBA 3KV5A 2E8IA 1MMAA 2VKHA 4GYRA 1XWMA 3TLUA 2Q9QB 5HYAA 4GOUA 3KFWX 3ZYKA 1HFAA 4KBMB 5AQUB 2CMRA 2XQ9A 3ONJA 2ZLYA 3FZFB 2VQET 5DQVA 4PJMA 1WR0A 4A5XA 1HG5A 2UXBT 1MIWA 3N9NA 4LF8T 3RI5A 1Z8UA 4WBOA 2E5VA 4IGUA 5M4YA 2BBJA 4COFA 4UXNB 4AKRB 1HX8A 2IW5B 4WYVA 2V1DB 4KP3C 5JDNA 2LM9A 2JQHA 3TLVA 4KX6A 4NUVA 2CBJA 3Q2MA 4CN1A 3PV0F 2MBGA 3ZMSB 3JC6C 2X9YA 3MKDA 2K48A 3T1HT 2E5LT 5FNVE 4HEAA 5LG3A 4EXTA 5KDMC 3PJAA 3ZJ2A 3ZYLA 4NPPA 1T98A 3T8OA 2X67A 4IDPA 3RYCE 4C90A 2VURA 4L5GA 4OX9T 5IHYA 1IJ5A 3R84B 2Q9QA 3X1DA 2V6XA 5AQKB 5LYJE 2VKOA 3FXDB 5ABEA 3KVBA 3QUJA 4K0KT 2OV9A 5HAXA 4ZI7E 1ZV4X 1Y64B 4ISTA 3KBTA 1HNZT 3CQXC 3JC6D 4YLHA 2IIUA 1KNZA 5ETWA 3VR9A 2BG9E 1BR4A 2ACZA 1JNRA 2CA5A 2VL8A 2I0MA 3M3ZB 5HEUA 4QX7B 3GMIA 1OEDE 4MFRA 4QXBB 4EEDA 2LOPA 4ERRA 2QYWA 2QRXA 1IBKT 4U7YA 5IWAT 1HTJF 3LK3B 1N34T 3H3MA 1XDPA 3K1SA 3V5SA 3HA4A 3W15B 5LCYA 2CEAA 1MIVA 3HR0A 4EZHA 3AA0B 4AQGA 3EABA 4JLEA 5LP6E 1YW0A 3RC8A 3O1JA 1UURA 3RRCA 3DP7A 1HNXT 3AE8A 4TWDA 5FXXA 3L3PA 5AQIB 1B7TA 1LRZA 5DABA 2W2UA 3BQIA 1T7SA 2WWVA 3B57A 2H89A 1HNWT 3K8PC 4TWFA 2XQ5A 3SWHA 3HKEE 2E2AA 3L8RA 3ANWB 4IE4A 5H6QB 3LJCA 4OYKA 3MACA 4X1KE 3JADA 1MIYA 4IREA 1KEYA 2AXDS 4JI0T 3H37A 4HTEA 3RRWA 1QSDA 4DV3T 3AEAA 3M65A 3NKZA 5FXWA 4HFDA 3ETVA 3PU3A 3T1YT 3P7IA 3HI2A 2PTFA 2V7IA 5HXEA 2D9DA 4KMCA 1JNZA 3EUHA 3OTOT 2N9DA 2XM2A 1MMNA 4LMLA 4WBNE 3G06A 2XAHB 3CX8B 4GIWA 3RIUA 4NUUA 4HGAA 1YXRA 2XQ4A 2JQKA 3AECA 2HPJA 2JIWA 2IC9A 4JV5T 4DUZT 2F4VT 1KF6A 3BQLA 4IE5A 3E0ZA 4H9PC 5HCJA 3ZKRA 5ABHA 5LGTB 2BKOA 4B3MT 2DI4A 3CK6A 2IDOB 3UFEA 3C4WA 3N2GE 4YXDA 2WY2A 4IL9A 3A7MA 2DNXA 4G63A 5IUXA 3N9PA 4AXPA 3ZMVB 1R8IA 1X79A 4JI2T 4X62T 4PW8A 2YU2A 3AEEA 3KVAA 3ANWA 3IHRA 2UXNB 5F5WA 3PDYA 4XZCA 1SA0E 1T8BA 4O2BE 3AE4A 4G2AA 2XASB 2WZIA 2BDEA 5AQVB 5C2TA 2UUCT 1HF8A 1XNRT 3L09A 5AQRB 2WU5A 2VQFT 2LT3A 5LXTE 3Q5EA 4LMJA 4E7ZA 4X65T 1HCIA 2J4GA 3C64A 4JI3T 3EVYA 4GK5E 1ZOYA 1XMOT 2BG9B 3O1HA 1VOMA 2UXXB 1XZYA 2X51A 4IHJE 2BZBA 1VCTA 1OEDB 2XY8B 4OHFA 2C5KT 2IUBA 2XPKA 3PUAA 5LOVE 5HWYA 4NXNT 3CPZA 2YEVC 3QC9A 5DQWA 4ZOLE 2VKJA 3CIRA 2E9XB 3AEBA 3RQWA 2WM9A 1HR0T 2Q9QC 5AQNB 4H9QC 4MALA 5CA1E 3GA8A 5EK3A 2L3LA 4JI6T 2XUEA 2UUBT 3RGLA 1ZEEA 5LHIB 4AQFA 3NRXA 3AVSA 4A56A 4EOZB 1G8XA 3FXEB 1UCUA 2YOEA 4AQYT 2NOXA 3F2EA 2XHEB 4QX8B 1X9BA 2ZM6T 3QB5K 2A3DA 4X1YE 5L3BB 3VR8A 4YTPA 2WQYA 2A9UA 2CWOA 4UVCB 3ZT7A 2WMOA 5FVKA 4GKKT 2BS4A 5HXCA 4QWNB 4U7IA 4EAHA 1O3XA 4OFZA 2Q9QD 2WDRA 2V6YB 4KHZF 4PK6A 3J9X1 2C5JA 1CHUA 3AE6A 3UU8A 3C98B 3N9QA 3JAEA 4U2YA 3NVOA 4ZEYA 3IEEA 1S94A 2XJ7A 3UU5A 4ZI2D 2UXDT 4M1PA 4HWFA 2E9XA 3Q5WA 2H7OA 4YJ2E 4O4HE 3UUXB 2KMFA 5L2LA 5FL0A 4HWCA 2FUPA 3VU7H 1W0AA 4QH4A 3RLFF 3CQCB 5AFUL 2I59A 2XTLA 2KZ7B 5HEJA 3VRAA 1GQEA 4JEHB 4DR2T 2WAUA 5HCMA 2IHR1 4ZHQE 3GN5B 4Z91A 5JH7E 2FJDA 1XMQT 3AE5A 4IE0A 4UF0A 4CI2B 2YDRA 3ONLC 3ZC1A 4PK4A 3HKBE 2XAQB 3N5LA 3ZT6A 1IBLT 4B3TT 2JRKA 3PUXF 3SS1A 2LSIA 2PJQA 3RIUC 5CB4E 2ZMAA 3RIFA 4PK5A 4YTMA 4HFVA 2LHRA 5FKYA 2V6YA 1UUSA 2WDQA 2X0YA 3FBZA 1E7PA 3IBPA 4X66T 2X9XA 2ACXA 2XQ3A 4IE6A 2CBIA 4O4IE 3AXJB 3UT5E 2KWIB 5C8YE 5LBMA 4LMKA 3QOFA 2CLYB 3DJBA 3MXZA 3I1AA 2FJAA 3N2KE 2WZHA 4AKIA 1D1CA 2XQ7A 4V1Av 1I6ZA 3LDQB 3A5XA 5JRCB 2FJEA 1QLBA 1NENA 2M6BA 3FHNA 1N36T 3LSVA 3KBUA 4HFHA 3ZCIA 5J0ZA 4O4LE 4BAYB 2LHNA 3UU3A 3PUQA 3GN5A 1J5ET 4PJLA 1QUUA 4DR3T 2VK9A 2PBIA 3UULA 2N2NA 5JDQA 5LHGB 4JBWF 4LF6T 2WS3A 5L3FB 1BR1A 5HEGA 2G0UA 4ZI3C 4ANJA 4X5TA 5ABFB 3FZLB 1N33T 3I9YA 3LK2B 3OYZA 5F8PA 4I4TE 3NBXX 4CN4A 5EZYE 4CI3B 2MTQA 4IDNA 2YU1A 4H9RC 3UQ4A 3V5UA 2WCAA 1VCSA 2JPFA 4DUYT 3IF8B 5JRCA 2CM0A 1KFYA 3KV9A 4YY3T 2X68A 5LHHB 2WP9A 2JMKA 1US7B 5JDLA 4DV1T 3FBLA 1D0ZA 3HKCE 4DBRA 3ZJ1A 4IE7A 4JEUB 4ASKA 4DV4T 1T72A 4I43B 2CXLA 5FXZA 3JAFA 3PJAJ 5FYMA 1BR2A 5A1LA 3AAIA 4HWIB 5ADXL 3CQGB 5TAOA 2KLQA 4AQFC 5AQFB 2D0UA 2ZM8A 2V26A 2KWHA 3C4ZA 4P0BA 3DTOA 4MBQA 4CZZB 5ABFA 2HPLA 1FJGT 5LJMA 2D2SA 3K3QC 2A2FX 2YKSA 2BG9C 1I94T 1NEKA 1WRDA 3Q5XA 2DLRA 2OLTA 3E08A 3F57A 2V7LA 3GWHA 3RX6A 5FMNA 4HFEA 1J1JA 1OEDC 4ILBA 4O2AE 2EHOB 4HFBA 4AI6A 4J2CA 3UUNA 2NR4A 3P4SA 5ABGA 3C4XA 4JUYA 5J2TE 4JI4T 4BA9A 3PUYF 2X66A 2UUAT 3CWZB 4ADZA 2M67A 3AEDA 2Y8DA 2E9XC 4AKGA 2V5DA 4O8SA 4N78D 2MAWA 1N32T 5JDHA 3RH3A 2XSBA 3SFEA 4HWHA 4P09A 1ZP0A 2UXCT 3CVRA 3EHZA 2BKPA 2HHHT 3SOLA 4CN6A 4B6XA 3HKDE 2V8SV 4ZZCA 1YQ4A 4L9IA 4LFBT 3MA9A 4Q25A 3UUMA 4DV7T 4JI5T 2CE7A 1LVKA 3OYXA 4CXXA 3AA1B 4Z8XA 4UV9B 4DMVA 5HWXA 3RC3A 4CQIA 2VL0A 4UELA 1WFDA 1MMDA 3PUZF 4IDOA 3CKDA 3ZMTB 3EAMA 2E9XD 2K3WA 1HG2A 5L3DB 2NWBA 1MNEA 3FZMB 4ISSA 3HL6A 3B13A 2EHOA 4QHOA 2QGSA 4H63V 2LRLA 4YSZA 4YJ3E 2L9QA 2P9BA 2W00A 5JTGA 4LF5T 2PFVA 2XQ8A 5LB7B 3QNUA 3TLSA 3KV6A 5JDGA 3QB5A 4DV0T 4ZZBA 2LSKA 1YKEB 5HEOA 3A8YC 4U72A 3AE2A 1SUMB 2B1EA 5L4HA 5AQMB 5AQSB 4HN9A 5CFBA 3I0QA 4YHJA 3ONXA 2M6IA 2JQQA 4HKAA 5AQHB 5FL1A 2N1GA 2V5CA 2WDVA 4K0UA 3P4QA 4PNIA 3P8CD 4HFIA 3ZT5A 1DU2A 3LFMA 2X9HA 5HXSA 3NZPA 1HS7A 1FIOA 4ILCA 1IJ6A 1EZ3A 4WW0A 2BVLA 2V7JA 4LFAT 5AQQB 2A72A 4YSXA 3OBVE 5CJ5A 1V9DA 2LM2A 5AQJB 2LKGA 4JI8T 2MPKA 4I55E 2BG9A 2LJLA 1WR6A 3ESLA 3CX7B 5AQTB 1G73A 3PUWF 2Y48B 1CUNA 4P1NA 4TUYE 2ZM2A 4PJNA 4EEBA 3ZSTA 2LRKA 5AQOB 1OEDA 5F3JA 4YFSA 1W09A 4CI1B 4E7SA 3PUGA 2B76A 1WLXA 2JQ9A 3TLTA 2CLYC 5KX5E 4PAGA 4F6RC 1AJ3A 1SE7A 2OA5A 4XAXB 2KT9A 5KXJA 5FVLA 3ZYMA 2JJ9A 3P4RA 1FMWA 4IDZA 1KK7A 4L0RA 3VKGA 1U5PA 2LEHA 4YTNA 1D0XA 3AE1A 4TX5A 3VHLA 2J47A 2XQAA 4B3ST 4MLKA 4ZXLA 1KNRA 2CXDA 2K24A 5E0OA 4EYUA 3P4WA 4GK0E 2JMHA 2YDSA 4EYYR 5EK4A 4X20E 2YINA 3MZKB 2XM1A 2YN6A 3PTRB 2X9WA 4OK0A 2FJBA 1YQ3A 4DBQA 3CX6B 5HEHA 1BR0A 4UVBB 2D0TA 4QKNA 4QXCB 3K3OA 2XZEA 2K9AA 3TLWA 5FP3A 4KHPT 3ETUA 3UFGA 4WNKA 4XBFB 2WBLA 5LJNA 3L39A 3ZMZB 1MMGA 3H3AA 2NTXA 1NAFA 2NW7A 1KNPA 1D1BA 3MK7C 4GYSA 2C0SA 4DVDA 1M7KA 2XSAA 2FBWA 2ODVA 4ZS3A 3RPUA 2D5UA 3SFDA 3KDSE 4MHCA 4AKHA 5CA0E 3U78A 4HWDA 3RYHE 2H7VC 2HH7A 2Z6EA 5JREA 3ZEFB 5HXHA 1LKXA 3FZKB 3PE0A 3RKGA 2WWUA 4Z90A 4DV2T 1E2AA 3C51A 3O9XA 1OXZA 2W61A 4EIWA 1UGOA 3QK6A 5J2UE 4F8HA 3IA3A 5FY1A 2NP9A 2WSSV 5EK2A 4TN7B 3RKOA 2RP4A 2W0GA 3I9WA 3ZMUB 5HXRA 1YKHB 3R6NA 1IBMT 4LFCT 5LBQB 2R6GF 3Q5DA 2CCQA 5LGNB 2MYSA 1FEWA 2W67A 3OKQA 4ZS2A 2GK9A 1U4QA 2BVMA 4BJMA 1UK5A 1E1HB 2W4XA 2CHOA 5KMGP 4DMWA 1HX1B 4O4JE 3NWIA 5L3EB 4HE8A 5LNKA
chains in the Genus database with same CATH topology
4U2ZA 2K3WA 2DL1A 3K1SA 3ZT7A 2RPAA 5LB7B 2JQ9A 4U2YA 1WR0A 4IT4A 4A5XA 5FVKA 4ZEYA 2W2UA 1WCRA 5CGMA 4U33A 4CN6A 2WWVA 4P1NA 2CRBA 3ZSTA 4WZXA 2LRKA 3EABA 2CPTA 2JQHA 2V6XA 4U7IA 1WFDA 2LRLA 4U7YA 1YXRA 3ZSSA 5CJ5A 2WY2A 4CN4A 2V6YA 2XZEA 2V6YB 4U3CA 2JQKA 4NIQA 3ZT5A 4U31A 2MPKA 5FVLA 4CN1A 3ZT6A 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Z A;  2K3W A;  2DL1 A;  3K1S A;  3ZT7 A;  2RPA A;  5LB7 B;  2JQ9 A;  4U2Y A;  1WR0 A;  4IT4 A;  4A5X A;  5FVK A;  4ZEY A;  2W2U A;  1WCR A;  5CGM A;  4U33 A;  4CN6 A;  2WWV A;  4P1N A;  2CRB A;  3ZST A;  4WZX A;  2LRK A;  3EAB A;  2CPT A;  2JQH A;  2V6X A;  4U7I A;  1WFD A;  2LRL A;  4U7Y A;  1YXR A;  3ZSS A;  5CJ5 A;  2WY2 A;  4CN4 A;  2V6Y A;  2XZE A;  2V6Y B;  4U3C A;  2JQK A;  4NIQ A;  3ZT5 A;  4U31 A;  2MPK A;  5FVL A;  4CN1 A;  3ZT6 A;  2A9U A; 
#chains in the Genus database with same CATH topology
 4U2Z A;  4DID B;  2J1D G;  2CHN A;  2EHO C;  3OJA A;  4UV8 B;  2V7M A;  4BJN A;  3O4X E;  2ZM0 A;  3AXJ A;  3N9O A;  3WAJ A;  5FY0 A;  2W66 A;  3AA7 B;  2XAJ B;  3RHW A;  4U3C A;  3K3N A;  4LF7 T;  3AVR A;  2H3R A;  3CML A;  3UQ7 A;  5L3C B;  2RA1 A;  5LGU B;  1ZKE A;  4UR9 A;  4A98 A;  3P4P A;  4OYJ A;  3D0T A;  4TZ4 C;  2SPC A;  3AEG A;  2YK0 A;  3EDV A;  1L0V A;  4ZI3 D;  2LKH A;  3ZLI A;  4DO0 A;  4KI0 F;  2YDQ A;  4B3R T;  1IAP A;  4HFC A;  5C3J A;  2EHO D;  3I0O A;  5LA6 E;  4DR5 T;  5JR9 C;  3C50 A;  2L8K A;  3KV4 A;  5IYZ E;  3ABV A;  4C91 A;  1SHZ C;  4I50 E;  3RYI E;  3BQK A;  4EV6 A;  1W0B A;  3JCF A;  4TNW A;  3UU6 A;  4AIS A;  1FMV A;  3P50 A;  2IML A;  4KUM B;  3NZQ A;  3UU4 A;  1W9R A;  2LSG A;  2MOZ A;  4QH5 A;  3AE9 A;  3ZN1 B;  1Y01 A;  3RF1 A;  3VKH A;  3PUS A;  4TNV A;  4IT4 A;  2LE8 A;  5J1G A;  2J62 A;  4AKL A;  2CXF A;  2CRB A;  2DWG A;  4TWH A;  4WZX A;  4LF9 T;  4IIJ E;  1NWM X;  3TKL B;  4DR7 T;  4ILA A;  4U31 A;  3AB3 B;  3BK9 A;  1OWA A;  3Q9D A;  3VRB A;  2W62 A;  2XAG B;  3LG7 A;  4YHH T;  2QA7 A;  2BS3 A;  4X1I E;  1UX4 A;  4JI1 T;  2BS2 A;  2VKD A;  3U3I A;  2KSR A;  2VWA A;  5H6R B;  3E22 E;  4P0A A;  2W63 A;  4UIG A;  3PUR A;  5AQP B;  5GON E;  2X0L B;  2IAK A;  2ES0 A;  3LBX B;  3UTK A;  4IDQ A;  1H7C A;  3UUB A;  3FZH B;  5JDF A;  4EGW A;  3AAA B;  2QVA A;  4PJJ A;  4GKJ T;  3AEF A;  2ODU A;  2WMN A;  5JR9 B;  3WI3 A;  4JYA T;  4PFO A;  3AE7 A;  4UVA B;  3EI0 A;  4DR1 T;  1S35 A;  3AAE B;  2BKN A;  5LMU T;  1J5W A;  4UEM A;  5AQL B;  1WYB A;  5CGM A;  3PU8 A;  3WAK A;  3RQU A;  5FY7 A;  2VAS A;  3S4U A;  4NIQ A;  3ZC0 A;  2NTY A;  2HN1 A;  2DHR A;  2PG8 A;  2LLY A;  4YT0 A;  4TV9 E;  3RIA A;  2LOS A;  2K5B B;  1WCR A;  5JQG E;  2IC6 A;  1IZN B;  4QH1 A;  4CXY A;  2KIN B;  3N9L A;  3ZN0 B;  4JI7 T;  2AE9 A;  4CXW A;  2LSY A;  1D0Y A;  1M62 A;  4FI5 A;  4EB6 E;  4H9N C;  3N9M A;  1WYC A;  2WU2 A;  3LBX A;  2KND A;  3O1I A;  2XAF B;  4DR6 T;  4FJO A;  3LK4 2;  1UX5 A;  4H63 H;  3PUV F;  4DV6 T;  2V7K A;  5JVD E;  3B5M A;  4YSY A;  3N2O A;  5L3G B;  2BBH A;  2HN2 A;  1ZHC A;  2RPA A;  3NRY A;  5FXV A;  3EDU A;  3OPC A;  2Y6X A;  5JR9 A;  1XDO A;  2H88 A;  4TV8 E;  2NW9 A;  3ZCJ A;  2DCF A;  2XQY A;  2CPT A;  4PFP A;  4ZI2 C;  1Z0P A;  3MJX A;  4DR4 T;  4U74 A;  4A97 A;  3F31 A;  3AE3 A;  4U33 A;  5DJQ C;  3SRZ A;  1MND A;  4UF0 B;  2X0H A;  4H9S E;  4IL4 A;  5JDM A;  2VVN A;  2XQ6 A;  4X64 T;  2VB6 A;  4DV5 T;  5AQG B;  5BMV E;  3RYF E;  4QXH B;  2LSJ A;  4H9O C;  3AA6 B;  3ZPO A;  2C5I T;  4AIU A;  3KIN B;  2WB5 A;  2KXP B;  4DND A;  5L47 A;  1YD8 G;  5L4E A;  4ILU A;  5LG4 A;  1XNQ T;  4I0U A;  4NXM T;  1D1A A;  2NW8 A;  2VVS A;  3ZSS A;  4EZ4 A;  3J7Y q;  1LVF A;  4LF4 T;  2I6H A;  5LMN T;  2UU9 T;  3OVU A;  2CWY A;  5BR8 T;  2DL1 A;  2DWK A;  3FB2 A;  1VRB A;  3KV5 A;  2E8I A;  1MMA A;  2VKH A;  4GYR A;  1XWM A;  3TLU A;  2Q9Q B;  5HYA A;  4GOU A;  3KFW X;  3ZYK A;  1HFA A;  4KBM B;  5AQU B;  2CMR A;  2XQ9 A;  3ONJ A;  2ZLY A;  3FZF B;  2VQE T;  5DQV A;  4PJM A;  1WR0 A;  4A5X A;  1HG5 A;  2UXB T;  1MIW A;  3N9N A;  4LF8 T;  3RI5 A;  1Z8U A;  4WBO A;  2E5V A;  4IGU A;  5M4Y A;  2BBJ A;  4COF A;  4UXN B;  4AKR B;  1HX8 A;  2IW5 B;  4WYV A;  2V1D B;  4KP3 C;  5JDN A;  2LM9 A;  2JQH A;  3TLV A;  4KX6 A;  4NUV A;  2CBJ A;  3Q2M A;  4CN1 A;  3PV0 F;  2MBG A;  3ZMS B;  3JC6 C;  2X9Y A;  3MKD A;  2K48 A;  3T1H T;  2E5L T;  5FNV E;  4HEA A;  5LG3 A;  4EXT A;  5KDM C;  3PJA A;  3ZJ2 A;  3ZYL A;  4NPP A;  1T98 A;  3T8O A;  2X67 A;  4IDP A;  3RYC E;  4C90 A;  2VUR A;  4L5G A;  4OX9 T;  5IHY A;  1IJ5 A;  3R84 B;  2Q9Q A;  3X1D A;  2V6X A;  5AQK B;  5LYJ E;  2VKO A;  3FXD B;  5ABE A;  3KVB A;  3QUJ A;  4K0K T;  2OV9 A;  5HAX A;  4ZI7 E;  1ZV4 X;  1Y64 B;  4IST A;  3KBT A;  1HNZ T;  3CQX C;  3JC6 D;  4YLH A;  2IIU A;  1KNZ A;  5ETW A;  3VR9 A;  2BG9 E;  1BR4 A;  2ACZ A;  1JNR A;  2CA5 A;  2VL8 A;  2I0M A;  3M3Z B;  5HEU A;  4QX7 B;  3GMI A;  1OED E;  4MFR A;  4QXB B;  4EED A;  2LOP A;  4ERR A;  2QYW A;  2QRX A;  1IBK T;  4U7Y A;  5IWA T;  1HTJ F;  3LK3 B;  1N34 T;  3H3M A;  1XDP A;  3K1S A;  3V5S A;  3HA4 A;  3W15 B;  5LCY A;  2CEA A;  1MIV A;  3HR0 A;  4EZH A;  3AA0 B;  4AQG A;  3EAB A;  4JLE A;  5LP6 E;  1YW0 A;  3RC8 A;  3O1J A;  1UUR A;  3RRC A;  3DP7 A;  1HNX T;  3AE8 A;  4TWD A;  5FXX A;  3L3P A;  5AQI B;  1B7T A;  1LRZ A;  5DAB A;  2W2U A;  3BQI A;  1T7S A;  2WWV A;  3B57 A;  2H89 A;  1HNW T;  3K8P C;  4TWF A;  2XQ5 A;  3SWH A;  3HKE E;  2E2A A;  3L8R A;  3ANW B;  4IE4 A;  5H6Q B;  3LJC A;  4OYK A;  3MAC A;  4X1K E;  3JAD A;  1MIY A;  4IRE A;  1KEY A;  2AXD S;  4JI0 T;  3H37 A;  4HTE A;  3RRW A;  1QSD A;  4DV3 T;  3AEA A;  3M65 A;  3NKZ A;  5FXW A;  4HFD A;  3ETV A;  3PU3 A;  3T1Y T;  3P7I A;  3HI2 A;  2PTF A;  2V7I A;  5HXE A;  2D9D A;  4KMC A;  1JNZ A;  3EUH A;  3OTO T;  2N9D A;  2XM2 A;  1MMN A;  4LML A;  4WBN E;  3G06 A;  2XAH B;  3CX8 B;  4GIW A;  3RIU A;  4NUU A;  4HGA A;  1YXR A;  2XQ4 A;  2JQK A;  3AEC A;  2HPJ A;  2JIW A;  2IC9 A;  4JV5 T;  4DUZ T;  2F4V T;  1KF6 A;  3BQL A;  4IE5 A;  3E0Z A;  4H9P C;  5HCJ A;  3ZKR A;  5ABH A;  5LGT B;  2BKO A;  4B3M T;  2DI4 A;  3CK6 A;  2IDO B;  3UFE A;  3C4W A;  3N2G E;  4YXD A;  2WY2 A;  4IL9 A;  3A7M A;  2DNX A;  4G63 A;  5IUX A;  3N9P A;  4AXP A;  3ZMV B;  1R8I A;  1X79 A;  4JI2 T;  4X62 T;  4PW8 A;  2YU2 A;  3AEE A;  3KVA A;  3ANW A;  3IHR A;  2UXN B;  5F5W A;  3PDY A;  4XZC A;  1SA0 E;  1T8B A;  4O2B E;  3AE4 A;  4G2A A;  2XAS B;  2WZI A;  2BDE A;  5AQV B;  5C2T A;  2UUC T;  1HF8 A;  1XNR T;  3L09 A;  5AQR B;  2WU5 A;  2VQF T;  2LT3 A;  5LXT E;  3Q5E A;  4LMJ A;  4E7Z A;  4X65 T;  1HCI A;  2J4G A;  3C64 A;  4JI3 T;  3EVY A;  4GK5 E;  1ZOY A;  1XMO T;  2BG9 B;  3O1H A;  1VOM A;  2UXX B;  1XZY A;  2X51 A;  4IHJ E;  2BZB A;  1VCT A;  1OED B;  2XY8 B;  4OHF A;  2C5K T;  2IUB A;  2XPK A;  3PUA A;  5LOV E;  5HWY A;  4NXN T;  3CPZ A;  2YEV C;  3QC9 A;  5DQW A;  4ZOL E;  2VKJ A;  3CIR A;  2E9X B;  3AEB A;  3RQW A;  2WM9 A;  1HR0 T;  2Q9Q C;  5AQN B;  4H9Q C;  4MAL A;  5CA1 E;  3GA8 A;  5EK3 A;  2L3L A;  4JI6 T;  2XUE A;  2UUB T;  3RGL A;  1ZEE A;  5LHI B;  4AQF A;  3NRX A;  3AVS A;  4A56 A;  4EOZ B;  1G8X A;  3FXE B;  1UCU A;  2YOE A;  4AQY T;  2NOX A;  3F2E A;  2XHE B;  4QX8 B;  1X9B A;  2ZM6 T;  3QB5 K;  2A3D A;  4X1Y E;  5L3B B;  3VR8 A;  4YTP A;  2WQY A;  2A9U A;  2CWO A;  4UVC B;  3ZT7 A;  2WMO A;  5FVK A;  4GKK T;  2BS4 A;  5HXC A;  4QWN B;  4U7I A;  4EAH A;  1O3X A;  4OFZ A;  2Q9Q D;  2WDR A;  2V6Y B;  4KHZ F;  4PK6 A;  3J9X 1;  2C5J A;  1CHU A;  3AE6 A;  3UU8 A;  3C98 B;  3N9Q A;  3JAE A;  4U2Y A;  3NVO A;  4ZEY A;  3IEE A;  1S94 A;  2XJ7 A;  3UU5 A;  4ZI2 D;  2UXD T;  4M1P A;  4HWF A;  2E9X A;  3Q5W A;  2H7O A;  4YJ2 E;  4O4H E;  3UUX B;  2KMF A;  5L2L A;  5FL0 A;  4HWC A;  2FUP A;  3VU7 H;  1W0A A;  4QH4 A;  3RLF F;  3CQC B;  5AFU L;  2I59 A;  2XTL A;  2KZ7 B;  5HEJ A;  3VRA A;  1GQE A;  4JEH B;  4DR2 T;  2WAU A;  5HCM A;  2IHR 1;  4ZHQ E;  3GN5 B;  4Z91 A;  5JH7 E;  2FJD A;  1XMQ T;  3AE5 A;  4IE0 A;  4UF0 A;  4CI2 B;  2YDR A;  3ONL C;  3ZC1 A;  4PK4 A;  3HKB E;  2XAQ B;  3N5L A;  3ZT6 A;  1IBL T;  4B3T T;  2JRK A;  3PUX F;  3SS1 A;  2LSI A;  2PJQ A;  3RIU C;  5CB4 E;  2ZMA A;  3RIF A;  4PK5 A;  4YTM A;  4HFV A;  2LHR A;  5FKY A;  2V6Y A;  1UUS A;  2WDQ A;  2X0Y A;  3FBZ A;  1E7P A;  3IBP A;  4X66 T;  2X9X A;  2ACX A;  2XQ3 A;  4IE6 A;  2CBI A;  4O4I E;  3AXJ B;  3UT5 E;  2KWI B;  5C8Y E;  5LBM A;  4LMK A;  3QOF A;  2CLY B;  3DJB A;  3MXZ A;  3I1A A;  2FJA A;  3N2K E;  2WZH A;  4AKI A;  1D1C A;  2XQ7 A;  4V1A v;  1I6Z A;  3LDQ B;  3A5X A;  5JRC B;  2FJE A;  1QLB A;  1NEN A;  2M6B A;  3FHN A;  1N36 T;  3LSV A;  3KBU A;  4HFH A;  3ZCI A;  5J0Z A;  4O4L E;  4BAY B;  2LHN A;  3UU3 A;  3PUQ A;  3GN5 A;  1J5E T;  4PJL A;  1QUU A;  4DR3 T;  2VK9 A;  2PBI A;  3UUL A;  2N2N A;  5JDQ A;  5LHG B;  4JBW F;  4LF6 T;  2WS3 A;  5L3F B;  1BR1 A;  5HEG A;  2G0U A;  4ZI3 C;  4ANJ A;  4X5T A;  5ABF B;  3FZL B;  1N33 T;  3I9Y A;  3LK2 B;  3OYZ A;  5F8P A;  4I4T E;  3NBX X;  4CN4 A;  5EZY E;  4CI3 B;  2MTQ A;  4IDN A;  2YU1 A;  4H9R C;  3UQ4 A;  3V5U A;  2WCA A;  1VCS A;  2JPF A;  4DUY T;  3IF8 B;  5JRC A;  2CM0 A;  1KFY A;  3KV9 A;  4YY3 T;  2X68 A;  5LHH B;  2WP9 A;  2JMK A;  1US7 B;  5JDL A;  4DV1 T;  3FBL A;  1D0Z A;  3HKC E;  4DBR A;  3ZJ1 A;  4IE7 A;  4JEU B;  4ASK A;  4DV4 T;  1T72 A;  4I43 B;  2CXL A;  5FXZ A;  3JAF A;  3PJA J;  5FYM A;  1BR2 A;  5A1L A;  3AAI A;  4HWI B;  5ADX L;  3CQG B;  5TAO A;  2KLQ A;  4AQF C;  5AQF B;  2D0U A;  2ZM8 A;  2V26 A;  2KWH A;  3C4Z A;  4P0B A;  3DTO A;  4MBQ A;  4CZZ B;  5ABF A;  2HPL A;  1FJG T;  5LJM A;  2D2S A;  3K3Q C;  2A2F X;  2YKS A;  2BG9 C;  1I94 T;  1NEK A;  1WRD A;  3Q5X A;  2DLR A;  2OLT A;  3E08 A;  3F57 A;  2V7L A;  3GWH A;  3RX6 A;  5FMN A;  4HFE A;  1J1J A;  1OED C;  4ILB A;  4O2A E;  2EHO B;  4HFB A;  4AI6 A;  4J2C A;  3UUN A;  2NR4 A;  3P4S A;  5ABG A;  3C4X A;  4JUY A;  5J2T E;  4JI4 T;  4BA9 A;  3PUY F;  2X66 A;  2UUA T;  3CWZ B;  4ADZ A;  2M67 A;  3AED A;  2Y8D A;  2E9X C;  4AKG A;  2V5D A;  4O8S A;  4N78 D;  2MAW A;  1N32 T;  5JDH A;  3RH3 A;  2XSB A;  3SFE A;  4HWH A;  4P09 A;  1ZP0 A;  2UXC T;  3CVR A;  3EHZ A;  2BKP A;  2HHH T;  3SOL A;  4CN6 A;  4B6X A;  3HKD E;  2V8S V;  4ZZC A;  1YQ4 A;  4L9I A;  4LFB T;  3MA9 A;  4Q25 A;  3UUM A;  4DV7 T;  4JI5 T;  2CE7 A;  1LVK A;  3OYX A;  4CXX A;  3AA1 B;  4Z8X A;  4UV9 B;  4DMV A;  5HWX A;  3RC3 A;  4CQI A;  2VL0 A;  4UEL A;  1WFD A;  1MMD A;  3PUZ F;  4IDO A;  3CKD A;  3ZMT B;  3EAM A;  2E9X D;  2K3W A;  1HG2 A;  5L3D B;  2NWB A;  1MNE A;  3FZM B;  4ISS A;  3HL6 A;  3B13 A;  2EHO A;  4QHO A;  2QGS A;  4H63 V;  2LRL A;  4YSZ A;  4YJ3 E;  2L9Q A;  2P9B A;  2W00 A;  5JTG A;  4LF5 T;  2PFV A;  2XQ8 A;  5LB7 B;  3QNU A;  3TLS A;  3KV6 A;  5JDG A;  3QB5 A;  4DV0 T;  4ZZB A;  2LSK A;  1YKE B;  5HEO A;  3A8Y C;  4U72 A;  3AE2 A;  1SUM B;  2B1E A;  5L4H A;  5AQM B;  5AQS B;  4HN9 A;  5CFB A;  3I0Q A;  4YHJ A;  3ONX A;  2M6I A;  2JQQ A;  4HKA A;  5AQH B;  5FL1 A;  2N1G A;  2V5C A;  2WDV A;  4K0U A;  3P4Q A;  4PNI A;  3P8C D;  4HFI A;  3ZT5 A;  1DU2 A;  3LFM A;  2X9H A;  5HXS A;  3NZP A;  1HS7 A;  1FIO A;  4ILC A;  1IJ6 A;  1EZ3 A;  4WW0 A;  2BVL A;  2V7J A;  4LFA T;  5AQQ B;  2A72 A;  4YSX A;  3OBV E;  5CJ5 A;  1V9D A;  2LM2 A;  5AQJ B;  2LKG A;  4JI8 T;  2MPK A;  4I55 E;  2BG9 A;  2LJL A;  1WR6 A;  3ESL A;  3CX7 B;  5AQT B;  1G73 A;  3PUW F;  2Y48 B;  1CUN A;  4P1N A;  4TUY E;  2ZM2 A;  4PJN A;  4EEB A;  3ZST A;  2LRK A;  5AQO B;  1OED A;  5F3J A;  4YFS A;  1W09 A;  4CI1 B;  4E7S A;  3PUG A;  2B76 A;  1WLX A;  2JQ9 A;  3TLT A;  2CLY C;  5KX5 E;  4PAG A;  4F6R C;  1AJ3 A;  1SE7 A;  2OA5 A;  4XAX B;  2KT9 A;  5KXJ A;  5FVL A;  3ZYM A;  2JJ9 A;  3P4R A;  1FMW A;  4IDZ A;  1KK7 A;  4L0R A;  3VKG A;  1U5P A;  2LEH A;  4YTN A;  1D0X A;  3AE1 A;  4TX5 A;  3VHL A;  2J47 A;  2XQA A;  4B3S T;  4MLK A;  4ZXL A;  1KNR A;  2CXD A;  2K24 A;  5E0O A;  4EYU A;  3P4W A;  4GK0 E;  2JMH A;  2YDS A;  4EYY R;  5EK4 A;  4X20 E;  2YIN A;  3MZK B;  2XM1 A;  2YN6 A;  3PTR B;  2X9W A;  4OK0 A;  2FJB A;  1YQ3 A;  4DBQ A;  3CX6 B;  5HEH A;  1BR0 A;  4UVB B;  2D0T A;  4QKN A;  4QXC B;  3K3O A;  2XZE A;  2K9A A;  3TLW A;  5FP3 A;  4KHP T;  3ETU A;  3UFG A;  4WNK A;  4XBF B;  2WBL A;  5LJN A;  3L39 A;  3ZMZ B;  1MMG A;  3H3A A;  2NTX A;  1NAF A;  2NW7 A;  1KNP A;  1D1B A;  3MK7 C;  4GYS A;  2C0S A;  4DVD A;  1M7K A;  2XSA A;  2FBW A;  2ODV A;  4ZS3 A;  3RPU A;  2D5U A;  3SFD A;  3KDS E;  4MHC A;  4AKH A;  5CA0 E;  3U78 A;  4HWD A;  3RYH E;  2H7V C;  2HH7 A;  2Z6E A;  5JRE A;  3ZEF B;  5HXH A;  1LKX A;  3FZK B;  3PE0 A;  3RKG A;  2WWU A;  4Z90 A;  4DV2 T;  1E2A A;  3C51 A;  3O9X A;  1OXZ A;  2W61 A;  4EIW A;  1UGO A;  3QK6 A;  5J2U E;  4F8H A;  3IA3 A;  5FY1 A;  2NP9 A;  2WSS V;  5EK2 A;  4TN7 B;  3RKO A;  2RP4 A;  2W0G A;  3I9W A;  3ZMU B;  5HXR A;  1YKH B;  3R6N A;  1IBM T;  4LFC T;  5LBQ B;  2R6G F;  3Q5D A;  2CCQ A;  5LGN B;  2MYS A;  1FEW A;  2W67 A;  3OKQ A;  4ZS2 A;  2GK9 A;  1U4Q A;  2BVM A;  4BJM A;  1UK5 A;  1E1H B;  2W4X A;  2CHO A;  5KMG P;  4DMW A;  1HX1 B;  4O4J E;  3NWI A;  5L3E B;  4HE8 A;  5LNK A; 
#chains in the Genus database with same CATH homology
 4U2Z A;  2K3W A;  2DL1 A;  3K1S A;  3ZT7 A;  2RPA A;  5LB7 B;  2JQ9 A;  4U2Y A;  1WR0 A;  4IT4 A;  4A5X A;  5FVK A;  4ZEY A;  2W2U A;  1WCR A;  5CGM A;  4U33 A;  4CN6 A;  2WWV A;  4P1N A;  2CRB A;  3ZST A;  4WZX A;  2LRK A;  3EAB A;  2CPT A;  2JQH A;  2V6X A;  4U7I A;  1WFD A;  2LRL A;  4U7Y A;  1YXR A;  3ZSS A;  5CJ5 A;  2WY2 A;  4CN4 A;  2V6Y A;  2XZE A;  2V6Y B;  4U3C A;  2JQK A;  4NIQ A;  3ZT5 A;  4U31 A;  2MPK A;  5FVL A;  4CN1 A;  3ZT6 A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...