5FVNA

X-ray crystal structure of enterobacter cloacae ompe36 porin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
342
structure length
342
Chain Sequence
b'AEIYNKDGNKLDLYGKVDGLHYFSDDDSQDGDQTYMRLGFKGETQVNDQLTGYGQWEYQIQGNSGENENNSWTRVAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNSDFFGLVDGLNFAVQYQGKNGSASGEDQTNNGRTELRQNGDGVGGSITYNLGEGFGIGTAVSSSKRTSSQNDLTYGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGNLGWANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDLENGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDDKEFTRNAGISTDDIVALGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMPC PORIN
publication title Gram-negative trimeric porins have specific LPS binding sites that are essential for porin biogenesis.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Membrane protein
total genus 108
structure length 342
sequence length 342
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5fvnA00
3VZTX 4FOZA 5PRNA 1OSMA 3POUA 3K19A 1GFQA 3T24A 3SZVA 3UPGA 2FGRA 3VZUX 2XG6A 3HWBA 4D64A 7PRNA 4FMSA 3VZWX 4FSPA 2Y0KA 5FVNA 4BUMX 4D5UA 1BT9A 3HW9A 4FSOA 1MPFA 2Y0LA 2XE2A 4D65A 2QTKA 4LSHA 3WI4A 4KR4A 1OPFA 5DL7A 3NSGA 3SY7A 3PORA 2PRNA 3VY9X 2ZFGA 2Y2XA 3A2SX 4RJWA 4GCPA 4AUIA 2K4TA 1H6S1 2ZLDA 3EMNX 1GFNA 2OMFA 2XE3A 2XE1A 2ODJA 1HXXA 1HXTA 3SZDA 5DL5A 3FYXA 1PHOA 3POXA 4FRXA 2O4VA 2PORA 1GFOA 3SYBA 8PRNA 3T20A 3JTYA 3SYSA 3VY8X 4LSFA 2J4UP 4LSIA 4FRTA 3O0EA 2J1NA 4C69X 1PRNA 4JFBA 2XE5A 4GCSA 4LSEA 6PRNA 3POQA 2FGQX 1BH3A 1HXUA 1GFPA 5JDPA 5DL8A 5DL6A 1GFMA 3UU2A 4FT6A 2Y0HA 3PRNA 3WI5A 1E54A 4KRAA 3T0SA 4GCQA 3SY9A 4RJXA 4KR8A
chains in the Genus database with same CATH superfamily
1QJ8A 4FZMA 3VZTX 4FOZA 3QRAA 5IYUA 2R4PA 2AXTO 5PRNA 1OSMA 2F1VA 3T24A 2KZ7A 3POUA 5D5DA 1YS5A 3K19A 3G7GA 3PGUA 3A0HO 2R4OA 5GTHO 3AA0B 2R4NA 5G38A 4O49A 1GFQA 2LFUA 2R89A 3C5OA 3RBHA 2K0LA 2F1TA 2FGRA 2XG6A 3SZVA 3AA1B 3LK2A 3VZUX 2ERVA 3HWBA 4D64A 4JCHA 4FMSA 7PRNA 3AA1A 3VZWX 4FSPA 3AAAB 3PQSA 2Y0KA 1Q9GA 2KXPB 5FVNA 2R4LA 4N58A 1ZHWA 4BUMX 2W81C 4D5UA 4FZLA 4PUXA 3PQUA 4RLCA 2KC0A 1BT9A 1ZHTA 3LK3B 5H2FO 2Y7SA 3HW9A 3PGSA 3DWOX 4FQEA 4RLBA 5EE2A 4AKRB 4AZLA 2LHFA 5AFUL 2XMXA 3LK3A 4FSOA 2MHLA 1MPFA 4G75A 4AKRA 2Y0LA 3BRYA 4UB8O 3KVDD 4XNKA 3LK41 2XTRA 2N2LA 2XE2A 5B5EO 4D65A 2QTKA 4LSHA 3WI4A 4KR4A 4AYDC 1OPFA 3LK42 5DL7A 3NSGA 5E79O 4C00A 4FUVA 2GE4A 1ZHXA 3VE2A 4K3CA 4C4VB 4N75A 3AAEB 3SY7A 3TZGA 4QQ1A 3AA0A 3PORA 3JCUO 4N74A 5ADXL 4XNLA 4AFKA 4C4VA 1ORMA 2PRNA 3BRZA 3VE1A 3VY9X 4Z3TA 4F4BA 5G3AA 5G39A 2ZFGA 2Y2XA 3A2SX 4RJWA 5TISO 1QJ9A 4GCPA 3AAAA 1ZHYA 4AUIA 4AKMA 2KXPA 2K4TA 2WJRA 1H6S1 2M07A 2YNKA 2ZLDA 1GFNA 3EMNX 5KAIO 2OMFA 2XE3A 2XE1A 3WU2O 4G76A 2ODJA 4AYNA 1S5LO 2F1CX 1P4TA 2WJQA 1T16A 4O4XA 1HXXA 2XTQA 4RJXA 1IZNB 3UPGA 1HXTA 4O3ZA 2X9KA 5G26A 3AA7B 3SZDA 3DZMA 3KZIO 2IWWA 5DL5A 3GP6A 3DA3A 5GV0A 3FYXA 1T1LA 1PHOA 2IWVA 3POXA 4FRXA 2O4VA 4FESA 2PORA 1Q9FA 4AYEC 1GFOA 1BXWA 3AAEA 4O3XB 5B66O 2R8AA 2X27X 3SYBA 8PRNA 3T20A 3JTYA 3QRCA 5GTIO 3SYSA 2JMMA 3UAQA 3VY8X 4LSFA 2M06A 4O4UA 3HOEA 4GHBA 2YPVA 4GF4A 4UB6O 1MM4A 4AYMC 4LSIA 4FRTA 4B61A 2J4UP 1G90A 2MNHA 2N2MA 2JQYA 2KZ7B 2J1NA 3O0EA 2R88A 3PGRA 1PRNA 4C69X 4CTDA 4JFBA 4N59A 2XE5A 5KAFO 4RL9A 4GCSA 4U9CA 2KDYA 3BS0A 5AFUK 1ZHZA 4LSEA 3LK2B 4PR7A 6PRNA 1IZNA 3AA6B 3DA4A 1QJPA 4E1TA 3POQA 4O3YA 1BH3A 1HXUA 1THQA 3AA7A 1GFPA 3AA6A 4AYID 5JDPA 5DL8A 5DL6A 1GFMA 3UU2A 4FT6A 1MM5A 2Y0HA 3PRNA 3HOLA 3DWNA 4O3WA 2WVPA 3PF1A 4PJ0O 3WI5A 1E54A 4KRAA 3NJTA 4FZNA 3A0BO 2W80C 4GCQA 5T5FA 3T0SA 3SY9A 4E1SA 3V8UA 4IL6O 2FGQX 4KR8A 5ADXK 4K3BA
chains in the Genus database with same CATH topology
1QJ8A 4FZMA 3VZTX 4FOZA 3QRAA 5IYUA 5PRNA 1OSMA 2F1VA 2KZ7A 3POUA 5D5DA 1YS5A 3K19A 3G7GA 3AA0B 4O49A 1GFQA 2LFUA 3RBHA 3C5OA 3SZVA 2K0LA 2F1TA 2FGRA 2XG6A 3T24A 3AA1B 3LK2A 3VZUX 2ERVA 3HWBA 4D64A 4JCHA 4FMSA 7PRNA 3AA1A 3VZWX 4FSPA 3AAAB 3PQSA 2Y0KA 1Q9GA 2KXPB 5FVNA 4N58A 1ZHWA 4BUMX 2W81C 4D5UA 4FZLA 4PUXA 3PQUA 4RLCA 2KC0A 1BT9A 1ZHTA 3LK3B 2Y7SA 3HW9A 4RLBA 5EE2A 4AZLA 5AFUL 4AKRB 5GV0A 2LHFA 2XMXA 3LK3A 4FSOA 2MHLA 1MPFA 4G75A 4AKRA 2Y0LA 3KVDD 4XNKA 3LK41 2XTRA 2N2LA 2XE2A 4D65A 2QTKA 4LSHA 3WI4A 4KR4A 4AYDC 1OPFA 3LK42 5DL7A 3NSGA 4FUVA 2GE4A 1ZHXA 3VE2A 3SY7A 3AAEB 3TZGA 4QQ1A 3AA0A 3PORA 5ADXL 4XNLA 4AFKA 4Z3TA 1ORMA 2PRNA 3VE1A 3VY9X 4F4BA 2ZFGA 2Y2XA 3A2SX 4RJWA 1QJ9A 4GCPA 3AAAA 1ZHYA 4AUIA 4AKMA 2KXPA 2K4TA 1H6S1 2M07A 2YNKA 2ZLDA 1GFNA 3EMNX 2OMFA 2XE3A 2XE1A 4G76A 2ODJA 4AYNA 1P4TA 4O4XA 1HXXA 2XTQA 4RJXA 1IZNB 3UPGA 1HXTA 4O3ZA 5G26A 3AA7B 3SZDA 5DL5A 3GP6A 3DA3A 3FYXA 1PHOA 3POXA 4FRXA 2O4VA 4FESA 2PORA 1Q9FA 4AYEC 1GFOA 1BXWA 3AAEA 4O3XB 2X27X 3SYBA 8PRNA 3T20A 3JTYA 3QRCA 3SYSA 2JMMA 3VY8X 4LSFA 2M06A 4O4UA 3HOEA 4GHBA 2YPVA 4GF4A 4AYMC 1MM4A 4B61A 4LSIA 4FRTA 2J4UP 1G90A 2MNHA 2N2MA 2KZ7B 3O0EA 2J1NA 4C69X 1PRNA 4JFBA 4N59A 2XE5A 4RL9A 4GCSA 4U9CA 2KDYA 5AFUK 1ZHZA 4LSEA 3LK2B 6PRNA 1IZNA 3AA6B 3DA4A 1QJPA 4E1TA 3POQA 4O3YA 1BH3A 1HXUA 1THQA 3AA7A 1GFPA 3AA6A 4AYID 5JDPA 5DL8A 5DL6A 1GFMA 3UU2A 4FT6A 1MM5A 2Y0HA 3PRNA 3HOLA 4O3WA 3WI5A 1E54A 4KRAA 4FZNA 5T5FA 3T0SA 2W80C 4GCQA 3UAQA 4E1SA 3SY9A 3V8UA 2FGQX 4KR8A 5ADXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VZT X;  4FOZ A;  5PRN A;  1OSM A;  3POU A;  3K19 A;  1GFQ A;  3T24 A;  3SZV A;  3UPG A;  2FGR A;  3VZU X;  2XG6 A;  3HWB A;  4D64 A;  7PRN A;  4FMS A;  3VZW X;  4FSP A;  2Y0K A;  5FVN A;  4BUM X;  4D5U A;  1BT9 A;  3HW9 A;  4FSO A;  1MPF A;  2Y0L A;  2XE2 A;  4D65 A;  2QTK A;  4LSH A;  3WI4 A;  4KR4 A;  1OPF A;  5DL7 A;  3NSG A;  3SY7 A;  3POR A;  2PRN A;  3VY9 X;  2ZFG A;  2Y2X A;  3A2S X;  4RJW A;  4GCP A;  4AUI A;  2K4T A;  1H6S 1;  2ZLD A;  3EMN X;  1GFN A;  2OMF A;  2XE3 A;  2XE1 A;  2ODJ A;  1HXX A;  1HXT A;  3SZD A;  5DL5 A;  3FYX A;  1PHO A;  3POX A;  4FRX A;  2O4V A;  2POR A;  1GFO A;  3SYB A;  8PRN A;  3T20 A;  3JTY A;  3SYS A;  3VY8 X;  4LSF A;  2J4U P;  4LSI A;  4FRT A;  3O0E A;  2J1N A;  4C69 X;  1PRN A;  4JFB A;  2XE5 A;  4GCS A;  4LSE A;  6PRN A;  3POQ A;  2FGQ X;  1BH3 A;  1HXU A;  1GFP A;  5JDP A;  5DL8 A;  5DL6 A;  1GFM A;  3UU2 A;  4FT6 A;  2Y0H A;  3PRN A;  3WI5 A;  1E54 A;  4KRA A;  3T0S A;  4GCQ A;  3SY9 A;  4RJX A;  4KR8 A; 
#chains in the Genus database with same CATH topology
 1QJ8 A;  4FZM A;  3VZT X;  4FOZ A;  3QRA A;  5IYU A;  2R4P A;  2AXT O;  5PRN A;  1OSM A;  2F1V A;  3T24 A;  2KZ7 A;  3POU A;  5D5D A;  1YS5 A;  3K19 A;  3G7G A;  3PGU A;  3A0H O;  2R4O A;  5GTH O;  3AA0 B;  2R4N A;  5G38 A;  4O49 A;  1GFQ A;  2LFU A;  2R89 A;  3C5O A;  3RBH A;  2K0L A;  2F1T A;  2FGR A;  2XG6 A;  3SZV A;  3AA1 B;  3LK2 A;  3VZU X;  2ERV A;  3HWB A;  4D64 A;  4JCH A;  4FMS A;  7PRN A;  3AA1 A;  3VZW X;  4FSP A;  3AAA B;  3PQS A;  2Y0K A;  1Q9G A;  2KXP B;  5FVN A;  2R4L A;  4N58 A;  1ZHW A;  4BUM X;  2W81 C;  4D5U A;  4FZL A;  4PUX A;  3PQU A;  4RLC A;  2KC0 A;  1BT9 A;  1ZHT A;  3LK3 B;  5H2F O;  2Y7S A;  3HW9 A;  3PGS A;  3DWO X;  4FQE A;  4RLB A;  5EE2 A;  4AKR B;  4AZL A;  2LHF A;  5AFU L;  2XMX A;  3LK3 A;  4FSO A;  2MHL A;  1MPF A;  4G75 A;  4AKR A;  2Y0L A;  3BRY A;  4UB8 O;  3KVD D;  4XNK A;  3LK4 1;  2XTR A;  2N2L A;  2XE2 A;  5B5E O;  4D65 A;  2QTK A;  4LSH A;  3WI4 A;  4KR4 A;  4AYD C;  1OPF A;  3LK4 2;  5DL7 A;  3NSG A;  5E79 O;  4C00 A;  4FUV A;  2GE4 A;  1ZHX A;  3VE2 A;  4K3C A;  4C4V B;  4N75 A;  3AAE B;  3SY7 A;  3TZG A;  4QQ1 A;  3AA0 A;  3POR A;  3JCU O;  4N74 A;  5ADX L;  4XNL A;  4AFK A;  4C4V A;  1ORM A;  2PRN A;  3BRZ A;  3VE1 A;  3VY9 X;  4Z3T A;  4F4B A;  5G3A A;  5G39 A;  2ZFG A;  2Y2X A;  3A2S X;  4RJW A;  5TIS O;  1QJ9 A;  4GCP A;  3AAA A;  1ZHY A;  4AUI A;  4AKM A;  2KXP A;  2K4T A;  2WJR A;  1H6S 1;  2M07 A;  2YNK A;  2ZLD A;  1GFN A;  3EMN X;  5KAI O;  2OMF A;  2XE3 A;  2XE1 A;  3WU2 O;  4G76 A;  2ODJ A;  4AYN A;  1S5L O;  2F1C X;  1P4T A;  2WJQ A;  1T16 A;  4O4X A;  1HXX A;  2XTQ A;  4RJX A;  1IZN B;  3UPG A;  1HXT A;  4O3Z A;  2X9K A;  5G26 A;  3AA7 B;  3SZD A;  3DZM A;  3KZI O;  2IWW A;  5DL5 A;  3GP6 A;  3DA3 A;  5GV0 A;  3FYX A;  1T1L A;  1PHO A;  2IWV A;  3POX A;  4FRX A;  2O4V A;  4FES A;  2POR A;  1Q9F A;  4AYE C;  1GFO A;  1BXW A;  3AAE A;  4O3X B;  5B66 O;  2R8A A;  2X27 X;  3SYB A;  8PRN A;  3T20 A;  3JTY A;  3QRC A;  5GTI O;  3SYS A;  2JMM A;  3UAQ A;  3VY8 X;  4LSF A;  2M06 A;  4O4U A;  3HOE A;  4GHB A;  2YPV A;  4GF4 A;  4UB6 O;  1MM4 A;  4AYM C;  4LSI A;  4FRT A;  4B61 A;  2J4U P;  1G90 A;  2MNH A;  2N2M A;  2JQY A;  2KZ7 B;  2J1N A;  3O0E A;  2R88 A;  3PGR A;  1PRN A;  4C69 X;  4CTD A;  4JFB A;  4N59 A;  2XE5 A;  5KAF O;  4RL9 A;  4GCS A;  4U9C A;  2KDY A;  3BS0 A;  5AFU K;  1ZHZ A;  4LSE A;  3LK2 B;  4PR7 A;  6PRN A;  1IZN A;  3AA6 B;  3DA4 A;  1QJP A;  4E1T A;  3POQ A;  4O3Y A;  1BH3 A;  1HXU A;  1THQ A;  3AA7 A;  1GFP A;  3AA6 A;  4AYI D;  5JDP A;  5DL8 A;  5DL6 A;  1GFM A;  3UU2 A;  4FT6 A;  1MM5 A;  2Y0H A;  3PRN A;  3HOL A;  3DWN A;  4O3W A;  2WVP A;  3PF1 A;  4PJ0 O;  3WI5 A;  1E54 A;  4KRA A;  3NJT A;  4FZN A;  3A0B O;  2W80 C;  4GCQ A;  5T5F A;  3T0S A;  3SY9 A;  4E1S A;  3V8U A;  4IL6 O;  2FGQ X;  4KR8 A;  5ADX K;  4K3B A; 
#chains in the Genus database with same CATH homology
 1QJ8 A;  4FZM A;  3VZT X;  4FOZ A;  3QRA A;  5IYU A;  5PRN A;  1OSM A;  2F1V A;  2KZ7 A;  3POU A;  5D5D A;  1YS5 A;  3K19 A;  3G7G A;  3AA0 B;  4O49 A;  1GFQ A;  2LFU A;  3RBH A;  3C5O A;  3SZV A;  2K0L A;  2F1T A;  2FGR A;  2XG6 A;  3T24 A;  3AA1 B;  3LK2 A;  3VZU X;  2ERV A;  3HWB A;  4D64 A;  4JCH A;  4FMS A;  7PRN A;  3AA1 A;  3VZW X;  4FSP A;  3AAA B;  3PQS A;  2Y0K A;  1Q9G A;  2KXP B;  5FVN A;  4N58 A;  1ZHW A;  4BUM X;  2W81 C;  4D5U A;  4FZL A;  4PUX A;  3PQU A;  4RLC A;  2KC0 A;  1BT9 A;  1ZHT A;  3LK3 B;  2Y7S A;  3HW9 A;  4RLB A;  5EE2 A;  4AZL A;  5AFU L;  4AKR B;  5GV0 A;  2LHF A;  2XMX A;  3LK3 A;  4FSO A;  2MHL A;  1MPF A;  4G75 A;  4AKR A;  2Y0L A;  3KVD D;  4XNK A;  3LK4 1;  2XTR A;  2N2L A;  2XE2 A;  4D65 A;  2QTK A;  4LSH A;  3WI4 A;  4KR4 A;  4AYD C;  1OPF A;  3LK4 2;  5DL7 A;  3NSG A;  4FUV A;  2GE4 A;  1ZHX A;  3VE2 A;  3SY7 A;  3AAE B;  3TZG A;  4QQ1 A;  3AA0 A;  3POR A;  5ADX L;  4XNL A;  4AFK A;  4Z3T A;  1ORM A;  2PRN A;  3VE1 A;  3VY9 X;  4F4B A;  2ZFG A;  2Y2X A;  3A2S X;  4RJW A;  1QJ9 A;  4GCP A;  3AAA A;  1ZHY A;  4AUI A;  4AKM A;  2KXP A;  2K4T A;  1H6S 1;  2M07 A;  2YNK A;  2ZLD A;  1GFN A;  3EMN X;  2OMF A;  2XE3 A;  2XE1 A;  4G76 A;  2ODJ A;  4AYN A;  1P4T A;  4O4X A;  1HXX A;  2XTQ A;  4RJX A;  1IZN B;  3UPG A;  1HXT A;  4O3Z A;  5G26 A;  3AA7 B;  3SZD A;  5DL5 A;  3GP6 A;  3DA3 A;  3FYX A;  1PHO A;  3POX A;  4FRX A;  2O4V A;  4FES A;  2POR A;  1Q9F A;  4AYE C;  1GFO A;  1BXW A;  3AAE A;  4O3X B;  2X27 X;  3SYB A;  8PRN A;  3T20 A;  3JTY A;  3QRC A;  3SYS A;  2JMM A;  3VY8 X;  4LSF A;  2M06 A;  4O4U A;  3HOE A;  4GHB A;  2YPV A;  4GF4 A;  4AYM C;  1MM4 A;  4B61 A;  4LSI A;  4FRT A;  2J4U P;  1G90 A;  2MNH A;  2N2M A;  2KZ7 B;  3O0E A;  2J1N A;  4C69 X;  1PRN A;  4JFB A;  4N59 A;  2XE5 A;  4RL9 A;  4GCS A;  4U9C A;  2KDY A;  5AFU K;  1ZHZ A;  4LSE A;  3LK2 B;  6PRN A;  1IZN A;  3AA6 B;  3DA4 A;  1QJP A;  4E1T A;  3POQ A;  4O3Y A;  1BH3 A;  1HXU A;  1THQ A;  3AA7 A;  1GFP A;  3AA6 A;  4AYI D;  5JDP A;  5DL8 A;  5DL6 A;  1GFM A;  3UU2 A;  4FT6 A;  1MM5 A;  2Y0H A;  3PRN A;  3HOL A;  4O3W A;  3WI5 A;  1E54 A;  4KRA A;  4FZN A;  5T5F A;  3T0S A;  2W80 C;  4GCQ A;  3UAQ A;  4E1S A;  3SY9 A;  3V8U A;  2FGQ X;  4KR8 A;  5ADX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...