5FW9A

Human spectrin sh3 domain d48g, e7y, k60y
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'KYLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKYLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
molecule tags Structural protein
source organism Homo sapiens
publication title Human Spectrin SH3 Domain D48G, E7Y, K60Y
rcsb
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fw9A00
1FYNA 2OI3A 5FW9A 1PRLC 1PWTA 3C0CA 2EGEA 2EYYA 2K7AA 4J9BA 4CC2A 2DRKA 5GJWB 4FSSA 2M0YA 4F17A 4J9FA 2LJ0A 1JU5C 1GCQC 2CREA 2YUPA 3M0PA 4OMNA 1GBQA 2AKKA 2O31A 2EGAA 2DILA 4LN2A 2CUBA 1YWPA 1K4US 2KR3A 1FMKA 4OMMA 2YUQA 2KYBA 1ZX6A 2KRMA 5GJVB 2SRCA 1ARKA 3PVLA 3A98A 4JPBW 2DVJA 1ABQA 1E7OA 1MV0B 2YUNA 1AWXA 1MV3A 1WXUA 1QLYA 1K9AA 1AWJA 2ECZA 2ENMA 1N5ZA 1NG2A 3EG2A 3TSWA 1JXOA 4GBQA 4GLMA 2CDTA 1V1CA 1ABOA 5IH2A 3REBB 1BBZA 1AD5A 1UE9A 3EGUA 1Y0MA 2RN8A 2AK5A 1ZSGA 1PNJA 4LUEA 3UA6A 2L3QA 2DX1A 2LJ1A 2W10A 1PKSA 1G83A 2D0NA 1UJYA 1WIEA 2J6KA 3PVQA 2FG0A 4AFUC 3FJ5A 2ROLA 2LCSA 1GL5A 1KSWA 2X3WD 3UATA 1NLOC 3H0HA 2ED0A 4F16A 1AZGB 2FRYA 1EFNA 3ULRB 2DRMA 1TUCA 4CC3A 2EYXA 2DJQA 5IXFA 2FPEA 1SHFA 1YNZA 1HJDA 3EG1A 1KJWA 1K76A 4OMPA 4ESRA 3KFVA 4IIOA 2CSIA 2FPFA 2L3PA 2F2VA 2LZ6B 2IIMA 2DE0X 2HEQA 2DL3A 3M0QA 1WLPB 4LNPA 1SPKA 1JEGA 2CH4W 3JV3A 2PNIA 2B86A 3SEMA 5FWCA 1K0XA 3VS1A 1NM7A 1PRMC 3UA7A 4A63B 4JJDA 4HVVA 5IXBA 1GFDA 1RLQC 3NPFA 1X69A 3NMZC 1IO6A 2BTTA 3R6NA 1S1NA 2A36A 4J9HA 4OMOA 1YN8A 4AFSC 1VA7A 2JTEA 4LUDA 3RBBB 2DA9A 4HXJA 3VS0A 1U3OA 1U5SA 2RQTA 2EKHA 2HBWA 2A37A 5IHNA 4J9GA 4RTZA 1WDXA 2O9SA 3SHWA 1AZEA 4KRTA 2JS2A 2DL5A 2OAWA 1OOTA 4AFQC 2KT1A 2YT6A 5EC7A 2LNHB 2OJ2A 2DBKA 2YSQA 3M0TA 2JM9A 2AZSA 1XOVA 1UGVA 2F2WA 1GFCA 4M4ZA 2RNAA 3TSZA 1NLPC 1E6HA 4CC7A 2DMOA 2NUZA 1GCPA 2JM8A 2C0TA 2GGRA 1YWOA 4Z8AA 4EIKA 2V1QA 4IIMA 2DLPA 1I1JA 1K0SA 1NYGA 2J7IA 2FPDA 3THKA 2YUOA 3QWYA 2GTOA 3H0FA 2FRWA 2HCKA 4R0KA 2DF6A 3UF4A 3NGPA 3I35A 1H3HA 1OPKA 2K3BA 1YCSB 2KEAA 4J9EA 1I0CA 1QKWA 4J9DA 1WXTA 2ROTA 2LJ3A 5ECAA 1B07A 4CC4B 2KROA 3EHQA 1M3CA 4RTYA 1W1FA 5L23A 2SEMA 1H8KA 2LQWA 1T3LA 2KXDA 2X3XD 2JW4A 2XMFA 2MOXA 2D1XA 4AG2C 4WCIA 1WX6A 2DNUA 2O2OA 2MIOA 3I5RA 3VS6A 1JO8A 1OV3A 2KNBB 2DL4A 2K6DA 4JZ4A 1UG1A 2JS0A 1NEBA 4OMLA 4J9IA 4Z88A 5I22A 1M3BA 1M30A 2VKNA 1ZUYA 1AWWA 1SSHA 3EHRA 4X1VA 2BZXA 2DL8A 4RTXA 2DYBA 2EYZA 2F2XA 1PKTA 2EQIA 2RPNA 4OMQA 2JMAA 2GQIA 2JT4A 1VYVA 2RF0A 1BU1A 2LP5A 1AOJA 1SRMA 5FWBA 2W0ZA 2L0AA 2CH4A 3O5ZA 2V1RA 2I0NA 1W6XA 1GBRA 3IQLA 1M3AA 2AKLA 2C0IA 1GRIA 3U23A 1M8MA 2A08A 2BZ8A 1ZUUA 1MUZA 1VYTA 1HSQA 2YDLA 2J6OA 1U06A 2DL7A 2A28A 2JMCA 2DM1A 2HSPA 2RQUA 1Z9ZA 3VS3A 3VS2A 4RTWA 4DEXA 2L2PA 2LQNA 2O9VA 3I5SA 2ESWA 4K11A 5IHIA 4D8DA 2GBQA 3VRZA 4Z89A 1CKAA 2D8JA 4RTUA 1J3TA 2PZ1A 1TUDA 2J6FA 1SRLA 2O88A 3GBQA 2CSQA 1VYUA 2RQWA 2ED1A 2EW3A 3VS5A 1AEYA 3H41A 2D8HA 2NWMA 4JJCA 2GTJA 1X2QA 2EYWA 3M0SA 2HDAA 2H8HA 1RI9A 2P4RA 1I07A 1WYXA 2KXCA 1KIKA 1W70A 4J9CA 3VS7A 1B3QA 1ZBJA 4AFZC 1T0HA 1QWEA 2KBTA 4QT7A 4HVUA 1WI7A 1ZLMA 2KGTA 4LE9A 4JZ3A 1H92A 1QKXA 1UECA 2J06A 2M51A 4ORZA 1NEGA 1QCFA 1UHCA 4Y92A 1X27A 2VVKA 3QWXX 3PE0A 5HCKA 5I11A 2C0OA 1T3SA 1UHFA 1CSKA 2CUDA 2RMOA 2MCNA 4RTVA 1K1ZA 1TG0A 2LX7A 1AVZC 1X2KA 2CT3A 2VWFA 2CT4A 4RTTA 2JXBA 3I9QA 2DBMA 4E6RA 1OEBA 1OPLA 2QDLA 2FO0A 4F14A 1UUEA 3ZL7C 1GCQA 5IHKA 1PHTA 2L3SA 4DEYA 3EG0A 2AZVA 1X6GA 2KYMA 3LH5A 4D8KA 1HD3A 4HVWA 2RQRA 1UJ0A 1X43A 1UFFA 1KFZA 1Y57A 2GNCA 1SEMA 3M0UA 2G6FX 2KE9A 2RQVA 2EGCA 2E5KA 3VRYA 1QWFA 1ZUKA 3NHNA 4AG1C 1G2BA 2K2MA 3RNJA 1T0JA 4JJBA 1A0NB 1LCKA 1BB9A 2LMJA 3TVTA 3EG3A 1YP5A 1CKBA 4HCKA 2PTKA 1UTIA 1NYFA 2KRSA 2K9GA 1RLPC 1UDLA 2BZYA 2KT8A 2EPDA 4ZNXA 1Z9QA 1WFWA 2EVRA 2ABLA 1WA7A 3H0IA 2FEIA 2EBPA 3M0RA 1X6BA 1AWOA 2K79A 1JXMA 1SHGA 3REAB 4RUGA 2KRNA 3VS4A 2J05A 1BK2A 1JQQA 1E6GA 3CQTA 1M27C 1RUWA 1WXBA
chains in the Genus database with same CATH superfamily
3BW1A 1K9MR 1PWTA 3C0CA 2NUTA 2BIVA 3G6EA 2K7AA 3WVEB 2B8AA 3UPUA 4LD9K 2DRKA 5GJWB 5CCAA 4M78D 1IGUA 4M75F 2MF2A 3CD6Q 1GCQC 1NJIR 2HNIA 3MEVA 4OMNA 3A8MB 4FYXB 3CCLT 2KR3A 1FMKA 1NPPA 1VQLT 1ZX6A 1G3SA 3VU3C 1PM3A 3PVLA 1YITT 5GMKh 4JPBW 4FSXA 3OYDA 3CD6A 1MV0B 2YUNA 1MV3A 2NUTB 3SWNC 2ENMA 4NOYA 1X01A 5GMKj 5KCOA 5GAMh 3TSWA 3WXMB 4R55A 4GBQA 2CDTA 1ZSZA 1V1CA 4E7KA 3EGUA 1Y0MA 2QQ9A 1PNJA 5GMKe 2FHDA 2P0KA 5LJ5f 3I56A 2QGFB 3UDCA 1PKSA 1G83A 3RDVA 4NL3A 2COYA 1DJ7B 3QXEB 2D0NA 1UJYA 1QQJA 1RADB 3OS0A 3DKMA 3UATA 1M2VB 4B9WA 3KBGA 5CR2A 1AZGB 3MP8A 4ZTFA 2FRYA 3EFOB 1B34B 4JLIA 2X4YA 2DJQA 3CC4T 4M7AB 1VQ5T 1QP2A 1SHFA 1N27A 1VQKT 1HJDA 4BE0A 1KHIA 2RJEA 1O75A 1KJWA 2QTVA 2HD0A 2EJGA 1RAHB 1FMWA 2IIMA 4KH0B 2DD4A 2DE0X 2HEQA 1WLPB 1SPKA 3HFNA 4A4HA 2B86A 1K73R 1VQNT 5FWCA 4QVCA 1NM7A 1D1AA 2FYKA 1JJ2P 4A54A 4HVVA 4HT8A 1VQ4Q 2MI6A 4A53A 3S3OA 1MHNA 3R6NA 4F7UG 4J9HA 4OMOA 2RB6A 3CEYA 4AFSC 5GANh 5GAN2 2JTEA 1SG5A 2DA9A 1PCXA 2JTMA 4PNOA 4E7LA 3VS0A 1U3OA 2RQTA 2EKHA 3RKWA 3S3MA 2A37A 2NUPB 1W2BP 1RAAB 4J9GA 3ZEHA 3SHWA 2O9SA 1AZEA 2JS2A 1KQSS 2CZ0B 2OAWA 5I21A 5EG2A 3CCMA 4AFQC 4ELZC 2YSQA 4IUUA 3M0TA 1XQHA 4OMFB 2JM9A 1VQPT 2AZSA 2P0PA 2F2WA 2WSEE 1M2OA 2V26A 3JSCA 4M4ZA 2RNAA 1YJNQ 1K8AU 3MJXA 1E6HA 4CC7A 4N0AA 1VQOA 2PUKB 3M9QA 1UB4A 1VQMA 1M90C 2PVGB 1GCPA 2C06A 3JCMe 4ZN3A 4Z8AA 4EIKA 2DXCA 5LJ3e 2Y4XA 1H3ZA 2CYZB 4QQDA 1IB8A 2YUOA 3QWYA 3H0FA 4ME7A 2FRWA 5I2SA 4FL6A 4C92F 3JCMc 3GOXA 4JDSA 3MKDA 2LCLA 5DY9A 1YCSB 1I0CA 4J9DA 4FW2A 1KD1R 8AT1B 4RTYA 5LJ5g 1W1FA 3PGGA 2SEMA 5L23A 1T3LA 2KXDA 2X3XD 4C5EA 1XTDA 2E4HA 3C4SA 3JCMb 4BY6B 1JO8A 5GAMj 1BCOA 2DL4A 2ZPHB 5M9OA 1BIBA 3M54A 1D09B 4PJOF 1NEBA 4OMLA 3OYFA 2DETA 2EIFA 4J9IA 5I22A 1M3BA 1M30A 2RK1A 2VKNA 3FIFA 2M0OA 2Z0WA 1SSHA 3X28B 1G3WA 3PMIA 3OSVA 1ZA1B 3OYNA 2X4WA 2DL8A 4RTXA 4VUBA 1S72Q 2DEUA 1VQ5Q 3QSUA 2FZCB 2JT4A 3M57A 3L2WA 2LP5A 5FWBA 2VC8A 4Z02A 2L0AA 2CH4A 2V1RA 1JB0E 1W6XA 3IQLA 2ZPFB 1TUGB 3CD6T 3CC2Q 2COWA 2AKLA 1ZUUA 4C8QD 1HSQA 2J6OA 2JMCA 1I8FA 1JJ2A 3VS3A 4JS4A 2L2PA 4J83A 4LDVA 3RKYA 2ZPBB 5IHIA 3GIBA 1QCOA 2GBQA 4EPCA 4Z89A 4RTUA 3CCLQ 2PZ1A 3MCAB 4M7AC 4OF1A 1BIAA 2CSQA 2DVEA 4BB7A 1VYUA 1SF9A 2D8HA 4N0AC 2GTJA 3CMAA 3GLXA 3M0SA 2L3RA 4IKFA 4PJOB 1MMDA 2HDAA 4M7AF 5KYWA 3L2RA 3CCSA 1WYXA 2KXCA 4J9CA 2XD0A 4RCCA 3G7ZA 2JNGA 3LGFA 4Y28E 1B3QA 4C92G 3CC7A 2KBTA 2JZ2A 2QASA 3L2VA 2DIQA 4RCBA 1UECA 1N9SA 2GFAA 3VKIA 4OVAA 3EGXB 1WHLA 1WJSA 5CKEA 3QWXX 4EMKC 2CGHA 2C0OA 4PFOA 1EIFA 4M78F 1VQ9Q 2LX7A 4RTTA 4DOWA 4IUPA 4L5GA 3N5BB 2NUPA 3ZL7C 4LD6A 2XG8D 5GMKi 1XJWB 1PSEA 3EG0A 1EX4A 2RJCA 1VQLA 1HD3A 4PLLA 1V76A 4PJNA 2RQRA 5GAOr 1X6OA 2E12A 1SKUB 3BE3A 4M75A 1Q82C 5FRMA 1KFZA 3CMEA 2GNCA 1ZBXA 2K2VA 2KE9A 3CCEA 2RQVA 2EGCA 3CCRQ 2EJ9A 4F7UF 3GP8A 1ZUKA 2A7YA 2OTLQ 2EAYA 2LC4A 2ZGWA 2XDDA 1BB9A 4LDWA 3F70A 1UTIA 4IUTA 4KT0E 1VIFA 2QXFA 2BZYA 2E6NA 2KT8A 1WQ7A 4DOVA 1VQ4T 1VQ8A 9ATCB 2ABLA 5GAN3 3FB9A 1NZ9A 2EBPA 2D0QB 1K73U 3EH1A 2BE9B 1AWOA 2K79A 1UEBA 1NPRA 3CCRA 3CCVA 1BK2A 1E6GA 3ER0A 4XTWA 1YFNA 1WHJA 1FYNA 3KUFA 1YITA 1PRLC 3OYHA 1JRIA 3PFSA 2DAQA 2LVMA 3JCMX 5GAOp 4FSSA 2E64A 4F17A 1M1KU 4HT9A 2VUBA 3C12A 2LJ0A 1IGQA 1JU5C 3QKJA 3R6OA 4QKUA 3MP1A 2R57A 4KGXB 1GBQA 2O31A 2DILA 3I56T 2FL7A 1YIJQ 4J8OA 4OMMA 4F7UE 1BI2A 2KRMA 2WSCE 3E2UA 3CCUT 2L5QA 2YLBA 5GJVB 1QW1A 2F5KA 3P8HA 1VQPA 3FRNA 1RAEB 4PKCC 2RD1A 4QVZA 3OYLA 4EDUA 1N8RR 3WVDB 1C6VX 5GAN6 4WTOB 1QLYA 1K9AA 5GANg 1VQOT 2ECZA 2VXFA 3EG2A 3T9NA 5LJ3f 1HK9A 2HL3A 4M77E 1QVFS 3BY7A 1IREB 5D6YA 3JB9I 3EH2A 1ZSZC 4BD3A 3REBB 1VQNQ 4C0GA 1D0ZA 5A0DA 5CAIA 1UE9A 3CBOA 1ZSGA 4BDZA 2L3QA 4BE1A 1RI0A 2QEXT 3QYHB 3I55Q 3G6ET 3G4SQ 4PK4A 2V8JA 2DTIA 3PVQA 2IVWA 3FJ5A 3SWNB 5CQYA 4D6WA 3CMEQ 1GL5A 1KSWA 2VASA 1NLOC 3H0HA 3OBYA 2RO0A 3EFRA 3JB9J 4CC3A 3HFOA 2FPEA 1IXDA 4OB1B 1YNZA 4ANJA 1Q81U 2E41A 3G4SA 5IAYA 4OMPA 4B6MA 1TWBA 2CSIA 4CI0C 4ELYC 2F2VA 2LZ6B 4JRQA 1K8AC 3M0QA 3PIPA 1JEGA 5LJ5e 2JUFA 3SEMA 3BDLA 3LLRA 1PRMC 4LXCA 3UA7A 4A63B 2LX9A 3NPFA 1M9SA 3PIOA 2YRCA 1YJNT 1IO6A 4C92A 5IN1A 1S1NA 3QZ5B 3CPFA 2A36A 3RIRA 3OW2A 2D9TA 3FLGA 4M77A 4OB2B 2LCCA 1V29B 4N4GA 3L2UA 3VYHB 4M75D 1Q86R 1MGQA 2WSFE 2XICA 4C0ZA 4C8QC 1M1FA 1KD1U 4ATOA 3P8BB 2M1HA 2RJFA 4PL6A 3LWIA 5KCHA 1Q86C 4BUGA 2KT1A 1FWZA 2YT6A 4ZN1A 5EC7A 2LNHB 2DBKA 3VUZA 2IG0A 3DLLA 1XOVA 4PJOA 2ZZDA 4IURA 1HXDA 2DTOA 5GAOl 2DMOA 2Y90A 3BDUA 3UT1A 1VQ7A 2DLPA 4KGVB 1YJWT 3VV0A 1K0SA 5DM7R 2EYQA 3CCMQ 1WPYA 3FEOA 5GAOn 1VQNA 2ZCFB 2OTJQ 4WF2A 1K8AR 3MEUA 3QBYA 3CC7T 3RESA 1H3HA 4BDYA 1N8RC 3QJ6A 2YHTA 2JJ9A 2K3BA 4M7DA 2ROTA 2LJ3A 4CC4B 1S72T 1M3CA 4C0FA 2QEXA 1M1GA 4IUQA 3VYGA 1UGPB 2JW4A 3PNWC 3VUBA 2GQVA 1WHGA 4WCIA 1WX6A 2KDSA 1IZ6A 4B9XA 2A3LA 1OV3A 4JRPA 1PC0A 1UG1A 3L2QA 5GAOm 1ZSZB 1U1SA 2MYSA 4Z88A 2COZA 1ZUYA 1AWWA 1YI2Q 2R5MA 2QI2A 4X1VA 2WACA 2R5AA 2BKDN 1MMNA 2BZXA 1LPLA 4GY5A 2EYZA 2F2XA 2HKNA 2M02A 3H6ZA 3L2ZA 2JN0A 1C1AA 4PJOE 2GQIA 1BI0A 4FM4B 5GMKm 2W0ZA 4NS5A 4MZPA 1UGQB 3JB9F 3SDZA 4R56A 1YI2A 4C8QB 1GRIA 3U23A 1M8MA 4DQ2A 2BZ8A 3G71T 2YXYA 4OB3B 4LDXA 4XU3A 4CRIA 3X25B 5CIUA 2CP3A 4M78A 2RI5A 3QO3A 3JCMd 2O9VA 3OYAA 4EMKA 1M90U 4BI3A 2G3RA 3VRZA 3M53A 5C6SA 2LT4A 2P4TA 2HQEA 3OS2A 3RERA 1J3TA 1TUDA 4NL2A 2O88A 5KYYA 1Q82R 2JOYA 2K3XA 1AEYA 3H41A 2NWMA 3JCMJ 2BUDA 3CCUQ 4XU1A 2DKGA 5C0MA 3D7SB 4J6YA 1G5VA 4E47A 3QZ9B 1I07A 5FRNA 2JVVA 4F7UA 3HKSA 3JB9D 2DXUA 3X24B 3CCRT 3CCVT 3I55T 1ZBJA 4AFZC 3CXCA 1YHQQ 3NTKA 3INZA 3HRUA 4LE9A 2J06A 1RABB 2RHZA 4ORZA 8ATCB 1QCFA 5KYNA 1X27A 5I11A 2CZ6B 2QEXQ 5IT9E 1CSKA 2MCNA 4RTVA 1K1ZA 1TG0A 3LGLA 4C8QF 2CT4A 1VQ5A 2PU9B 1QVGA 4M75B 3J80E 3RUXA 1OPLA 3OYYA 2QDLA 2FO0A 2PVOB 4F14A 4M77B 1VOMA 2KQWA 2L3SA 3MP6A 3CPWA 1WHHA 1X6GA 2KYMA 1OI1A 4RG2A 1PG5B 2EWNA 2OX7A 5HK3A 3JCMW 2DXBA 4HVWA 1UJ0A 2EJFA 3OMCA 2O4XA 4PJOG 2PQWA 1QVFA 1SEMA 2G6FX 4PJOC 1VQ9A 1D0YA 2VGMA 4FU6A 3TU4K 4JJNK 2E5KA 4YTLA 1RL2A 4AG1C 1G2BA 3DB3A 2K5FA 2X9HA 2O4XB 1YBYA 3I56Q 2LMJA 4HCKA 2YRVA 2MPXC 1NYFA 4ZNXA 3V8KA 1Z9QA 2AIRB 2QA4Q 2DZ9A 1R8OB 4M78B 1I81A 4RMOA 5DLOA 2R58A 1QCNA 1SHGA 3REAB 3JAME 4A4EA 3PMTA 1OZ3A 1JQQA 3HP9A 3CCSQ 1I5LA 5LJ3h 4FW1A 2QQRA 2OI3A 1KHCA 5FW9A 2RK2A 3AT1B 1TU0B 2K4YA 4J9BA 1OYXA 3HTRA 3V8LA 2GCXA 2DZCA 2HSEB 5LJ5d 2NLUA 3JB9H 2FVUA 4J9FA 1NBEB 2CREA 2YUPA 1M8VA 2AKKA 2EGAA 2K3YA 3M56A 1KK7A 3CMET 4LN2A 2CUBA 1H641 4C92B 1K4US 2K5LA 1KQ2A 2YUQA 3META 4M7AG 2KYBA 3OMGA 2X51A 1M2VA 5FU7B 1VQ6T 4M75G 4X9CA 2ATCB 2VB6A 2SRCA 3FJPA 5A0LA 1KD1C 3OY9A 2QAZA 1LJOA 2RHIA 3JCMV 1Q86U 4HCCA 1AT1B 1OU9A 1WXUA 1VQ8T 1FMVA 1VQ7Q 4C8QE 1JXOA 1ABOA 5IH2A 2Y4YA 3GPLA 1BBZA 2EQJA 4XQ3A 5KYWB 2RN8A 2I2LA 1Y7XA 2AK5A 4FYYB 1NJIU 4A4GA 4F7UB 4DBHA 2DJZA 4FYWB 2W10A 2DERA 4UC4A 2FG0A 4AFUC 4M77F 2VYTA 2LCSA 1UGRB 2ROLA 5GAMe 4O6JA 2V8IA 2X3WD 5FROA 1C0MA 4A4FA 4F16A 2ED0A 4M7DD 4RG8A 2GF7A 2CZ7B 2ZAEA 4A4KA 2ZPIB 1BI1A 3ULRB 1LNXA 3OSSC 2EYXA 1G8XA 1MMAA 5FU7C 1YJWA 4ZTJA 3O8VA 3EG1A 4ESRA 3KFVA 4J6WA 2QQAA 1QVFP 3QHSA 4LNPA 2E5QA 2CH4W 2KI7A 2PNIA 3JV3A 3QIIA 4M77D 1ZQ1A 3LWHA 5LJ3d 3CCQQ 2KAFA 2RI2A 1K0XA 3OB9A 3VS1A 2KY9A 2LRQA 4JJDA 2E1HA 5IXBA 2HL5C 4M7DC 4PJOD 3HPWA 1X69A 2FZKB 2QA4T 1RAGB 5KYUA 2LT1A 2FB7A 2V8KA 3J81E 2QYZA 1VA7A 4LUDA 1PD1A 4M7DF 1GXIE 1U5SA 3CCST 2HBWA 3CCMT 3NTHA 1EZZB 3CCJA 2LDMA 2DL5A 2QG9B 3CC7Q 5D6XA 3ASKA 3A8GB 3CC2A 2P84A 1D3BA 5DLQE 1SSFA 1UGVA 2CP2A 1GFCA 1W4SA 2F1LA 4XAXB 3TSZA 4E7SA 2NUZA 4BI8B 2CKKA 1N6AA 2JM8A 1YJ9A 3JB9G 1YWOA 3V7RA 1WGSA 1TSFA 1I1JA 1VUBA 2CP7A 3E9FA 4MDWA 1NYGA 2FPDA 1K73C 3M4YA 4FIBA 3H8ZA 3THKA 3PT9A 3HSBA 3CCLA 1WJQA 3A8HB 4C5HA 2CZ1B 1BKBA 1YHQA 3OYJA 5D6WA 3UF4A 2X35A 3NGPA 3I35A 4XTYA 2HQXA 1VQPQ 3ZFJA 1OPKA 4J9EA 2ZPEB 5GAN4 1WXTA 1B07A 2KROA 3EHQA 3HRTA 5GMKl 4LDYA 2H3EB 4DBQA 2DK3A 4XU0A 4XTVA 4HCBA 1TTHB 2D1XA 2K5IA 2L8DA 4E2FB 2O2OA 3I5RA 3VS6A 2HBPA 1QVGP 2K6DA 3MO8A 1ZA2B 1B7TA 3G71A 1VQ4A 2JS0A 3NTIA 3G1JA 3I55A 1NE8A 3OYGA 3EHRA 5CKFA 2RHXA 4JRKA 1Q82U 5KYUB 1PKTA 4OMQA 4PLIA 4M7AE 2RF0A 1BU1A 1AOJA 1KQ1A 1SRMA 4ZGJB 2HKQB 4C92E 1N8RU 4HKEA 1GBRA 2DEQA 2LNVA 4M7DB 3OW2S 5CKDA 4OB0B 1D0XA 1M1KC 4FT4A 4OGCA 1MUZA 4JRIA 1YIJT 1R0CB 2DM1A 4M78C 1I5OB 2CS7A 3TREA 4C92D 1VQ6Q 4RTWA 4DEXA 2AHJB 4C8QA 2LQNA 3CCJQ 3I5SA 2ESWA 4K11A 3C94A 1VQ9T 2YRDA 5CKBA 5GAMd 4C0DB 2KVQG 3OS5A 3EFOA 5FU6C 3GBQA 4J6XA 1PSFA 1VQ8Q 1TOVA 4XTUA 2EW3A 2F5TX 2ZPGB 3VS5A 4QW2A 1X2QA 2EYWA 2GFUA 4XK8E 2CP6A 2H8HA 2E10A 3HHTB 3QPHA 1KIKA 1W70A 3LH0A 3A8OB 4E7HA 1KG1A 3SD4A 3G6EQ 1QWEA 4C5GA 2QGGA 1MNDA 3RMQA 1WI7A 1ZLMA 2KGTA 1H92A 1QKXA 1O9SA 3M5AA 2QDYB 4C8QG 1D3BB 1WQWA 2OAUA 1KC8R 5HCKA 3PE0A 3QJYA 3M55A 1UHFA 2CUDA 4O5VA 4L59A 2RJDA 1X2KA 4QQ6A 2CT3A 3QUIA 4M75E 3KXTA 3C95A 2JXBA 3QYGB 2RM4A 2EQMA 4E6RA 4M77C 5GAN8 3JCMQ 1UUEA 1GCQA 4M77G 4HA8A 3J7AF 2YWWA 2CP5A 4DEYA 4AT1B 3CXCP 1VIEA 4II1A 2E3HA 3LH5A 3CCET 3OYKA 1B34A 4L6V5 1X43A 5CK9A 2XI9A 1Y57A 5A2QE 4BACA 3S6WA 3EGDA 2BE7D 3CXCS 1QWFA 2DFUA 2RH2A 3RNJA 1T0JA 4JJBA 1A0NB 1M90R 4M7DG 1QP3A 1CKBA 3RMSA 3SWNA 2KRSA 1UDLA 2EPDA 2RHYA 1QVPA 2AT1B 2EVRA 2XU8A 1Q7YR 2FEIA 1AHJB 3LX7A 4XU2A 3CMAQ 1U1TA 1JJ2S 4PJLA 2KRNA 3VS4A 3LW5E 3CCQA 2J05A 3V7CA 3CBMA 1VQ6A 1M27C 1WXBA 4J7IA 1D1BA 2E65A 2EGEA 2EYYA 3QDRB 2KK4A 5LJ5j 2VXEA 2XDBA 1WJRA 4CC2A 2QA4A 4KULA 5LJ3g 3GNFB 2M0YA 1VQOQ 1VQMQ 4PFZA 1VQ7T 2DIGA 2XKOC 5L8RE 3M0PA 2LQKA 1KQSP 1KQSA 2OTLT 3SFMA 2DXTA 2QK0A 1YWPA 2VV5A 3FC3A 2HZYA 1D1CA 1OULA 1Q7YU 3VJPA 4FCYA 5I2MA 3CPWP 5A0GA 1XNIA 2X4XA 3ME9A 2XK0A 3E19A 2MAMA 1ARKA 3A98A 2DVJA 4JUVA 5KYXB 3OS1A 1ABQA 3CCUA 3M59A 4KUDK 1E7OA 1AWXA 3MPUB 1RAFB 2O01E 1AWJA 1N5ZA 2FZGB 1G3TA 1NG2A 1W2BA 1K9MU 2JTFA 3JRZA 4GLMA 3X20B 2RI3A 1UGSB 1AD5A 1BI3A 4QVDA 3P8DA 4V2SA 4LDUA 4M75C 4LUEA 3UA6A 3RKXA 2DX1A 2LJ1A 4EMHA 1QMCA 2DPPB 5CO7A 5GAMf 1WIEA 2RHUA 2CP0A 3M58A 5CQXA 2J6KA 3CPWS 3AHUA 1MNEA 1P92A 4N4IA 3A8LB 5LJ3j 5KYYB 3S3NA 3GF5A 1TXQA 4ZGEB 4KH1B 1EFNA 3CBPA 2MK5A 4F04B 1YJ9T 2DRMA 1TUCA 5GAMg 3X26B 2MMPA 1Q81C 5IXFA 4J7FA 1TH7A 1YITQ 2P0QA 1K76A 4IIOA 2L3PA 2FPFA 2F69A 1OU8A 3CCJT 2DL3A 3G4ST 2MWOA 3TEEA 5AT1B 1LVKA 5GANd 1NJIC 1BCMA 1GFDA 2M9UA 1RLQC 3L42A 3H9NA 5CKHA 3URGA 1Y96A 5J26A 3NMZC 4N4HA 2BTTA 4E7ZA 4PJMA 1YN8A 1OX9A 2E6ZA 1M1KR 3RBBB 1K9MC 1VQKA 5KH6A 4HXJA 4HCZA 2M16A 3CCVQ 3V7SA 5IHNA 1Q81R 3L1AA 1ZHIA 1MMGA 4MMLA 2OTJT 4RTZA 1WDXA 2XDPA 4KRTA 1WHMA 1OOTA 2MWPA 5GANf 4QQGA 3DB4A 4MDXA 2EQUA 2OJ2A 3EGDB 4BE2A 2HMAA 4X34A 3EAEA 1NLPC 4M78G 1BYMA 5KE3A 5AYFA 5GAOq 2HQHA 4XTZA 1U8RA 2C0TA 2GGRA 4E7IA 4P5NA 5J39A 3OYIA 4ZGDB 2YLCA 5CVIA 4IUVA 2V1QA 4IIMA 4XTXA 6AT1B 3DLMA 2J7IA 1YIJA 4M7DE 2GTOA 2XIDA 4OGEA 2HCKA 4R0KA 1WZOA 2DF6A 2E3IA 5LL6S 1RAIB 3OBWA 4AMCA 2A0FB 1VQLQ 3UWNA 2LTOA 2KEAA 1QKWA 1OQKA 5ECAA 1M5Q1 1H8KA 3TCJA 2LQWA 3CCEQ 1OX8A 1QVGS 2XMFA 2MOXA 4GLKA 5KYXA 5FLXE 4AG2C 4RKUE 1LOJA 2DNUA 4DBRA 2MIOA 2KNBB 4JZ4A 4Y91A 2XHCA 3JCMP 2L89A 3CMAT 3QDFA 2EQKA 1JBMA 4J5YA 2RA2A 4KGZB 2QQBA 1FX7A 3SB2A 2DYBA 4X9DA 4DA4A 1Y07A 5J3BA 2EQIA 2RPNA 4BI4A 3CC4Q 2DD5A 2JMAA 3EG9B 2NYSA 3RR6A 5KE2A 1Y96B 1VYVA 3M4GA 5FU6B 2PUOB 4JS5A 1G3YA 3O5ZA 1VQMT 2I0NA 2K57A 3MEAA 4M78E 1M3AA 2E70A 1YHQT 3OW2P 2C0IA 4MZTA 5HKCA 2A08A 1VYTA 1VQKQ 2YDLA 4TVRA 1YI2T 1U06A 2DL7A 1R77A 2A28A 1Y71A 2HSPA 2RQUA 1FXXA 1Z9ZA 3VS2A 1X75C 4JLGA 4D8DA 5HK0A 5GAN5 2HAXA 3V8JA 1CKAA 4C0DC 2KSSA 2D8JA 3QG1A 4PJJA 2OTJA 3FDRA 1M4ZA 2J6FA 1SRLA 3E9GA 3OYEA 3EG9A 2RQWA 1YJNA 2PVDB 2ED1A 4JJCA 4EMGA 4FT2A 4DBFA 7AT1B 1ACMB 2X4JA 1RI9A 2P4RA 1TS9A 5HY6A 3VS7A 4OP0A 3Q1JA 1T0HA 1Q7YC 1Q95G 3OYBA 4QT7A 1IHWA 4HVUA 1HYOA 3G71Q 4JZ3A 3PTAA 4BY6C 4Q5WA 1IHVA 3A5ZB 2M51A 1NEGA 1RACB 1UHCA 4Y92A 3A1PA 3TQ7P 1WNLA 1F1BB 2VVKA 4M7AD 2VGNA 1YJ9Q 4C5IA 1PD0A 4EMKB 2DYIA 1T3SA 1W2BS 3OA6A 2RMOA 2KMTA 1AVZC 2VWFA 4KUIA 5LJ5h 3BFMA 3I9QA 3HL8A 2DBMA 3OYMA 1OEBA 2DO3A 2OTLA 1YJWQ 2IPOB 5IHKA 5D7UA 1PHTA 3OYCA 1IRXA 2AZVA 5GAN7 4KBMB 4MMKA 3JCMh 4D8KA 2EFIA 3CCQT 1YCYA 2QTXA 4E7JA 1UFFA 3M0UA 5GANe 4M7AA 1OZ2A 3OQ5A 1N9RA 1S72A 3CC4A 3VRYA 4FYVB 3NHNA 2H3JA 3EFSA 2K2MA 3EGXA 3JCMf 1I4K1 3ZBDA 4PFPA 2LQ8A 1KC8C 1LCKA 3TVTA 3EG3A 1YP5A 2PTKA 2QQSA 1WHKA 2K9GA 1RLPC 3MEWA 4MZMA 1KC8U 1WFWA 3HRSA 3NFCA 4C92C 1WA7A 3E1SA 3H0IA 2D6FA 2EKOA 3JCMg 3M0RA 1X6BA 1R0BG 1JXMA 4RUGA 3MHXA 3GNGA 3CQTA 5GANj 1RUWA 2DTHA 3CC2T 3LYIA
chains in the Genus database with same CATH topology
1FYNA 2OI3A 5FW9A 1PRLC 1PWTA 3C0CA 2EGEA 2EYYA 2K7AA 4J9BA 4CC2A 2DRKA 5GJWB 4FSSA 2M0YA 4F17A 4J9FA 2LJ0A 1JU5C 1GCQC 2CREA 2YUPA 3M0PA 4OMNA 1GBQA 2AKKA 2O31A 2EGAA 2DILA 4LN2A 2CUBA 1YWPA 1K4US 2KR3A 1FMKA 4OMMA 2YUQA 2KYBA 1ZX6A 2KRMA 5GJVB 2SRCA 1ARKA 3PVLA 3A98A 4JPBW 2DVJA 1ABQA 1E7OA 1MV0B 2YUNA 1AWXA 1MV3A 1WXUA 1QLYA 1K9AA 1AWJA 2ECZA 2ENMA 1N5ZA 1NG2A 3EG2A 3TSWA 1JXOA 4GBQA 4GLMA 2CDTA 1V1CA 1ABOA 5IH2A 3REBB 1BBZA 1AD5A 1UE9A 3EGUA 1Y0MA 2RN8A 2AK5A 1ZSGA 1PNJA 4LUEA 3UA6A 2L3QA 2DX1A 2LJ1A 2W10A 1PKSA 1G83A 2D0NA 1UJYA 1WIEA 2J6KA 3PVQA 2FG0A 4AFUC 3FJ5A 2ROLA 2LCSA 1GL5A 1KSWA 2X3WD 3UATA 1NLOC 3H0HA 2ED0A 4F16A 1AZGB 2FRYA 1EFNA 3ULRB 2DRMA 1TUCA 4CC3A 2EYXA 2DJQA 5IXFA 2FPEA 1SHFA 1YNZA 1HJDA 3EG1A 1KJWA 1K76A 4OMPA 4ESRA 3KFVA 4IIOA 2CSIA 2FPFA 2L3PA 2F2VA 2LZ6B 2IIMA 2DE0X 2HEQA 2DL3A 3M0QA 1WLPB 4LNPA 1SPKA 1JEGA 2CH4W 3JV3A 2PNIA 2B86A 3SEMA 5FWCA 1K0XA 3VS1A 1NM7A 1PRMC 3UA7A 4A63B 4JJDA 4HVVA 5IXBA 1GFDA 1RLQC 3NPFA 1X69A 3NMZC 1IO6A 2BTTA 3R6NA 1S1NA 2A36A 4J9HA 4OMOA 1YN8A 4AFSC 1VA7A 2JTEA 4LUDA 3RBBB 2DA9A 4HXJA 3VS0A 1U3OA 1U5SA 2RQTA 2EKHA 2HBWA 2A37A 5IHNA 4J9GA 4RTZA 1WDXA 2O9SA 3SHWA 1AZEA 4KRTA 2JS2A 2DL5A 2OAWA 1OOTA 4AFQC 2KT1A 2YT6A 5EC7A 2LNHB 2OJ2A 2DBKA 2YSQA 3M0TA 2JM9A 2AZSA 1XOVA 1UGVA 2F2WA 1GFCA 4M4ZA 2RNAA 3TSZA 1NLPC 1E6HA 4CC7A 2DMOA 2NUZA 1GCPA 2JM8A 2C0TA 2GGRA 1YWOA 4Z8AA 4EIKA 2V1QA 4IIMA 2DLPA 1I1JA 1K0SA 1NYGA 2J7IA 2FPDA 3THKA 2YUOA 3QWYA 2GTOA 3H0FA 2FRWA 2HCKA 4R0KA 2DF6A 3UF4A 3NGPA 3I35A 1H3HA 1OPKA 2K3BA 1YCSB 2KEAA 4J9EA 1I0CA 1QKWA 4J9DA 1WXTA 2ROTA 2LJ3A 5ECAA 1B07A 4CC4B 2KROA 3EHQA 1M3CA 4RTYA 1W1FA 5L23A 2SEMA 1H8KA 2LQWA 1T3LA 2KXDA 2X3XD 2JW4A 2XMFA 2MOXA 2D1XA 4AG2C 4WCIA 1WX6A 2DNUA 2O2OA 2MIOA 3I5RA 3VS6A 1JO8A 1OV3A 2KNBB 2DL4A 2K6DA 4JZ4A 1UG1A 2JS0A 1NEBA 4OMLA 4J9IA 4Z88A 5I22A 1M3BA 1M30A 2VKNA 1ZUYA 1AWWA 1SSHA 3EHRA 4X1VA 2BZXA 2DL8A 4RTXA 2DYBA 2EYZA 2F2XA 1PKTA 2EQIA 2RPNA 4OMQA 2JMAA 2GQIA 2JT4A 1VYVA 2RF0A 1BU1A 2LP5A 1AOJA 1SRMA 5FWBA 2W0ZA 2L0AA 2CH4A 3O5ZA 2V1RA 2I0NA 1W6XA 1GBRA 3IQLA 1M3AA 2AKLA 2C0IA 1GRIA 3U23A 1M8MA 2A08A 2BZ8A 1ZUUA 1MUZA 1VYTA 1HSQA 2YDLA 2J6OA 1U06A 2DL7A 2A28A 2JMCA 2DM1A 2HSPA 2RQUA 1Z9ZA 3VS3A 3VS2A 4RTWA 4DEXA 2L2PA 2LQNA 2O9VA 3I5SA 2ESWA 4K11A 5IHIA 4D8DA 2GBQA 3VRZA 4Z89A 1CKAA 2D8JA 4RTUA 1J3TA 2PZ1A 1TUDA 2J6FA 1SRLA 2O88A 3GBQA 2CSQA 1VYUA 2RQWA 2ED1A 2EW3A 3VS5A 1AEYA 3H41A 2D8HA 2NWMA 4JJCA 2GTJA 1X2QA 2EYWA 3M0SA 2HDAA 2H8HA 1RI9A 2P4RA 1I07A 1WYXA 2KXCA 1KIKA 1W70A 4J9CA 3VS7A 1B3QA 1ZBJA 4AFZC 1T0HA 1QWEA 2KBTA 4QT7A 4HVUA 1WI7A 1ZLMA 2KGTA 4LE9A 4JZ3A 1H92A 1QKXA 1UECA 2J06A 2M51A 4ORZA 1NEGA 1QCFA 1UHCA 4Y92A 1X27A 2VVKA 3QWXX 3PE0A 5HCKA 5I11A 2C0OA 1T3SA 1UHFA 1CSKA 2CUDA 2RMOA 2MCNA 4RTVA 1K1ZA 1TG0A 2LX7A 1AVZC 1X2KA 2CT3A 2VWFA 2CT4A 4RTTA 2JXBA 3I9QA 2DBMA 4E6RA 1OEBA 1OPLA 2QDLA 2FO0A 4F14A 1UUEA 3ZL7C 1GCQA 5IHKA 1PHTA 2L3SA 4DEYA 3EG0A 2AZVA 1X6GA 2KYMA 3LH5A 4D8KA 1HD3A 4HVWA 2RQRA 1UJ0A 1X43A 1UFFA 1KFZA 1Y57A 2GNCA 1SEMA 3M0UA 2G6FX 2KE9A 2RQVA 2EGCA 2E5KA 3VRYA 1QWFA 1ZUKA 3NHNA 4AG1C 1G2BA 2K2MA 3RNJA 1T0JA 4JJBA 1A0NB 1LCKA 1BB9A 2LMJA 3TVTA 3EG3A 1YP5A 1CKBA 4HCKA 2PTKA 1UTIA 1NYFA 2KRSA 2K9GA 1RLPC 1UDLA 2BZYA 2KT8A 2EPDA 4ZNXA 1Z9QA 1WFWA 2EVRA 2ABLA 1WA7A 3H0IA 2FEIA 2EBPA 3M0RA 1X6BA 1AWOA 2K79A 1JXMA 1SHGA 3REAB 4RUGA 2KRNA 3VS4A 2J05A 1BK2A 1JQQA 1E6GA 3CQTA 1M27C 1RUWA 1WXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYN A;  2OI3 A;  5FW9 A;  1PRL C;  1PWT A;  3C0C A;  2EGE A;  2EYY A;  2K7A A;  4J9B A;  4CC2 A;  2DRK A;  5GJW B;  4FSS A;  2M0Y A;  4F17 A;  4J9F A;  2LJ0 A;  1JU5 C;  1GCQ C;  2CRE A;  2YUP A;  3M0P A;  4OMN A;  1GBQ A;  2AKK A;  2O31 A;  2EGA A;  2DIL A;  4LN2 A;  2CUB A;  1YWP A;  1K4U S;  2KR3 A;  1FMK A;  4OMM A;  2YUQ A;  2KYB A;  1ZX6 A;  2KRM A;  5GJV B;  2SRC A;  1ARK A;  3PVL A;  3A98 A;  4JPB W;  2DVJ A;  1ABQ A;  1E7O A;  1MV0 B;  2YUN A;  1AWX A;  1MV3 A;  1WXU A;  1QLY A;  1K9A A;  1AWJ A;  2ECZ A;  2ENM A;  1N5Z A;  1NG2 A;  3EG2 A;  3TSW A;  1JXO A;  4GBQ A;  4GLM A;  2CDT A;  1V1C A;  1ABO A;  5IH2 A;  3REB B;  1BBZ A;  1AD5 A;  1UE9 A;  3EGU A;  1Y0M A;  2RN8 A;  2AK5 A;  1ZSG A;  1PNJ A;  4LUE A;  3UA6 A;  2L3Q A;  2DX1 A;  2LJ1 A;  2W10 A;  1PKS A;  1G83 A;  2D0N A;  1UJY A;  1WIE A;  2J6K A;  3PVQ A;  2FG0 A;  4AFU C;  3FJ5 A;  2ROL A;  2LCS A;  1GL5 A;  1KSW A;  2X3W D;  3UAT A;  1NLO C;  3H0H A;  2ED0 A;  4F16 A;  1AZG B;  2FRY A;  1EFN A;  3ULR B;  2DRM A;  1TUC A;  4CC3 A;  2EYX A;  2DJQ A;  5IXF A;  2FPE A;  1SHF A;  1YNZ A;  1HJD A;  3EG1 A;  1KJW A;  1K76 A;  4OMP A;  4ESR A;  3KFV A;  4IIO A;  2CSI A;  2FPF A;  2L3P A;  2F2V A;  2LZ6 B;  2IIM A;  2DE0 X;  2HEQ A;  2DL3 A;  3M0Q A;  1WLP B;  4LNP A;  1SPK A;  1JEG A;  2CH4 W;  3JV3 A;  2PNI A;  2B86 A;  3SEM A;  5FWC A;  1K0X A;  3VS1 A;  1NM7 A;  1PRM C;  3UA7 A;  4A63 B;  4JJD A;  4HVV A;  5IXB A;  1GFD A;  1RLQ C;  3NPF A;  1X69 A;  3NMZ C;  1IO6 A;  2BTT A;  3R6N A;  1S1N A;  2A36 A;  4J9H A;  4OMO A;  1YN8 A;  4AFS C;  1VA7 A;  2JTE A;  4LUD A;  3RBB B;  2DA9 A;  4HXJ A;  3VS0 A;  1U3O A;  1U5S A;  2RQT A;  2EKH A;  2HBW A;  2A37 A;  5IHN A;  4J9G A;  4RTZ A;  1WDX A;  2O9S A;  3SHW A;  1AZE A;  4KRT A;  2JS2 A;  2DL5 A;  2OAW A;  1OOT A;  4AFQ C;  2KT1 A;  2YT6 A;  5EC7 A;  2LNH B;  2OJ2 A;  2DBK A;  2YSQ A;  3M0T A;  2JM9 A;  2AZS A;  1XOV A;  1UGV A;  2F2W A;  1GFC A;  4M4Z A;  2RNA A;  3TSZ A;  1NLP C;  1E6H A;  4CC7 A;  2DMO A;  2NUZ A;  1GCP A;  2JM8 A;  2C0T A;  2GGR A;  1YWO A;  4Z8A A;  4EIK A;  2V1Q A;  4IIM A;  2DLP A;  1I1J A;  1K0S A;  1NYG A;  2J7I A;  2FPD A;  3THK A;  2YUO A;  3QWY A;  2GTO A;  3H0F A;  2FRW A;  2HCK A;  4R0K A;  2DF6 A;  3UF4 A;  3NGP A;  3I35 A;  1H3H A;  1OPK A;  2K3B A;  1YCS B;  2KEA A;  4J9E A;  1I0C A;  1QKW A;  4J9D A;  1WXT A;  2ROT A;  2LJ3 A;  5ECA A;  1B07 A;  4CC4 B;  2KRO A;  3EHQ A;  1M3C A;  4RTY A;  1W1F A;  5L23 A;  2SEM A;  1H8K A;  2LQW A;  1T3L A;  2KXD A;  2X3X D;  2JW4 A;  2XMF A;  2MOX A;  2D1X A;  4AG2 C;  4WCI A;  1WX6 A;  2DNU A;  2O2O A;  2MIO A;  3I5R A;  3VS6 A;  1JO8 A;  1OV3 A;  2KNB B;  2DL4 A;  2K6D A;  4JZ4 A;  1UG1 A;  2JS0 A;  1NEB A;  4OML A;  4J9I A;  4Z88 A;  5I22 A;  1M3B A;  1M30 A;  2VKN A;  1ZUY A;  1AWW A;  1SSH A;  3EHR A;  4X1V A;  2BZX A;  2DL8 A;  4RTX A;  2DYB A;  2EYZ A;  2F2X A;  1PKT A;  2EQI A;  2RPN A;  4OMQ A;  2JMA A;  2GQI A;  2JT4 A;  1VYV A;  2RF0 A;  1BU1 A;  2LP5 A;  1AOJ A;  1SRM A;  5FWB A;  2W0Z A;  2L0A A;  2CH4 A;  3O5Z A;  2V1R A;  2I0N A;  1W6X A;  1GBR A;  3IQL A;  1M3A A;  2AKL A;  2C0I A;  1GRI A;  3U23 A;  1M8M A;  2A08 A;  2BZ8 A;  1ZUU A;  1MUZ A;  1VYT A;  1HSQ A;  2YDL A;  2J6O A;  1U06 A;  2DL7 A;  2A28 A;  2JMC A;  2DM1 A;  2HSP A;  2RQU A;  1Z9Z A;  3VS3 A;  3VS2 A;  4RTW A;  4DEX A;  2L2P A;  2LQN A;  2O9V A;  3I5S A;  2ESW A;  4K11 A;  5IHI A;  4D8D A;  2GBQ A;  3VRZ A;  4Z89 A;  1CKA A;  2D8J A;  4RTU A;  1J3T A;  2PZ1 A;  1TUD A;  2J6F A;  1SRL A;  2O88 A;  3GBQ A;  2CSQ A;  1VYU A;  2RQW A;  2ED1 A;  2EW3 A;  3VS5 A;  1AEY A;  3H41 A;  2D8H A;  2NWM A;  4JJC A;  2GTJ A;  1X2Q A;  2EYW A;  3M0S A;  2HDA A;  2H8H A;  1RI9 A;  2P4R A;  1I07 A;  1WYX A;  2KXC A;  1KIK A;  1W70 A;  4J9C A;  3VS7 A;  1B3Q A;  1ZBJ A;  4AFZ C;  1T0H A;  1QWE A;  2KBT A;  4QT7 A;  4HVU A;  1WI7 A;  1ZLM A;  2KGT A;  4LE9 A;  4JZ3 A;  1H92 A;  1QKX A;  1UEC A;  2J06 A;  2M51 A;  4ORZ A;  1NEG A;  1QCF A;  1UHC A;  4Y92 A;  1X27 A;  2VVK A;  3QWX X;  3PE0 A;  5HCK A;  5I11 A;  2C0O A;  1T3S A;  1UHF A;  1CSK A;  2CUD A;  2RMO A;  2MCN A;  4RTV A;  1K1Z A;  1TG0 A;  2LX7 A;  1AVZ C;  1X2K A;  2CT3 A;  2VWF A;  2CT4 A;  4RTT A;  2JXB A;  3I9Q A;  2DBM A;  4E6R A;  1OEB A;  1OPL A;  2QDL A;  2FO0 A;  4F14 A;  1UUE A;  3ZL7 C;  1GCQ A;  5IHK A;  1PHT A;  2L3S A;  4DEY A;  3EG0 A;  2AZV A;  1X6G A;  2KYM A;  3LH5 A;  4D8K A;  1HD3 A;  4HVW A;  2RQR A;  1UJ0 A;  1X43 A;  1UFF A;  1KFZ A;  1Y57 A;  2GNC A;  1SEM A;  3M0U A;  2G6F X;  2KE9 A;  2RQV A;  2EGC A;  2E5K A;  3VRY A;  1QWF A;  1ZUK A;  3NHN A;  4AG1 C;  1G2B A;  2K2M A;  3RNJ A;  1T0J A;  4JJB A;  1A0N B;  1LCK A;  1BB9 A;  2LMJ A;  3TVT A;  3EG3 A;  1YP5 A;  1CKB A;  4HCK A;  2PTK A;  1UTI A;  1NYF A;  2KRS A;  2K9G A;  1RLP C;  1UDL A;  2BZY A;  2KT8 A;  2EPD A;  4ZNX A;  1Z9Q A;  1WFW A;  2EVR A;  2ABL A;  1WA7 A;  3H0I A;  2FEI A;  2EBP A;  3M0R A;  1X6B A;  1AWO A;  2K79 A;  1JXM A;  1SHG A;  3REA B;  4RUG A;  2KRN A;  3VS4 A;  2J05 A;  1BK2 A;  1JQQ A;  1E6G A;  3CQT A;  1M27 C;  1RUW A;  1WXB A; 
#chains in the Genus database with same CATH topology
 3BW1 A;  1K9M R;  1PWT A;  3C0C A;  2NUT A;  2BIV A;  3G6E A;  2K7A A;  3WVE B;  2B8A A;  3UPU A;  4LD9 K;  2DRK A;  5GJW B;  5CCA A;  4M78 D;  1IGU A;  4M75 F;  2MF2 A;  3CD6 Q;  1GCQ C;  1NJI R;  2HNI A;  3MEV A;  4OMN A;  3A8M B;  4FYX B;  3CCL T;  2KR3 A;  1FMK A;  1NPP A;  1VQL T;  1ZX6 A;  1G3S A;  3VU3 C;  1PM3 A;  3PVL A;  1YIT T;  5GMK h;  4JPB W;  4FSX A;  3OYD A;  3CD6 A;  1MV0 B;  2YUN A;  1MV3 A;  2NUT B;  3SWN C;  2ENM A;  4NOY A;  1X01 A;  5GMK j;  5KCO A;  5GAM h;  3TSW A;  3WXM B;  4R55 A;  4GBQ A;  2CDT A;  1ZSZ A;  1V1C A;  4E7K A;  3EGU A;  1Y0M A;  2QQ9 A;  1PNJ A;  5GMK e;  2FHD A;  2P0K A;  5LJ5 f;  3I56 A;  2QGF B;  3UDC A;  1PKS A;  1G83 A;  3RDV A;  4NL3 A;  2COY A;  1DJ7 B;  3QXE B;  2D0N A;  1UJY A;  1QQJ A;  1RAD B;  3OS0 A;  3DKM A;  3UAT A;  1M2V B;  4B9W A;  3KBG A;  5CR2 A;  1AZG B;  3MP8 A;  4ZTF A;  2FRY A;  3EFO B;  1B34 B;  4JLI A;  2X4Y A;  2DJQ A;  3CC4 T;  4M7A B;  1VQ5 T;  1QP2 A;  1SHF A;  1N27 A;  1VQK T;  1HJD A;  4BE0 A;  1KHI A;  2RJE A;  1O75 A;  1KJW A;  2QTV A;  2HD0 A;  2EJG A;  1RAH B;  1FMW A;  2IIM A;  4KH0 B;  2DD4 A;  2DE0 X;  2HEQ A;  1WLP B;  1SPK A;  3HFN A;  4A4H A;  2B86 A;  1K73 R;  1VQN T;  5FWC A;  4QVC A;  1NM7 A;  1D1A A;  2FYK A;  1JJ2 P;  4A54 A;  4HVV A;  4HT8 A;  1VQ4 Q;  2MI6 A;  4A53 A;  3S3O A;  1MHN A;  3R6N A;  4F7U G;  4J9H A;  4OMO A;  2RB6 A;  3CEY A;  4AFS C;  5GAN h;  5GAN 2;  2JTE A;  1SG5 A;  2DA9 A;  1PCX A;  2JTM A;  4PNO A;  4E7L A;  3VS0 A;  1U3O A;  2RQT A;  2EKH A;  3RKW A;  3S3M A;  2A37 A;  2NUP B;  1W2B P;  1RAA B;  4J9G A;  3ZEH A;  3SHW A;  2O9S A;  1AZE A;  2JS2 A;  1KQS S;  2CZ0 B;  2OAW A;  5I21 A;  5EG2 A;  3CCM A;  4AFQ C;  4ELZ C;  2YSQ A;  4IUU A;  3M0T A;  1XQH A;  4OMF B;  2JM9 A;  1VQP T;  2AZS A;  2P0P A;  2F2W A;  2WSE E;  1M2O A;  2V26 A;  3JSC A;  4M4Z A;  2RNA A;  1YJN Q;  1K8A U;  3MJX A;  1E6H A;  4CC7 A;  4N0A A;  1VQO A;  2PUK B;  3M9Q A;  1UB4 A;  1VQM A;  1M90 C;  2PVG B;  1GCP A;  2C06 A;  3JCM e;  4ZN3 A;  4Z8A A;  4EIK A;  2DXC A;  5LJ3 e;  2Y4X A;  1H3Z A;  2CYZ B;  4QQD A;  1IB8 A;  2YUO A;  3QWY A;  3H0F A;  4ME7 A;  2FRW A;  5I2S A;  4FL6 A;  4C92 F;  3JCM c;  3GOX A;  4JDS A;  3MKD A;  2LCL A;  5DY9 A;  1YCS B;  1I0C A;  4J9D A;  4FW2 A;  1KD1 R;  8AT1 B;  4RTY A;  5LJ5 g;  1W1F A;  3PGG A;  2SEM A;  5L23 A;  1T3L A;  2KXD A;  2X3X D;  4C5E A;  1XTD A;  2E4H A;  3C4S A;  3JCM b;  4BY6 B;  1JO8 A;  5GAM j;  1BCO A;  2DL4 A;  2ZPH B;  5M9O A;  1BIB A;  3M54 A;  1D09 B;  4PJO F;  1NEB A;  4OML A;  3OYF A;  2DET A;  2EIF A;  4J9I A;  5I22 A;  1M3B A;  1M30 A;  2RK1 A;  2VKN A;  3FIF A;  2M0O A;  2Z0W A;  1SSH A;  3X28 B;  1G3W A;  3PMI A;  3OSV A;  1ZA1 B;  3OYN A;  2X4W A;  2DL8 A;  4RTX A;  4VUB A;  1S72 Q;  2DEU A;  1VQ5 Q;  3QSU A;  2FZC B;  2JT4 A;  3M57 A;  3L2W A;  2LP5 A;  5FWB A;  2VC8 A;  4Z02 A;  2L0A A;  2CH4 A;  2V1R A;  1JB0 E;  1W6X A;  3IQL A;  2ZPF B;  1TUG B;  3CD6 T;  3CC2 Q;  2COW A;  2AKL A;  1ZUU A;  4C8Q D;  1HSQ A;  2J6O A;  2JMC A;  1I8F A;  1JJ2 A;  3VS3 A;  4JS4 A;  2L2P A;  4J83 A;  4LDV A;  3RKY A;  2ZPB B;  5IHI A;  3GIB A;  1QCO A;  2GBQ A;  4EPC A;  4Z89 A;  4RTU A;  3CCL Q;  2PZ1 A;  3MCA B;  4M7A C;  4OF1 A;  1BIA A;  2CSQ A;  2DVE A;  4BB7 A;  1VYU A;  1SF9 A;  2D8H A;  4N0A C;  2GTJ A;  3CMA A;  3GLX A;  3M0S A;  2L3R A;  4IKF A;  4PJO B;  1MMD A;  2HDA A;  4M7A F;  5KYW A;  3L2R A;  3CCS A;  1WYX A;  2KXC A;  4J9C A;  2XD0 A;  4RCC A;  3G7Z A;  2JNG A;  3LGF A;  4Y28 E;  1B3Q A;  4C92 G;  3CC7 A;  2KBT A;  2JZ2 A;  2QAS A;  3L2V A;  2DIQ A;  4RCB A;  1UEC A;  1N9S A;  2GFA A;  3VKI A;  4OVA A;  3EGX B;  1WHL A;  1WJS A;  5CKE A;  3QWX X;  4EMK C;  2CGH A;  2C0O A;  4PFO A;  1EIF A;  4M78 F;  1VQ9 Q;  2LX7 A;  4RTT A;  4DOW A;  4IUP A;  4L5G A;  3N5B B;  2NUP A;  3ZL7 C;  4LD6 A;  2XG8 D;  5GMK i;  1XJW B;  1PSE A;  3EG0 A;  1EX4 A;  2RJC A;  1VQL A;  1HD3 A;  4PLL A;  1V76 A;  4PJN A;  2RQR A;  5GAO r;  1X6O A;  2E12 A;  1SKU B;  3BE3 A;  4M75 A;  1Q82 C;  5FRM A;  1KFZ A;  3CME A;  2GNC A;  1ZBX A;  2K2V A;  2KE9 A;  3CCE A;  2RQV A;  2EGC A;  3CCR Q;  2EJ9 A;  4F7U F;  3GP8 A;  1ZUK A;  2A7Y A;  2OTL Q;  2EAY A;  2LC4 A;  2ZGW A;  2XDD A;  1BB9 A;  4LDW A;  3F70 A;  1UTI A;  4IUT A;  4KT0 E;  1VIF A;  2QXF A;  2BZY A;  2E6N A;  2KT8 A;  1WQ7 A;  4DOV A;  1VQ4 T;  1VQ8 A;  9ATC B;  2ABL A;  5GAN 3;  3FB9 A;  1NZ9 A;  2EBP A;  2D0Q B;  1K73 U;  3EH1 A;  2BE9 B;  1AWO A;  2K79 A;  1UEB A;  1NPR A;  3CCR A;  3CCV A;  1BK2 A;  1E6G A;  3ER0 A;  4XTW A;  1YFN A;  1WHJ A;  1FYN A;  3KUF A;  1YIT A;  1PRL C;  3OYH A;  1JRI A;  3PFS A;  2DAQ A;  2LVM A;  3JCM X;  5GAO p;  4FSS A;  2E64 A;  4F17 A;  1M1K U;  4HT9 A;  2VUB A;  3C12 A;  2LJ0 A;  1IGQ A;  1JU5 C;  3QKJ A;  3R6O A;  4QKU A;  3MP1 A;  2R57 A;  4KGX B;  1GBQ A;  2O31 A;  2DIL A;  3I56 T;  2FL7 A;  1YIJ Q;  4J8O A;  4OMM A;  4F7U E;  1BI2 A;  2KRM A;  2WSC E;  3E2U A;  3CCU T;  2L5Q A;  2YLB A;  5GJV B;  1QW1 A;  2F5K A;  3P8H A;  1VQP A;  3FRN A;  1RAE B;  4PKC C;  2RD1 A;  4QVZ A;  3OYL A;  4EDU A;  1N8R R;  3WVD B;  1C6V X;  5GAN 6;  4WTO B;  1QLY A;  1K9A A;  5GAN g;  1VQO T;  2ECZ A;  2VXF A;  3EG2 A;  3T9N A;  5LJ3 f;  1HK9 A;  2HL3 A;  4M77 E;  1QVF S;  3BY7 A;  1IRE B;  5D6Y A;  3JB9 I;  3EH2 A;  1ZSZ C;  4BD3 A;  3REB B;  1VQN Q;  4C0G A;  1D0Z A;  5A0D A;  5CAI A;  1UE9 A;  3CBO A;  1ZSG A;  4BDZ A;  2L3Q A;  4BE1 A;  1RI0 A;  2QEX T;  3QYH B;  3I55 Q;  3G6E T;  3G4S Q;  4PK4 A;  2V8J A;  2DTI A;  3PVQ A;  2IVW A;  3FJ5 A;  3SWN B;  5CQY A;  4D6W A;  3CME Q;  1GL5 A;  1KSW A;  2VAS A;  1NLO C;  3H0H A;  3OBY A;  2RO0 A;  3EFR A;  3JB9 J;  4CC3 A;  3HFO A;  2FPE A;  1IXD A;  4OB1 B;  1YNZ A;  4ANJ A;  1Q81 U;  2E41 A;  3G4S A;  5IAY A;  4OMP A;  4B6M A;  1TWB A;  2CSI A;  4CI0 C;  4ELY C;  2F2V A;  2LZ6 B;  4JRQ A;  1K8A C;  3M0Q A;  3PIP A;  1JEG A;  5LJ5 e;  2JUF A;  3SEM A;  3BDL A;  3LLR A;  1PRM C;  4LXC A;  3UA7 A;  4A63 B;  2LX9 A;  3NPF A;  1M9S A;  3PIO A;  2YRC A;  1YJN T;  1IO6 A;  4C92 A;  5IN1 A;  1S1N A;  3QZ5 B;  3CPF A;  2A36 A;  3RIR A;  3OW2 A;  2D9T A;  3FLG A;  4M77 A;  4OB2 B;  2LCC A;  1V29 B;  4N4G A;  3L2U A;  3VYH B;  4M75 D;  1Q86 R;  1MGQ A;  2WSF E;  2XIC A;  4C0Z A;  4C8Q C;  1M1F A;  1KD1 U;  4ATO A;  3P8B B;  2M1H A;  2RJF A;  4PL6 A;  3LWI A;  5KCH A;  1Q86 C;  4BUG A;  2KT1 A;  1FWZ A;  2YT6 A;  4ZN1 A;  5EC7 A;  2LNH B;  2DBK A;  3VUZ A;  2IG0 A;  3DLL A;  1XOV A;  4PJO A;  2ZZD A;  4IUR A;  1HXD A;  2DTO A;  5GAO l;  2DMO A;  2Y90 A;  3BDU A;  3UT1 A;  1VQ7 A;  2DLP A;  4KGV B;  1YJW T;  3VV0 A;  1K0S A;  5DM7 R;  2EYQ A;  3CCM Q;  1WPY A;  3FEO A;  5GAO n;  1VQN A;  2ZCF B;  2OTJ Q;  4WF2 A;  1K8A R;  3MEU A;  3QBY A;  3CC7 T;  3RES A;  1H3H A;  4BDY A;  1N8R C;  3QJ6 A;  2YHT A;  2JJ9 A;  2K3B A;  4M7D A;  2ROT A;  2LJ3 A;  4CC4 B;  1S72 T;  1M3C A;  4C0F A;  2QEX A;  1M1G A;  4IUQ A;  3VYG A;  1UGP B;  2JW4 A;  3PNW C;  3VUB A;  2GQV A;  1WHG A;  4WCI A;  1WX6 A;  2KDS A;  1IZ6 A;  4B9X A;  2A3L A;  1OV3 A;  4JRP A;  1PC0 A;  1UG1 A;  3L2Q A;  5GAO m;  1ZSZ B;  1U1S A;  2MYS A;  4Z88 A;  2COZ A;  1ZUY A;  1AWW A;  1YI2 Q;  2R5M A;  2QI2 A;  4X1V A;  2WAC A;  2R5A A;  2BKD N;  1MMN A;  2BZX A;  1LPL A;  4GY5 A;  2EYZ A;  2F2X A;  2HKN A;  2M02 A;  3H6Z A;  3L2Z A;  2JN0 A;  1C1A A;  4PJO E;  2GQI A;  1BI0 A;  4FM4 B;  5GMK m;  2W0Z A;  4NS5 A;  4MZP A;  1UGQ B;  3JB9 F;  3SDZ A;  4R56 A;  1YI2 A;  4C8Q B;  1GRI A;  3U23 A;  1M8M A;  4DQ2 A;  2BZ8 A;  3G71 T;  2YXY A;  4OB3 B;  4LDX A;  4XU3 A;  4CRI A;  3X25 B;  5CIU A;  2CP3 A;  4M78 A;  2RI5 A;  3QO3 A;  3JCM d;  2O9V A;  3OYA A;  4EMK A;  1M90 U;  4BI3 A;  2G3R A;  3VRZ A;  3M53 A;  5C6S A;  2LT4 A;  2P4T A;  2HQE A;  3OS2 A;  3RER A;  1J3T A;  1TUD A;  4NL2 A;  2O88 A;  5KYY A;  1Q82 R;  2JOY A;  2K3X A;  1AEY A;  3H41 A;  2NWM A;  3JCM J;  2BUD A;  3CCU Q;  4XU1 A;  2DKG A;  5C0M A;  3D7S B;  4J6Y A;  1G5V A;  4E47 A;  3QZ9 B;  1I07 A;  5FRN A;  2JVV A;  4F7U A;  3HKS A;  3JB9 D;  2DXU A;  3X24 B;  3CCR T;  3CCV T;  3I55 T;  1ZBJ A;  4AFZ C;  3CXC A;  1YHQ Q;  3NTK A;  3INZ A;  3HRU A;  4LE9 A;  2J06 A;  1RAB B;  2RHZ A;  4ORZ A;  8ATC B;  1QCF A;  5KYN A;  1X27 A;  5I11 A;  2CZ6 B;  2QEX Q;  5IT9 E;  1CSK A;  2MCN A;  4RTV A;  1K1Z A;  1TG0 A;  3LGL A;  4C8Q F;  2CT4 A;  1VQ5 A;  2PU9 B;  1QVG A;  4M75 B;  3J80 E;  3RUX A;  1OPL A;  3OYY A;  2QDL A;  2FO0 A;  2PVO B;  4F14 A;  4M77 B;  1VOM A;  2KQW A;  2L3S A;  3MP6 A;  3CPW A;  1WHH A;  1X6G A;  2KYM A;  1OI1 A;  4RG2 A;  1PG5 B;  2EWN A;  2OX7 A;  5HK3 A;  3JCM W;  2DXB A;  4HVW A;  1UJ0 A;  2EJF A;  3OMC A;  2O4X A;  4PJO G;  2PQW A;  1QVF A;  1SEM A;  2G6F X;  4PJO C;  1VQ9 A;  1D0Y A;  2VGM A;  4FU6 A;  3TU4 K;  4JJN K;  2E5K A;  4YTL A;  1RL2 A;  4AG1 C;  1G2B A;  3DB3 A;  2K5F A;  2X9H A;  2O4X B;  1YBY A;  3I56 Q;  2LMJ A;  4HCK A;  2YRV A;  2MPX C;  1NYF A;  4ZNX A;  3V8K A;  1Z9Q A;  2AIR B;  2QA4 Q;  2DZ9 A;  1R8O B;  4M78 B;  1I81 A;  4RMO A;  5DLO A;  2R58 A;  1QCN A;  1SHG A;  3REA B;  3JAM E;  4A4E A;  3PMT A;  1OZ3 A;  1JQQ A;  3HP9 A;  3CCS Q;  1I5L A;  5LJ3 h;  4FW1 A;  2QQR A;  2OI3 A;  1KHC A;  5FW9 A;  2RK2 A;  3AT1 B;  1TU0 B;  2K4Y A;  4J9B A;  1OYX A;  3HTR A;  3V8L A;  2GCX A;  2DZC A;  2HSE B;  5LJ5 d;  2NLU A;  3JB9 H;  2FVU A;  4J9F A;  1NBE B;  2CRE A;  2YUP A;  1M8V A;  2AKK A;  2EGA A;  2K3Y A;  3M56 A;  1KK7 A;  3CME T;  4LN2 A;  2CUB A;  1H64 1;  4C92 B;  1K4U S;  2K5L A;  1KQ2 A;  2YUQ A;  3MET A;  4M7A G;  2KYB A;  3OMG A;  2X51 A;  1M2V A;  5FU7 B;  1VQ6 T;  4M75 G;  4X9C A;  2ATC B;  2VB6 A;  2SRC A;  3FJP A;  5A0L A;  1KD1 C;  3OY9 A;  2QAZ A;  1LJO A;  2RHI A;  3JCM V;  1Q86 U;  4HCC A;  1AT1 B;  1OU9 A;  1WXU A;  1VQ8 T;  1FMV A;  1VQ7 Q;  4C8Q E;  1JXO A;  1ABO A;  5IH2 A;  2Y4Y A;  3GPL A;  1BBZ A;  2EQJ A;  4XQ3 A;  5KYW B;  2RN8 A;  2I2L A;  1Y7X A;  2AK5 A;  4FYY B;  1NJI U;  4A4G A;  4F7U B;  4DBH A;  2DJZ A;  4FYW B;  2W10 A;  2DER A;  4UC4 A;  2FG0 A;  4AFU C;  4M77 F;  2VYT A;  2LCS A;  1UGR B;  2ROL A;  5GAM e;  4O6J A;  2V8I A;  2X3W D;  5FRO A;  1C0M A;  4A4F A;  4F16 A;  2ED0 A;  4M7D D;  4RG8 A;  2GF7 A;  2CZ7 B;  2ZAE A;  4A4K A;  2ZPI B;  1BI1 A;  3ULR B;  1LNX A;  3OSS C;  2EYX A;  1G8X A;  1MMA A;  5FU7 C;  1YJW A;  4ZTJ A;  3O8V A;  3EG1 A;  4ESR A;  3KFV A;  4J6W A;  2QQA A;  1QVF P;  3QHS A;  4LNP A;  2E5Q A;  2CH4 W;  2KI7 A;  2PNI A;  3JV3 A;  3QII A;  4M77 D;  1ZQ1 A;  3LWH A;  5LJ3 d;  3CCQ Q;  2KAF A;  2RI2 A;  1K0X A;  3OB9 A;  3VS1 A;  2KY9 A;  2LRQ A;  4JJD A;  2E1H A;  5IXB A;  2HL5 C;  4M7D C;  4PJO D;  3HPW A;  1X69 A;  2FZK B;  2QA4 T;  1RAG B;  5KYU A;  2LT1 A;  2FB7 A;  2V8K A;  3J81 E;  2QYZ A;  1VA7 A;  4LUD A;  1PD1 A;  4M7D F;  1GXI E;  1U5S A;  3CCS T;  2HBW A;  3CCM T;  3NTH A;  1EZZ B;  3CCJ A;  2LDM A;  2DL5 A;  2QG9 B;  3CC7 Q;  5D6X A;  3ASK A;  3A8G B;  3CC2 A;  2P84 A;  1D3B A;  5DLQ E;  1SSF A;  1UGV A;  2CP2 A;  1GFC A;  1W4S A;  2F1L A;  4XAX B;  3TSZ A;  4E7S A;  2NUZ A;  4BI8 B;  2CKK A;  1N6A A;  2JM8 A;  1YJ9 A;  3JB9 G;  1YWO A;  3V7R A;  1WGS A;  1TSF A;  1I1J A;  1VUB A;  2CP7 A;  3E9F A;  4MDW A;  1NYG A;  2FPD A;  1K73 C;  3M4Y A;  4FIB A;  3H8Z A;  3THK A;  3PT9 A;  3HSB A;  3CCL A;  1WJQ A;  3A8H B;  4C5H A;  2CZ1 B;  1BKB A;  1YHQ A;  3OYJ A;  5D6W A;  3UF4 A;  2X35 A;  3NGP A;  3I35 A;  4XTY A;  2HQX A;  1VQP Q;  3ZFJ A;  1OPK A;  4J9E A;  2ZPE B;  5GAN 4;  1WXT A;  1B07 A;  2KRO A;  3EHQ A;  3HRT A;  5GMK l;  4LDY A;  2H3E B;  4DBQ A;  2DK3 A;  4XU0 A;  4XTV A;  4HCB A;  1TTH B;  2D1X A;  2K5I A;  2L8D A;  4E2F B;  2O2O A;  3I5R A;  3VS6 A;  2HBP A;  1QVG P;  2K6D A;  3MO8 A;  1ZA2 B;  1B7T A;  3G71 A;  1VQ4 A;  2JS0 A;  3NTI A;  3G1J A;  3I55 A;  1NE8 A;  3OYG A;  3EHR A;  5CKF A;  2RHX A;  4JRK A;  1Q82 U;  5KYU B;  1PKT A;  4OMQ A;  4PLI A;  4M7A E;  2RF0 A;  1BU1 A;  1AOJ A;  1KQ1 A;  1SRM A;  4ZGJ B;  2HKQ B;  4C92 E;  1N8R U;  4HKE A;  1GBR A;  2DEQ A;  2LNV A;  4M7D B;  3OW2 S;  5CKD A;  4OB0 B;  1D0X A;  1M1K C;  4FT4 A;  4OGC A;  1MUZ A;  4JRI A;  1YIJ T;  1R0C B;  2DM1 A;  4M78 C;  1I5O B;  2CS7 A;  3TRE A;  4C92 D;  1VQ6 Q;  4RTW A;  4DEX A;  2AHJ B;  4C8Q A;  2LQN A;  3CCJ Q;  3I5S A;  2ESW A;  4K11 A;  3C94 A;  1VQ9 T;  2YRD A;  5CKB A;  5GAM d;  4C0D B;  2KVQ G;  3OS5 A;  3EFO A;  5FU6 C;  3GBQ A;  4J6X A;  1PSF A;  1VQ8 Q;  1TOV A;  4XTU A;  2EW3 A;  2F5T X;  2ZPG B;  3VS5 A;  4QW2 A;  1X2Q A;  2EYW A;  2GFU A;  4XK8 E;  2CP6 A;  2H8H A;  2E10 A;  3HHT B;  3QPH A;  1KIK A;  1W70 A;  3LH0 A;  3A8O B;  4E7H A;  1KG1 A;  3SD4 A;  3G6E Q;  1QWE A;  4C5G A;  2QGG A;  1MND A;  3RMQ A;  1WI7 A;  1ZLM A;  2KGT A;  1H92 A;  1QKX A;  1O9S A;  3M5A A;  2QDY B;  4C8Q G;  1D3B B;  1WQW A;  2OAU A;  1KC8 R;  5HCK A;  3PE0 A;  3QJY A;  3M55 A;  1UHF A;  2CUD A;  4O5V A;  4L59 A;  2RJD A;  1X2K A;  4QQ6 A;  2CT3 A;  3QUI A;  4M75 E;  3KXT A;  3C95 A;  2JXB A;  3QYG B;  2RM4 A;  2EQM A;  4E6R A;  4M77 C;  5GAN 8;  3JCM Q;  1UUE A;  1GCQ A;  4M77 G;  4HA8 A;  3J7A F;  2YWW A;  2CP5 A;  4DEY A;  4AT1 B;  3CXC P;  1VIE A;  4II1 A;  2E3H A;  3LH5 A;  3CCE T;  3OYK A;  1B34 A;  4L6V 5;  1X43 A;  5CK9 A;  2XI9 A;  1Y57 A;  5A2Q E;  4BAC A;  3S6W A;  3EGD A;  2BE7 D;  3CXC S;  1QWF A;  2DFU A;  2RH2 A;  3RNJ A;  1T0J A;  4JJB A;  1A0N B;  1M90 R;  4M7D G;  1QP3 A;  1CKB A;  3RMS A;  3SWN A;  2KRS A;  1UDL A;  2EPD A;  2RHY A;  1QVP A;  2AT1 B;  2EVR A;  2XU8 A;  1Q7Y R;  2FEI A;  1AHJ B;  3LX7 A;  4XU2 A;  3CMA Q;  1U1T A;  1JJ2 S;  4PJL A;  2KRN A;  3VS4 A;  3LW5 E;  3CCQ A;  2J05 A;  3V7C A;  3CBM A;  1VQ6 A;  1M27 C;  1WXB A;  4J7I A;  1D1B A;  2E65 A;  2EGE A;  2EYY A;  3QDR B;  2KK4 A;  5LJ5 j;  2VXE A;  2XDB A;  1WJR A;  4CC2 A;  2QA4 A;  4KUL A;  5LJ3 g;  3GNF B;  2M0Y A;  1VQO Q;  1VQM Q;  4PFZ A;  1VQ7 T;  2DIG A;  2XKO C;  5L8R E;  3M0P A;  2LQK A;  1KQS P;  1KQS A;  2OTL T;  3SFM A;  2DXT A;  2QK0 A;  1YWP A;  2VV5 A;  3FC3 A;  2HZY A;  1D1C A;  1OUL A;  1Q7Y U;  3VJP A;  4FCY A;  5I2M A;  3CPW P;  5A0G A;  1XNI A;  2X4X A;  3ME9 A;  2XK0 A;  3E19 A;  2MAM A;  1ARK A;  3A98 A;  2DVJ A;  4JUV A;  5KYX B;  3OS1 A;  1ABQ A;  3CCU A;  3M59 A;  4KUD K;  1E7O A;  1AWX A;  3MPU B;  1RAF B;  2O01 E;  1AWJ A;  1N5Z A;  2FZG B;  1G3T A;  1NG2 A;  1W2B A;  1K9M U;  2JTF A;  3JRZ A;  4GLM A;  3X20 B;  2RI3 A;  1UGS B;  1AD5 A;  1BI3 A;  4QVD A;  3P8D A;  4V2S A;  4LDU A;  4M75 C;  4LUE A;  3UA6 A;  3RKX A;  2DX1 A;  2LJ1 A;  4EMH A;  1QMC A;  2DPP B;  5CO7 A;  5GAM f;  1WIE A;  2RHU A;  2CP0 A;  3M58 A;  5CQX A;  2J6K A;  3CPW S;  3AHU A;  1MNE A;  1P92 A;  4N4I A;  3A8L B;  5LJ3 j;  5KYY B;  3S3N A;  3GF5 A;  1TXQ A;  4ZGE B;  4KH1 B;  1EFN A;  3CBP A;  2MK5 A;  4F04 B;  1YJ9 T;  2DRM A;  1TUC A;  5GAM g;  3X26 B;  2MMP A;  1Q81 C;  5IXF A;  4J7F A;  1TH7 A;  1YIT Q;  2P0Q A;  1K76 A;  4IIO A;  2L3P A;  2FPF A;  2F69 A;  1OU8 A;  3CCJ T;  2DL3 A;  3G4S T;  2MWO A;  3TEE A;  5AT1 B;  1LVK A;  5GAN d;  1NJI C;  1BCM A;  1GFD A;  2M9U A;  1RLQ C;  3L42 A;  3H9N A;  5CKH A;  3URG A;  1Y96 A;  5J26 A;  3NMZ C;  4N4H A;  2BTT A;  4E7Z A;  4PJM A;  1YN8 A;  1OX9 A;  2E6Z A;  1M1K R;  3RBB B;  1K9M C;  1VQK A;  5KH6 A;  4HXJ A;  4HCZ A;  2M16 A;  3CCV Q;  3V7S A;  5IHN A;  1Q81 R;  3L1A A;  1ZHI A;  1MMG A;  4MML A;  2OTJ T;  4RTZ A;  1WDX A;  2XDP A;  4KRT A;  1WHM A;  1OOT A;  2MWP A;  5GAN f;  4QQG A;  3DB4 A;  4MDX A;  2EQU A;  2OJ2 A;  3EGD B;  4BE2 A;  2HMA A;  4X34 A;  3EAE A;  1NLP C;  4M78 G;  1BYM A;  5KE3 A;  5AYF A;  5GAO q;  2HQH A;  4XTZ A;  1U8R A;  2C0T A;  2GGR A;  4E7I A;  4P5N A;  5J39 A;  3OYI A;  4ZGD B;  2YLC A;  5CVI A;  4IUV A;  2V1Q A;  4IIM A;  4XTX A;  6AT1 B;  3DLM A;  2J7I A;  1YIJ A;  4M7D E;  2GTO A;  2XID A;  4OGE A;  2HCK A;  4R0K A;  1WZO A;  2DF6 A;  2E3I A;  5LL6 S;  1RAI B;  3OBW A;  4AMC A;  2A0F B;  1VQL Q;  3UWN A;  2LTO A;  2KEA A;  1QKW A;  1OQK A;  5ECA A;  1M5Q 1;  1H8K A;  3TCJ A;  2LQW A;  3CCE Q;  1OX8 A;  1QVG S;  2XMF A;  2MOX A;  4GLK A;  5KYX A;  5FLX E;  4AG2 C;  4RKU E;  1LOJ A;  2DNU A;  4DBR A;  2MIO A;  2KNB B;  4JZ4 A;  4Y91 A;  2XHC A;  3JCM P;  2L89 A;  3CMA T;  3QDF A;  2EQK A;  1JBM A;  4J5Y A;  2RA2 A;  4KGZ B;  2QQB A;  1FX7 A;  3SB2 A;  2DYB A;  4X9D A;  4DA4 A;  1Y07 A;  5J3B A;  2EQI A;  2RPN A;  4BI4 A;  3CC4 Q;  2DD5 A;  2JMA A;  3EG9 B;  2NYS A;  3RR6 A;  5KE2 A;  1Y96 B;  1VYV A;  3M4G A;  5FU6 B;  2PUO B;  4JS5 A;  1G3Y A;  3O5Z A;  1VQM T;  2I0N A;  2K57 A;  3MEA A;  4M78 E;  1M3A A;  2E70 A;  1YHQ T;  3OW2 P;  2C0I A;  4MZT A;  5HKC A;  2A08 A;  1VYT A;  1VQK Q;  2YDL A;  4TVR A;  1YI2 T;  1U06 A;  2DL7 A;  1R77 A;  2A28 A;  1Y71 A;  2HSP A;  2RQU A;  1FXX A;  1Z9Z A;  3VS2 A;  1X75 C;  4JLG A;  4D8D A;  5HK0 A;  5GAN 5;  2HAX A;  3V8J A;  1CKA A;  4C0D C;  2KSS A;  2D8J A;  3QG1 A;  4PJJ A;  2OTJ A;  3FDR A;  1M4Z A;  2J6F A;  1SRL A;  3E9G A;  3OYE A;  3EG9 A;  2RQW A;  1YJN A;  2PVD B;  2ED1 A;  4JJC A;  4EMG A;  4FT2 A;  4DBF A;  7AT1 B;  1ACM B;  2X4J A;  1RI9 A;  2P4R A;  1TS9 A;  5HY6 A;  3VS7 A;  4OP0 A;  3Q1J A;  1T0H A;  1Q7Y C;  1Q95 G;  3OYB A;  4QT7 A;  1IHW A;  4HVU A;  1HYO A;  3G71 Q;  4JZ3 A;  3PTA A;  4BY6 C;  4Q5W A;  1IHV A;  3A5Z B;  2M51 A;  1NEG A;  1RAC B;  1UHC A;  4Y92 A;  3A1P A;  3TQ7 P;  1WNL A;  1F1B B;  2VVK A;  4M7A D;  2VGN A;  1YJ9 Q;  4C5I A;  1PD0 A;  4EMK B;  2DYI A;  1T3S A;  1W2B S;  3OA6 A;  2RMO A;  2KMT A;  1AVZ C;  2VWF A;  4KUI A;  5LJ5 h;  3BFM A;  3I9Q A;  3HL8 A;  2DBM A;  3OYM A;  1OEB A;  2DO3 A;  2OTL A;  1YJW Q;  2IPO B;  5IHK A;  5D7U A;  1PHT A;  3OYC A;  1IRX A;  2AZV A;  5GAN 7;  4KBM B;  4MMK A;  3JCM h;  4D8K A;  2EFI A;  3CCQ T;  1YCY A;  2QTX A;  4E7J A;  1UFF A;  3M0U A;  5GAN e;  4M7A A;  1OZ2 A;  3OQ5 A;  1N9R A;  1S72 A;  3CC4 A;  3VRY A;  4FYV B;  3NHN A;  2H3J A;  3EFS A;  2K2M A;  3EGX A;  3JCM f;  1I4K 1;  3ZBD A;  4PFP A;  2LQ8 A;  1KC8 C;  1LCK A;  3TVT A;  3EG3 A;  1YP5 A;  2PTK A;  2QQS A;  1WHK A;  2K9G A;  1RLP C;  3MEW A;  4MZM A;  1KC8 U;  1WFW A;  3HRS A;  3NFC A;  4C92 C;  1WA7 A;  3E1S A;  3H0I A;  2D6F A;  2EKO A;  3JCM g;  3M0R A;  1X6B A;  1R0B G;  1JXM A;  4RUG A;  3MHX A;  3GNG A;  3CQT A;  5GAN j;  1RUW A;  2DTH A;  3CC2 T;  3LYI A; 
#chains in the Genus database with same CATH homology
 1FYN A;  2OI3 A;  5FW9 A;  1PRL C;  1PWT A;  3C0C A;  2EGE A;  2EYY A;  2K7A A;  4J9B A;  4CC2 A;  2DRK A;  5GJW B;  4FSS A;  2M0Y A;  4F17 A;  4J9F A;  2LJ0 A;  1JU5 C;  1GCQ C;  2CRE A;  2YUP A;  3M0P A;  4OMN A;  1GBQ A;  2AKK A;  2O31 A;  2EGA A;  2DIL A;  4LN2 A;  2CUB A;  1YWP A;  1K4U S;  2KR3 A;  1FMK A;  4OMM A;  2YUQ A;  2KYB A;  1ZX6 A;  2KRM A;  5GJV B;  2SRC A;  1ARK A;  3PVL A;  3A98 A;  4JPB W;  2DVJ A;  1ABQ A;  1E7O A;  1MV0 B;  2YUN A;  1AWX A;  1MV3 A;  1WXU A;  1QLY A;  1K9A A;  1AWJ A;  2ECZ A;  2ENM A;  1N5Z A;  1NG2 A;  3EG2 A;  3TSW A;  1JXO A;  4GBQ A;  4GLM A;  2CDT A;  1V1C A;  1ABO A;  5IH2 A;  3REB B;  1BBZ A;  1AD5 A;  1UE9 A;  3EGU A;  1Y0M A;  2RN8 A;  2AK5 A;  1ZSG A;  1PNJ A;  4LUE A;  3UA6 A;  2L3Q A;  2DX1 A;  2LJ1 A;  2W10 A;  1PKS A;  1G83 A;  2D0N A;  1UJY A;  1WIE A;  2J6K A;  3PVQ A;  2FG0 A;  4AFU C;  3FJ5 A;  2ROL A;  2LCS A;  1GL5 A;  1KSW A;  2X3W D;  3UAT A;  1NLO C;  3H0H A;  2ED0 A;  4F16 A;  1AZG B;  2FRY A;  1EFN A;  3ULR B;  2DRM A;  1TUC A;  4CC3 A;  2EYX A;  2DJQ A;  5IXF A;  2FPE A;  1SHF A;  1YNZ A;  1HJD A;  3EG1 A;  1KJW A;  1K76 A;  4OMP A;  4ESR A;  3KFV A;  4IIO A;  2CSI A;  2FPF A;  2L3P A;  2F2V A;  2LZ6 B;  2IIM A;  2DE0 X;  2HEQ A;  2DL3 A;  3M0Q A;  1WLP B;  4LNP A;  1SPK A;  1JEG A;  2CH4 W;  3JV3 A;  2PNI A;  2B86 A;  3SEM A;  5FWC A;  1K0X A;  3VS1 A;  1NM7 A;  1PRM C;  3UA7 A;  4A63 B;  4JJD A;  4HVV A;  5IXB A;  1GFD A;  1RLQ C;  3NPF A;  1X69 A;  3NMZ C;  1IO6 A;  2BTT A;  3R6N A;  1S1N A;  2A36 A;  4J9H A;  4OMO A;  1YN8 A;  4AFS C;  1VA7 A;  2JTE A;  4LUD A;  3RBB B;  2DA9 A;  4HXJ A;  3VS0 A;  1U3O A;  1U5S A;  2RQT A;  2EKH A;  2HBW A;  2A37 A;  5IHN A;  4J9G A;  4RTZ A;  1WDX A;  2O9S A;  3SHW A;  1AZE A;  4KRT A;  2JS2 A;  2DL5 A;  2OAW A;  1OOT A;  4AFQ C;  2KT1 A;  2YT6 A;  5EC7 A;  2LNH B;  2OJ2 A;  2DBK A;  2YSQ A;  3M0T A;  2JM9 A;  2AZS A;  1XOV A;  1UGV A;  2F2W A;  1GFC A;  4M4Z A;  2RNA A;  3TSZ A;  1NLP C;  1E6H A;  4CC7 A;  2DMO A;  2NUZ A;  1GCP A;  2JM8 A;  2C0T A;  2GGR A;  1YWO A;  4Z8A A;  4EIK A;  2V1Q A;  4IIM A;  2DLP A;  1I1J A;  1K0S A;  1NYG A;  2J7I A;  2FPD A;  3THK A;  2YUO A;  3QWY A;  2GTO A;  3H0F A;  2FRW A;  2HCK A;  4R0K A;  2DF6 A;  3UF4 A;  3NGP A;  3I35 A;  1H3H A;  1OPK A;  2K3B A;  1YCS B;  2KEA A;  4J9E A;  1I0C A;  1QKW A;  4J9D A;  1WXT A;  2ROT A;  2LJ3 A;  5ECA A;  1B07 A;  4CC4 B;  2KRO A;  3EHQ A;  1M3C A;  4RTY A;  1W1F A;  5L23 A;  2SEM A;  1H8K A;  2LQW A;  1T3L A;  2KXD A;  2X3X D;  2JW4 A;  2XMF A;  2MOX A;  2D1X A;  4AG2 C;  4WCI A;  1WX6 A;  2DNU A;  2O2O A;  2MIO A;  3I5R A;  3VS6 A;  1JO8 A;  1OV3 A;  2KNB B;  2DL4 A;  2K6D A;  4JZ4 A;  1UG1 A;  2JS0 A;  1NEB A;  4OML A;  4J9I A;  4Z88 A;  5I22 A;  1M3B A;  1M30 A;  2VKN A;  1ZUY A;  1AWW A;  1SSH A;  3EHR A;  4X1V A;  2BZX A;  2DL8 A;  4RTX A;  2DYB A;  2EYZ A;  2F2X A;  1PKT A;  2EQI A;  2RPN A;  4OMQ A;  2JMA A;  2GQI A;  2JT4 A;  1VYV A;  2RF0 A;  1BU1 A;  2LP5 A;  1AOJ A;  1SRM A;  5FWB A;  2W0Z A;  2L0A A;  2CH4 A;  3O5Z A;  2V1R A;  2I0N A;  1W6X A;  1GBR A;  3IQL A;  1M3A A;  2AKL A;  2C0I A;  1GRI A;  3U23 A;  1M8M A;  2A08 A;  2BZ8 A;  1ZUU A;  1MUZ A;  1VYT A;  1HSQ A;  2YDL A;  2J6O A;  1U06 A;  2DL7 A;  2A28 A;  2JMC A;  2DM1 A;  2HSP A;  2RQU A;  1Z9Z A;  3VS3 A;  3VS2 A;  4RTW A;  4DEX A;  2L2P A;  2LQN A;  2O9V A;  3I5S A;  2ESW A;  4K11 A;  5IHI A;  4D8D A;  2GBQ A;  3VRZ A;  4Z89 A;  1CKA A;  2D8J A;  4RTU A;  1J3T A;  2PZ1 A;  1TUD A;  2J6F A;  1SRL A;  2O88 A;  3GBQ A;  2CSQ A;  1VYU A;  2RQW A;  2ED1 A;  2EW3 A;  3VS5 A;  1AEY A;  3H41 A;  2D8H A;  2NWM A;  4JJC A;  2GTJ A;  1X2Q A;  2EYW A;  3M0S A;  2HDA A;  2H8H A;  1RI9 A;  2P4R A;  1I07 A;  1WYX A;  2KXC A;  1KIK A;  1W70 A;  4J9C A;  3VS7 A;  1B3Q A;  1ZBJ A;  4AFZ C;  1T0H A;  1QWE A;  2KBT A;  4QT7 A;  4HVU A;  1WI7 A;  1ZLM A;  2KGT A;  4LE9 A;  4JZ3 A;  1H92 A;  1QKX A;  1UEC A;  2J06 A;  2M51 A;  4ORZ A;  1NEG A;  1QCF A;  1UHC A;  4Y92 A;  1X27 A;  2VVK A;  3QWX X;  3PE0 A;  5HCK A;  5I11 A;  2C0O A;  1T3S A;  1UHF A;  1CSK A;  2CUD A;  2RMO A;  2MCN A;  4RTV A;  1K1Z A;  1TG0 A;  2LX7 A;  1AVZ C;  1X2K A;  2CT3 A;  2VWF A;  2CT4 A;  4RTT A;  2JXB A;  3I9Q A;  2DBM A;  4E6R A;  1OEB A;  1OPL A;  2QDL A;  2FO0 A;  4F14 A;  1UUE A;  3ZL7 C;  1GCQ A;  5IHK A;  1PHT A;  2L3S A;  4DEY A;  3EG0 A;  2AZV A;  1X6G A;  2KYM A;  3LH5 A;  4D8K A;  1HD3 A;  4HVW A;  2RQR A;  1UJ0 A;  1X43 A;  1UFF A;  1KFZ A;  1Y57 A;  2GNC A;  1SEM A;  3M0U A;  2G6F X;  2KE9 A;  2RQV A;  2EGC A;  2E5K A;  3VRY A;  1QWF A;  1ZUK A;  3NHN A;  4AG1 C;  1G2B A;  2K2M A;  3RNJ A;  1T0J A;  4JJB A;  1A0N B;  1LCK A;  1BB9 A;  2LMJ A;  3TVT A;  3EG3 A;  1YP5 A;  1CKB A;  4HCK A;  2PTK A;  1UTI A;  1NYF A;  2KRS A;  2K9G A;  1RLP C;  1UDL A;  2BZY A;  2KT8 A;  2EPD A;  4ZNX A;  1Z9Q A;  1WFW A;  2EVR A;  2ABL A;  1WA7 A;  3H0I A;  2FEI A;  2EBP A;  3M0R A;  1X6B A;  1AWO A;  2K79 A;  1JXM A;  1SHG A;  3REA B;  4RUG A;  2KRN A;  3VS4 A;  2J05 A;  1BK2 A;  1JQQ A;  1E6G A;  3CQT A;  1M27 C;  1RUW A;  1WXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...