5FWAA

Crystal structure of mus musculus protein arginine methyltransferase 2 with cp1
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
339
structure length
339
Chain Sequence
DTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVLSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVSLSWVVTSALDPTSQRVGEKVFPIWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN ARGININE N-METHYLTRANSFERASE 2
publication title Structural studies of protein arginine methyltransferase 2 reveal its interactions with potential substrates and inhibitors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 109
structure length 339
sequence length 339
ec nomenclature ec 2.1.1.125: Transferred entry: 2.1.1.319, 2.1.1.320, 2.1.1.321 and 2.1.1.322.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fwaA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fwaA01
4G56A 3DMFA 1JSZA 3KQTA 4H0NA 4XUDA 3HVJA 4E31A 1XJ5A 2AOUA 2I6GA 3MCZA 3AJDA 1JQ3A 4NECA 3B3FA 1QZZA 3LDUA 5CCBA 2NXEA 3THRA 2UYHA 3G8AA 5HZMA 1I9GA 1ZKDA 4EMSA 1X1AA 3FPFA 1NW7A 3MTIA 3K0BA 4P7FA 5JR3A 5B1SA 5CVUA 1YB2A 2IPXA 3E8SA 2P7IA 3LCUA 3PVCA 2B3TA 4P7GA 4QTTB 2EG5A 2P3LA 3EVBA 2UYOA 4RWZA 4RTNA 2UZ4A 3CVOA 1VQ1A 3LCVB 3DP7A 3PFHA 1DL5A 1NW8A 4CWAA 3M6WA 5DX8A 1JG2A 1L3IA 4MTLA 3UWPA 3KPYA 4AUKA 1JQDA 2XVMA 4O29A 4A6DA 5ICGA 3BGIA 1YFLA 5HILA 3MCTA 4E2XA 2VDUE 3QOWA 4OQDA 3P9NA 3FUUA 4F84A 2IGTA 3B7PA 1O54A 2ZWVA 4MHTA 1VE3A 3IEIA 2QY6A 3HCCA 3P9KA 2IBSA 2PGXA 3PT9A 3FUVA 4RTLA 2B9EA 4PYKA 1V39A 2XYQA 2ZLBA 2IDKA 4PIPA 5EMMA 4HGYA 2CMHA 2WK1A 1X1BA 1O9HA 3CJQA 4PYMA 5HIJA 4M38A 2H1RA 5KQRA 3BT7A 3HVHA 5DTRA 5FCDA 3REOA 3DH0A 5KYGA 4DCMA 1NW3A 3G2QA 4QPNA 5D1NA 3UZUA 1ORHA 3IV6A 3HM2A 3A7DA 1X1DA 5LQJA 2EX4A 3BKWA 2OBFA 2OO3A 2PLWA 1MJFA 2PWPA 3DXZA 2CMGA 3G5LA 3KQQA 2CWWA 3LBFA 3OPNA 4R6XA 5EHIA 5EIFA 2H11A 4BLUA 4RTSA 3MHTA 2YQZA 5CVJA 3NW9A 4QDJA 2YX1A 5CIYA 4QQKA 3HA7A 3O4FA 4LG1A 5T67A 3V8VA 2UYQA 5DPMA 4E33A 4ISCA 4EKIA 3DULA 3GRZA 5IH3A 2GH1A 4GEKA 5ERGB 5EOVA 2BZGA 4PYLA 5E1MA 4GOMD 4A6EA 1AQJA 4BY9E 4ER7A 3C6MA 5HFJA 2C7OA 1R00A 1WY7A 3GGDA 3LECA 5MHTA 3KQOA 1N7JA 2ZIEA 3HCDA 4C4AA 3F4KA 1KPIA 3UFBA 4E70A 4IKPA 3SVZA 5LQRA 5LQNA 4RTMA 3NVKI 3TOSA 1NBHA 4KW7A 3LPMA 4KIGA 4PGGA 4EQZA 1KP9A 4EK9A 2DULA 2Z6UA 1TW3A 4WVLA 4V0RA 3OFJA 3LCCA 2ERCA 4CTKA 3OU2A 2O06A 10MHA 5LR6A 3I58A 4YV2A 1BKYA 3KQWA 3U81A 2G1PA 5GM2A 3BKXA 5K05A 4YUWA 5U4XA 3OU6A 2FYTA 3AY0A 3G89A 1EJ6A 3MAGA 2ZZNA 3O7WA 4KVZA 3LKZA 5FHRA 4GUAA 1F3LA 1NW6A 3GO4A 2GS9A 3FYDA 5KQSA 2XYVA 2BH2A 3SGLA 3P9CA 2NP7A 4E2WA 2JH9A 3BXOA 5EVJA 2ZULA 1UFKA 3MGGA 3PS9A 2V7EA 1L3CA 2Z6QA 3B3JA 3PLAE 5FWDA 3FRHA 2NYUA 1YF3A 2ZCJA 1XXLA 4P58A 1ORIA 1NE2A 2PY6A 5CVEA 3TR6A 3ER9A 3A7EA 5GIPE 4DA4A 2Z6AA 2JH8A 4XUEA 2IIPA 4YV0A 2QM3A 2IH4A 2GB4A 5E2BA 1RI5A 2PX2A 5EEHA 3PTAA 3UJCA 3ELDA 3OE5A 5EKUA 2B78A 4RTPA 3LL7A 3GXOA 3KQSA 5K0EA 1XVAA 2CL5A 3A26A 4CKEA 1BOOA 2IDJA 5F2NA 5EGSA 3UA3A 3I53A 1KPGA 1WXWA 5K01A 3HEMA 3HTXA 3A4TA 2AZTA 4YUYA 3GRVA 4X60A 2R6ZA 3A25A 3BWYA 5DXAA 3EVDA 4V0QA 5HIMA 4R8RA 2F8LA 2CKDA 3BGVA 1FPQA 3ELWA 1RJEA 4FT4A 2IFTA 2YXDA 3TKYA 5E1DA 2FK8A 3S68A 2VZ9A 3TM4A 2ESRA 1AQIA 1TW2A 2NXNA 2QRVB 5KVAA 5EIWA 3HCBA 2PT9A 2PX4A 2AS0A 3M6VA 4DCGA 2ZW9A 4FT2A 2FHPA 2ZBPA 1R6AA 5CVDA 2P35A 5GOZA 3TQSA 4ATNA 4DMGA 4RTOA 4RSRA 4CTJA 4RTQA 3BWCA 3ORHA 3CJTA 2KW5A 5T64A 2HMYB 4R6WA 2JJQA 1M0EA 1RJGA 1XDUA 2R3SA 3CC8A 1U2ZA 3KPUA 4EKGA 5LSAA 4RTKA 1I1NA 3MB5A 4XCXA 3A27A 4OA5A 4X61A 2PBFA 5E2AA 5EMLA 3QOXA 1QANA 3NTVA 4OQEA 1MHTA 1JG4A 1X19A 4ER3A 4DKJA 2Y1WA 4OX9Y 3KR0A 1L9KA 5GM1A 3UJ9A 2VDVE 4YMHA 4P7JA 1O9GA 2I7CA 4PYIA 3PX3A 4FSDA 3VC1A 1JG1A 2AOWA 3DMHA 3LBYA 3M6UA 5EQJB 4Z2YA 2ZFUA 3M33A 3TPZA 1P91A 2YUIA 5DXJA 3CBGA 3NWBA 4GOND 3P9IA 2YXLA 1YZHA 4F85A 3GIWA 1Z3CA 5EPEA 3HCFA 4BLVA 3Q7EA 3D2LA 3ELYA 1HNNA 2LD4A 2PVCA 4GQBA 3NVMB 4MWZA 4QVGA 4RVDA 3TMAA 2O07A 4Y30A 1QAMA 3EGEA 4FGZA 4HC4A 2BR3A 1P1BA 1KYZA 4QQNA 3FYCA 2PKWA 5ICCA 3MTEA 2OZVA 2FRXA 1IM8A 2GAFA 4PGHA 2A14A 3FPGA 2PJDA 1OR8A 3MERA 5E9JA 4BP1A 3HNRA 4KRGA 3R24A 3T0IA 5C0OE 3FUWA 1BHJA 1RI1A 3LX6A 4QDKA 5K0CA 3C3YA 4EVIA 5DX0A 4RX1A 2O0LA 3ELUA 3VSEA 7MHTA 2UYCA 3KQPA 1VLMA 5EEGA 4DM3A 2IH5A 1IY9A 1R18A 1SQGA 2H00A 1B42A 2XBMA 3MQ2A 2JHAA 4ER5A 1R8YA 3E7PA 3C3PA 3R9XB 4M37A 2ZVJA 1WG8A 1KXZA 4ER6A 2YVLA 5DM4A 2P8JA 2WA1A 2PXCA 3K6RA 3GJYA 3KKZA 1Q0SA 4R05A 2C7QA 1VP9A 4AX8A 5EZQA 2Q41A 4F86A 4B17A 5BXYA 3SR4A 1UIRA 2EFJA 3ERCA 1ZGAA 1T43A 4GF5A 2PXXA 4JXJA 4PYJA 3HA5A 1YFJA 2GA9A 3LGAA 4KDRA 1EG2A 2QE6A 4ZTBA 5GP1A 1G38A 4PYOA 4C03A 1JR4A 5DTMA 4KWCA 1QAQA 3OU7A 3P2IA 3NJRA 2QYOA 2P40A 2PT6A 4X63A 3R6TA 1JG3A 1FJXA 5GIOE 3EMDA 3EVEA 5F2OA 3EPPA 3OZSA 1M6EX 2ONZA 3R0QA 2QRVA 2JG3A 3SSNA 1VP3A 4LWOA 2PSSA 5E1BA 2YTZA 3DLCA 5E9QA 5FA5A 1H1DA 1KR5A 2E5WA 3FZGA 2IH2A 1N7IA 3EVCA 4KIFA 3X0DA 2ZBRA 2AOTB 2HTEA 4P7KA 1I4WA 2G71A 4HH4A 3EEYA 5DLYA 3ID6C 4HG2A 3DTNA 4PONA 5GINE 1DCTA 3CGGA 5K0FA 3JWJA 3NDJA 4HSGA 5LQAA 2FPOA 3UJ6A 1FP1D 2XYRA 5DWQA 5FQOA 3FPEA 1HMYA 2P1DA 3KR9A 3RIEA 4E32A 2VS1A 3JWIA 5C9ZA 5EMKA 3B3GA 3G2OA 3PFGA 4U7PB 3E23A 3KQVA 2OB2A 2B25A 2XVAA 4IV0A 5FA8A 4C06A 1SG9A 1RI3A 2BR5A 2PXAA 2ZWAA 3OZRA 2O57A 1RI2A 1ZQ9A 3M6XA 2C7RA 1WZNA 5DM2A 1N2XA 3DXXA 5DTQA 5FHQA 3T7SA 5IKMA 3WSTA 4HTFB 1IXKA 1KPHA 2BR4A 2PX8A 3EVFA 5K0NA 4E2ZA 5LQCA 2EJTA 3JWGA 3PX2A 2ONYA 1BC5A 3EVGA 2BM9A 3GDHA 3TM5A 1NBIA 4BP3A 1FBNA 3GNLA 4DZRA 5FUBA 4DF3A 2VP3A 3B5IA 3GRUA 4PINA 4FSXA 3VYWA 4X41A 1VL5A 3M70A 1KHHA 3KPWA 2ZSUA 1L3BA 1SVUA 4GC5A 4XUCA 2GPYA 3GWZA 1SKMA 3EEOA 4AZSA 4AZVA 2NP6A 1JQEA 2AR0A 3DOUA 4PYQA 5FTWA 5T6BA 5DRTA 2OXTA 3LDFA 4CKCA 3H2BA 3KR1A 3NMUF 2GLUA 2P3OA 5EG5A 5K0JA 3SMQA 2G8NA 4ER0A 3FRIA 1EJ0A 5D1HA 5KS2A 3P2EA 4OBWA 2I62A 2OKCA 3C6KA 2ADMA 2FK7A 2N47A 5K03A 4OA8A 1G8SA 4QPPA 4C04A 3Q87B 5E1OA 1NV9A 1XCLA 3LKDA 4LWPA 3LHDA 4C07A 1TPYA 2OPBA 2IBTA 1PRYA 4RTJA 4FP9A 2NNWB 4GOLD 3UA4A 5DSXA 2BM8A 3UJBA 3KU1A 3P97A 4K6MA 5BW5A 3QV2A 3I9FA 3OFKA 3SXJA 3CJRA 3I5UA 3IHTA 5CUQA 3HVIA 5F2KA 4X1OA 4BLWA 2EJUA 1SUIA 3DR5A 3HA3A 2AN3A 1EIZA 3FUXA 4RVGA 2WA2A 2DPMA 3OCJA 1D2HA 5DT2A 3RODA 5CM2Z 4PWYA 5P8WA 3SM3A 4Y2HA 3GCZA 1NW5A 3JWHA 1G6Q1 1KYWA 1M6YA 2FCAA 5H02A 2AOUB 1JTEA 1ZG3A 4WXHA 3P71T 1JSXA 5LQUA 1X1CA 2ZIGA 5HIIA 4PCAA 5M5BA 3TRKA 3L8DA 5DM0A 4CKBA 3M4XA 5K0GA 2I9KA 2HWKA 5K8VA 5ICEA 2AN4A 3SSOA 1XTPA 2G72A 1F38A 1G60A 3KPVA 2YR0A 2C7PA 1WXXA 4RYLA 5FULA 3GU3A 4OBXA 5E9WA 5EZSA 3EGIA 9MHTA 1EAMA 5EHGA 5FADA 4MQ4A 4PYNA 3ER8A 2YXEA 2O05A 1SUSA 2AOTA 2HV9A 2PV0A 3FTDA 3DUWA 4FZVA 4YUXA 3OZTA 3HCEA 2HNKA 3PB3A 5JUWA 3RW9A 1AV6A 2K4MA 4QTUB 3KHKA 3EMBA 3HVKA 3NWEA 2ZZKA 4U7TB 4UOEA 4RVHA 4RTRA 1DUSA 1QYRA 1NV8A 1YZ3A 3TFWA 5LQKA 3FTFA 2OY0A 4R8SA 3UJ8A 3G2PA 1VPTA 2V74B 3THSA 2OYRA 1D2GA 1RJFA 1YUBA 2B2CA 4YUZA 3FUTA 3E05A 3V97A 5FWAA 3AWIA 3O31A 4AZWA 5HOQA 4FR0A 3LSTA 2PX5A 3P2KA 4HRAA 2P7HA 4HTFA 3VC2A 1JTFA 1VBFA 1Q0TA 3ANXA 4GBED 4RVFA 2IP2A 3AXSA 3DXYA 3P8ZA 1R8XA 5CVVA 3R3HA 4PNEA 4CXMA 3TLJA 5HEKA 1NKVA 1RI4A 3AXTA 3EGVA 1SQFA 1XDZA 3BWMA 3C0KA 2NXJA 3FPHA 3G2MA 3GRYA 4GC9A 2P3QA 4QVKA 1KIAA 1P39A 4GOOD 3UJDA 1VIDA 4AZTA 3G8BA 5BW4A 8MHTA 1D2CA 1UWVA 3KQYA 3EVAA 1NT2A 2AN5A 3DMGA 5C1IA 2AOXA 3TKAA 3ME5A 3DLIA 1INLA 2AVDA 4PCLA 5K09A 3CCFA 3SX0A 3FPJA 1QAOA 4LECA 1G8AA 5EKXA 3HP7A 3BWBA 3OE4A 1G55A 1L1EA 5HIKA 4FS8A 3B89A 3G5TA 4C08A 1EQAA 3EVZA 5DM1A 5DX1A 1RJDA 2P41A 5GWXA 5EC8A 5E8JA 3G7UA 3GRRA 5E8RA 2ZZMA 2NXCA 4M7RA 2ORED 1Y8CA 4PIMA 5BP7A 4YV1A 2OB1A 2HR1A 3BUSA 1FP2A 2ZIFA 5CD1A 3IYLW 4KDCA 1R74A 4E2YA 3HCAA 4M36A 5DSTA 1P1CA 3UJAA 3G88A 5K0BA 2JHPA 1AF7A 3KR2A 4E30A 1PJZA 2Y1XA 1ZHFA 4C05A 4MIKA 3BGDA 5FQNA 1ZGJA 3LDGA 5K0LA 2ZBQA 3KPJA 3SSMA 4DQ0A 4L7VA 2PWYA 3UBTA 4POOA 2ZTHA 4IWNA 3BZBA 2AVNA 4HGZA 3T7RA 1XCJA 5CCXA 3T7TA 2AOVA 5DRYA 4YUVA 5G02A 3NDIA 3CKKA 5EMJA 1XDSA 3FTCA 3FTEA 3KQMA 1WS6A 2VDWA 3I64A 5ICFA 4YMGA 2JHCA 4RV9A 2G70A 3UJ7A 4IV8A
chains in the Genus database with same CATH superfamily
4QATA 4IEFB 1RXYA 4OMDA 4RXTA 3MN1A 4B3DA 3NFRA 1QC5A 4K0KB 1IBSA 1N6RA 1TIPA 4BMCA 4HNTA 3OESA 4RHFA 4ND1A 3M3PA 1ZN7A 5FLYA 1NIJA 1XJ5A 3MCZA 2C4VA 1UFOA 3CUUA 2CFCA 3ETLA 3LJKA 3NANA 4FJ1A 1MO3A 1RLUA 1U1GA 1PSWA 4MUXA 1KJQA 1R4NB 4MOWA 3AR6A 4YACA 4N18A 3VH3A 4A8PA 1DTWB 4RW0A 5ELMA 2IV7A 1DAKA 1JLHA 3CR8A 2F67A 1KJYA 1I80A 5LBUA 2Z2KA 1U7UA 2GJAA 1YS9A 3TTSA 1UQTA 1UPXA 3DP7A 2B83A 5GAJA 1L4GA 2YWJA 5H1YA 1L5RA 1TD1A 3C2QA 3H4VA 3FSJX 2OUKA 1H8HD 2ZJ0A 4LQLA 4KPGA 2W2NA 1GEGA 2XVMA 2W6ID 1NMYA 1QZUA 1YZTA 4MV0A 1G6HA 4OQDA 2I22A 4WFJA 4EYGA 1XEWY 4QUHA 4DCGA 5L7WA 4F5EA 1K3UB 1NF8A 2PGXA 3IA2A 3PT9A 4TLBA 3L0OA 4EGSA 2ODNA 2VP2A 5I8ZA 1V39A 3MBKA 4AMZA 3FBWA 4OKNA 4BVAA 4NXNB 3L79A 4Q3EA 4RDXA 3HBJA 3W6ZA 3OLQA 3H97A 4Q7JB 1M6NA 3SEFA 3OIWA 1D0VA 1GUDA 1M34B 2FEMA 3AETA 1OB2A 4JYAB 4DB2A 5G0TA 4MGYR 4ZCTA 1VJGA 4FFDA 3U09A 1J0EA 2QG6A 1G7TA 2QMYA 4R1MA 4AAYA 4D81A 5KTPA 1Z2OX 1LX6A 1RYMA 2F1RA 5HMMA 1E2DA 2AMFA 4GL2A 4QQKA 2PMBA 4Q4DA 3VPBA 3NEPX 4B4WA 2MYNA 4PC3A 2HOQA 2IL1A 2WDZA 1NOKA 2O8CB 3D3WA 3H42B 1K7CA 2EQAA 4H1TA 2RCYA 4EUSA 4WZAE 1G8MA 1Y98A 3HJCA 4LRXA 4MNTA 4ARZB 2DR3A 3G0GA 1TA9A 4RO0A 3WMXA 1AQJA 3QE9Y 1P62B 4U02A 2ALJA 4JJEA 2WZBA 3WSWA 5CH5A 1Z0UA 1N7JA 3KQOA 5FA6A 2VHVA 1I1QB 2FN8A 2GPWA 3QG5A 4N7BA 4R68A 2ZUCA 5BSRA 3RBXA 4ZICA 1QO0A 1I5OA 4Y98A 4JYZA 3ICWA 4BEWA 1KOGA 1O58A 1PD0A 2G09A 3BJIC 3LLCA 4M1EA 4C0WA 5IKXA 4BE7B 2ZRPA 4ITUA 4CM6A 3IUMA 3IT3A 3OE7D 3B2EA 2BGNA 4FQ7A 4F2DA 2PUCA 1A04A 1BKDR 1OW3B 2Q50A 1NJ8A 1W29A 3LC1O 3RYHA 3H8WA 4KQGA 1BKYA 4HDNA 4QO7A 4KIUA 3H2IA 4A27A 2G76A 1O57A 1S89A 1W8DA 5AW4A 3F4BA 2RHGB 4Z0TA 1GLVA 1VB5A 4LQ4A 5U4XA 2FYTA 1YL5A 3EF3A 1HGXA 2JFWA 2XA2A 3PWSA 2B0CA 2FEXA 4P4SA 2Q1WA 4EJMA 2Q2VA 3Q8MA 4JLJA 5FHRA 4GE0A 4EFMA 1F3LA 1YO6A 1OXBB 1NXQA 1F0KA 1EDBA 1P6XA 3FYDA 4WUTA 1B26A 3N05A 1MB9A 3BM5A 3OT4A 1FYWA 2KYRA 1K06A 3O0TA 4HQKA 4QQFA 3S1SA 3P9CA 1W85A 4MUKA 2H3EA 2NP7A 4LZOA 1JEQA 3LY5A 4G1EB 5F23A 1PG0A 2V55B 3EXG1 1UFKA 2MIIA 4RHEA 2V7EA 3FKSA 5BN5B 2OLJA 1NJ1A 3UG6A 1VSUA 1J23A 5IBCA 3HUFA 3ZY2A 2GZMA 4J0IA 1I4DD 1YFZA 1SWVA 2V8BA 3A2NA 4F3YA 5B7PA 2AMLA 2EKQA 1U3TA 3RC9A 5HSGA 3GROA 3GOQA 1W44A 2GRAA 3EW7A 4YVFA 4CU5A 2E55A 5EEHA 4L75A 1IVYA 4OK6A 3OX4A 3OE5A 3IBGA 1T2FA 2QMUA 3H84A 1V71A 1WY5A 4GI1A 1N3IA 4GU5A 4JGGA 4K1LA 4NS1A 5BV7A 2NZ8A 2CL5A 4P80A 4WCFA 5FV4A 2ZUUA 1VZ3A 1VYVA 2FW7A 3Q5GA 3UA3A 2Q5OA 3VPAA 4B7ZA 5F2NA 1PYDA 5PGMA 3QYPA 1MCZA 2JDIA 3UCFA 4WDRA 3PQ8A 4I5EA 4N01A 4DTCA 1FTWA 5CNKA 1VM6A 1GUAA 4N7MA 2QE7D 4H7KA 1JJFA 2FHSA 4AECA 5FJIA 2GK7A 2IFTA 3PFWO 4F1KA 2CD7A 2IPLA 4ZCMA 3SX4A 3W8FA 2RAFA 3GRCA 1NOIA 2QW0X 1H3NA 2FFRA 1B8UA 1XCMA 2H7XA 4RH0A 4D3FA 5HQTA 2M6KA 5HJ2A 4B4KA 3BFPA 2CHFA 1BH6A 1V8DA 3WHIA 4X64B 3CUEF 4XJTA 5GOZA 1V16B 3L8EA 3OI7A 3P20A 4HS9A 5ED4A 3VZDA 4B33A 3W9UA 3I9NA 2HMYB 2WU3A 1JLKA 4BQSA 5FOVA 1UXGA 1XYVA 4PW0A 4Q5IA 4O2AB 1KKLA 4R7ZA 3HNPA 3MZ0A 1N1EA 3DBIA 1LSOA 4Q7KA 3NTVA 3PZBA 1CQXA 1DSSG 1RM3A 4QQ8A 4XB1A 3JRNA 1F51E 3UG7A 1FFCA 2DSNA 3CX3A 3QVUA 2RHBA 4JX9A 3FPBA 3RHFA 1UPAA 1U7XA 1LK0A 3ESAA 2V4MA 3BD7A 4QYXA 3N8KA 1YIOA 3LUJA 3DDWA 3TRFA 2IJGX 2RBKA 4K9KA 4Q93A 1EDZA 5IANA 3WMEA 4JP2A 5HBGA 3R6WA 1E63A 5EQJB 3KAPA 4EI8A 1A9RA 1UWCA 5EXEA 1NLUA 3OPMA 1KDVA 5EQDA 3GIWA 5AK6A 4M87A 3BGWA 3D0QA 3VO2A 1RRCA 5IJZA 2BJVA 3V8QA 3KRTA 1HNNA 2ASVA 3P2YA 4LRTB 3WJAA 4BTEA 2FFAA 4ZMRA 3LPCA 4A10A 4BDSA 1YA4A 2J85A 4QTYA 2HCBA 3K15A 2I71A 3PQ5A 3O2JA 4O4LB 5A0TA 1T4BA 1OE0A 1I2MA 1NJ2A 1Q0PA 1G8FA 1RACA 1HTWA 3BAZA 2RAVA 3QU2A 3JPYA 2W8ZA 2AJDA 4B7XA 2IU6A 2Q6KA 2V9CA 4PLWA 3X2SA 1EK5A 4RPIA 4ETMA 4QU9A 4AWXA 4EF4A 4ND5A 5KYUA 2UUOA 3USZA 3TUJC 4C14A 2WOOA 3KCQA 4QLBA 5K5EA 2J5BA 4EFDA 3CLUD 3TO5A 3KXPA 4CV3A 4N5NA 3Q3GE 3C1TA 3FOWA 1II0A 1MNQA 4BGIA 2QRZA 5FFFA 4DMFA 4G4SO 5CA1B 4HAVA 1FBTA 1UBMS 4QSMA 1PW5A 1W76A 3JQBC 4DJTA 1X7ZA 1ZD1A 3OIGA 4LCBA 1X7GA 1QK3A 1R0KA 2GK4A 2ZAIA 4L0DA 3HDHA 4M1ZA 3ZOZA 4OLAA 2YHIB 4LDRA 4N6NA 4GI5A 3FWPA 1KH1A 3THYA 2VYCA 3ZZMA 1YVDA 4GMHA 3AM4A 1XX6A 2R6AA 3GJYA 4LBVA 1F8YA 3NPMA 1NRWA 5DT9A 2NUAB 4Z4IA 1OAKA 2YJNA 2VZLA 4ALIA 3NORA 5HJEA 1HDIA 2RHLA 3ZHSA 3FOCA 3LGXA 1JDPA 3SZLA 3HFSA 5I47A 3QMMA 1CDZA 2FLVA 3UKDA 3MSCA 4DLYA 2LUOA 4O4HF 1D8TA 4MDYA 4KR6A 1KSGA 2DC1A 4DS3A 2VPWA 3A36A 5AVRA 4J0KA 3L7YA 1UP7A 4NCHA 3U13A 2CLCX 3C14C 3C8UA 5DBEX 4L95C 1EM6A 4WCVA 4TGLA 2GDJA 3O8QB 4BNHA 4D25A 1EDOA 1T9GR 1T9BA 4YO8A 5JO9A 1VZ2A 3LQKA 3EPRA 4RD2A 1QP8A 4OXXA 1UBKS 1QTNA 3LBHA 2E49A 2GJKA 2XT9A 4JLBA 4V38A 5BVGA 4F4HA 2FPSA 5DU2A 5AW3A 3AJAA 2PKXA 1TZBA 4XWYA 3AVUA 2OV8A 3NJ8A 1E1QD 3LOQA 3RLIA 4MQLA 4DXDA 4Y1FA 2WE7A 2MCFA 3W8EA 5DHSA 1LX7A 2XTMA 4NL4H 1PT8A 5DHFA 1XZMA 1SXJA 3PQCA 1KARA 5F1YA 1H5QA 3FMFA 1YAHA 3JTEA 1SG9A 3VYUB 4HQOA 2RGAA 1NVMB 2VWPA 4OMCA 2FWNA 4HH1A 4BZZA 1FDSA 3PHHA 4YJ3B 2JEOA 1XTZA 3NUZA 4GXTA 4RVCA 5F9MA 2XB9A 4BWGA 4KJXA 3TNDA 4CE6A 5JWOA 3QFSA 1HZJA 1YKGA 1Z2NX 2OHJA 1H0SA 1FJ2A 2J3MA 3EVFA 2YXPX 2J7PA 1AKTA 3HKCA 2HHJA 3QELB 2NX2A 4Q1CA 4UVGA 2BM9A 2QW8A 3DEKA 3PP8A 2YJ4A 3ZXXA 4BP3A 4N47A 1JAHA 3CF4G 4CF5A 4IJ6A 4CMIA 2UXDB 1R5OA 4PINA 1NZFA 1H85A 2GM9A 3FA2A 3ZZUA 4ZODA 1F2DA 4B4UA 2BFAA 1M1YE 4WN9B 2ZIXB 5H16A 3T9AA 4B3BA 3U0VA 4KP7A 3O1IC 5I7WA 4LQDA 5GMOA 2YC2C 5D5HA 1AKWA 2ZSJA 3GY0A 4RK0A 4M99A 5DW0A 1K6JA 1YFKA 1KZ6A 3WGLA 3QUSA 2AB0A 4OUDB 4E1AA 4XWAA 1KTVA 4OQLA 2V4UA 5CNIA 4OBWA 5DHRA 3R3VA 1WW3A 2JLBA 4JJIA 4Y6QA 1KZGB 2W70A 3D1JA 2UU9B 1UM8A 1CTQA 3V48A 3ZIAA 2EZUA 3D6AA 1VSBA 2XMDA 4C07A 3G7NA 2YZMA 4EHNA 3R9XA 3H8VA 3CSUA 3OPYA 4MR9B 3CWZA 4BJ5A 3RYCB 2IY7A 3FTQA 3M6MD 2FMFA 2WU8A 3L0SA 4POAA 5FBRB 1DAGA 1WLSA 1I4OA 4K6FA 3C87A 4JP1A 4JOCA 1K8XB 1W6RA 1A69A 2BEVB 1I51A 2P9EA 5CUQA 3RRXA 2FXVA 2QVYX 4K40A 4BVLA 5K0ZA 5DTIA 1QO7A 1ML4A 2EKBA 1Y5RA 3IQDB 4GGMX 4TKLA 4U9UA 4J29A 3JZFA 3O82A 4KO8A 4B3IA 4XYMA 1KHTA 1E9BA 4D8YA 2DT8A 2FCAA 5DEIA 4L9WA 1NSFA 1E79D 3P71T 1G2OA 3PIRA 3L4BC 4HVAA 1X1CA 2V7TA 5CH3A 3LXRA 5TMDA 3S28A 2PRZA 4MYDA 3PUZA 4CKBA 2XMZA 3M4XA 1C7IA 4I4TF 3G9UA 1YSCA 3M83A 4BO4A 1ESNA 3DZBA 1N5RA 1XEXB 3T1TA 4I99A 3LPAA 2C61A 5BO5A 1IJKA 5EHGA 2WSIA 3UC5A 3ER8A 4PCUA 3PDIA 1B8PA 1VJDA 2YXEA 3BRWA 3QH4A 3UAZA 3GFGA 3F6CA 3V6LA 1PWXA 2VAMA 4R2IA 4TT8A 4CEIA 2MSKA 4CW7A 4X7PA 1YBAA 1LWNA 1P6UA 2CHVA 2JGNA 1KKMA 2RH4A 1PS0A 3I34X 1QK5A 2OO7A 3U4IA 4NMWA 4EKDA 3AFHA 3DCNA 2A1TR 3THXA 3SBEA 2ZZKA 1FFSA 3WGNA 3IMKA 1QG2A 1DUSA 1EINA 4W63A 4RD1A 2LKCA 4H77A 2ONJA 4EMBA 1W94A 4RK4A 3UJ8A 2V74B 2XH8A 2B2CA 1WETA 2OV4A 3PWKA 2BFCA 3C5VA 4RPGA 3PFBA 5F1PA 2K7FA 2NTVA 1FYDA 3IMFA 3K0FB 1OLXB 4ZU6X 1PJTA 2I55A 2NU8A 3TW0A 4AYWA 1RVV1 1XLTC 2IK8A 3EQ2A 3EIHA 4J8PA 2YKGA 5CYPA 2D6FA 3NXSA 4Q1FA 2UDPA 1HQKA 5E7IA 1NC3A 2XHZA 4NKRA 3O8OB 3OLCX 4CZ2A 3SBOA 1JHQA 2AKYA 3X1WA 3D5QA 3PIDA 1FU7A 5CMLA 3DBOB 3X43A 3EPHA 1AGYA 4R2KA 3EJ6A 3TIXB 4BQNA 4XDYA 2NV2B 3NTXA 3ANMA 5BWOA 5BW4A 4A9AA 3GLHA 4HUJA 1QIIA 3DMGA 2C1ZA 2WAOA 2AOXA 4W8OA 1JQ5A 2ZJAA 4EJFA 3PPXA 3M49A 4FD3A 3TW6A 5JSZA 3LFUA 1U3CA 4ZOAA 4WFQA 1NMEA 4R1OA 4C6TA 3GT7A 3AHCA 3B89A 4QXMA 3QF7A 4RU1A 4XR9A 4AO8A 4YXWD 2CNBA 2JBAB 4MARA 4S35A 4WZAB 3TOZA 4EMTA 1ILEA 1M5UA 5E8RA 4C76A 1U8TA 4HDKB 3RS2A 2GEKA 3UAYA 1QP7A 2ZSFA 3BWXA 4TV8F 1OA0A 1NFFA 2O8FA 1U0TA 5KNDH 3K20A 1M2VA 3CTPA 2R1TB 3ORQA 5CFOA 3VAYA 4EHBA 1TEZA 3B52X 5G1OA 3DQZA 4HYYA 5FQNA 2Z8XA 5AHOA 4P0QB 2Q7XA 3FNEA 3KPJA 4V3CA 3FVRA 1SPXA 3TTUA 2YOHA 5AVUA 4RUKA 1SUCA 4GYJA 1BFDA 5AK3A 4YUVA 3KT3A 2H2GA 2MSEB 3NDIA 2WLTA 3ICOA 5IAGA 5D86A 2WUDA 1FVFA 2C5AA 4J76A 3O92A 2UAGA 4X93A 1EBFA 2NTJA 3AF1A 4EQ6B 4GW3A 1I2AA 4D8VA 5K4AA 2JAHA 1JSZA 3RB8A 4BNGA 1KH3A 4H0NA 1VJ5A 5EJ9A 1U7ZA 4F2WA 4QUDA 4D6PA 2NMVA 1NNUA 2R8RA 3JD0A 5FYDA 1XHLA 5HKLA 3B3FA 1KNXA 2NVBA 2HU7A 3ANTA 3SS9X 4DQUA 2F3PA 1DARA 4EMSA 1X1AA 5B58T 3Q0TA 5TE9A 1UIMA 3BF7A 1KFEB 3PVCA 5A1JA 4KVGA 3GYBA 5GJBA 1RYNA 5B6JA 1MA0A 2QRNA 2PSFA 3BHMA 2A3RA 1TF7A 1JEYA 3LCVB 4E13A 1L4MA 4MV4A 3SVLA 1QF9A 4M22A 3CLHA 3Q12A 5DX8A 1VKOA 4C0BA 4R8MA 3RU7A 1KDYA 1AH2A 2GBPA 1K6IA 2QUBA 3LUDA 3MTJA 5T41A 1YFLA 2PMDA 3VDXA 3QOWA 5FPQA 2J5QA 2WY2D 3SP1A 4F84A 5IJ0B 4W1PA 3JQ7B 1FNBA 1SCKA 1RD4A 1VE3A 1ZK0A 2E9SA 5K3EA 2FUKA 3ZCTA 4CDMA 3FGNA 4LXTA 2IDKA 5AKLA 2NO9A 2CMHA 1TTHA 4ZZ0A 3HRHA 4PYMA 5KOJA 4Q3OA 3AM5A 3T3MB 5LQCA 4PRLA 2JJ2A 1SO8A 4JLKA 2XV1A 4YMWA 1FXSA 1YU9A 5E0OA 4ECEA 2D0IA 2GOYA 4UMFA 1SOMA 3KKEA 4KQ6A 5THQA 3ZWNA 5JS2A 1UDAA 4DCNA 2LCFA 2QN7A 1B8VA 2WU1A 1KEPA 5B4UA 4KQFA 3ZGNA 1NQAO 2CHGA 4MKXA 3TJMA 4I3FA 3OBBA 2XQGA 5FO0A 2G6BA 3FRJA 2C9CA 4YIKA 5JDIA 3U39A 1VPLA 2BFDB 2DWCA 2ZI9A 3Q7TA 4GRDA 4LG1A 4ZO9A 3L0PA 1PLJA 1JHUA 2PIAA 5CVTA 1A9XA 5DIZA 1QU2A 2QR2A 1CIPA 2QT0A 4WNYA 4F6RA 1TKCA 2V7QA 3FSRA 2JH3A 4M7PA 4JY7A 1S2NA 2UZ1A 1WEKA 5ALLA 1GITA 2ZYUX 3FROA 4KE6A 3TTXA 4D44A 3GUYA 3GUVA 1PR4A 3MGBA 4KHPB 3KV3O 4HNUA 5IAOA 2VA9A 3DBRA 1XA0A 1LDEA 4I50F 4LYEA 4G0MA 4KIGA 3ZOKA 1KO1A 5P21A 4UBOA 2H4JA 1DQZA 4TKVA 5KTSA 1CWUA 2C78A 3B2NA 5EIBD 3K5PA 5ALOA 4WOBA 4BRSA 4JUFA 1X80A 4DRYA 4EG4A 4YI5A 5JSYA 5BSFA 2ZRHA 1JI0A 3U7GA 4UBLA 1Z6YA 2BEWB 4YV2A 3OX1A 3SZUA 4U8GA 1E7QA 1LU9A 1P17A 1QIFA 3KWMA 1AN0A 4DR3B 3QIVA 4E5VA 1ZNWA 3RFTA 1RXEA 2I2WA 1J2TA 4J0EA 1QFZA 2OXRA 4BU1A 1J39A 4HTAA 2D2FA 4W1QA 1NJ6A 1P0IA 1O96A 1C4KA 4L4YA 4MRPA 4Y7DA 1X42A 5ALKA 2MMGA 2DPYA 1N75A 4MS1B 4C7OA 4H7JA 1Z4LA 2NZWA 3CISA 1EWQA 5JZOA 1UQUA 2NAFA 4QUGA 5E6SA 1QVVA 4JOBA 3FB1A 1U2GC 5CIWA 3U4AA 1NMQA 2IYZA 1E1CB 4RF3A 4Q4CA 1Z0DA 4B6GA 4JAVC 5BSMA 3BXOA 4E2WA 5ALYA 1H6BA 2Z8ZA 3A37A 3PV0A 5L6MB 3IBCA 3HJHA 1FEZA 3UAGA 3V2UA 5IN4A 2J0SA 4DMUB 3HP4A 2JLQA 5FUXA 5FWDA 1PO7A 3T15A 1TJNA 3WGTA 2FZKA 1SHJA 4KAAA 1QR6A 1YCFA 3I9V1 2R6FA 3H2HA 3H9BA 1LBIA 4FOTA 1Q12A 3N59A 4RA9A 1PJ2A 3SDBA 2BE9A 3TSCA 1E2PA 3U4QA 2QF7A 1XVTA 5C5CA 3TCXB 2I80A 1LB1B 1P8JA 5A62A 3PTAA 4W8GA 1PAUA 3EIEA 4HNQA 3EMVA 1XD8A 2BEJA 4OGLA 3ICEA 5DLDA 3IHKA 3ITKA 2EP8A 1QP0A 5EGSA 1MAUA 5HBRA 4I19A 3DEIA 4ZTUB 1IE3A 4OJTA 5AJZA 2F7SA 1GPH1 5I3ZA 5CEEA 1NVVQ 2JA2A 3CNBA 3GC6A 5MFZA 1CJVC 1L8AA 3LYLA 5FNVF 1GTG1 3HB0A 4Z1MA 4MICA 3VSCA 3N8GA 4EDHA 2ZT8A 5A4FS 3WMWA 3ZHYA 4E03A 2CKDA 2R1VA 3BZUA 3OAAD 4PXSA 4RD4A 2CYCA 1SKBA 3HKBB 3L8ZA 4FT4A 1IWBB 3IO3A 2EBHX 3R9IA 4O08A 1TLFA 4AG3A 4RETA 4GOXA 1QGYA 3L9XA 2CMDA 4X00A 3DVAB 4IQGA 3CO5A 4IUBS 4EH1A 1MIHA 3F7NA 2EBWA 2GVDC 3C4VA 1GKYA 3RANA 1IVNA 3FY4A 3BSSA 4ZOQI 4WH0A 3DLBA 2DUJA 4RSRA 3UWDA 2H4WA 2G25A 4YK7A 1BTOA 1CZKA 4UE3S 3BWDD 4TWRA 4I9FA 1EZ4A 3GEEA 3LLUA 1U2ZA 1I3CA 4DHEA 1RRPA 3C43A 2EYQA 3GJ6A 1A71A 2GEJA 4XCXA 4BTLA 3E0XA 4DWOA 4B34A 4US2R 2OFFA 3FR7A 2XGSA 3T5MA 2H0RA 5AXDA 3K6JA 4EFKA 5BUZA 3B6KA 3ZDFA 5AVOA 1DCKA 2HNBA 1YR9A 2HPVA 3O4HA 2V3WA 2VPZA 4DLNA 2LWIA 2SKDA 5C7LO 3H2SA 3KLBA 3SICE 3KVVA 1T8PA 4M3NA 2AOWA 4MRNA 4YJ2A 2XDQA 2ZATA 4YJKA 3SF0A 4HLDA 5DXJA 4DSZA 4FHCA 3RWBA 2DY1A 2CE7A 3O6VA 1EA5A 3AUSA 1JLLB 3NBAA 4N3GA 2YQ5A 2FUG6 2I2CA 4FILA 4V03A 1OSNA 2LD4A 3DTVB 3ZHXA 1CZRA 1G5QA 1N6NA 3P0FA 3QNWA 4KR0A 2A1UB 5A6VA 1QAMA 3F8WA 4ETWA 5TF0A 1EU1A 1BE1A 4HC4A 3UANA 2W58A 3H5WA 2QLLA 2C5FA 2PL9A 4PC2A 2PKWA 4BCCA 5FLKA 4EG5A 5JNSA 3FE2A 2PL1A 3R7LA 4PGHA 1SXIA 3BXHA 1JTVA 3VUEA 4NZZA 2FUCA 4UBKA 2RCNA 1PWEA 3I2IA 4DBZA 1IXZA 4W1SA 1TGVA 2CHEA 2FEOA 4QDKA 1CF9A 4HAWA 7MHTA 4ZC1A 3L06A 4F3NA 4P0TA 2HQOA 3MILA 5C1DA 2WZQA 2ZTUA 3C3KA 3MWJA 3JASA 2OMEA 3OHMA 5EEGA 5JSQA 4PHFA 3K8ZA 5FTJA 2J9XB 2GI4A 3OJCA 1AY0A 2A0YA 2GARA 2H4ZA 4NCKA 1EGHA 2ADOA 4ZRNA 2MJLA 1R8YA 1RW4A 4FCTA 5FPTA 4ALJA 2FPGB 4R98A 3WNBA 3WLKX 5IUJC 3M3HA 2YVLA 5FTLA 4GZMA 4A0FA 2ICAA 1SPBS 2Q0QA 2B7BA 4V0NA 4YS6A 2NUTA 3ICQB 4G0VA 5CB4B 4QBGB 3KKZA 4P82A 5JMOA 1LRKA 3NPAA 2C7QA 3IA7A 3RFCA 1FSSA 1IONA 2G9NA 5EN4A 5JS6A 3O4IA 2B0JA 3OC0A 2FP3A 2CLMB 3I1IA 1R0BA 1UIRA 2VPPA 3AK4A 3IIKA 4NZMA 4RVSA 4FJ0A 3AI2A 2GA9A 4J4TA 4C0XA 4A0RA 1EG2A 4EJSA 5K2OA 3T52A 1TD9A 3M0EA 2N3ZA 3EC2A 4AMGA 1ANKA 1CY0A 2AUNA 1GN9A 1QAQA 2C92A 2JANA 3O93A 3RS0A 3RVQA 1C7FA 3GIDA 3H5LA 4RGYA 1OFHA 3RIYA 5ESXA 5CXXA 3MF4A 1IJEA 4BNZA 3C3XA 2ZUTA 3EMDA 3GRFA 1S5PA 1EBUA 1LZLA 4ND2A 2V5UA 4UFOA 2QRVA 3CRNA 2AHRA 4EX7A 3ZXIA 3MT8A 1GL9B 4TVBA 2J48A 1HLPA 1O9BA 3K09C 3LX8A 1LBTA 3QWBA 4FFSA 3X2EA 4U6SA 3ZH9B 1PZMA 1ZMBA 2RKOA 4LYGA 4UHJA 5FI1B 2JI4A 3WRWA 3SYNA 2Y1EA 5EKSA 4A73A 2X2FA 3KDPA 2XSZD 4YQZA 3NALA 1AURA 1QCDA 4JXXA 3ESDA 1ZD4A 2KE5A 1PJQA 1AUQA 1M1ZA 1L7MA 2X8JB 4XVUA 4Q4JA 1JZQA 3IKLA 4A6PA 4AY2A 1W6UA 4WZBB 2GDZA 2O0KA 1PJCA 1GQOA 1L4UA 4IV0A 2AFHA 3AI7A 3CNHA 2LGJA 3F96A 4BPRA 3KYCA 4GRIA 1JSRA 2PZLA 1CUXA 4TYMA 2OM2A 3NWJA 4TWAA 4XYLA 4KX3A 4OAPA 3QK7A 4LZNA 4O2BB 1DLIA 1H94A 4UD6A 3GVCA 4IS2A 5LYJA 5DEOA 2CZGA 2CMKA 2W2TA 2X76A 4YONB 4MK4A 2PUJA 3GEPA 5TT1A 4CG0A 3UJHA 3K6KA 4AL4A 4F38A 2DGDA 4MGZR 4HLCA 1ADFA 1RKXA 3RSSA 621PA 2PMEA 3ZDQA 1SVUA 2C5GA 4M1SA 4BAZA 2QUHA 2OD9A 4AI6A 1E5DA 1Q14A 1TT7A 3EN0A 1HLFA 3L46A 5G40A 1FW6A 1ZIXA 2IU3A 4BNXA 6PFKA 4XSHA 2EKDA 2AR0A 2HSZA 1LF0A 2PKYX 3DAHA 1R6TA 4BVJA 5A3JA 5I51A 2IZ7A 3H2BA 4IOKA 3BWVA 4EGCB 2GLUA 2WF8A 3WYGA 1XCBA 2P6NA 3LUGA 1R0RE 4AP5A 4KNVA 1ZISA 1MXHA 1T2DA 4GI3A 3GUCA 4H15A 1QGOA 2YMMA 3A28A 3SHFA 2PGAA 3RVPA 2JHGA 3B6MA 4LV8B 2XUPA 3N70A 4G65A 4G8DA 4QX6A 5E1OA 5ADVA 2AQKA 1DOAA 5JZVA 3RUPA 2OPBA 1Y37A 1NF3A 5EKTA 3UGQA 2J5XA 4BFUA 1YZYA 4L6AA 1YQGA 2RC6A 3OPVA 3CX4A 3FMPB 2AMJA 3RTEA 4Z54A 2I6QA 4U9IS 5J5VA 1RQ2A 3A9VA 1SOAA 2WLSA 3TR0A 4OHKA 2HA4A 1HLDA 1VFNA 1HA3A 4M7WA 2NU9B 3DR5A 3BVPA 3JQRA 4AP6A 1EIZA 2ZKIA 4RVGA 4I5IA 3Q3IA 1K5HA 3EGOA 1CJKC 3U4CA 3QEMA 1ODIA 4FM9A 4PQFA 4L9SA 1SAYA 4OJMX 1RHUA 3GFQA 1OYOA 1Z0AA 3ABZA 3JRWA 2DETA 1BMQA 1VI5A 1NX9A 2PZBA 2OLKA 3NETA 3NU1A 1JSXA 1K08A 4P92A 4WXHA 5F77A 2REXB 3CMCO 4J7UA 4JYCA 4KKVA 3WIBA 1U2SA 1E3EA 4R7TA 1G60A 4BB9A 3F5FA 2OYCA 2BUAA 4FW8A 2JGFA 1YHNA 3NTQA 4QUJA 5E9WA 1YZNA 5EZSA 2JVKA 4MQ4A 5FOXA 4Z7OB 4WXYB 1BVYF 1RLIA 4HDMB 3O94A 2IEBA 3MUOA 1OI2A 4IUCS 3GQVA 4YY3B 4YUXA 1ORTA 2WKSA 1ZXBA 2FUEA 2GZAA 3L04A 4PBSA 1QGUA 3DM9B 4BBAA 1EVLA 3NAMA 3NWPA 2FY8A 4JT2A 2OO5A 4U7TB 2OV2A 3HHEA 2FNAA 1SHTX 3E3OA 2Z5GA 2QL7A 3G6WA 4Y67A 3SHQA 5INTA 3R77A 3LS2A 2ZB7A 2HREA 2J9RA 2N75A 2OXEA 4I1RA 4J7AA 4AYTA 1D2GA 5IARA 4RKYA 1FFYA 4RPKA 821PA 5M2QA 3TX2A 3OZ7A 2CC2A 2WG2A 1CE8B 3STYA 1IDOA 3RK1A 1IPHA 3AZOA 1YB4A 1EXMA 4ZO6A 3ABQB 5JMPA 4YT5A 1DEKA 4X62B 3ANXA 1UMCB 1WCV1 2OBYA 3DXYA 5KNCA 1RPTA 3KJGA 1F2UA 1Y7IA 2OV1A 4DIKA 4L1KA 1T91A 2WJJA 3NHWA 5I9IA 2CDNA 2I78A 3GRYA 1KBOA 5DLPA 2ZM5A 2BFBA 4Q9AA 3B6IA 4UVIA 4AKEA 1LFDB 4YJDA 2P0YA 1VIDA 1WTCA 4RDHA 1XQ6A 4Z6KA 1US8B 3KQYA 5BV2P 4URZR 3GLIE 3GBVA 1VOTA 2AXNA 4BKRA 1B74A 3GLRA 4LOLA 3QUQA 4U7JA 2EL7A 5REQB 5EJ5A 1RYHA 5IT4A 1PSDA 1TUIA 4FHFA 1AXGA 1G8HA 2Z1NA 1E61A 2HRBA 221PA 3A14A 1NA5A 4TL7A 1DQPA 2QVXX 1SU4A 4QPDA 4AURA 2JLUA 2R00C 3LQFA 1XTJA 3NG1A 1MVLA 1CUEA 2BMWA 2NXCA 1BNCA 2VCEA 2PMWB 4Y2XA 2PDAA 2JLCA 1P2FA 3OCZA 5CX1B 3RVSA 2ZIFA 4HB2A 3ZVLA 4YV1A 5EIOA 2X14A 3HCAA 3MOGA 2H1LA 2YY5A 2EVWX 3BFVA 3RVDA 1HSOA 3VM6A 4NMLA 1AF7A 2EYUA 3PENA 2FRDA 2ENWA 5ELLA 2UXCB 3QPWA 3FNRA 2YW2A 1SK8A 1HZZC 5FIUA 3BGDA 1KY3A 4UAGA 4EUNA 1FVXA 2H48A 5JJBA 3GLFB 3GNSA 2ZTHA 3LXXA 4IWNA 8OHMA 1BEUB 3KEOA 1ECPA 4IG4A 2EZTA 1DC8A 2B21A 4ISBA 2C8KA 3HH8A 3MT9A 1XDSA 4JBGA 4JFRA 4R2HA 1UZLA 3EXEB 3I64A 3ZDDA 3OQ1A 4GSYA 3FMIA 4UM8B 4CM8B 2I7DA 2JFHA 1OZAA 1AHNA 5IAJA 5IP5A 2P9QA 4DANA 1E9FA 5LA6A 4C30A 4J7CA 3CONA 3HVJA 3GHYA 5BRAA 3MTBA 1CVLA 4K05A 5IC5A 3ZLUA 1THGA 3OSUA 4AKHA 2JBWA 4MW5A 4BX2A 4D1YA 1FK8A 4Y6SA 1ZH8A 3QUTA 4KFTA 1GRNA 3V2HA 5E7JA 3OD5A 3MWEA 4D7AA 3EZXA 4DZTA 3AL0C 3EUWA 4HRYA 3ZHQA 2CXXA 2IXTA 2R1UA 3ASUA 3R23A 1U3FA 5G1PA 3G13A 1S6YA 5AW2A 4LI0A 5A71A 3SHOA 3VO9A 5JLAA 1IJBA 2WFMA 3DO6A 2QU8A 2XKJE 3NZEA 4MRMA 2R62A 3HBAA 5C5EA 4A6DA 5K6AC 3BGIA 2CYBA 4E2XA 3LYUA 3QMVA 2WWIA 1G63A 1X3LA 3P9NA 5NULA 2R2AA 3WA6A 2WIFA 4F2PA 1G3MA 1EHYA 3MGAA 1GRRA 2GBGA 3QX9A 2RGYA 4LSWA 1AK1A 3ETJA 4JXKA 3TLAA 4MO2A 1IBLB 3MYYA 4IDAA 2IYPA 3HCRA 1X2EA 5TQ2A 1T0UA 5C35A 3VV2A 3KTFA 3R9KA 3WSVA 3MHPA 3NR2A 2CGEA 1Z4JA 4M0DA 4OEHA 3MJFA 1JBQA 3IAM1 1APBA 3QU7A 4A8JC 3F1KA 3U80A 3PD0A 4I6EA 4DLXA 4G8BA 4HV4A 2A7QA 4RS4A 1PTJA 1B0PA 1XZPA 2QUKA 1P4RA 2A92A 1DU4A 4JJKA 3GFVA 4ND8A 4PZZA 3RE1A 3N28A 3R5KA 1RRGA 1Q92A 2ZYAA 5CVJA 4E4YA 1ORDA 2BBTA 3K35A 2VYVD 5A05A 3CUWA 2EARA 4ZYTA 2X9QA 3BBLA 4B09A 4FHDA 2QSJA 3DUFA 3P4XA 3K9BA 4CN9A 5IWCA 2C9BA 1KR2A 2W22A 3WFZA 3ABSB 4Q34A 1GQFA 3NGLA 5F7OA 3D7LA 2GKSA 4ABYA 4D3XA 3EQ9A 5LLDA 4O2AF 3UPUA 3UFBA 5A6SA 5FYQA 4N0DA 1VCNA 4XX0A 2AJLI 4UE2A 5DNEA 5FWXA 4DLBA 1KQFA 1TYCA 2IOYA 3DAPA 1ABFA 1HDGO 1IEQA 2Z2XA 2DUMA 2I6TA 2PS0A 4KRXA 4MV7A 1DP4A 1E5VA 3FW1A 5TVGA 1X92A 5H80A 3TPCA 3BZWA 1GCUA 3OFJA 3BMNB 1N77A 3H05A 2O06A 4FE3A 3IP6A 3EB9A 1YR7A 5AVJA 1AUOA 3I58A 3FJYA 5FNZA 3UVEA 3FFWA 1IK6A 2C97A 1GRQA 1PI3A 3AYZB 1V9CA 4ASUA 5CXUA 3Q5DA 5SZHB 2WF6A 1SBTA 1IEWA 3TECE 4JOSA 4LXUA 2WPNA 2ZE7A 1OH5A 1KI2A 1GNVA 3N0XA 5JY1A 2H18A 5L3SA 1EJ6A 5EZ6B 5BYAA 1YUNA 4HMQA 3AY7A 4Q21A 1FS4A 2VCYA 4I6JA 5DIFA 4XH9B 3GO4A 1YQDA 2CNLA 4YAFA 4KPUB 1MQSA 4O4LF 1H1LB 1B8OA 4AZ3B 3G1TA 3WGZA 1TJYA 3HBMA 1OI3A 3KEQA 1JIUA 2XTZA 4N41A 4Y1RB 4OYHA 1XZCA 3COYA 3KEFA 1L3CA 2PT5A 3AVQA 5FWYB 4DG5A 4DYDA 3T3NA 3OCWA 1E7MA 3ORSA 3PDWA 3MM4A 1NURA 1CY1A 2DQZA 1JHYA 3QV1A 3VPSA 4MGKR 2ZCJA 1BCRB 4X9XA 4EBFA 4IIFA 1NVUQ 3TR6A 3DG9A 5CVEA 5CA1F 5JJIA 2Z6AA 3QTLA 3KSZO 3RUDA 2ZCVA 2BPOA 2IIPA 3G49A 4K6HA 3WWCA 2B61A 1C3OB 2HNAA 2P8SA 2QM3A 3HWWA 5TRTA 4BO1A 3RIGA 2HWUA 1MC5A 4L15A 2DSTA 3GR6A 3N2YA 5E4TA 4TLDA 2DQ4A 2OOSA 1EX7A 3B48A 2DVMA 4MVYA 4Q9JA 2I1QA 3V1KA 2D3WA 1RFGE 2F8SA 3JD3A 1WXWA 4DIOA 4K46A 2Z58A 1J8QA 2PGNA 3KETA 3GRVA 2GETA 1LVHA 3HR7A 4IGEA 5FBVB 3R3YA 3GFSA 3Q8XB 1FE8A 3KZKA 3MFQA 3OQOA 5COQA 1F3OA 2WFLA 2J6BA 4XPIA 3ELWA 3OWXA 2UZ3A 2HQ1A 3FD8A 2QM8A 4FOOA 1ST2A 4QNNA 4TXMA 3D81A 5BQ5A 3S68A 3DQQA 1RHQA 2NXNA 3AB3A 5IBQA 1I7LA 4HEA1 1KRWA 4DR6B 3QTBA 1G0OA 3KU4A 1BW9B 3MD9A 5EVCA 4DV3B 4I2VA 1J8MF 2BKAA 1HDCA 2FHPA 2QN9A 3Q9UA 3QE3A 4JZYA 4Q01A 4RQTA 3I4LA 1U98A 3QVGA 4UUAA 4WNAA 3RYIB 2GZ3A 3TW8B 3LPDA 4WBNB 1W19A 4YDQA 1NRIA 1LJLA 1I5RA 1XJWA 4YFVA 1E92A 3CLRC 1UBGA 4KAXA 4R69A 4YRJA 3ZWAA 5ITZA 5KMGB 1GM5A 1GL6A 1HSZA 1MHTA 4RHUA 4DLRA 2J09A 3OCXA 2C82A 2H92A 3P9QA 3KR0A 1XAIA 3N1UA 1SUWA 2FZCA 4MQFA 4RIEA 4IJUA 4HF7A 3AUUA 1B0UA 4UCXA 3I4CA 3VSBA 4YJ3F 3SEZA 1WZ2A 5C53B 1YE3A 1CUFA 1GCGA 2WT9A 4JCOA 3VBEA 1NG9A 3AUTA 1IPFA 1XSEA 2BFOA 3E6AA 4IUDS 5PNTA 2UYGA 1GXSB 1OILA 3C6XA 4ICIA 4KQ2A 4MMZB 4QJBA 4BFTA 4RGVA 2O2GA 3ACDA 3NVMB 3TX6A 3ESYA 3IEVA 5K8IA 5IK2A 3LD9A 3H3JA 3T41A 1WNTA 4DMLA 1XTSA 4QOJA 1P0PA 4A2QA 4RMIA 2XA9A 3LX5A 3DCJA 3ND8A 1CUJA 5A4MS 4HVLA 1ZD2P 2ZJZA 2B2NA 3N0RA 4MIEA 1WU8A 3FPGA 2O1SA 1ULSA 4IWYA 4QECA 5D5QA 1Z6XA 3EXHA 1TFUA 4JJ4A 1F1JA 1XRNA 2KS6A 2PUBA 2GN0A 3QUAA 1LBSA 2CMFA 4B7UA 3PITA 3PQDA 4EVIA 3RBZA 4ITRC 4XTCS 4MWCA 3LF1A 2V0CA 3IAHA 1XI2A 1E3LA 1UXIA 1KYVA 2F6RA 3B3AA 4Y2QA 5U1PA 4DM3A 1FRQA 1LTQA 3L43A 3MQ2A 2NO7A 1V0JA 5ENDA 2GPAA 1ZK4A 3C3PA 2ASEA 2G1AA 3JAWA 1HUQA 2CZCA 2JFGA 3DW3X 3GJ7A 3LK7A 4Z7NB 5L6LB 4IR7A 3K5HA 3IAS6 4IQ0A 3VR5D 4FB5A 3Q9SA 4QYIA 3ZX4A 4N48A 2D5AA 4CR6A 4OJYA 3TLZA 3N6XA 2HWWA 4B4DA 3AU8A 4G37A 5A04A 2IUTA 2A5DA 1OBCA 4RE6A 5FTMA 2A5YB 3UWOA 4NAVA 3I1FA 1H4SA 5KCZA 2PXXA 2SKCA 3HA5A 2CV0A 3P5SA 1YOBA 1JPJA 1U65A 1FB5A 2WABA 3EOZA 1MG5A 3DFIA 1O7JA 3H5VA 4P8RA 1F9EA 1M2JA 4I3HA 1FX1A 1RXUA 2P40A 5JS7A 3O3OB 1QHEA 1K3FA 2HA7A 3N0WA 2PZGA 3EVEA 2A94A 1ZH0A 3LRTA 1TYDE 1H1TA 3GELA 3N2KA 4IICA 3SE0A 5BW8A 4KXNA 4LSMA 3T4PA 2YZ7A 3E84A 2LP4Y 2X5NA 3MTDA 5DNWA 2J08A 3CM0A 5TJHA 3N2IA 2QAGC 2F48A 2IIBA 1RU3A 3JPWA 3EG5A 4XRGA 2Z2IA 4GXQA 1R10A 3A2KA 2ECFA 4R4JA 5CNMA 4DRZA 2NZVG 4H1UA 5HUHA 5JS8A 4YALA 2X42A 1PDVA 3OVMA 3CLTC 1H5UA 3T7AA 2EHJA 4UMEA 3NQ41 3D4PA 2YJ5A 3TL3A 3WDKA 1TYZA 5J23A 3OZVA 2H8KA 2Y68A 3V9AA 2G17A 1G8YA 4C1BA 3KV1A 2ZWAA 3D8UA 2BCJQ 2ZANA 1RWMA 3IP8A 4LF8B 1EE9A 3AG5A 5KZMB 4OAOA 1FNCA 1QIEA 3T3EA 1C8BA 1N2XA 3O90A 1UBOS 4KYIB 1RAEA 2CW5A 3DSRA 1KPHA 1USIA 2BR4A 2WPDA 1HV8A 4NAUA 1Y4ZA 2WTNA 4ZU3A 3TL2A 4RNCA 2C9OA 3BICA 4U8HA 4OHBA 1QF6A 3UMSA 3VU1A 4G24A 4YP9A 3MCAA 3EIQA 3U3MA 1G8PA 5C8VA 4PANA 4CKZA 5TMPA 4DV0B 3HVUA 1CRPA 1CQJB 1UT5A 3NBZC 5GGXA 2IZ1A 4ZV9A 3KPWA 4TYQA 1XVLA 3CE6A 2GYWA 4PLZA 2XIJA 2DQYA 1QHXA 1QGDA 4ZYUA 1RXSA 4COKA 3X1DA 5IVPA 3OA0A 1UODA 2BBOA 3GLIB 4I8XA 5HZHA 2BM0A 5IZCA 1AZTA 1LH0A 2ORIA 3PUJA 3JZDA 3O2SB 4QEKA 1ZITA 1GOTA 5FOSA 4R9VA 1OMOA 2BJWA 5EHQA 4EHLA 5BV8A 1N92A 1JH8A 2Y76A 3OH8A 1AS0A 4IG9A 1BQ3A 1EFTA 1Y3CE 2VSYA 3L0IB 4LJ9A 2E1RA 4OA8A 3LOUA 3JQAA 4CMBA 1NXXA 2OAP1 4MUAA 3L0DA 3FDZA 4RVOA 1PNRA 2QBYA 4K9MA 4OHFA 4RLSA 2BGGA 3RBAA 1EFDN 1DFIA 2C4TA 5FL7A 4KYVA 1PHPA 3OWOA 2BFFB 4N6GA 2FSVC 4XFDA 5DBIA 4D9KA 4LOHA 4Z2AA 1V3UA 4OCZA 3H1AA 1YRBA 3CF2A 4OHUA 4CMAA 4J16C 5A3VA 2HAEA 5TEVA 3DHNA 1LSUA 2CCJA 1VKHA 4D5GA 4D5EA 4R16A 4GI7A 1QYDA 4J43A 4LDAA 4RA6A 2DPMA 2YXNA 1T0HB 4K9OA 4L5BA 4XDHA 1RPAA 5KWJA 1P19A 5CM2Z 1N0UA 2E3JA 3C6YA 4IXTA 3GCZA 2FV8A 3OTGA 1WQ1R 1WZUA 1Z7YA 3NT2A 1K0FA 1ODJA 1P9RA 1X38A 5CGZA 4ARIA 4M0PA 3DE3X 3JYOA 2V1UA 3RRFA 1MENA 1TCBA 5I8PA 2KSQA 2ACWA 4P3YA 1KEVA 4Q6BA 2D2VA 1F38A 3B9RA 1JHMA 4C5AA 1R0CA 1ZZGA 4MEBA 4RYLA 3EGCA 4ROTA 1B76A 1OVGA 2C07A 4JQOA 4XGKA 4X5OA 4YJHB 1Z5VA 3B5EA 4PN3A 2XEXA 1I4LD 3F46A 3NX4A 4HUTA 1K86A 3BFKA 3KSDO 1NXTA 4UHKA 3OZTA 1VSTA 1O1YA 4GP7A 4KGXA 5DDIP 5LP6C 2PT7A 3ISJA 2VXBA 2DTDA 3F74A 3GPDG 1T6YA 3BXEA 5IJWA 4XCQA 5JCOC 3K16A 2IS6A 2YWEA 1KETA 5BWBA 5MFPA 4BFYA 2ETXA 3LOPA 4BXOA 1D4ZA 1VPTA 2KI5A 3QXGA 3R3SA 2HJ9A 4JB8A 4P0PB 3RASA 3KTAA 5A5GA 2IHVA 3PNBA 1KK2A 4G1MB 1T5BA 3Q15C 3H4MA 3LZ6A 4IM7A 2XQJA 1R6UA 4FR0A 4REQA 3ZUGA 4Q7QA 1Z38A 1YQ9A 3FOAA 2ON6A 1PJLA 2EEZA 3U62A 2YY7A 5IJ9A 4QM7A 3TZBA 4ND4A 2F9FA 4KXLA 4UNIA 2IA5A 5BNTA 3HL4A 1PK8A 1U3GA 2YOGA 4YO7A 5KSOA 5CITA 4E5PA 3HB9A 5KX5B 4FOPA 4EY8A 1JXOA 1PD1A 1PV2A 3EASA 4U2KA 1XMVA 2DJIA 4WFIA 1CFJA 2YMPA 1ESCA 1MB0A 4WMLA 3UPTA 4O3MA 3EJWA 2WW8A 4NK4A 2WNSA 2XUQA 3UQYS 4RYDA 1Y1LA 3PFNA 1Y5MA 2HA2A 4O2RA 3RTGA 2PQMA 3OFVA 1TO6A 1XGKA 4NG4A 2PUFA 1X13A 2Z08A 1WMBA 2C57A 2ZRAA 3PBKA 1SVNA 3QW4B 1E7RA 4CM5A 4ACBA 4KNYA 3BEOA 3EGWA 4I46A 2RKBA 1YTLA 1XA3A 3A6LA 1CC1S 3HFRA 3HR4A 4FR2A 3I6BA 5F76A 3K05A 1T9DA 1NDUA 3NT5A 5CAEB 5DX1A 4BMNA 1UF9A 1TUBB 2H4HA 2H59A 4TZTA 4PFQA 1Y9JA 2ISSD 2Y05A 2ORED 2Y0EA 3ECAA 4L76A 4CKWA 5FO1A 2A9FA 2RHDA 3VPFA 1S2MA 2F1KA 4KODA 3EISA 1JMKC 2QQEA 3E9DA 2YBDA 1TK9A 4QLOA 2YV5A 5BOSB 3ENQA 5ETJA 2ZSBA 4FDLA 1PGOA 3L1JA 2QD2A 2XITA 3PRKE 4CQMD 1RRFA 2ZS9A 4D42A 1T26A 5IDVA 4CEHA 3B53X 2WUFA 2YRXA 3TXAA 2C83A 4GMKA 5CFMA 4E46A 2I2XB 5F12A 3UMBA 4AN1A 2O19A 4YMGA 5HM6A 4XB6B 2JHCA 4FQ8A 4TVSA 1WL8A 2GAAA 3P27A 4H6WA 2VNHA 4YRAA 3KB8A 1J1IA 3NIBA 4WBXC 3KQTA 1E69A 4R0MA 2OOKA 3H0EA 4MDEA 1N1GA 4BO2A 4HJRA 3NHLA 4RPCA 5B53A 2Y71A 2FPPA 2TECE 4F3RA 5CCBA 4HS4A 2EQ5A 3RWMB 3AUYA 5HZMA 3THRA 2P0EA 4LNUA 3I2GA 4GWLA 4YRDA 5H5JA 4FFPA 1XMIA 4LE2A 1UJ2A 1YB2A 3KZOA 5AMXA 3TRHA 3VR3D 1A0OA 2P3LA 2VYNA 2WKRA 3EVBA 3OEED 4ZEOA 5AW7A 1G59A 5BN4B 4XVQA 5J4KA 3HKDA 3CLVA 1ORVA 3EZ2A 4RY9A 5EHXA 2BZSA 2FMUA 3BRSA 1ELOA 1VHLA 1YJCA 1U8CB 3VNVA 1L3IA 1NVEA 3NH6A 1TMOA 3FTPA 1D0IA 1QQ5A 2J3QA 3U3DA 2HLHA 1PJ8A 1VE1A 1FFXA 1USUA 2V7BA 4TRJA 4WJZA 1NM5A 4OI0A 5DOVA 5LWQA 3M89A 3IEIA 3R0ZA 3FUVA 4IHJA 3S8YA 3UQZA 4C29A 1H2EA 1O95C 2VH1A 2VXYA 5KNCH 4ZAXA 3K72B 3RAEC 2ETVA 6GPBA 2VAXA 1X1BA 3U4HA 1UPBA 4M38A 3NHAA 3Q1LA 4DLVA 2B6NA 5KEIA 2H51A 1YCGA 3KSUA 4IIVA 4Q6WA 3ZHCA 2JAXA 1W88B 2AG1A 2R2GA 3KD2A 2HK6A 4QPNA 1HG0A 5D1NA 4DV5B 2H65A 2AC4A 2IPNA 1LRJA 4TSRA 2QN1A 5LQJA 2ZSHA 4R1QA 1FIUA 1MJFA 2AX3A 1ZGHA 4R2MA 5EG5A 2P4SA 5A3RA 2Q5FA 1CRZA 4MWBA 3VISA 3ZXUB 4CLOB 3H6KA 4Q3KA 2QQFA 2WTEA 4RTSA 2IPMA 4R9SA 3SFVA 3NW9A 4ZI7A 3DDUA 1OWPA 3O3CA 4QOFA 1Z74A 3HA7A 3UK2A 4B75A 4ZZIA 4BX8A 3UY4A 4E33A 5J3JA 2O4CA 3HY4A 1C30B 1O77A 1T3ZA 5LWHA 3G17A 1DRJA 3TDMA 3AU9A 3JYPA 3L0BA 3ONFA 1K5PA 4IJ5A 1N2GA 1T2CA 3WYCA 2GVNA 4TYYA 3O9ZA 1KI6B 3IUJA 5F7ZA 4URFA 4YPFA 4CI0B 3NVKI 1TI7A 8ADHA 3TOSA 4ND3A 2FPWA 4IDHA 4DJAA 2YWBA 2C95A 5TLSA 2PX3A 3FIUA 3ESQA 3R7BA 4EKYA 5EJAA 3OU2A 2IYYA 3ET4A 2VEDA 3AEYA 4ES6A 1WOYA 3CRRA 4JOQA 4DLSA 3QHPA 5GM2A 4E51A 2G77B 2HHHB 1J99A 1L4LA 3EUFA 2GM4A 3SJBA 5GONB 1IM2A 4IYJA 1CYDA 4PFJA 4JJZA 4D0GA 1FTSA 5CYFA 1JKFA 1RR6A 3ZV6A 2RGCA 4OHYA 2ZIXA 1E1RD 3D0OA 2GNPA 5FTNA 5GTDA 4CTOA 3ETCA 1T2UA 2GUWA 1TTQB 1YXMA 3GUUA 1YR6A 3R5HA 5K3OA 1Y33E 1BFKA 3ZV3A 4CCAA 5KYYB 2BKUA 2P4QA 1OX4A 5FOQA 2QM7A 4C2BA 2X4GA 3TZQA 1QTIA 2XRFA 5LKAA 5EIXA 3NUGA 4NJOA 3W8NA 1E2GA 3BSFA 2PTGA 5C4MA 3AHGA 5CLFA 2DFKB 1Z5OA 2JAOA 2B2XA 5ILQA 2ZI6A 4HNRA 4CKYA 3HUTA 1ZR2A 2FPXA 1Z15A 3QEJA 2R4TA 4I36A 5AKKA 1A4UA 2FN4A 5HQ3A 1N2CA 4G09A 4UU8A 4H3KB 2EWWA 2QI9C 4A26A 1XEAA 4BV9A 5LB2A 2JFUA 3RAGA 1QK4A 2Q9BA 1RI5A 2AFIA 4PTYA 4Y0VA 2FX3A 5GGYA 1NN0A 1SG6A 2VYFA 2DHQA 4MWOA 1OWLA 3V7NA 1XT6A 4E94A 1I6WA 2PUAA 2PRKA 2OZLB 1KP2A 2DFVA 1EM8B 2C88A 5CB4F 3DMPA 2ZRFA 4R7GA 3NRJA 3I53A 2A88A 2GJ8A 3B82A 3HEMA 1KEWA 4M0CA 2AIRA 4IJVA 5IT5A 1GTL1 3GGPA 1TMGE 1Z6AA 1PU2A 1V1JA 5DXAA 1Z08A 1RKUA 2HPHA 5B2EA 3UXHA 1LC0A 1T1GA 1VG0B 4GMXA 5C8YA 4AO7A 4AP9A 1XZFA 4MYTA 1DNPA 2PWBA 4HLUA 4GO1A 4KSBA 5LCXA 4F9TA 5KOHB 2QD4A 3FFAA 3IVRA 1T5SA 1AZWA 3NHZA 1BDHA 2XHEA 2BE7A 2O8BA 2I2FA 2PL3A 4I9NA 1E9EA 2BJHA 5AKXA 4NS4A 5FB3A 5C51B 2BGLA 1QRRA 3UFXB 1OIVA 2EKZA 1NN3A 2FFHA 1FL9A 2AC7A 4IH4A 4L85A 1Z4IA 2UVDA 2DUNA 2ATIA 3K70D 3BWCA 4HWKA 2KJQA 4JI8B 1RJGA 3AIOA 3H9QA 4ZVLA 5HUQA 3WLLA 2B5VA 3SZ3A 1Y4DE 2ODQA 5HW0A 4QM6A 2VP5A 3JQGB 3K8OE 5LJIA 4G25A 1BWRA 2YINC 5DSZA 1QH8B 4FGJA 1AJEA 4G84A 3WL3A 4U2CA 3M4YA 1ATIA 3RRZA 4P7JA 1C9YA 1F17A 1JXMA 1W5EA 4NMHA 1XLWA 1YQXA 3DMHA 3QLTA 5ABPA 5BR7A 2VAPA 4N3AA 4OGKA 5LPNA 2C2KA 1K7XB 3FVVA 5J40A 4O2BF 1JBKA 5AICA 1B4DA 1SKAA 4NR0A 3RKSA 2CXHA 5FUWA 3G2NA 3MRTA 4UC0A 4Z0NA 2O2IA 1PL7A 2GEUA 4P36A 1UXHA 5HMLA 2O07A 4J49A 1DC6A 1QHHB 2VJMA 4QGGA 1BJRE 2RKWA 3KS9A 4MJ7A 3FYCA 4MW6A 1R16A 2XMCA 3UWSA 4JMPA 5ALZA 1MH1A 2W2XA 2GBCA 1FSZA 2YY6A 5AI0A 4P4UA 3VR2A 1WXDA 5C4IA 1E2MA 3OJXA 1Q0ZA 3R24A 2D59A 3OSZA 5FTKA 5E2IA 1S01A 2X4IA 5ALVA 2CLEB 3OOHA 1VCIA 2W8BB 2WNHA 2LR0A 4RX1A 1EXVA 3RNLA 1NVFA 4XSGA 1FF9A 4L4RA 4ZYZA 3A11A 3E4CA 4UXJA 1II8B 2O8DA 1JDBC 4KK3A 1QHSA 3LBNA 4OG2A 3ZZTA 3OZEA 1W0KD 4KI0A 4P3NA 2V54A 3W5VA 1U3VA 1R6BX 1V8OA 1ZCAA 2X2OA 1DFGA 3LT2A 4JLSA 1UWKA 5IBPA 4R05A 4YA6A 1D4AA 3SDSA 4CQMB 4AX8A 5KOYA 4AJ2A 3G9TA 3CZ5A 2BBSA 4DDHA 1IB6A 1U28A 1P2SA 2JFBA 4V0OA 3CA8A 3RYFB 3BXPA 1N2BA 3RWOA 3MS2A 4JXJA 4YIHA 4S04A 1YDEA 4KU4A 1A88A 2Y9PB 2D0PB 2CWDA 2QTLA 2XE6A 1RWPA 3B7WA 3ECCA 3H11A 5CDFE 2IHYA 5JDCC 1U9IC 3AERB 4YLGA 1JHVA 3H1FA 3CXUA 4WECA 1KMNA 4IPTA 3MGCA 1UKEA 4FWIB 4F3CA 3VUFA 4TPKA 1WHTB 3FAZA 2IV3A 3DR3A 5AW5A 2QV0A 1RJ9B 2E5WA 4HNGA 4MRAA 1O97C 4ZQHA 4ZMBA 2FXIA 1SD5A 1WB6A 1KEUA 2BMDA 5JHHB 1XLTA 4O4JA 3K8YA 3HYTA 4YR7A 2JJ8A 4WADA 5ENVA 1PFYA 1NQOA 5CH8A 4O63O 4DDUA 1NI4A 2FPOA 3UJ6A 1O94C 4BNIA 3RIEA 1JHOA 4A4DA 1IYZA 3CTMA 3GDGA 2FW9A 2CL7X 1OZHA 3GCWA 4FMCB 4WW0A 4ZQEA 2B4YA 1USGA 2NZXA 4OFXA 3V7YA 4C1NA 3G0HA 1NT4A 1P5ZB 2I3GA 2CK3A 3IUEA 2Z3ZA 4B74A 2ZS7A 1BVRA 1QCZA 3EFOA 1IXKA 2YJ3A 3GARA 4ONEA 3ROZA 5JOQA 3OZBA 2Q4DA 2GHRA 2FPIB 1PIWA 3EZLA 1T6XA 2BGJA 4L5YA 3RU3A 4F45A 2ONYA 5CFZA 3P0JA 1S9DA 1OF1A 2VHTA 5A1TA 1GCIA 2VP3A 3B5IA 2ST1A 4Z51A 1Y48E 5JZMA 2MU1A 4Z9XA 1N34B 2IEAA 3VYWA 1BE0A 4N6OA 1VHWA 1X7HA 2XMSA 3C7TA 3KQHA 1CUUA 1D1PA 1OAOC 2Q2OA 4XUCA 1CPYA 2GPYA 2WC1A 3M6AA 3OEHA 3OO1A 5CT9A 3BIFA 5EUBA 2M98A 5BSGA 2ZR8A 1ZRNA 4IJMA 3TJRA 3E9QA 3V55A 3DOUA 4D0NA 1EWTA 2DCUA 4NNJA 5DRTA 1PT6A 2X9NA 2REQA 1CCWA 2NU7A 2P3OA 3V8MA 1GUYA 1EUCA 4PN7A 5JD4A 3EZNA 5IASA 1E4EB 1MN6A 4W5OA 1IIBA 2J3IA 3GH1A 1WUIS 4G9EA 4N54A 3FCXA 3S2UA 6NULA 2V59A 2C2GA 4ENPA 1O5OA 3VX3A 4PLTA 3ZGXA 1G8SA 4QPPA 3OKFA 2FSUA 2PXHA 2ID7A 3PDCA 3PC7A 1P61B 1DXHA 1DQNA 4MQEB 1XDWA 3TZLA 5CDGA 1P7CA 3RKUA 4DG9A 5A5VA 5BR1A 1C7JA 1MEEA 1YI0A 3H1BA 1RP7A 2V45A 3PF8A 2WM8A 1NKTA 1CEQA 3BMOA 4GVLA 3UA4A 1PWYE 1V8PA 2ZJ1A 1DAHA 3H4IA 2G28A 1ESMA 3P97A 4Q1VA 3W9SA 3PHIA 5BN1A 4DL9A 3IQXA 3GEDA 2Y1CA 3DE0X 3OT1B 3HKEB 4D9MA 5K0TA 1E3TA 1U7TA 3IJPA 3VDRA 3KAKA 3B70A 4MHSA 4CTNA 3E22B 2BV3A 4ENUA 4TWJA 2JRLA 3FNHA 1DRWA 1R15A 4G1BA 2IHJA 3G2JA 2GUGA 3BJRA 1LSJA 1E89A 4TMVA 1DWUA 2CE2X 1GPMA 3MWGA 3UH0A 5LNK1 3F7MA 3WBJA 5EIEA 1WTAA 2EGHA 3L8DA 1GQRA 2BFEA 1WR8A 4JI3B 2B3DA 1EESA 4G9GA 1LSSA 2G83A 4WLNA 1KY2A 3SI7A 5ICEA 5CM8B 3RSFA 1QWSA 3EUEA 4AKGA 5F1KA 1VE6A 2GK3A 1IUPA 2I4IA 3KJXA 4FFMA 2X23A 4G1FA 1IBRA 1N2HA 3N3BC 1JEDA 3DMDA 2ZM6B 1RPJA 3EGIA 1N1MA 2R1ZA 4C89A 3Q9NA 2I6UA 4KO2S 5BN3B 2KHZA 1SUSA 2B20A 3QFHA 2QRHA 5JRJA 2QXYA 1X1QA 1NXOA 2FOLA 3D54D 3FYTA 3HCEA 3RW9A 1Z8NA 5BVHA 2Q2QA 7AT1A 2FN3A 3EZ6A 2GKOA 3V3TA 2Q49A 3NWEA 2G1KA 1KZ9A 2WOJA 5I4KA 1UT6A 4RTRA 1YZ3A 4RJJA 2WQ6A 1YS2X 5EQFA 1L7EA 3WFIA 3THSA 4YX9A 2QX4A 4A15A 3ESZA 3JALA 1OHHA 4YLYA 4EZBA 1MQAA 3B6JA 4LXIA 3FCAA 3ZCQA 1J2RA 4DRXA 1KQGA 5EE0A 4WERA 3S1AA 5I3CA 3L4JA 2VG8A 3D5TA 1WB5A 4YJFB 5CVVA 1QH1A 1TF5A 121PA 2AG5A 2WUVA 3EHDA 2WWGA 3RFVA 4D8XA 4YYZA 4JVLA 3B9BA 3ESXA 2QR5A 1ID1A 2CB9A 4GBGA 4MVJF 4AIIA 2X58A 3BWMA 2D5LA 5DBFA 3KT8A 4LHEA 3PXCX 1JG7A 8MHTA 1Y81A 1YACA 4LF9B 2VFAA 2R79A 3BD8A 2TMGA 3H4TA 4QFCA 4YASA 3H5NA 3HJGA 4JP3A 1ES9A 3JV7A 1X7YB 3CCFA 2Q2WA 4CG3A 4DC9A 2HA0A 3D3EA 4LPSA 2GXQA 4LECA 5G3ZA 1LZKA 2WZCA 4QG7A 3V7WA 2NQ8A 1RBMA 3LQQA 4NY1A 1AKYA 4LN1A 4DFDA 5A9SA 3K70B 4AJOA 1JB1A 2C00A 2VHCA 3ZU5A 3V00A 3IQIX 4MXDA 2DOKA 3I72A 1L5HB 3N0TA 4JT4A 1BU5A 2C2BA 4K3UA 2ODWA 4MUHA 1IC6A 5E7QA 5E8JA 2WINI 5SZIA 1Q7BA 3ZTTA 3AM1A 1FMFA 1KYIA 5EFZA 1JHDA 1OTHA 2ZYDA 4IZOA 2HIGA 4EHHA 1OJLA 4JGBA 3KQKA 3KSMA 2PEYA 1TYEB 4E30A 4Q66C 2X9GA 1SVIA 1C7EA 3AMVA 3WYNA 5CFLA 4TQGA 3TEMA 3HPRA 3DZIA 1WB4A 2DECA 3IBTA 4D98A 1E9DA 5H0IA 1F60A 4POOA 4UCFA 3BZBA 4OJQA 1L5OA 1XCGB 1D7OA 1TQ2A 4LZWA 4Q82A 4KG7A 4QUIA 421PA 3ZWMA 2PUTA 1U0EA 4Y0NA 5MF6A 2B1JA 3QXXA 5ICFA 1F06A 3PXBA 3RF6A 4EGAA 4KVAA 4HHEA 1GNPA 3OJOA 2FUG1 3ZZNA 1EG7A 3O8LA 4PRYA 4NEQA 3ZJUA 5FUYA 1W59A 3I04M 4MVJI 1U4NA 4KFRA 2PV7A 1CSEE 1GAWA 1M1YA 3B9QA 3CF6R 3MMNA 2YVUA 1QV6A 5JSUA 2JFXA 3FPFA 3EMKA 3FJ1A 3E8SA 5MGNA 3NRBA 4FMPA 2EG5A 4OYLA 4YXWA 1N7GA 1NJSA 4FDAA 4ZHQB 4FYWA 2HT1A 3DE7X 1GAJA 3A3PA 4UU0A 1KMHA 2FFQA 2HYDA 3PNPA 1XTVA 4HBGA 3A31A 5DYTA 3S2YA 4EO9A 3REQA 2E21A 5EKDA 5DN6D 3DHWC 3F67A 3LBAA 1VYHA 3M6FA 3DFUA 3QQPA 3TLXA 2CJPA 2DEUA 1BVHA 1W96A 2HRDA 4YRZA 4UATA 3K6SB 3DV0A 1XU7A 1E1DA 1NLYA 1QNLA 1ILWA 1X7WA 1YS6A 2C7BA 2JK0A 5DVZA 3PJRA 1ZJ4A 1WLYA 1OASA 1ZEMA 3T9CA 4L27A 4XQEA 1W9MA 2ORVA 4YAIA 1N2JA 5JFOA 1A8UA 4BFWA 4YBRA 4M21A 5LDHA 1H6CA 3GFOA 3E3AA 5EP1A 1S3GA 1Z4KA 1YMUA 1WUTA 2Y2UA 2ZU6A 5EMMA 4JI4B 3HI4A 2HSJA 1E5TA 1MJGA 1TM4E 1Y6QA 5EWJB 3OZIA 1IUNA 1M66A 5TY0A 2YYSA 3W04A 2WJ4A 2YWRA 2XTJA 1M74A 3JAKB 4U00A 2R6HA 2VNJA 1BG6A 2X3UA 3HM2A 3KC2A 4MWGA 5HDQA 1XQ9A 4UDXX 2JFVA 3GVXA 5KYVA 1AMUA 3KOWA 3G1UA 5EHIA 2LCQA 3U7QB 4R6XA 2NTEA 5EIFA 3PI6A 1ECFA 1C80A 4H31A 1JJIA 1PBNA 5AUOB 5AVWA 2YX1A 2ISCA 1IOLA 3UTDA 1VXRA 2XTAA 2YZ2A 3DOFA 3ZDYB 2DZDA 1CF2O 2ZR9A 2E4WA 1C0IA 3OQBA 3JWEA 2OSBA 3U7IA 5IH3A 5DK6A 2A9JA 4M0LA 3X1YA 4WBNF 2I5PO 4AKSA 4EPVA 2VH5R 2WD7B 5G0UA 2AE1A 4RSMA 1TM7E 4JA2A 4BKOA 3GF4A 4AN4A 1YBFA 1KPIA 5F5LA 1DKOA 1RBYA 3H18A 2CNWD 2F43B 1JYSA 4KQXA 4CN8A 2Z8YA 5HZKA 1ODKA 3C5CA 1M8KA 1P31A 4EK9A 4RTOA 2BM1A 5K8LA 5CEFA 2ZIWB 1XK6A 3TMKA 2NQTA 3TNJA 1W5BA 4GVPA 1FRNA 4YPVA 2ZT7A 2VF4X 1NATA 1YJAA 5K6TA 1JWAB 1S3IA 3GJXC 1YV9A 3HWRA 4IY1A 3H9EO 2FJPA 1EFHA 4LC0A 5I7AA 5TS2A 2JEZA 1MG0A 4N0QA 4ODIA 4CIDA 3RADC 3R40A 1BN7A 3AY0A 2QXUA 5EI5A 3IL2A 1C1DA 4C4OA 1OIWA 2CXRA 3F6RA 5CEJA 4WKBA 2AN1A 3SYLA 2GBIA 3LO5A 2WHRA 3OTHA 4HZIA 3VYRB 2GCPA 3A1NA 4FD2A 4PBRA 4MPPA 4XW2A 2RGEA 3VYTB 1U1DA 1J90A 3R9WA 1T24A 2W2LA 4B9EA 3KKNA 3PYLA 2XF2A 1GNLA 2YS6A 1VRWA 4GR4A 3RV3A 4O4IB 1NQ5A 3EHEA 4E6EA 3Q6MA 1GUFA 3ECSA 1HFWA 2VC2B 3IQZA 3LNCA 4KQJA 3CURA 4UNQA 1EFLA 1P45A 3PL1A 3UTCA 3N39C 1MC8A 1Y9EA 3IVCA 4FGKA 4LHXA 3MJDA 2NVOA 2PY6A 3UOAB 3AR9A 1AGRA 1YB7A 1YGPA 3FCEA 3T3HA 1BOFA 1R27A 4YCJA 2VT7A 1NQXA 2CFRA 1TVMA 4HQ6A 1Z7EA 4M0UA 4TVOA 3RIHA 1E0KA 2GB4A 3CH6A 2GYVA 3URKA 2PJZA 3U26A 1ACJA 5EKUA 2NGRA 2D7CA 3T0FA 4NRDA 4RMGA 3Q0EA 3WP0A 4CKEA 1NIPA 2QGZA 4IIDA 1NVDA 3I4FA 5G4KA 3A6JA 2CNDA 4AN0A 1V7CA 2BGUA 3QZUA 1XF9A 3A4TA 4AZ0A 3K09A 3IAFA 4YI3A 3VYVA 1F14A 1QVZA 4BZXA 3EGDA 3P4YA 3PGMA 4XOUA 3UHJA 4D99A 2CV2A 3KJQA 3TIVA 4R8RA 5HQJA 2OORA 1UK7A 2O7QA 1T5DX 1G1AA 2I9PA 1GTSA 1UK9A 1Z0KA 1UZMA 2ARKA 2HXGA 3C16C 4D45A 2PKEA 4GNKA 2W43A 3M3DA 2PWAA 2PM8A 4MP8A 1VMIA