5FVNA

X-ray crystal structure of enterobacter cloacae ompe36 porin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
342
structure length
342
Chain Sequence
AEIYNKDGNKLDLYGKVDGLHYFSDDDSQDGDQTYMRLGFKGETQVNDQLTGYGQWEYQIQGNSGENENNSWTRVAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNSDFFGLVDGLNFAVQYQGKNGSASGEDQTNNGRTELRQNGDGVGGSITYNLGEGFGIGTAVSSSKRTSSQNDLTYGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGNLGWANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDLENGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDDKEFTRNAGISTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gram-negative trimeric porins have specific LPS binding sites that are essential for porin biogenesis.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Membrane protein
molecule keywords OMPC PORIN
total genus 108
structure length 342
sequence length 342
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5fvnA00
1H6S1 2ZLDA 3VZWX 2PRNA 3SYBA 4KRAA 3SYSA 4D65A 2K4TA 4GCQA 3T24A 4FMSA 3SY9A 3O0EA 2FGQX 4LSHA 2Y0LA 4FT6A 3UU2A 2XE1A 3VY9X 4LSEA 1GFNA 3SZVA 3T20A 5DL5A 5FVNA 3SZDA 3A2SX 2XE5A 2Y0HA 1GFOA 2Y0KA 3VY8X 1OSMA 3PORA 5PRNA 3VZTX 2XG6A 4AUIA 1GFMA 4C69X 1GFQA 2XE2A 3PRNA 3HW9A 5JDPA 2PORA 4LSIA 7PRNA 4LSFA 3UPGA 2Y2XA 1HXUA 2FGRA 3T0SA 4FRXA 3WI4A 2ODJA 3POQA 2OMFA 1BH3A 8PRNA 3WI5A 1PRNA 4D5UA 4KR4A 1GFPA 4FRTA 5DL7A 2ZFGA 2QTKA 3K19A 3POXA 4FSOA 4JFBA 2J1NA 4RJXA 1BT9A 1E54A 4BUMX 3NSGA 3FYXA 2O4VA 1OPFA 3SY7A 4FOZA 4RJWA 4KR8A 4D64A 5DL6A 1MPFA 6PRNA 5DL8A 1HXTA 4GCSA 4GCPA 3HWBA 3JTYA 1HXXA 1PHOA 2XE3A 2J4UP 4FSPA 3POUA 3VZUX 3EMNX
chains in the Genus database with same CATH superfamily
1H6S1 1IZNB 2R4NA 3DZMA 2ZLDA 3VZWX 2PRNA 1ZHWA 5G26A 3SYBA 2JMMA 2N2MA 3LK41 4KRAA 4E1TA 1IZNA 3SYSA 4D65A 2K4TA 4GCQA 4O3WA 1S5LO 4K3BA 3T24A 3WU2O 4AKRA 2LHFA 2R4LA 4FMSA 4RLBA 1BXWA 3SY9A 5GTHO 2Y7SA 3PGRA 4FUVA 4C00A 4AKRB 2KXPA 3O0EA 5B66O 2FGQX 4LSHA 2YPVA 1MM4A 2KZ7A 2ERVA 2Y0LA 2XE1A 2R4OA 3AAAB 3LK42 2JQYA 3PF1A 4FT6A 4GHBA 4F4BA 3TZGA 2KXPB 4LSEA 4O49A 1GFNA 3AAAA 2KZ7B 4PJ0O 3SZVA 5H2FO 3T20A 3UPGA 2X27X 4UB6O 3UU2A 4FESA 5DL5A 5FVNA 4AYMC 4PUXA 3SZDA 2IWVA 2XE5A 3A2SX 2M06A 3HOLA 3AAEB 2Y0HA 2M07A 3PGUA 3JCUO 1G90A 5IYUA 3RBHA 2F1TA 3AAEA 3AA0A 1QJ8A 1THQA 1GFOA 2Y0KA 3VY8X 4AYNA 1OSMA 3PORA 5PRNA 3VZTX 2XG6A 5AFUK 3VE1A 3AA0B 3A0BO 1GFMA 3QRCA 4FZLA 4QQ1A 3C5OA 4FZMA 1GFQA 2XE2A 4N74A 4C69X 3KZIO 3PRNA 3AA7A 3VE2A 3HW9A 3DA4A 2PORA 5G39A 5JDPA 4LSIA 4O4XA 2MHLA 3PQSA 2X9KA 4AFKA 3LK2A 2XTRA 4C4VB 2R8AA 7PRNA 1T16A 2N2LA 3AA7B 4G76A 4LSFA 5GTIO 1ZHYA 3HOEA 2Y2XA 4U9CA 4C4VA 2LFUA 2FGRA 1HXUA 3LK2B 4N59A 4XNKA 5EE2A 3GP6A 3T0SA 4FRXA 3UAQA 5D5DA 3WI4A 3NJTA 1ZHZA 2ODJA 4PR7A 5G38A 1MM5A 3DWNA 3POQA 3BRZA 2OMFA 4AKMA 1BH3A 8PRNA 4IL6O 3VY9X 3KVDD 3PQUA 2XTQA 3WI5A 1Q9GA 5ADXK 4GF4A 1PRNA 2MNHA 4D5UA 4KR4A 1GFPA 2AXTO 4FRTA 4JCHA 5DL7A 4AUIA 4AYID 2ZFGA 3PGSA 5ADXL 2QTKA 3K19A 3POXA 4FSOA 4JFBA 4AYEC 4E1SA 1T1LA 2J1NA 4RJXA 4CTDA 1BT9A 4FQEA 1E54A 5G3AA 4BUMX 3FYXA 3NSGA 2IWWA 2F1CX 2O4VA 2GE4A 5TISO 1ZHXA 1ORMA 2K0LA 3G7GA 1OPFA 2YNKA 3SY7A 1P4TA 2WJQA 5E79O 1QJPA 2R89A 2W81C 2WVPA 3BRYA 3QRAA 4FOZA 4RJWA 4KR8A 3DA3A 5DL6A 4D64A 2F1VA 1MPFA 5B5EO 1YS5A 6PRNA 5DL8A 2KC0A 4AYDC 1HXTA 4GCSA 3AA1A 4N58A 5KAFO 4GCPA 1Q9FA 3HWBA 4Z3TA 2KDYA 4G75A 5GV0A 4K3CA 3BS0A 3JTYA 4B61A 3LK3A 1HXXA 1PHOA 4O3YA 3AA1B 4XNLA 3V8UA 3A0HO 4UB8O 5T5FA 3AA6B 4AZLA 5AFUL 4N75A 2R4PA 2XE3A 3LK3B 4O4UA 4RL9A 4RLCA 2J4UP 4FSPA 4O3XB 2WJRA 3AA6A 2W80C 1ZHTA 2R88A 2XMXA 4FZNA 3POUA 3VZUX 3DWOX 3EMNX 1QJ9A 4O3ZA 5KAIO
chains in the Genus database with same CATH topology
1H6S1 1IZNB 2ZLDA 3VZWX 2PRNA 1ZHWA 5G26A 3SYBA 2JMMA 2N2MA 3LK41 4KRAA 4E1TA 1IZNA 3SYSA 4D65A 2K4TA 4GCQA 4O3WA 3T24A 4AKRA 2LHFA 4FMSA 4RLBA 3SY9A 1BXWA 2Y7SA 4FUVA 4AKRB 2KXPA 3O0EA 2FGQX 4LSHA 2YPVA 1MM4A 2KZ7A 2ERVA 2Y0LA 2XE1A 3AAAB 3LK42 4FT6A 4GHBA 3UU2A 3VY9X 4F4BA 3TZGA 2KXPB 4LSEA 4O49A 1GFNA 3AAAA 2KZ7B 3SZVA 3T20A 2X27X 4FESA 5DL5A 5FVNA 4AYMC 4PUXA 3SZDA 3A2SX 2XE5A 3HOLA 2M06A 3AAEB 2Y0HA 2M07A 1G90A 5IYUA 3RBHA 2F1TA 3AAEA 3AA0A 1QJ8A 1THQA 1GFOA 2Y0KA 3VY8X 4AYNA 1OSMA 3PORA 5PRNA 3VZTX 2XG6A 5AFUK 3VE1A 3AA0B 4AUIA 1GFMA 3QRCA 4FZLA 4QQ1A 3C5OA 4FZMA 1GFQA 2XE2A 4C69X 3PRNA 3AA7A 3VE2A 3HW9A 3DA4A 2PORA 5JDPA 4LSIA 4O4XA 2MHLA 3PQSA 4AFKA 7PRNA 3LK2A 2XTRA 2N2LA 3AA7B 4G76A 4LSFA 1ZHYA 3HOEA 2Y2XA 4U9CA 3UPGA 2LFUA 2FGRA 1HXUA 3LK2B 4N59A 4XNKA 5EE2A 3GP6A 3T0SA 4FRXA 3UAQA 5D5DA 3WI4A 1ZHZA 2ODJA 1MM5A 3POQA 2OMFA 4AKMA 1BH3A 8PRNA 3KVDD 3PQUA 2XTQA 3WI5A 1Q9GA 5ADXK 4GF4A 1PRNA 2MNHA 4D5UA 4KR4A 1GFPA 4JCHA 4FRTA 5DL7A 4AYID 2ZFGA 5ADXL 2QTKA 3K19A 3POXA 4FSOA 4JFBA 4AYEC 4E1SA 2J1NA 4RJXA 1BT9A 1E54A 4BUMX 3FYXA 3NSGA 2O4VA 2GE4A 1ZHXA 1ORMA 2K0LA 3G7GA 1OPFA 2YNKA 3SY7A 1P4TA 1QJPA 2W81C 4FOZA 3QRAA 4RJWA 4KR8A 3DA3A 5DL6A 4D64A 2F1VA 1MPFA 6PRNA 1YS5A 5DL8A 2KC0A 4AYDC 1HXTA 4GCSA 3AA1A 4N58A 4GCPA 1Q9FA 3HWBA 4Z3TA 2KDYA 4G75A 5GV0A 3JTYA 4B61A 3LK3A 1HXXA 1PHOA 4O3YA 3AA1B 4XNLA 3V8UA 5T5FA 3AA6B 4AZLA 5AFUL 2XE3A 3LK3B 4O4UA 4RL9A 2J4UP 4RLCA 4FSPA 4O3XB 3AA6A 2W80C 1ZHTA 2XMXA 4FZNA 3POUA 3VZUX 3EMNX 4O3ZA 1QJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6S 1;  2ZLD A;  3VZW X;  2PRN A;  3SYB A;  4KRA A;  3SYS A;  4D65 A;  2K4T A;  4GCQ A;  3T24 A;  4FMS A;  3SY9 A;  3O0E A;  2FGQ X;  4LSH A;  2Y0L A;  4FT6 A;  3UU2 A;  2XE1 A;  3VY9 X;  4LSE A;  1GFN A;  3SZV A;  3T20 A;  5DL5 A;  5FVN A;  3SZD A;  3A2S X;  2XE5 A;  2Y0H A;  1GFO A;  2Y0K A;  3VY8 X;  1OSM A;  3POR A;  5PRN A;  3VZT X;  2XG6 A;  4AUI A;  1GFM A;  4C69 X;  1GFQ A;  2XE2 A;  3PRN A;  3HW9 A;  5JDP A;  2POR A;  4LSI A;  7PRN A;  4LSF A;  3UPG A;  2Y2X A;  1HXU A;  2FGR A;  3T0S A;  4FRX A;  3WI4 A;  2ODJ A;  3POQ A;  2OMF A;  1BH3 A;  8PRN A;  3WI5 A;  1PRN A;  4D5U A;  4KR4 A;  1GFP A;  4FRT A;  5DL7 A;  2ZFG A;  2QTK A;  3K19 A;  3POX A;  4FSO A;  4JFB A;  2J1N A;  4RJX A;  1BT9 A;  1E54 A;  4BUM X;  3NSG A;  3FYX A;  2O4V A;  1OPF A;  3SY7 A;  4FOZ A;  4RJW A;  4KR8 A;  4D64 A;  5DL6 A;  1MPF A;  6PRN A;  5DL8 A;  1HXT A;  4GCS A;  4GCP A;  3HWB A;  3JTY A;  1HXX A;  1PHO A;  2XE3 A;  2J4U P;  4FSP A;  3POU A;  3VZU X;  3EMN X; 
#chains in the Genus database with same CATH topology
 1H6S 1;  1IZN B;  2R4N A;  3DZM A;  2ZLD A;  3VZW X;  2PRN A;  1ZHW A;  5G26 A;  3SYB A;  2JMM A;  2N2M A;  3LK4 1;  4KRA A;  4E1T A;  1IZN A;  3SYS A;  4D65 A;  2K4T A;  4GCQ A;  4O3W A;  1S5L O;  4K3B A;  3T24 A;  3WU2 O;  4AKR A;  2LHF A;  2R4L A;  4FMS A;  4RLB A;  1BXW A;  3SY9 A;  5GTH O;  2Y7S A;  3PGR A;  4FUV A;  4C00 A;  4AKR B;  2KXP A;  3O0E A;  5B66 O;  2FGQ X;  4LSH A;  2YPV A;  1MM4 A;  2KZ7 A;  2ERV A;  2Y0L A;  2XE1 A;  2R4O A;  3AAA B;  3LK4 2;  2JQY A;  3PF1 A;  4FT6 A;  4GHB A;  4F4B A;  3TZG A;  2KXP B;  4LSE A;  4O49 A;  1GFN A;  3AAA A;  2KZ7 B;  4PJ0 O;  3SZV A;  5H2F O;  3T20 A;  3UPG A;  2X27 X;  4UB6 O;  3UU2 A;  4FES A;  5DL5 A;  5FVN A;  4AYM C;  4PUX A;  3SZD A;  2IWV A;  2XE5 A;  3A2S X;  2M06 A;  3HOL A;  3AAE B;  2Y0H A;  2M07 A;  3PGU A;  3JCU O;  1G90 A;  5IYU A;  3RBH A;  2F1T A;  3AAE A;  3AA0 A;  1QJ8 A;  1THQ A;  1GFO A;  2Y0K A;  3VY8 X;  4AYN A;  1OSM A;  3POR A;  5PRN A;  3VZT X;  2XG6 A;  5AFU K;  3VE1 A;  3AA0 B;  3A0B O;  1GFM A;  3QRC A;  4FZL A;  4QQ1 A;  3C5O A;  4FZM A;  1GFQ A;  2XE2 A;  4N74 A;  4C69 X;  3KZI O;  3PRN A;  3AA7 A;  3VE2 A;  3HW9 A;  3DA4 A;  2POR A;  5G39 A;  5JDP A;  4LSI A;  4O4X A;  2MHL A;  3PQS A;  2X9K A;  4AFK A;  3LK2 A;  2XTR A;  4C4V B;  2R8A A;  7PRN A;  1T16 A;  2N2L A;  3AA7 B;  4G76 A;  4LSF A;  5GTI O;  1ZHY A;  3HOE A;  2Y2X A;  4U9C A;  4C4V A;  2LFU A;  2FGR A;  1HXU A;  3LK2 B;  4N59 A;  4XNK A;  5EE2 A;  3GP6 A;  3T0S A;  4FRX A;  3UAQ A;  5D5D A;  3WI4 A;  3NJT A;  1ZHZ A;  2ODJ A;  4PR7 A;  5G38 A;  1MM5 A;  3DWN A;  3POQ A;  3BRZ A;  2OMF A;  4AKM A;  1BH3 A;  8PRN A;  4IL6 O;  3VY9 X;  3KVD D;  3PQU A;  2XTQ A;  3WI5 A;  1Q9G A;  5ADX K;  4GF4 A;  1PRN A;  2MNH A;  4D5U A;  4KR4 A;  1GFP A;  2AXT O;  4FRT A;  4JCH A;  5DL7 A;  4AUI A;  4AYI D;  2ZFG A;  3PGS A;  5ADX L;  2QTK A;  3K19 A;  3POX A;  4FSO A;  4JFB A;  4AYE C;  4E1S A;  1T1L A;  2J1N A;  4RJX A;  4CTD A;  1BT9 A;  4FQE A;  1E54 A;  5G3A A;  4BUM X;  3FYX A;  3NSG A;  2IWW A;  2F1C X;  2O4V A;  2GE4 A;  5TIS O;  1ZHX A;  1ORM A;  2K0L A;  3G7G A;  1OPF A;  2YNK A;  3SY7 A;  1P4T A;  2WJQ A;  5E79 O;  1QJP A;  2R89 A;  2W81 C;  2WVP A;  3BRY A;  3QRA A;  4FOZ A;  4RJW A;  4KR8 A;  3DA3 A;  5DL6 A;  4D64 A;  2F1V A;  1MPF A;  5B5E O;  1YS5 A;  6PRN A;  5DL8 A;  2KC0 A;  4AYD C;  1HXT A;  4GCS A;  3AA1 A;  4N58 A;  5KAF O;  4GCP A;  1Q9F A;  3HWB A;  4Z3T A;  2KDY A;  4G75 A;  5GV0 A;  4K3C A;  3BS0 A;  3JTY A;  4B61 A;  3LK3 A;  1HXX A;  1PHO A;  4O3Y A;  3AA1 B;  4XNL A;  3V8U A;  3A0H O;  4UB8 O;  5T5F A;  3AA6 B;  4AZL A;  5AFU L;  4N75 A;  2R4P A;  2XE3 A;  3LK3 B;  4O4U A;  4RL9 A;  4RLC A;  2J4U P;  4FSP A;  4O3X B;  2WJR A;  3AA6 A;  2W80 C;  1ZHT A;  2R88 A;  2XMX A;  4FZN A;  3POU A;  3VZU X;  3DWO X;  3EMN X;  1QJ9 A;  4O3Z A;  5KAI O; 
#chains in the Genus database with same CATH homology
 1H6S 1;  1IZN B;  2ZLD A;  3VZW X;  2PRN A;  1ZHW A;  5G26 A;  3SYB A;  2JMM A;  2N2M A;  3LK4 1;  4KRA A;  4E1T A;  1IZN A;  3SYS A;  4D65 A;  2K4T A;  4GCQ A;  4O3W A;  3T24 A;  4AKR A;  2LHF A;  4FMS A;  4RLB A;  3SY9 A;  1BXW A;  2Y7S A;  4FUV A;  4AKR B;  2KXP A;  3O0E A;  2FGQ X;  4LSH A;  2YPV A;  1MM4 A;  2KZ7 A;  2ERV A;  2Y0L A;  2XE1 A;  3AAA B;  3LK4 2;  4FT6 A;  4GHB A;  3UU2 A;  3VY9 X;  4F4B A;  3TZG A;  2KXP B;  4LSE A;  4O49 A;  1GFN A;  3AAA A;  2KZ7 B;  3SZV A;  3T20 A;  2X27 X;  4FES A;  5DL5 A;  5FVN A;  4AYM C;  4PUX A;  3SZD A;  3A2S X;  2XE5 A;  3HOL A;  2M06 A;  3AAE B;  2Y0H A;  2M07 A;  1G90 A;  5IYU A;  3RBH A;  2F1T A;  3AAE A;  3AA0 A;  1QJ8 A;  1THQ A;  1GFO A;  2Y0K A;  3VY8 X;  4AYN A;  1OSM A;  3POR A;  5PRN A;  3VZT X;  2XG6 A;  5AFU K;  3VE1 A;  3AA0 B;  4AUI A;  1GFM A;  3QRC A;  4FZL A;  4QQ1 A;  3C5O A;  4FZM A;  1GFQ A;  2XE2 A;  4C69 X;  3PRN A;  3AA7 A;  3VE2 A;  3HW9 A;  3DA4 A;  2POR A;  5JDP A;  4LSI A;  4O4X A;  2MHL A;  3PQS A;  4AFK A;  7PRN A;  3LK2 A;  2XTR A;  2N2L A;  3AA7 B;  4G76 A;  4LSF A;  1ZHY A;  3HOE A;  2Y2X A;  4U9C A;  3UPG A;  2LFU A;  2FGR A;  1HXU A;  3LK2 B;  4N59 A;  4XNK A;  5EE2 A;  3GP6 A;  3T0S A;  4FRX A;  3UAQ A;  5D5D A;  3WI4 A;  1ZHZ A;  2ODJ A;  1MM5 A;  3POQ A;  2OMF A;  4AKM A;  1BH3 A;  8PRN A;  3KVD D;  3PQU A;  2XTQ A;  3WI5 A;  1Q9G A;  5ADX K;  4GF4 A;  1PRN A;  2MNH A;  4D5U A;  4KR4 A;  1GFP A;  4JCH A;  4FRT A;  5DL7 A;  4AYI D;  2ZFG A;  5ADX L;  2QTK A;  3K19 A;  3POX A;  4FSO A;  4JFB A;  4AYE C;  4E1S A;  2J1N A;  4RJX A;  1BT9 A;  1E54 A;  4BUM X;  3FYX A;  3NSG A;  2O4V A;  2GE4 A;  1ZHX A;  1ORM A;  2K0L A;  3G7G A;  1OPF A;  2YNK A;  3SY7 A;  1P4T A;  1QJP A;  2W81 C;  4FOZ A;  3QRA A;  4RJW A;  4KR8 A;  3DA3 A;  5DL6 A;  4D64 A;  2F1V A;  1MPF A;  6PRN A;  1YS5 A;  5DL8 A;  2KC0 A;  4AYD C;  1HXT A;  4GCS A;  3AA1 A;  4N58 A;  4GCP A;  1Q9F A;  3HWB A;  4Z3T A;  2KDY A;  4G75 A;  5GV0 A;  3JTY A;  4B61 A;  3LK3 A;  1HXX A;  1PHO A;  4O3Y A;  3AA1 B;  4XNL A;  3V8U A;  5T5F A;  3AA6 B;  4AZL A;  5AFU L;  2XE3 A;  3LK3 B;  4O4U A;  4RL9 A;  2J4U P;  4RLC A;  4FSP A;  4O3X B;  3AA6 A;  2W80 C;  1ZHT A;  2XMX A;  4FZN A;  3POU A;  3VZU X;  3EMN X;  4O3Z A;  1QJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...