5FVNA

X-ray crystal structure of enterobacter cloacae ompe36 porin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
342
structure length
342
Chain Sequence
AEIYNKDGNKLDLYGKVDGLHYFSDDDSQDGDQTYMRLGFKGETQVNDQLTGYGQWEYQIQGNSGENENNSWTRVAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNSDFFGLVDGLNFAVQYQGKNGSASGEDQTNNGRTELRQNGDGVGGSITYNLGEGFGIGTAVSSSKRTSSQNDLTYGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGNLGWANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDLENGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDDKEFTRNAGISTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gram-negative trimeric porins have specific LPS binding sites that are essential for porin biogenesis.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Membrane protein
molecule keywords OMPC PORIN
total genus 108
structure length 342
sequence length 342
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5fvnA00
3EMNX 3HW9A 4BUMX 1GFOA 4FRXA 1PRNA 2ZLDA 2QTKA 4C69X 3UU2A 3T0SA 5PRNA 4FRTA 3SY7A 3SYBA 2PORA 3POUA 4GCQA 4AUIA 7PRNA 2OMFA 2O4VA 3SZVA 3POXA 2J4UP 1BT9A 3VZWX 1BH3A 5DL5A 4D65A 3T20A 2XE3A 1HXXA 1MPFA 3VZTX 3PRNA 1GFMA 2XE5A 4LSFA 8PRNA 2XE1A 2Y0HA 1H6S1 4FSOA 4KR8A 4FMSA 2PRNA 3WI5A 1OPFA 3VZUX 1GFPA 4D64A 2ODJA 4D5UA 6PRNA 3T24A 4FSPA 1HXUA 2XE2A 3O0EA 2Y0KA 3UPGA 3SYSA 2Y0LA 3PORA 4FOZA 5JDPA 2XG6A 5DL6A 4RJWA 2FGQX 4FT6A 5FVNA 1GFQA 4KR4A 4JFBA 5DL8A 3SY9A 3VY8X 3VY9X 5DL7A 3FYXA 4LSIA 2K4TA 3SZDA 3POQA 2Y2XA 4LSHA 4KRAA 3HWBA 4GCSA 4GCPA 1OSMA 3A2SX 2J1NA 3JTYA 3WI4A 2FGRA 1HXTA 1E54A 3NSGA 1PHOA 4LSEA 1GFNA 4RJXA 3K19A 2ZFGA
chains in the Genus database with same CATH superfamily
2M07A 4UB6O 4N74A 3EMNX 3HW9A 2R4NA 2IWWA 1G90A 4BUMX 2YPVA 1GFOA 4FRXA 5G38A 4PJ0O 1PRNA 5AFUL 2R89A 2QTKA 2ZLDA 1MM4A 3UU2A 3A0HO 3T0SA 4C69X 4C4VB 4QQ1A 2Y7SA 3AA7B 4FRTA 5PRNA 3BRYA 1Q9GA 2YNKA 2KZ7B 3AA7A 3BS0A 1T1LA 3SY7A 4AYMC 3SYBA 1ZHWA 2PORA 3POUA 4N59A 3AA6A 1MM5A 2X9KA 3LK2B 4O3XB 5G3AA 4GCQA 4AUIA 5B66O 4O4UA 2GE4A 7PRNA 4G75A 2F1CX 4O4XA 2R88A 2KDYA 2OMFA 3AA6B 3LK2A 5KAFO 3VE1A 2O4VA 2AXTO 3DA3A 3LK3B 3POXA 3SZVA 5AFUK 2J4UP 1BT9A 2KZ7A 3GP6A 3VZWX 1BH3A 3DWOX 5DL5A 4D65A 1ZHZA 3PQSA 4N58A 2WVPA 1QJ9A 4GF4A 4AKRA 3T20A 3VE2A 2WJQA 2XE3A 3V8UA 1HXXA 1MPFA 3TZGA 2XMXA 3VZTX 3PGSA 3PRNA 3QRAA 1GFMA 2LHFA 3KVDD 4AFKA 2XE5A 3LK41 4LSFA 3PF1A 4JCHA 5G26A 2W81C 4O49A 8PRNA 2XE1A 1ORMA 3AAAB 2Y0HA 1S5LO 5D5DA 2ERVA 1H6S1 3PGUA 4FSOA 2M06A 2MNHA 3AA0B 4KR8A 1BXWA 2W80C 4IL6O 4AKMA 4AYNA 4FMSA 4RLBA 1IZNA 3LK42 4AZLA 5T5FA 2PRNA 2KC0A 3PQUA 3WI5A 4AYEC 4XNLA 4O3YA 4C00A 5EE2A 4E1SA 2R4OA 5H2FO 1OPFA 2K0LA 3VZUX 4F4BA 2R8AA 1THQA 4CTDA 1GFPA 3AAEB 4D64A 4FESA 5G39A 2N2LA 2ODJA 1Q9FA 4PUXA 4D5UA 2JQYA 4O3WA 4FZNA 1ZHTA 3T24A 6PRNA 1P4TA 3QRCA 4G76A 3A0BO 3KZIO 4FSPA 4K3CA 1HXUA 2XE2A 3O0EA 2WJRA 3UAQA 2Y0KA 3UPGA 2N2MA 3SYSA 4FZMA 2Y0LA 4N75A 5GV0A 2R4LA 4AYID 2MHLA 1YS5A 3PORA 4FQEA 4K3BA 4FOZA 3G7GA 5JDPA 4U9CA 2XG6A 2F1TA 2R4PA 3BRZA 5DL6A 4RJWA 3WU2O 3RBHA 2FGQX 3AAEA 4RLCA 4FT6A 4GHBA 5FVNA 1GFQA 3AA1A 2X27X 4JFBA 4KR4A 5DL8A 3DWNA 4C4VA 3C5OA 4O3ZA 5ADXK 4Z3TA 2F1VA 4XNKA 3SY9A 5ADXL 1T16A 5B5EO 3VY8X 3JCUO 4UB8O 3VY9X 5DL7A 3FYXA 4PR7A 4FZLA 4LSIA 2K4TA 2IWVA 1ZHYA 3DA4A 3POQA 3SZDA 2Y2XA 1QJPA 4B61A 1ZHXA 4LSHA 2LFUA 2XTQA 2JMMA 2KXPB 3HOEA 4KRAA 4RL9A 3HWBA 4GCSA 4E1TA 1QJ8A 5IYUA 5GTIO 4GCPA 1OSMA 5KAIO 1IZNB 3PGRA 3NJTA 5TISO 3A2SX 3AA0A 2J1NA 3LK3A 4AKRB 4FUVA 3AAAA 3JTYA 2FGRA 1HXTA 1E54A 3NSGA 5E79O 3WI4A 1PHOA 3DZMA 4LSEA 4AYDC 2KXPA 1GFNA 3AA1B 3HOLA 5GTHO 4RJXA 2XTRA 3K19A 2ZFGA
chains in the Genus database with same CATH topology
2M07A 3EMNX 3HW9A 1G90A 4BUMX 2YPVA 1GFOA 4FRXA 1PRNA 5AFUL 2ZLDA 2QTKA 4C69X 1MM4A 3UU2A 3T0SA 4QQ1A 2Y7SA 3AA7B 4FRTA 5PRNA 1Q9GA 2YNKA 2KZ7B 3AA7A 3SY7A 4AYMC 3SYBA 1ZHWA 2PORA 3POUA 4N59A 3AA6A 1MM5A 3LK2B 4O3XB 4GCQA 4AUIA 4O4UA 2GE4A 7PRNA 4G75A 4O4XA 2KDYA 2OMFA 3AA6B 3LK2A 3VE1A 2O4VA 3DA3A 3LK3B 3POXA 3SZVA 5AFUK 2J4UP 1BT9A 2KZ7A 3GP6A 3VZWX 1BH3A 5DL5A 4D65A 1ZHZA 3PQSA 4N58A 1QJ9A 4GF4A 4AKRA 3T20A 3VE2A 2XE3A 3V8UA 1HXXA 1MPFA 3TZGA 2XMXA 3VZTX 3PRNA 3QRAA 4AFKA 1GFMA 2LHFA 3KVDD 2XE5A 3LK41 4LSFA 4JCHA 5G26A 8PRNA 2W81C 4O49A 2XE1A 1ORMA 3AAAB 2Y0HA 5D5DA 2ERVA 1H6S1 4FSOA 2M06A 2MNHA 3AA0B 4KR8A 1BXWA 2W80C 4AKMA 4AYNA 4FMSA 4RLBA 1IZNA 3LK42 4AZLA 5T5FA 2PRNA 2KC0A 3PQUA 3WI5A 4AYEC 4XNLA 4O3YA 5EE2A 4E1SA 1OPFA 2K0LA 3VZUX 4F4BA 1THQA 1GFPA 3AAEB 4D64A 4FESA 2N2LA 2ODJA 1Q9FA 4PUXA 4D5UA 6PRNA 4O3WA 4FZNA 1ZHTA 3T24A 1P4TA 3QRCA 4G76A 4FSPA 1HXUA 2XE2A 3O0EA 3UAQA 2Y0KA 3UPGA 2N2MA 3SYSA 4FZMA 2Y0LA 5GV0A 4AYID 2MHLA 1YS5A 3PORA 4FOZA 3G7GA 5JDPA 4U9CA 2XG6A 2F1TA 5DL6A 4RJWA 3RBHA 2FGQX 3AAEA 4RLCA 4FT6A 4GHBA 5FVNA 1GFQA 3AA1A 2X27X 4JFBA 4KR4A 5DL8A 3C5OA 4O3ZA 5ADXK 4Z3TA 2F1VA 4XNKA 3SY9A 5ADXL 3VY8X 3VY9X 5DL7A 3FYXA 4FZLA 4LSIA 2K4TA 3SZDA 1ZHYA 3DA4A 3POQA 2Y2XA 1QJPA 4B61A 1ZHXA 4LSHA 2LFUA 2XTQA 2JMMA 2KXPB 3HOEA 4KRAA 4RL9A 3HWBA 4GCSA 4E1TA 1QJ8A 5IYUA 4GCPA 1OSMA 1IZNB 3A2SX 3AA0A 2J1NA 3LK3A 4AKRB 4FUVA 3AAAA 3JTYA 2FGRA 1HXTA 1E54A 3NSGA 3WI4A 4AYDC 1PHOA 4LSEA 2KXPA 1GFNA 3AA1B 3HOLA 4RJXA 2XTRA 3K19A 2ZFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMN X;  3HW9 A;  4BUM X;  1GFO A;  4FRX A;  1PRN A;  2ZLD A;  2QTK A;  4C69 X;  3UU2 A;  3T0S A;  5PRN A;  4FRT A;  3SY7 A;  3SYB A;  2POR A;  3POU A;  4GCQ A;  4AUI A;  7PRN A;  2OMF A;  2O4V A;  3SZV A;  3POX A;  2J4U P;  1BT9 A;  3VZW X;  1BH3 A;  5DL5 A;  4D65 A;  3T20 A;  2XE3 A;  1HXX A;  1MPF A;  3VZT X;  3PRN A;  1GFM A;  2XE5 A;  4LSF A;  8PRN A;  2XE1 A;  2Y0H A;  1H6S 1;  4FSO A;  4KR8 A;  4FMS A;  2PRN A;  3WI5 A;  1OPF A;  3VZU X;  1GFP A;  4D64 A;  2ODJ A;  4D5U A;  6PRN A;  3T24 A;  4FSP A;  1HXU A;  2XE2 A;  3O0E A;  2Y0K A;  3UPG A;  3SYS A;  2Y0L A;  3POR A;  4FOZ A;  5JDP A;  2XG6 A;  5DL6 A;  4RJW A;  2FGQ X;  4FT6 A;  5FVN A;  1GFQ A;  4KR4 A;  4JFB A;  5DL8 A;  3SY9 A;  3VY8 X;  3VY9 X;  5DL7 A;  3FYX A;  4LSI A;  2K4T A;  3SZD A;  3POQ A;  2Y2X A;  4LSH A;  4KRA A;  3HWB A;  4GCS A;  4GCP A;  1OSM A;  3A2S X;  2J1N A;  3JTY A;  3WI4 A;  2FGR A;  1HXT A;  1E54 A;  3NSG A;  1PHO A;  4LSE A;  1GFN A;  4RJX A;  3K19 A;  2ZFG A; 
#chains in the Genus database with same CATH topology
 2M07 A;  4UB6 O;  4N74 A;  3EMN X;  3HW9 A;  2R4N A;  2IWW A;  1G90 A;  4BUM X;  2YPV A;  1GFO A;  4FRX A;  5G38 A;  4PJ0 O;  1PRN A;  5AFU L;  2R89 A;  2QTK A;  2ZLD A;  1MM4 A;  3UU2 A;  3A0H O;  3T0S A;  4C69 X;  4C4V B;  4QQ1 A;  2Y7S A;  3AA7 B;  4FRT A;  5PRN A;  3BRY A;  1Q9G A;  2YNK A;  2KZ7 B;  3AA7 A;  3BS0 A;  1T1L A;  3SY7 A;  4AYM C;  3SYB A;  1ZHW A;  2POR A;  3POU A;  4N59 A;  3AA6 A;  1MM5 A;  2X9K A;  3LK2 B;  4O3X B;  5G3A A;  4GCQ A;  4AUI A;  5B66 O;  4O4U A;  2GE4 A;  7PRN A;  4G75 A;  2F1C X;  4O4X A;  2R88 A;  2KDY A;  2OMF A;  3AA6 B;  3LK2 A;  5KAF O;  3VE1 A;  2O4V A;  2AXT O;  3DA3 A;  3LK3 B;  3POX A;  3SZV A;  5AFU K;  2J4U P;  1BT9 A;  2KZ7 A;  3GP6 A;  3VZW X;  1BH3 A;  3DWO X;  5DL5 A;  4D65 A;  1ZHZ A;  3PQS A;  4N58 A;  2WVP A;  1QJ9 A;  4GF4 A;  4AKR A;  3T20 A;  3VE2 A;  2WJQ A;  2XE3 A;  3V8U A;  1HXX A;  1MPF A;  3TZG A;  2XMX A;  3VZT X;  3PGS A;  3PRN A;  3QRA A;  1GFM A;  2LHF A;  3KVD D;  4AFK A;  2XE5 A;  3LK4 1;  4LSF A;  3PF1 A;  4JCH A;  5G26 A;  2W81 C;  4O49 A;  8PRN A;  2XE1 A;  1ORM A;  3AAA B;  2Y0H A;  1S5L O;  5D5D A;  2ERV A;  1H6S 1;  3PGU A;  4FSO A;  2M06 A;  2MNH A;  3AA0 B;  4KR8 A;  1BXW A;  2W80 C;  4IL6 O;  4AKM A;  4AYN A;  4FMS A;  4RLB A;  1IZN A;  3LK4 2;  4AZL A;  5T5F A;  2PRN A;  2KC0 A;  3PQU A;  3WI5 A;  4AYE C;  4XNL A;  4O3Y A;  4C00 A;  5EE2 A;  4E1S A;  2R4O A;  5H2F O;  1OPF A;  2K0L A;  3VZU X;  4F4B A;  2R8A A;  1THQ A;  4CTD A;  1GFP A;  3AAE B;  4D64 A;  4FES A;  5G39 A;  2N2L A;  2ODJ A;  1Q9F A;  4PUX A;  4D5U A;  2JQY A;  4O3W A;  4FZN A;  1ZHT A;  3T24 A;  6PRN A;  1P4T A;  3QRC A;  4G76 A;  3A0B O;  3KZI O;  4FSP A;  4K3C A;  1HXU A;  2XE2 A;  3O0E A;  2WJR A;  3UAQ A;  2Y0K A;  3UPG A;  2N2M A;  3SYS A;  4FZM A;  2Y0L A;  4N75 A;  5GV0 A;  2R4L A;  4AYI D;  2MHL A;  1YS5 A;  3POR A;  4FQE A;  4K3B A;  4FOZ A;  3G7G A;  5JDP A;  4U9C A;  2XG6 A;  2F1T A;  2R4P A;  3BRZ A;  5DL6 A;  4RJW A;  3WU2 O;  3RBH A;  2FGQ X;  3AAE A;  4RLC A;  4FT6 A;  4GHB A;  5FVN A;  1GFQ A;  3AA1 A;  2X27 X;  4JFB A;  4KR4 A;  5DL8 A;  3DWN A;  4C4V A;  3C5O A;  4O3Z A;  5ADX K;  4Z3T A;  2F1V A;  4XNK A;  3SY9 A;  5ADX L;  1T16 A;  5B5E O;  3VY8 X;  3JCU O;  4UB8 O;  3VY9 X;  5DL7 A;  3FYX A;  4PR7 A;  4FZL A;  4LSI A;  2K4T A;  2IWV A;  1ZHY A;  3DA4 A;  3POQ A;  3SZD A;  2Y2X A;  1QJP A;  4B61 A;  1ZHX A;  4LSH A;  2LFU A;  2XTQ A;  2JMM A;  2KXP B;  3HOE A;  4KRA A;  4RL9 A;  3HWB A;  4GCS A;  4E1T A;  1QJ8 A;  5IYU A;  5GTI O;  4GCP A;  1OSM A;  5KAI O;  1IZN B;  3PGR A;  3NJT A;  5TIS O;  3A2S X;  3AA0 A;  2J1N A;  3LK3 A;  4AKR B;  4FUV A;  3AAA A;  3JTY A;  2FGR A;  1HXT A;  1E54 A;  3NSG A;  5E79 O;  3WI4 A;  1PHO A;  3DZM A;  4LSE A;  4AYD C;  2KXP A;  1GFN A;  3AA1 B;  3HOL A;  5GTH O;  4RJX A;  2XTR A;  3K19 A;  2ZFG A; 
#chains in the Genus database with same CATH homology
 2M07 A;  3EMN X;  3HW9 A;  1G90 A;  4BUM X;  2YPV A;  1GFO A;  4FRX A;  1PRN A;  5AFU L;  2ZLD A;  2QTK A;  4C69 X;  1MM4 A;  3UU2 A;  3T0S A;  4QQ1 A;  2Y7S A;  3AA7 B;  4FRT A;  5PRN A;  1Q9G A;  2YNK A;  2KZ7 B;  3AA7 A;  3SY7 A;  4AYM C;  3SYB A;  1ZHW A;  2POR A;  3POU A;  4N59 A;  3AA6 A;  1MM5 A;  3LK2 B;  4O3X B;  4GCQ A;  4AUI A;  4O4U A;  2GE4 A;  7PRN A;  4G75 A;  4O4X A;  2KDY A;  2OMF A;  3AA6 B;  3LK2 A;  3VE1 A;  2O4V A;  3DA3 A;  3LK3 B;  3POX A;  3SZV A;  5AFU K;  2J4U P;  1BT9 A;  2KZ7 A;  3GP6 A;  3VZW X;  1BH3 A;  5DL5 A;  4D65 A;  1ZHZ A;  3PQS A;  4N58 A;  1QJ9 A;  4GF4 A;  4AKR A;  3T20 A;  3VE2 A;  2XE3 A;  3V8U A;  1HXX A;  1MPF A;  3TZG A;  2XMX A;  3VZT X;  3PRN A;  3QRA A;  4AFK A;  1GFM A;  2LHF A;  3KVD D;  2XE5 A;  3LK4 1;  4LSF A;  4JCH A;  5G26 A;  8PRN A;  2W81 C;  4O49 A;  2XE1 A;  1ORM A;  3AAA B;  2Y0H A;  5D5D A;  2ERV A;  1H6S 1;  4FSO A;  2M06 A;  2MNH A;  3AA0 B;  4KR8 A;  1BXW A;  2W80 C;  4AKM A;  4AYN A;  4FMS A;  4RLB A;  1IZN A;  3LK4 2;  4AZL A;  5T5F A;  2PRN A;  2KC0 A;  3PQU A;  3WI5 A;  4AYE C;  4XNL A;  4O3Y A;  5EE2 A;  4E1S A;  1OPF A;  2K0L A;  3VZU X;  4F4B A;  1THQ A;  1GFP A;  3AAE B;  4D64 A;  4FES A;  2N2L A;  2ODJ A;  1Q9F A;  4PUX A;  4D5U A;  6PRN A;  4O3W A;  4FZN A;  1ZHT A;  3T24 A;  1P4T A;  3QRC A;  4G76 A;  4FSP A;  1HXU A;  2XE2 A;  3O0E A;  3UAQ A;  2Y0K A;  3UPG A;  2N2M A;  3SYS A;  4FZM A;  2Y0L A;  5GV0 A;  4AYI D;  2MHL A;  1YS5 A;  3POR A;  4FOZ A;  3G7G A;  5JDP A;  4U9C A;  2XG6 A;  2F1T A;  5DL6 A;  4RJW A;  3RBH A;  2FGQ X;  3AAE A;  4RLC A;  4FT6 A;  4GHB A;  5FVN A;  1GFQ A;  3AA1 A;  2X27 X;  4JFB A;  4KR4 A;  5DL8 A;  3C5O A;  4O3Z A;  5ADX K;  4Z3T A;  2F1V A;  4XNK A;  3SY9 A;  5ADX L;  3VY8 X;  3VY9 X;  5DL7 A;  3FYX A;  4FZL A;  4LSI A;  2K4T A;  3SZD A;  1ZHY A;  3DA4 A;  3POQ A;  2Y2X A;  1QJP A;  4B61 A;  1ZHX A;  4LSH A;  2LFU A;  2XTQ A;  2JMM A;  2KXP B;  3HOE A;  4KRA A;  4RL9 A;  3HWB A;  4GCS A;  4E1T A;  1QJ8 A;  5IYU A;  4GCP A;  1OSM A;  1IZN B;  3A2S X;  3AA0 A;  2J1N A;  3LK3 A;  4AKR B;  4FUV A;  3AAA A;  3JTY A;  2FGR A;  1HXT A;  1E54 A;  3NSG A;  3WI4 A;  4AYD C;  1PHO A;  4LSE A;  2KXP A;  1GFN A;  3AA1 B;  3HOL A;  4RJX A;  2XTR A;  3K19 A;  2ZFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...